1VHSA

Crystal structure of a putative phosphinothricin n-acetyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
165
structure length
165
Chain Sequence
b'SLTLRLAEHRDLEAVVAIYNSTIASRMVTADTEPVTPEDRMEWFSGHTESRPLYVAEDENGNVAAWISFETFYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLMAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEMDGKRYDLKILGRELSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords similar to phosphinothricin acetyltransferase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 41
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.3.1.183: Phosphinothricin acetyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1vhsA00
3FNCA 4NXYA 2B58A 4XNHB 3R1KA 4NF1A 1QSRA 1SQHA 1V0CA 3ZJ0A 2VEZA 3BLNA 1Z4RA 5E96A 4M85A 3TOAA 3GKRA 4CRZB 1S3ZA 1QSNA 3SHPA 2CY2A 3WR7A 2J8MA 4KOWA 2RC4A 4KOVA 3C26A 1MJAA 2GE3A 1Y9KA 3SXOA 3P2FA 1Z4EA 4L89A 2D4PA 4J3GA 2BUEA 4RI1A 3FYNA 4M3SA 1ON0A 2R8VA 2KCWA 5JQ4A 1FY7A 3TE4A 3TOBA 2Q44A 1XE4A 4AG7A 4Y49C 3F5BA 4PSXA 4CAVA 2Z10A 3CXQA 1U6MA 5FVJA 4BMHA 2H5MA 2GANA 4HNXB 2BL1A 5F48A 5ISVA 5F49A 3RYOA 1Z9UA 4PSWA 4XPDC 1P0HA 4JLYA 4KVME 1QSTA 1R57A 2PSWA 4ORFA 4UA3A 3TTHA 4AVAA 1MK4A 2F5IA 2B4DB 4YFJA 4UWJA 3FRMA 1VHSA 2P6EA 2P0WA 5C82A 2OZUA 2FE7A 3JVNA 4QB9A 2OZGA 4NSQA 4EVYA 4R3KA 1MJ9A 4JXQA 4MY0A 3F0AA 4IF5A 2I79A 2P6GA 2EVNA 3F8KA 4R3LA 5EBVA 3D8PA 1NE9A 4X5KA 4KLWA 2Z0ZA 4YRHA 3TT2A 2O28A 3H4QA 1Q2CA 3MGDA 4YGOA 4PV6A 4JXRA 2ZPAA 3K9UA 5IB0A 2Z11A 3PP9A 3FXTA 4HKFA 1S7LA 1LRZA 2GIVA 4PK3A 1Q2YA 2QECA 3B8GA 5J8FA 5EC4A 1IB1E 3CXSA 2REFA 4FD4A 2ATRA 1RXTA 2PR8A 4KOYA 4K30A 4KVOE 3W91A 1VKCA 2PRBA 2OZHA 1RO5A 1J4JA 1GHEA 3OWCA 2B4DA 3N7ZA 2K5TA 4AG9A 1BO4A 2JDDA 4XNHC 5H84A 3PZJA 4R9MA 2JEVA 5HH1A 2Q7BA 4JD6A 4OLLA 4MI4A 4OAEA 5JPHA 4HNWB 5KTDA 1CJWA 2R1IA 3BJ8A 3EC4A 4KOSA 4KVXA 5IX3A 2Q4YA 2Q04A 1BOBA 3BJ7A 4RS2A 1KUXA 2BSWA 4AVCA 3SXNA 3W6SA 3VWEA 1Q2DA 1KUVA 5CNPA 2VZZA 4NCZA 1MJBA 4KOXA 1YREA 1KZFA 2ZXVA 3DR8A 3S6FA 2ZW4A 3G8WA 4QBJA 3LODA 3QAHA 1XIXA 2FS5A 3GY9A 4DNCA 1QSOA 2VQYA 2Q0YA 3R9EA 4QUSA 3FIXA 4XPKA 3IWGA 3D2PA 4PK2A 1XF8A 3ZZIA 3TO9A 5DWNA 4HNYB 2FXFA 1PUAA 4LX9A 4E8OA 1I1DA 1B87A 4AB7A 1S60A 3D2MA 4UWIA 2VI7A 1CM0A 2ZW5A 2JLMA 4MJ8A 3LD2A 3P2HA 5KTAA 2Q4VA 1QSMA 3DR6A 3TCVA 2I00A 1IIDA 2ARHA 2FSRA 2VBQA 3DNSA 3T90A 4II9A 2BEIA 4GS4A 4KLVA 1YVKA 3W6XA 3JUWA 2WPXA 2CNTA 2PR1A 2FT0A 2FIWA 1K4JA 1YK3A 5IV0A 2G3AA 3PGPA 2WPWA 1M4GA 2IL4A 3R95A 3EY5A 1Y9WA 4U9YA 4LUAA 4FD6A 4H6ZA 2OB0A 1YLEA 2HQYA 4H89A 4F0YA 2AE6A 3DDDA 3TFYA 4CAXA 1TIQA 2B4BA 3E0KA 2B3VA 2REEA 4B5OA 1WK4A 1M4IA 1XMTA 4ZBGA 4CS0B 1WWZA 2HV2A 5F46A 3R9FA 3UY5A 4KUBA 1L0CA 1NSLA 2FL4A 4I49A 2G0BA 3R96A 4CAWA 1M1DA 5I0CA 3V8IA 1Y7RA 4KOUA 3FBUA 2DXQA 1YX0A 2FCKA 1XEBA 2A4NA 2ZW6A 3TO7A 4FD5A 2P6FA 1S7FA 2B5GB 2ZW7A 2R7HA 4ONUA 4KOTA 4L8AA 1B6BA 1UFHA 1M44A 1S5KA 2QIRA 2G3TA 2VXKA 4Y49B 2HUZA 1S7NA 2PQ8A 2VZYA 3EO4A 3NE7A 2NMTA 1PU9A 4QVTA 3TO6A 1KUYA 4OADA 3DSBA 5GCNA 4CRYB 2PC1A 2PDOA 4B5PB 4E2AA 2J8NA 2AJ6A 4XPDB 5C88A 3D3SA 2J8RA 4MHDA 3EFAA 3GYAA 3I3GA 1IYKA 4U5YA 3EXNA 4U9ZA 4KUAA 3R9GA 1I12A 2X7BA 5DWMA 4XPLA 1YVOA 3QB8A 2OH1A 3S6HA 2CNMA 3VWDA 3IGRA 4IUSA 2JDCA 2Y0MA 2FIAA 4E0AA 1IYLA 1I21A 1OZPA 1YGHA 4MY3A 4JWPA 2EUIA 5KTCA 2B3UA 3G3SA 4KZTA 3FB3A 1YR0A 2B5GA 3KKWA 3CXPA 1IICA 5HMNA 1P4NA 5F47A 1N71A 1M4DA 3T9YA 2OU2A 2C27A 4R87A 5J8CA 4H6UA 2CNSA 5H86A 1NMTA 3S6KA 4NEXA 2R98A 4JJXA 2D4OA 2QMLA 4B5PA 4F6AA 4AVBA 4FD7A 3S6GA 3I9SA 4QC6A 1S7KA 4R57A 4UBRA 4MBUA 4KORA
chains in the Genus database with same CATH superfamily
3D7FA 3FNCA 3WC5A 4NXYA 3NH4A 2B58A 4XNHB 1IU8A 3R1KA 4P6YA 4A31A 1CPXA 4NJRA 5LYFA 1QMUA 4NF1A 4BINA 1QSRA 1SQHA 1V0CA 3L2NA 3ZJ0A 3FEDA 2VEZA 3BLNA 3BXMA 1Z4RA 8CPAA 4MFJA 3VH9A 5J1QA 4UCPA 5E96A 1A2ZA 5JM6A 4M85A 4C7IA 3V38A 3GIUA 3RZAA 3D67A 4GM5A 4A32A 3PBEA 4DJLA 4UFXA 3FX6A 3MRUA 2PJ6A 3KL9A 4A33A 2YNCC 1PCAA 1XBUA 2PJ3A 3TOAA 3GKRA 2POKA 2ZELA 4CRZB 2BCOA 4KSFA 1S3ZA 4TWEA 3HLPA 4CGOA 1FT7A 2XEIA 3KHZA 1UWYA 3WC7A 3ISXA 4PXCA 1QSNA 3SHPA 1M4LA 2CY2A 4EMEA 3A9LA 2J8MA 4KOWA 3WR7A 2RC4A 6CPAA 2ANPA 4KOVA 3C26A 1Z5RA 3PFOA 1MJAA 2GE3A 5JH9A 1Y9KA 3PB6X 4B12A 3SXOA 5EMIA 3S9LA 3P2FA 1Z4EA 1ZLHA 4L89A 2VL1A 2D4PA 2Z3LA 4H2KA 4J3GA 2ZEPA 2BUEA 2JBKA 4RI1A 4MMOA 2ZEOA 3FYNA 4LQ6A 4M3SA 3D4UA 1ON0A 2AFXA 2PJ7A 4NJQA 2R8VA 2CTCA 3IEHA 5AG7A 3KR5A 4RN7A 2HC9A 4CYNA 2KCWA 5A28A 5JQ4A 1FY7A 4R6TA 3FVLA 4M6HA 4R8FA 4PQAA 3TOBA 3TE4A 1DE4C 1YW4A 2Q44A 4C2YA 1XE4A 4AG7A 4Y49C 4A95A 1LAMA 3F5BA 4PSXA 4CAVA 4NGMA 2Z10A 3KQXA 5F09A 1Z2LA 1U6MA 2NSMA 1ELLP 3CXQA 5FVJA 4BMHA 3SJEA 2H5MA 5AG5A 2GANA 2Q7SA 3GUXA 3FMCA 4HNXB 4X8IA 5JGFA 2BL1A 5F48A 5ISVA 5F49A 1GYTA 2YNEA 3RYOA 5LRKA 2DPTA 1Z9UA 2PVVA 4PSWA 4XPDC 3TC8A 1P0HA 4JLYA 4KVME 1QSTA 1R57A 3B7IA 2PSWA 3PFEA 4ORFA 3PEIA 4UA3A 1YMEA 3TTHA 4AVAA 3H5ZA 1MK4A 3NA6A 2F5IA 3LWUA 2B4DB 1DTDA 2WSAA 4TNUA 1PYTB 1LCPA 1VHSA 2P6EA 2P0WA 2PJ2A 3FRMA 3FEEA 2OZUA 2FE7A 2ZEGA 3JVNA 5C82A 4QB9A 4NGQA 3CPXA 2OZGA 1IGBA 2PJCA 4NSQA 4O23A 4EWTA 2ZEMA 1YQEA 4BBHA 3MN8A 4OC0A 4EVYA 4ZI6A 4R3KA 2JBJA 1MJ9A 4JXQA 2Q4ZA 2C6CA 4CAEA 4MY0A 3F0AA 4ZX8A 2IMOA 4BD9A 4IF5A 5HVFA 2IJZA 2I79A 5G1ZA 4UEFA 2P6GA 4K3NA 2EVNA 2V8HA 2NYQA 3F8KA 4R3LA 5I4MA 5EBVA 4B10A 3D8PA 4P10A 1NE9A 4X5KA 4KLWA 3JTKA 2Z0ZA 4YRHA 3TT2A 2PJ0A 2O28A 3H4QA 1Z8TA 1CG2A 2AFSA 1TKHA 2V8DA 1HDQA 1Q2CA 3KASA 1TF8A 3MGDA 4YGOA 4PV6A 4JXRA 4CGLA 1TF9A 2J9AA 2ZPAA 1VHOA 3PB4X 3K9UA 3KGQA 4UCNA 5IB0A 2Z11A 4F8ZA 1CPSA 4NFRA 2YNDA 3PP9A 4B13A 3FXTA 3N5FA 4HKFA 1S7LA 1LRZA 4FUUA 4MFZA 2GIVA 4PK3A 1Q2YA 2QECA 3B8GA 5J8FA 5EC4A 2WZNA 1IB1E 3CXSA 3B3SA 2REFA 1IOIA 3DLJA 1VHEA 2AFWA 2EK9A 3BHXA 1Q7LA 3PB7X 4X2TA 5AG6A 2GREA 4FD4A 4UEZA 2ATRA 3PB9X 1RXTA 2PR8A 3IO1A 3D7DA 2PJ5A 3NH8A 2ABZA 4K30A 3K2KA 4KOYA 1CBXA 1VKCA 4KVOE 4Q7AA 3W91A 2PRBA 1YW6A 4CPAA 2PIZA 2OZHA 3SI2A 1RO5A 1Z8LA 1HEEA 1J4JA 1GHEA 2C1CA 3OWCA 4MFKA 2B4DA 2PJBA 3N7ZA 2K5TA 3QAYA 4UF4A 4AG9A 4B11A 1BO4A 2F7VA 1OBRA 2JDDA 3PRTA 3PZJA 4MXUA 2JEVA 4R9MA 4XNHC 5H84A 5HH1A 2Q7BA 3WT4A 4A37A 1BLLE 4JD6A 1ZO0A 4OLLA 4JZ0A 4IAVA 1ZG9A 4MI4A 4OAEA 3CDXA 2BOAA 4NGRA 4YFJA 2PIYA 5LRJA 5JPHA 4HNWB 4Q36A 1CJWA 5KTDA 2R1IA 3LMSA 3BJ8A 3EC4A 4KOSA 4KS9A 2PVWA 1JQGA 4KVXA 4ZY0A 3D66A 4WWVA 3D7GA 3DGVA 4AXVA 1F2PA 5IX3A 4OC2A 2Q4YA 3KHXA 1YSJA 2Q04A 2GU2A 5CPAA 5DS0A 1QQ9A 1NSAA 2ZOGA 4P45A 2C6PA 1BOBA 2V8GA 1IOFA 2AFOA 3BJ7A 4RS2A 1KUXA 4ZY2A 5AGEA 2BSWA 4AVCA 2CF4A 4MFQA 3SXNA 5D29A 3TX8A 3W6SA 3B3CA 4OIWA 3VWEA 1Q2DA 3CZXA 1KUVA 5CNPA 4ZYQA 2VZZA 4CGPA 4UCMA 5LYLA 2AFUA 2AFMA 1TKFA 4NCZA 4MRIA 4A39A 1MJBA 4KOXA 1YREA 1KZFA 4MFLA 2ZXVA 3DR8A 1F2OA 5K8NA 3S6FA 2ZW4A 3G8WA 4QBJA 3LODA 1ARLA 1Z8XA 3FECA 3WABA 3QAHA 1XIXA 2FS5A 3GY9A 4DNCA 1QSOA 2VQYA 2Q0YA 3R9EA 4QUSA 3FIXA 2RFHA 4XPKA 3IWGA 2CXAA 3D2PA 1LFWA 1XF8A 2PJAA 4NGTA 4PK2A 3ZZIA 4Z65A 2PJ1A 3H8EA 4P4EA 4Q38A 3TO9A 4OC4A 5HVHA 1H8LA 4MCSA 5DWNA 4HNYB 4ONWA 1AUGA 2FXFA 1KWMA 1PUAA 1X10A 4MFPA 2ZEEA 4LX9A 4E8OA 4PXBA 1I1DA 4C7HA 4FBEA 4CYPA 1B87A 3KR4A 4AB7A 1S60A 3LACA 3D2MA 4M6GA 2DF5A 4UWIA 4CGNA 5K8MA 2VI7A 1CM0A 2ZW5A 2JLMA 4MJ8A 2PCUA 3LD2A 3P2HA 4NGNA 3B2YA 5D8NA 5KTAA 1F57A 1QSMA 2Q4VA 3DR6A 4OKOA 3TCVA 2I00A 1IIDA 4FAIA 5HXDA 2Q43A 1JWQA 2ARHA 2CTBA 3D7HA 4ZX9A 1R43A 2FSRA 2QYVA 2VBQA 3DNSA 4MHYA 3T90A 4II9A 2BEIA 4GS4A 4KLVA 2ODFA 3RBUA 1YVKA 3W6XA 3JUWA 3B3VA 2WPXA 4CAFA 3FJUA 1XFOA 4C2XA 2CNTA 2PR1A 2FT0A 2FIWA 2F8HA 2Z3KA 1VGYA 2YGWA 4OC1A 1ZLIA 1K4JA 4PXDA 1Y7EA 2GFQA 1YK3A 4PXEA 4CYQA 3BI1A 3KZWA 5IV0A 2G3AA 3PGPA 2WPWA 4A2ZA 3IU1A 4MHPA 1M4GA 2IL4A 2OR4A 3EY5A 4MCRA 3R95A 1Y9WA 3JRUA 4U9YA 4LUAA 4FD6A 4G1PA 2OB0A 1YLEA 2HQYA 4H6ZA 4H89A 4F0YA 2DEAA 3RAMA 2AE6A 5G22A 3NE8A 3DDDA 4MCPA 4P4BA 3TFYA 4CAXA 2EWBA 3RO0A 1TIQA 1Y0RA 2B4BA 1XRYA 3E0KA 2AFZA 2B3VA 3I1UA 2REEA 2V8VA 5CBMA 2C6GA 4B5OA 1TKJA 1BAVA 1WK4A 1M4IA 1XMTA 4P4FA 3CT9A 4ZBGA 2WUUA 4CS0B 1WWZA 2HV2A 2O4HA 2ZEFA 5F46A 3R9FA 4R7MA 3VATA 1FNOA 4YWYA 3UY5A 4KUBA 1L0CA 3WC6A 1NSLA 1ZG8A 2FL4A 2EO8A 4UIAA 4I49A 2G0BA 2QVPA 3R96A 5BWAB 4CAWA 3NFZA 5ELYA 1M1DA 5I0CA 5HVGA 4JYWA 3IJ3A 3V8IA 4KSIA 2OOTA 4R76A 4DUKA 1Y7RA 4FWUA 4A30A 4KOUA 4MHNA 4P4DA 3FBUA 2IQ6A 4IHMA 2DXQA 1YX0A 4ZY1A 2FCKA 1XEBA 2A4NA 4CGMA 4DYOA 1XOVA 2ZW6A 3TO7A 4WJBA 5G20A 2GLFA 3IIBA 4FD5A 2HB6A 1S7FA 2B5GB 2P6FA 2R7HA 2ZW7A 3H8FA 4ONUA 4KOTA 3S9NA 3NH5A 1ELMP 4L8AA 3IWWA 1B6BA 3BI0A 1UFHA 4MHZA 1M44A 1Y0YA 3FF3A 4YU9A 2Z3MA 1S5KA 2QIRA 1XMBA 4M6IA 2G3TA 3ISZA 2VXKA 4Y49B 2HUZA 1S7NA 2PQ8A 2VZYA 2ZEDA 3EO4A 2NMTA 3NE7A 4HPSA 5LRGA 5IB9A 3D68A 4NGSA 1PU9A 4LQGA 4QVTA 3TO6A 1KUYA 4OADA 3DSBA 4UIBA 3CPAA 1RTQA 5GCNA 2XEFA 2DPSA 4CRYB 2PC1A 2PJ9A 2PDOA 4B5PB 4CYOA 2G9DA 2J8NA 4E2AA 2AJ6A 3KI9A 4XPDB 2BO9A 5C88A 2I3CA 3D3SA 4MCQA 2J8RA 3IWEA 3VARA 4A94A 4MHDA 3SJXA 3EFAA 3KQZA 2Z3PA 1CP7A 2ZENA 3B3TA 4UEEA 1X12A 5A27A 5K8PA 3GYAA 3I3GA 1IYKA 4U5YA 4GXHA 3EXNA 4C2ZA 1CP6A 3B3WA 5AG4A 2PRQA 4B14A 3GLJA 4P4JA 3V7ZA 2CIJA 3PBBA 4KSAA 4U9ZA 4F9VA 4P4IA 3RNZA 1BPNA 3B35A 4IK2A 4KUAA 3R9GA 2JEWA 4B6ZA 1LAPA 5G21A 1I12A 2X7BA 5DWMA 4C68A 5LYDA 2YNCA 4XPLA 1YVOA 3QB8A 2OH1A 3S6HA 2CNMA 2ZEHA 3VWDA 4OC3A 4ZGYB 2FVGA 3IGRA 4UWJA 3PB8X 1R3NA 4OIDA 3SJGA 3HUVA 4A38A 1ARMA 1HDUA 4UFWA 1VIXA 4IUSA 3SI0A 3K9TA 2JDCA 5THWA 5LYIA 2EBJA 2Z3OA 7CPAA 1AMPA 2Y0MA 2FIAA 4E0AA 1IYLA 1I21A 2QJ8A 5K8OA 1OZPA 2Z3NA 1YGHA 2Q51A 4JWPA 2EUIA 4MY3A 5KTCA 2B3UA 2V77A 4P44A 3G3SA 3IU2A 4F9UA 4F0XA 4OP4A 4KZTA 3FB3A 1YR0A 2B5GA 2WYRA 3KKWA 2RB7A 3CXPA 1IICA 4RUHA 4W9YA 4NGPA 5HMNA 1P4NA 5F47A 1N71A 1M4DA 2XEGA 3IC1A 3T9YA 2GLJA 2EK8A 2OU2A 2C27A 2ZOFA 1Z8WA 2XEJA 3QNVA 4H6UA 1IY7A 4R87A 5J8CA 2CNSA 3T8WA 5H86A 1TXRA 1NMTA 3GB0A 3S6KA 2PE3A 3FH4A 3H8GA 3S9MA 4NEXA 1BPMA 2R98A 4JJXA 4EFDA 2PJ8A 1LOKA 2D4OA 2QMLA 4PPZA 1CX8A 4B5PA 1LANA 4F6AA 4AVBA 1XJOA 4FD7A 3S6GA 2PJ4A 4OC5A 4OMEA 3SI1A 4UFVA 3I9SA 3IFEA 4QC6A 1ZG7A 2O53A 4X3RA 1S7KA 4R57A 3SJFA 4UBRA 1EE3P 1AYEA 4MBUA 1YLOA 4KORA
chains in the Genus database with same CATH topology
3FNCA 4NXYA 2B58A 4XNHB 3R1KA 4A31A 4NF1A 1QSRA 1SQHA 1V0CA 3ZJ0A 2VEZA 3BLNA 1Z4RA 4MFJA 4UCPA 5E96A 4M85A 4C7IA 4A32A 4UFXA 4A33A 2YNCC 3TOAA 3GKRA 4CRZB 4KSFA 1S3ZA 4CGOA 1QSNA 3SHPA 2CY2A 3A9LA 2J8MA 4KOWA 3WR7A 2RC4A 4KOVA 3C26A 1MJAA 2GE3A 1Y9KA 4B12A 3SXOA 3P2FA 1Z4EA 4L89A 2D4PA 2Z3LA 4J3GA 2BUEA 4RI1A 3FYNA 4M3SA 1ON0A 2R8VA 5AG7A 4CYNA 2KCWA 5A28A 5JQ4A 1FY7A 3TE4A 3TOBA 2Q44A 4C2YA 1XE4A 4AG7A 4Y49C 4A95A 3F5BA 4PSXA 4CAVA 2Z10A 3CXQA 1U6MA 5FVJA 4BMHA 2H5MA 5AG5A 2GANA 4HNXB 2BL1A 5F48A 5ISVA 5F49A 2YNEA 3RYOA 2DPTA 1Z9UA 4PSWA 4XPDC 1P0HA 4JLYA 4KVME 1QSTA 1R57A 2PSWA 4ORFA 4UA3A 3TTHA 4AVAA 3H5ZA 1MK4A 2F5IA 2B4DB 2WSAA 4UWJA 3FRMA 1VHSA 4YFJA 2P6EA 2P0WA 5BWAB 5C82A 2OZUA 2FE7A 3JVNA 4QB9A 2OZGA 4NSQA 4BBHA 4EVYA 4R3KA 1MJ9A 4JXQA 4CAEA 4MY0A 3F0AA 4IF5A 2I79A 5G1ZA 2P6GA 2EVNA 3F8KA 4R3LA 5EBVA 4B10A 3D8PA 1NE9A 4X5KA 4KLWA 3JTKA 2Z0ZA 4YRHA 3TT2A 2O28A 3H4QA 1Q2CA 3MGDA 4YGOA 4PV6A 4JXRA 4CGLA 2ZPAA 3K9UA 4UCNA 5IB0A 2Z11A 2YNDA 3PP9A 4B13A 3FXTA 4HKFA 1S7LA 1LRZA 4MFZA 2GIVA 4PK3A 1Q2YA 2QECA 3B8GA 5J8FA 5EC4A 1IB1E 3CXSA 2REFA 5AG6A 4FD4A 2ATRA 1RXTA 2PR8A 4KOYA 4K30A 4KVOE 3W91A 1VKCA 2PRBA 2OZHA 1RO5A 1J4JA 1GHEA 4MFKA 3OWCA 2B4DA 3N7ZA 2K5TA 4AG9A 5A27A 4B11A 1BO4A 2JDDA 4XNHC 5H84A 3PZJA 4R9MA 2JEVA 5HH1A 2Q7BA 4JD6A 1ZO0A 4OLLA 4MI4A 4OAEA 5JPHA 4HNWB 4Q36A 1CJWA 5KTDA 2R1IA 3BJ8A 3EC4A 4KOSA 4KS9A 4KVXA 5IX3A 2Q4YA 2Q04A 1BOBA 3BJ7A 4RS2A 1KUXA 5AGEA 2BSWA 4AVCA 4MFQA 3SXNA 3W6SA 3VWEA 1Q2DA 1KUVA 5CNPA 2VZZA 4CGPA 4UCMA 4NCZA 1MJBA 4KOXA 1YREA 1KZFA 4MFLA 2ZXVA 3DR8A 3S6FA 2ZW4A 3G8WA 4QBJA 3LODA 3QAHA 1XIXA 2FS5A 3GY9A 4DNCA 1QSOA 2VQYA 2Q0YA 3R9EA 4QUSA 3FIXA 4XPKA 3IWGA 2CXAA 3D2PA 4PK2A 1XF8A 3ZZIA 4Q38A 3TO9A 5DWNA 4HNYB 2FXFA 1PUAA 4MFPA 4LX9A 4E8OA 1I1DA 4C7HA 4CYPA 1B87A 4AB7A 1S60A 3D2MA 4UWIA 4CGNA 2VI7A 1CM0A 2ZW5A 2JLMA 4MJ8A 3LD2A 3P2HA 5KTAA 2Q4VA 1QSMA 3DR6A 3TCVA 2I00A 1IIDA 2ARHA 2FSRA 2VBQA 3DNSA 3T90A 4II9A 2BEIA 4GS4A 4KLVA 1YVKA 3W6XA 3JUWA 4CAFA 2WPXA 4C2XA 2CNTA 2PR1A 2FT0A 2FIWA 2Z3KA 2YGWA 1K4JA 1YK3A 4CYQA 5IV0A 2G3AA 3PGPA 2WPWA 4A2ZA 3IU1A 1M4GA 2IL4A 3R95A 3EY5A 1Y9WA 4U9YA 4LUAA 4FD6A 4H6ZA 2OB0A 1YLEA 2HQYA 4H89A 4F0YA 2AE6A 5G22A 3DDDA 3TFYA 4CAXA 1TIQA 2B4BA 3E0KA 2B3VA 2REEA 4B5OA 1WK4A 1M4IA 1XMTA 4ZBGA 2WUUA 4CS0B 1WWZA 2HV2A 5F46A 3R9FA 3UY5A 4KUBA 1L0CA 1NSLA 2FL4A 4I49A 2G0BA 3R96A 4CAWA 1M1DA 5I0CA 3V8IA 1Y7RA 4A30A 4KOUA 3FBUA 2DXQA 1YX0A 2FCKA 1XEBA 2A4NA 4CGMA 2ZW6A 3TO7A 5G20A 4FD5A 2P6FA 1S7FA 2B5GB 2ZW7A 2R7HA 4ONUA 4KOTA 4L8AA 1B6BA 1UFHA 1M44A 2Z3MA 1S5KA 2QIRA 2G3TA 2VXKA 4Y49B 2HUZA 1S7NA 2PQ8A 2VZYA 3EO4A 3NE7A 2NMTA 1PU9A 4QVTA 3TO6A 1KUYA 4OADA 3DSBA 5GCNA 2DPSA 4CRYB 2PC1A 4CYOA 2PDOA 4B5PB 4E2AA 2J8NA 2AJ6A 4XPDB 5C88A 3D3SA 2J8RA 3IWEA 4MHDA 3EFAA 2Z3PA 3GYAA 3I3GA 1IYKA 4U5YA 3EXNA 4C2ZA 5AG4A 4B14A 4KSAA 4U9ZA 4KUAA 3R9GA 5G21A 1I12A 2X7BA 5DWMA 4C68A 2YNCA 4XPLA 1YVOA 3QB8A 2OH1A 3S6HA 2CNMA 3VWDA 4ZGYB 3IGRA 4UFWA 4IUSA 2JDCA 2Z3OA 2Y0MA 2FIAA 4E0AA 1IYLA 1I21A 1OZPA 2Z3NA 1YGHA 4MY3A 4JWPA 2EUIA 5KTCA 2B3UA 3G3SA 3IU2A 4F0XA 4KZTA 3FB3A 1YR0A 2B5GA 3KKWA 3CXPA 1IICA 5HMNA 1P4NA 5F47A 1N71A 1M4DA 3T9YA 2OU2A 2C27A 4R87A 5J8CA 4H6UA 2CNSA 5H86A 1NMTA 3S6KA 4NEXA 2R98A 4JJXA 2D4OA 2QMLA 4B5PA 4F6AA 4AVBA 4FD7A 3S6GA 4UFVA 3I9SA 4QC6A 1S7KA 4R57A 4UBRA 4MBUA 4KORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FNC A;  4NXY A;  2B58 A;  4XNH B;  3R1K A;  4NF1 A;  1QSR A;  1SQH A;  1V0C A;  3ZJ0 A;  2VEZ A;  3BLN A;  1Z4R A;  5E96 A;  4M85 A;  3TOA A;  3GKR A;  4CRZ B;  1S3Z A;  1QSN A;  3SHP A;  2CY2 A;  3WR7 A;  2J8M A;  4KOW A;  2RC4 A;  4KOV A;  3C26 A;  1MJA A;  2GE3 A;  1Y9K A;  3SXO A;  3P2F A;  1Z4E A;  4L89 A;  2D4P A;  4J3G A;  2BUE A;  4RI1 A;  3FYN A;  4M3S A;  1ON0 A;  2R8V A;  2KCW A;  5JQ4 A;  1FY7 A;  3TE4 A;  3TOB A;  2Q44 A;  1XE4 A;  4AG7 A;  4Y49 C;  3F5B A;  4PSX A;  4CAV A;  2Z10 A;  3CXQ A;  1U6M A;  5FVJ A;  4BMH A;  2H5M A;  2GAN A;  4HNX B;  2BL1 A;  5F48 A;  5ISV A;  5F49 A;  3RYO A;  1Z9U A;  4PSW A;  4XPD C;  1P0H A;  4JLY A;  4KVM E;  1QST A;  1R57 A;  2PSW A;  4ORF A;  4UA3 A;  3TTH A;  4AVA A;  1MK4 A;  2F5I A;  2B4D B;  4YFJ A;  4UWJ A;  3FRM A;  1VHS A;  2P6E A;  2P0W A;  5C82 A;  2OZU A;  2FE7 A;  3JVN A;  4QB9 A;  2OZG A;  4NSQ A;  4EVY A;  4R3K A;  1MJ9 A;  4JXQ A;  4MY0 A;  3F0A A;  4IF5 A;  2I79 A;  2P6G A;  2EVN A;  3F8K A;  4R3L A;  5EBV A;  3D8P A;  1NE9 A;  4X5K A;  4KLW A;  2Z0Z A;  4YRH A;  3TT2 A;  2O28 A;  3H4Q A;  1Q2C A;  3MGD A;  4YGO A;  4PV6 A;  4JXR A;  2ZPA A;  3K9U A;  5IB0 A;  2Z11 A;  3PP9 A;  3FXT A;  4HKF A;  1S7L A;  1LRZ A;  2GIV A;  4PK3 A;  1Q2Y A;  2QEC A;  3B8G A;  5J8F A;  5EC4 A;  1IB1 E;  3CXS A;  2REF A;  4FD4 A;  2ATR A;  1RXT A;  2PR8 A;  4KOY A;  4K30 A;  4KVO E;  3W91 A;  1VKC A;  2PRB A;  2OZH A;  1RO5 A;  1J4J A;  1GHE A;  3OWC A;  2B4D A;  3N7Z A;  2K5T A;  4AG9 A;  1BO4 A;  2JDD A;  4XNH C;  5H84 A;  3PZJ A;  4R9M A;  2JEV A;  5HH1 A;  2Q7B A;  4JD6 A;  4OLL A;  4MI4 A;  4OAE A;  5JPH A;  4HNW B;  5KTD A;  1CJW A;  2R1I A;  3BJ8 A;  3EC4 A;  4KOS A;  4KVX A;  5IX3 A;  2Q4Y A;  2Q04 A;  1BOB A;  3BJ7 A;  4RS2 A;  1KUX A;  2BSW A;  4AVC A;  3SXN A;  3W6S A;  3VWE A;  1Q2D A;  1KUV A;  5CNP A;  2VZZ A;  4NCZ A;  1MJB A;  4KOX A;  1YRE A;  1KZF A;  2ZXV A;  3DR8 A;  3S6F A;  2ZW4 A;  3G8W A;  4QBJ A;  3LOD A;  3QAH A;  1XIX A;  2FS5 A;  3GY9 A;  4DNC A;  1QSO A;  2VQY A;  2Q0Y A;  3R9E A;  4QUS A;  3FIX A;  4XPK A;  3IWG A;  3D2P A;  4PK2 A;  1XF8 A;  3ZZI A;  3TO9 A;  5DWN A;  4HNY B;  2FXF A;  1PUA A;  4LX9 A;  4E8O A;  1I1D A;  1B87 A;  4AB7 A;  1S60 A;  3D2M A;  4UWI A;  2VI7 A;  1CM0 A;  2ZW5 A;  2JLM A;  4MJ8 A;  3LD2 A;  3P2H A;  5KTA A;  2Q4V A;  1QSM A;  3DR6 A;  3TCV A;  2I00 A;  1IID A;  2ARH A;  2FSR A;  2VBQ A;  3DNS A;  3T90 A;  4II9 A;  2BEI A;  4GS4 A;  4KLV A;  1YVK A;  3W6X A;  3JUW A;  2WPX A;  2CNT A;  2PR1 A;  2FT0 A;  2FIW A;  1K4J A;  1YK3 A;  5IV0 A;  2G3A A;  3PGP A;  2WPW A;  1M4G A;  2IL4 A;  3R95 A;  3EY5 A;  1Y9W A;  4U9Y A;  4LUA A;  4FD6 A;  4H6Z A;  2OB0 A;  1YLE A;  2HQY A;  4H89 A;  4F0Y A;  2AE6 A;  3DDD A;  3TFY A;  4CAX A;  1TIQ A;  2B4B A;  3E0K A;  2B3V A;  2REE A;  4B5O A;  1WK4 A;  1M4I A;  1XMT A;  4ZBG A;  4CS0 B;  1WWZ A;  2HV2 A;  5F46 A;  3R9F A;  3UY5 A;  4KUB A;  1L0C A;  1NSL A;  2FL4 A;  4I49 A;  2G0B A;  3R96 A;  4CAW A;  1M1D A;  5I0C A;  3V8I A;  1Y7R A;  4KOU A;  3FBU A;  2DXQ A;  1YX0 A;  2FCK A;  1XEB A;  2A4N A;  2ZW6 A;  3TO7 A;  4FD5 A;  2P6F A;  1S7F A;  2B5G B;  2ZW7 A;  2R7H A;  4ONU A;  4KOT A;  4L8A A;  1B6B A;  1UFH A;  1M44 A;  1S5K A;  2QIR A;  2G3T A;  2VXK A;  4Y49 B;  2HUZ A;  1S7N A;  2PQ8 A;  2VZY A;  3EO4 A;  3NE7 A;  2NMT A;  1PU9 A;  4QVT A;  3TO6 A;  1KUY A;  4OAD A;  3DSB A;  5GCN A;  4CRY B;  2PC1 A;  2PDO A;  4B5P B;  4E2A A;  2J8N A;  2AJ6 A;  4XPD B;  5C88 A;  3D3S A;  2J8R A;  4MHD A;  3EFA A;  3GYA A;  3I3G A;  1IYK A;  4U5Y A;  3EXN A;  4U9Z A;  4KUA A;  3R9G A;  1I12 A;  2X7B A;  5DWM A;  4XPL A;  1YVO A;  3QB8 A;  2OH1 A;  3S6H A;  2CNM A;  3VWD A;  3IGR A;  4IUS A;  2JDC A;  2Y0M A;  2FIA A;  4E0A A;  1IYL A;  1I21 A;  1OZP A;  1YGH A;  4MY3 A;  4JWP A;  2EUI A;  5KTC A;  2B3U A;  3G3S A;  4KZT A;  3FB3 A;  1YR0 A;  2B5G A;  3KKW A;  3CXP A;  1IIC A;  5HMN A;  1P4N A;  5F47 A;  1N71 A;  1M4D A;  3T9Y A;  2OU2 A;  2C27 A;  4R87 A;  5J8C A;  4H6U A;  2CNS A;  5H86 A;  1NMT A;  3S6K A;  4NEX A;  2R98 A;  4JJX A;  2D4O A;  2QML A;  4B5P A;  4F6A A;  4AVB A;  4FD7 A;  3S6G A;  3I9S A;  4QC6 A;  1S7K A;  4R57 A;  4UBR A;  4MBU A;  4KOR A; 
#chains in the Genus database with same CATH topology
 3D7F A;  3FNC A;  3WC5 A;  4NXY A;  3NH4 A;  2B58 A;  4XNH B;  1IU8 A;  3R1K A;  4P6Y A;  4A31 A;  1CPX A;  4NJR A;  5LYF A;  1QMU A;  4NF1 A;  4BIN A;  1QSR A;  1SQH A;  1V0C A;  3L2N A;  3ZJ0 A;  3FED A;  2VEZ A;  3BLN A;  3BXM A;  1Z4R A;  8CPA A;  4MFJ A;  3VH9 A;  5J1Q A;  4UCP A;  5E96 A;  1A2Z A;  5JM6 A;  4M85 A;  4C7I A;  3V38 A;  3GIU A;  3RZA A;  3D67 A;  4GM5 A;  4A32 A;  3PBE A;  4DJL A;  4UFX A;  3FX6 A;  3MRU A;  2PJ6 A;  3KL9 A;  4A33 A;  2YNC C;  1PCA A;  1XBU A;  2PJ3 A;  3TOA A;  3GKR A;  2POK A;  2ZEL A;  4CRZ B;  2BCO A;  4KSF A;  1S3Z A;  4TWE A;  3HLP A;  4CGO A;  1FT7 A;  2XEI A;  3KHZ A;  1UWY A;  3WC7 A;  3ISX A;  4PXC A;  1QSN A;  3SHP A;  1M4L A;  2CY2 A;  4EME A;  3A9L A;  2J8M A;  4KOW A;  3WR7 A;  2RC4 A;  6CPA A;  2ANP A;  4KOV A;  3C26 A;  1Z5R A;  3PFO A;  1MJA A;  2GE3 A;  5JH9 A;  1Y9K A;  3PB6 X;  4B12 A;  3SXO A;  5EMI A;  3S9L A;  3P2F A;  1Z4E A;  1ZLH A;  4L89 A;  2VL1 A;  2D4P A;  2Z3L A;  4H2K A;  4J3G A;  2ZEP A;  2BUE A;  2JBK A;  4RI1 A;  4MMO A;  2ZEO A;  3FYN A;  4LQ6 A;  4M3S A;  3D4U A;  1ON0 A;  2AFX A;  2PJ7 A;  4NJQ A;  2R8V A;  2CTC A;  3IEH A;  5AG7 A;  3KR5 A;  4RN7 A;  2HC9 A;  4CYN A;  2KCW A;  5A28 A;  5JQ4 A;  1FY7 A;  4R6T A;  3FVL A;  4M6H A;  4R8F A;  4PQA A;  3TOB A;  3TE4 A;  1DE4 C;  1YW4 A;  2Q44 A;  4C2Y A;  1XE4 A;  4AG7 A;  4Y49 C;  4A95 A;  1LAM A;  3F5B A;  4PSX A;  4CAV A;  4NGM A;  2Z10 A;  3KQX A;  5F09 A;  1Z2L A;  1U6M A;  2NSM A;  1ELL P;  3CXQ A;  5FVJ A;  4BMH A;  3SJE A;  2H5M A;  5AG5 A;  2GAN A;  2Q7S A;  3GUX A;  3FMC A;  4HNX B;  4X8I A;  5JGF A;  2BL1 A;  5F48 A;  5ISV A;  5F49 A;  1GYT A;  2YNE A;  3RYO A;  5LRK A;  2DPT A;  1Z9U A;  2PVV A;  4PSW A;  4XPD C;  3TC8 A;  1P0H A;  4JLY A;  4KVM E;  1QST A;  1R57 A;  3B7I A;  2PSW A;  3PFE A;  4ORF A;  3PEI A;  4UA3 A;  1YME A;  3TTH A;  4AVA A;  3H5Z A;  1MK4 A;  3NA6 A;  2F5I A;  3LWU A;  2B4D B;  1DTD A;  2WSA A;  4TNU A;  1PYT B;  1LCP A;  1VHS A;  2P6E A;  2P0W A;  2PJ2 A;  3FRM A;  3FEE A;  2OZU A;  2FE7 A;  2ZEG A;  3JVN A;  5C82 A;  4QB9 A;  4NGQ A;  3CPX A;  2OZG A;  1IGB A;  2PJC A;  4NSQ A;  4O23 A;  4EWT A;  2ZEM A;  1YQE A;  4BBH A;  3MN8 A;  4OC0 A;  4EVY A;  4ZI6 A;  4R3K A;  2JBJ A;  1MJ9 A;  4JXQ A;  2Q4Z A;  2C6C A;  4CAE A;  4MY0 A;  3F0A A;  4ZX8 A;  2IMO A;  4BD9 A;  4IF5 A;  5HVF A;  2IJZ A;  2I79 A;  5G1Z A;  4UEF A;  2P6G A;  4K3N A;  2EVN A;  2V8H A;  2NYQ A;  3F8K A;  4R3L A;  5I4M A;  5EBV A;  4B10 A;  3D8P A;  4P10 A;  1NE9 A;  4X5K A;  4KLW A;  3JTK A;  2Z0Z A;  4YRH A;  3TT2 A;  2PJ0 A;  2O28 A;  3H4Q A;  1Z8T A;  1CG2 A;  2AFS A;  1TKH A;  2V8D A;  1HDQ A;  1Q2C A;  3KAS A;  1TF8 A;  3MGD A;  4YGO A;  4PV6 A;  4JXR A;  4CGL A;  1TF9 A;  2J9A A;  2ZPA A;  1VHO A;  3PB4 X;  3K9U A;  3KGQ A;  4UCN A;  5IB0 A;  2Z11 A;  4F8Z A;  1CPS A;  4NFR A;  2YND A;  3PP9 A;  4B13 A;  3FXT A;  3N5F A;  4HKF A;  1S7L A;  1LRZ A;  4FUU A;  4MFZ A;  2GIV A;  4PK3 A;  1Q2Y A;  2QEC A;  3B8G A;  5J8F A;  5EC4 A;  2WZN A;  1IB1 E;  3CXS A;  3B3S A;  2REF A;  1IOI A;  3DLJ A;  1VHE A;  2AFW A;  2EK9 A;  3BHX A;  1Q7L A;  3PB7 X;  4X2T A;  5AG6 A;  2GRE A;  4FD4 A;  4UEZ A;  2ATR A;  3PB9 X;  1RXT A;  2PR8 A;  3IO1 A;  3D7D A;  2PJ5 A;  3NH8 A;  2ABZ A;  4K30 A;  3K2K A;  4KOY A;  1CBX A;  1VKC A;  4KVO E;  4Q7A A;  3W91 A;  2PRB A;  1YW6 A;  4CPA A;  2PIZ A;  2OZH A;  3SI2 A;  1RO5 A;  1Z8L A;  1HEE A;  1J4J A;  1GHE A;  2C1C A;  3OWC A;  4MFK A;  2B4D A;  2PJB A;  3N7Z A;  2K5T A;  3QAY A;  4UF4 A;  4AG9 A;  4B11 A;  1BO4 A;  2F7V A;  1OBR A;  2JDD A;  3PRT A;  3PZJ A;  4MXU A;  2JEV A;  4R9M A;  4XNH C;  5H84 A;  5HH1 A;  2Q7B A;  3WT4 A;  4A37 A;  1BLL E;  4JD6 A;  1ZO0 A;  4OLL A;  4JZ0 A;  4IAV A;  1ZG9 A;  4MI4 A;  4OAE A;  3CDX A;  2BOA A;  4NGR A;  4YFJ A;  2PIY A;  5LRJ A;  5JPH A;  4HNW B;  4Q36 A;  1CJW A;  5KTD A;  2R1I A;  3LMS A;  3BJ8 A;  3EC4 A;  4KOS A;  4KS9 A;  2PVW A;  1JQG A;  4KVX A;  4ZY0 A;  3D66 A;  4WWV A;  3D7G A;  3DGV A;  4AXV A;  1F2P A;  5IX3 A;  4OC2 A;  2Q4Y A;  3KHX A;  1YSJ A;  2Q04 A;  2GU2 A;  5CPA A;  5DS0 A;  1QQ9 A;  1NSA A;  2ZOG A;  4P45 A;  2C6P A;  1BOB A;  2V8G A;  1IOF A;  2AFO A;  3BJ7 A;  4RS2 A;  1KUX A;  4ZY2 A;  5AGE A;  2BSW A;  4AVC A;  2CF4 A;  4MFQ A;  3SXN A;  5D29 A;  3TX8 A;  3W6S A;  3B3C A;  4OIW A;  3VWE A;  1Q2D A;  3CZX A;  1KUV A;  5CNP A;  4ZYQ A;  2VZZ A;  4CGP A;  4UCM A;  5LYL A;  2AFU A;  2AFM A;  1TKF A;  4NCZ A;  4MRI A;  4A39 A;  1MJB A;  4KOX A;  1YRE A;  1KZF A;  4MFL A;  2ZXV A;  3DR8 A;  1F2O A;  5K8N A;  3S6F A;  2ZW4 A;  3G8W A;  4QBJ A;  3LOD A;  1ARL A;  1Z8X A;  3FEC A;  3WAB A;  3QAH A;  1XIX A;  2FS5 A;  3GY9 A;  4DNC A;  1QSO A;  2VQY A;  2Q0Y A;  3R9E A;  4QUS A;  3FIX A;  2RFH A;  4XPK A;  3IWG A;  2CXA A;  3D2P A;  1LFW A;  1XF8 A;  2PJA A;  4NGT A;  4PK2 A;  3ZZI A;  4Z65 A;  2PJ1 A;  3H8E A;  4P4E A;  4Q38 A;  3TO9 A;  4OC4 A;  5HVH A;  1H8L A;  4MCS A;  5DWN A;  4HNY B;  4ONW A;  1AUG A;  2FXF A;  1KWM A;  1PUA A;  1X10 A;  4MFP A;  2ZEE A;  4LX9 A;  4E8O A;  4PXB A;  1I1D A;  4C7H A;  4FBE A;  4CYP A;  1B87 A;  3KR4 A;  4AB7 A;  1S60 A;  3LAC A;  3D2M A;  4M6G A;  2DF5 A;  4UWI A;  4CGN A;  5K8M A;  2VI7 A;  1CM0 A;  2ZW5 A;  2JLM A;  4MJ8 A;  2PCU A;  3LD2 A;  3P2H A;  4NGN A;  3B2Y A;  5D8N A;  5KTA A;  1F57 A;  1QSM A;  2Q4V A;  3DR6 A;  4OKO A;  3TCV A;  2I00 A;  1IID A;  4FAI A;  5HXD A;  2Q43 A;  1JWQ A;  2ARH A;  2CTB A;  3D7H A;  4ZX9 A;  1R43 A;  2FSR A;  2QYV A;  2VBQ A;  3DNS A;  4MHY A;  3T90 A;  4II9 A;  2BEI A;  4GS4 A;  4KLV A;  2ODF A;  3RBU A;  1YVK A;  3W6X A;  3JUW A;  3B3V A;  2WPX A;  4CAF A;  3FJU A;  1XFO A;  4C2X A;  2CNT A;  2PR1 A;  2FT0 A;  2FIW A;  2F8H A;  2Z3K A;  1VGY A;  2YGW A;  4OC1 A;  1ZLI A;  1K4J A;  4PXD A;  1Y7E A;  2GFQ A;  1YK3 A;  4PXE A;  4CYQ A;  3BI1 A;  3KZW A;  5IV0 A;  2G3A A;  3PGP A;  2WPW A;  4A2Z A;  3IU1 A;  4MHP A;  1M4G A;  2IL4 A;  2OR4 A;  3EY5 A;  4MCR A;  3R95 A;  1Y9W A;  3JRU A;  4U9Y A;  4LUA A;  4FD6 A;  4G1P A;  2OB0 A;  1YLE A;  2HQY A;  4H6Z A;  4H89 A;  4F0Y A;  2DEA A;  3RAM A;  2AE6 A;  5G22 A;  3NE8 A;  3DDD A;  4MCP A;  4P4B A;  3TFY A;  4CAX A;  2EWB A;  3RO0 A;  1TIQ A;  1Y0R A;  2B4B A;  1XRY A;  3E0K A;  2AFZ A;  2B3V A;  3I1U A;  2REE A;  2V8V A;  5CBM A;  2C6G A;  4B5O A;  1TKJ A;  1BAV A;  1WK4 A;  1M4I A;  1XMT A;  4P4F A;  3CT9 A;  4ZBG A;  2WUU A;  4CS0 B;  1WWZ A;  2HV2 A;  2O4H A;  2ZEF A;  5F46 A;  3R9F A;  4R7M A;  3VAT A;  1FNO A;  4YWY A;  3UY5 A;  4KUB A;  1L0C A;  3WC6 A;  1NSL A;  1ZG8 A;  2FL4 A;  2EO8 A;  4UIA A;  4I49 A;  2G0B A;  2QVP A;  3R96 A;  5BWA B;  4CAW A;  3NFZ A;  5ELY A;  1M1D A;  5I0C A;  5HVG A;  4JYW A;  3IJ3 A;  3V8I A;  4KSI A;  2OOT A;  4R76 A;  4DUK A;  1Y7R A;  4FWU A;  4A30 A;  4KOU A;  4MHN A;  4P4D A;  3FBU A;  2IQ6 A;  4IHM A;  2DXQ A;  1YX0 A;  4ZY1 A;  2FCK A;  1XEB A;  2A4N A;  4CGM A;  4DYO A;  1XOV A;  2ZW6 A;  3TO7 A;  4WJB A;  5G20 A;  2GLF A;  3IIB A;  4FD5 A;  2HB6 A;  1S7F A;  2B5G B;  2P6F A;  2R7H A;  2ZW7 A;  3H8F A;  4ONU A;  4KOT A;  3S9N A;  3NH5 A;  1ELM P;  4L8A A;  3IWW A;  1B6B A;  3BI0 A;  1UFH A;  4MHZ A;  1M44 A;  1Y0Y A;  3FF3 A;  4YU9 A;  2Z3M A;  1S5K A;  2QIR A;  1XMB A;  4M6I A;  2G3T A;  3ISZ A;  2VXK A;  4Y49 B;  2HUZ A;  1S7N A;  2PQ8 A;  2VZY A;  2ZED A;  3EO4 A;  2NMT A;  3NE7 A;  4HPS A;  5LRG A;  5IB9 A;  3D68 A;  4NGS A;  1PU9 A;  4LQG A;  4QVT A;  3TO6 A;  1KUY A;  4OAD A;  3DSB A;  4UIB A;  3CPA A;  1RTQ A;  5GCN A;  2XEF A;  2DPS A;  4CRY B;  2PC1 A;  2PJ9 A;  2PDO A;  4B5P B;  4CYO A;  2G9D A;  2J8N A;  4E2A A;  2AJ6 A;  3KI9 A;  4XPD B;  2BO9 A;  5C88 A;  2I3C A;  3D3S A;  4MCQ A;  2J8R A;  3IWE A;  3VAR A;  4A94 A;  4MHD A;  3SJX A;  3EFA A;  3KQZ A;  2Z3P A;  1CP7 A;  2ZEN A;  3B3T A;  4UEE A;  1X12 A;  5A27 A;  5K8P A;  3GYA A;  3I3G A;  1IYK A;  4U5Y A;  4GXH A;  3EXN A;  4C2Z A;  1CP6 A;  3B3W A;  5AG4 A;  2PRQ A;  4B14 A;  3GLJ A;  4P4J A;  3V7Z A;  2CIJ A;  3PBB A;  4KSA A;  4U9Z A;  4F9V A;  4P4I A;  3RNZ A;  1BPN A;  3B35 A;  4IK2 A;  4KUA A;  3R9G A;  2JEW A;  4B6Z A;  1LAP A;  5G21 A;  1I12 A;  2X7B A;  5DWM A;  4C68 A;  5LYD A;  2YNC A;  4XPL A;  1YVO A;  3QB8 A;  2OH1 A;  3S6H A;  2CNM A;  2ZEH A;  3VWD A;  4OC3 A;  4ZGY B;  2FVG A;  3IGR A;  4UWJ A;  3PB8 X;  1R3N A;  4OID A;  3SJG A;  3HUV A;  4A38 A;  1ARM A;  1HDU A;  4UFW A;  1VIX A;  4IUS A;  3SI0 A;  3K9T A;  2JDC A;  5THW A;  5LYI A;  2EBJ A;  2Z3O A;  7CPA A;  1AMP A;  2Y0M A;  2FIA A;  4E0A A;  1IYL A;  1I21 A;  2QJ8 A;  5K8O A;  1OZP A;  2Z3N A;  1YGH A;  2Q51 A;  4JWP A;  2EUI A;  4MY3 A;  5KTC A;  2B3U A;  2V77 A;  4P44 A;  3G3S A;  3IU2 A;  4F9U A;  4F0X A;  4OP4 A;  4KZT A;  3FB3 A;  1YR0 A;  2B5G A;  2WYR A;  3KKW A;  2RB7 A;  3CXP A;  1IIC A;  4RUH A;  4W9Y A;  4NGP A;  5HMN A;  1P4N A;  5F47 A;  1N71 A;  1M4D A;  2XEG A;  3IC1 A;  3T9Y A;  2GLJ A;  2EK8 A;  2OU2 A;  2C27 A;  2ZOF A;  1Z8W A;  2XEJ A;  3QNV A;  4H6U A;  1IY7 A;  4R87 A;  5J8C A;  2CNS A;  3T8W A;  5H86 A;  1TXR A;  1NMT A;  3GB0 A;  3S6K A;  2PE3 A;  3FH4 A;  3H8G A;  3S9M A;  4NEX A;  1BPM A;  2R98 A;  4JJX A;  4EFD A;  2PJ8 A;  1LOK A;  2D4O A;  2QML A;  4PPZ A;  1CX8 A;  4B5P A;  1LAN A;  4F6A A;  4AVB A;  1XJO A;  4FD7 A;  3S6G A;  2PJ4 A;  4OC5 A;  4OME A;  3SI1 A;  4UFV A;  3I9S A;  3IFE A;  4QC6 A;  1ZG7 A;  2O53 A;  4X3R A;  1S7K A;  4R57 A;  3SJF A;  4UBR A;  1EE3 P;  1AYE A;  4MBU A;  1YLO A;  4KOR A; 
#chains in the Genus database with same CATH homology
 3FNC A;  4NXY A;  2B58 A;  4XNH B;  3R1K A;  4A31 A;  4NF1 A;  1QSR A;  1SQH A;  1V0C A;  3ZJ0 A;  2VEZ A;  3BLN A;  1Z4R A;  4MFJ A;  4UCP A;  5E96 A;  4M85 A;  4C7I A;  4A32 A;  4UFX A;  4A33 A;  2YNC C;  3TOA A;  3GKR A;  4CRZ B;  4KSF A;  1S3Z A;  4CGO A;  1QSN A;  3SHP A;  2CY2 A;  3A9L A;  2J8M A;  4KOW A;  3WR7 A;  2RC4 A;  4KOV A;  3C26 A;  1MJA A;  2GE3 A;  1Y9K A;  4B12 A;  3SXO A;  3P2F A;  1Z4E A;  4L89 A;  2D4P A;  2Z3L A;  4J3G A;  2BUE A;  4RI1 A;  3FYN A;  4M3S A;  1ON0 A;  2R8V A;  5AG7 A;  4CYN A;  2KCW A;  5A28 A;  5JQ4 A;  1FY7 A;  3TE4 A;  3TOB A;  2Q44 A;  4C2Y A;  1XE4 A;  4AG7 A;  4Y49 C;  4A95 A;  3F5B A;  4PSX A;  4CAV A;  2Z10 A;  3CXQ A;  1U6M A;  5FVJ A;  4BMH A;  2H5M A;  5AG5 A;  2GAN A;  4HNX B;  2BL1 A;  5F48 A;  5ISV A;  5F49 A;  2YNE A;  3RYO A;  2DPT A;  1Z9U A;  4PSW A;  4XPD C;  1P0H A;  4JLY A;  4KVM E;  1QST A;  1R57 A;  2PSW A;  4ORF A;  4UA3 A;  3TTH A;  4AVA A;  3H5Z A;  1MK4 A;  2F5I A;  2B4D B;  2WSA A;  4UWJ A;  3FRM A;  1VHS A;  4YFJ A;  2P6E A;  2P0W A;  5BWA B;  5C82 A;  2OZU A;  2FE7 A;  3JVN A;  4QB9 A;  2OZG A;  4NSQ A;  4BBH A;  4EVY A;  4R3K A;  1MJ9 A;  4JXQ A;  4CAE A;  4MY0 A;  3F0A A;  4IF5 A;  2I79 A;  5G1Z A;  2P6G A;  2EVN A;  3F8K A;  4R3L A;  5EBV A;  4B10 A;  3D8P A;  1NE9 A;  4X5K A;  4KLW A;  3JTK A;  2Z0Z A;  4YRH A;  3TT2 A;  2O28 A;  3H4Q A;  1Q2C A;  3MGD A;  4YGO A;  4PV6 A;  4JXR A;  4CGL A;  2ZPA A;  3K9U A;  4UCN A;  5IB0 A;  2Z11 A;  2YND A;  3PP9 A;  4B13 A;  3FXT A;  4HKF A;  1S7L A;  1LRZ A;  4MFZ A;  2GIV A;  4PK3 A;  1Q2Y A;  2QEC A;  3B8G A;  5J8F A;  5EC4 A;  1IB1 E;  3CXS A;  2REF A;  5AG6 A;  4FD4 A;  2ATR A;  1RXT A;  2PR8 A;  4KOY A;  4K30 A;  4KVO E;  3W91 A;  1VKC A;  2PRB A;  2OZH A;  1RO5 A;  1J4J A;  1GHE A;  4MFK A;  3OWC A;  2B4D A;  3N7Z A;  2K5T A;  4AG9 A;  5A27 A;  4B11 A;  1BO4 A;  2JDD A;  4XNH C;  5H84 A;  3PZJ A;  4R9M A;  2JEV A;  5HH1 A;  2Q7B A;  4JD6 A;  1ZO0 A;  4OLL A;  4MI4 A;  4OAE A;  5JPH A;  4HNW B;  4Q36 A;  1CJW A;  5KTD A;  2R1I A;  3BJ8 A;  3EC4 A;  4KOS A;  4KS9 A;  4KVX A;  5IX3 A;  2Q4Y A;  2Q04 A;  1BOB A;  3BJ7 A;  4RS2 A;  1KUX A;  5AGE A;  2BSW A;  4AVC A;  4MFQ A;  3SXN A;  3W6S A;  3VWE A;  1Q2D A;  1KUV A;  5CNP A;  2VZZ A;  4CGP A;  4UCM A;  4NCZ A;  1MJB A;  4KOX A;  1YRE A;  1KZF A;  4MFL A;  2ZXV A;  3DR8 A;  3S6F A;  2ZW4 A;  3G8W A;  4QBJ A;  3LOD A;  3QAH A;  1XIX A;  2FS5 A;  3GY9 A;  4DNC A;  1QSO A;  2VQY A;  2Q0Y A;  3R9E A;  4QUS A;  3FIX A;  4XPK A;  3IWG A;  2CXA A;  3D2P A;  4PK2 A;  1XF8 A;  3ZZI A;  4Q38 A;  3TO9 A;  5DWN A;  4HNY B;  2FXF A;  1PUA A;  4MFP A;  4LX9 A;  4E8O A;  1I1D A;  4C7H A;  4CYP A;  1B87 A;  4AB7 A;  1S60 A;  3D2M A;  4UWI A;  4CGN A;  2VI7 A;  1CM0 A;  2ZW5 A;  2JLM A;  4MJ8 A;  3LD2 A;  3P2H A;  5KTA A;  2Q4V A;  1QSM A;  3DR6 A;  3TCV A;  2I00 A;  1IID A;  2ARH A;  2FSR A;  2VBQ A;  3DNS A;  3T90 A;  4II9 A;  2BEI A;  4GS4 A;  4KLV A;  1YVK A;  3W6X A;  3JUW A;  4CAF A;  2WPX A;  4C2X A;  2CNT A;  2PR1 A;  2FT0 A;  2FIW A;  2Z3K A;  2YGW A;  1K4J A;  1YK3 A;  4CYQ A;  5IV0 A;  2G3A A;  3PGP A;  2WPW A;  4A2Z A;  3IU1 A;  1M4G A;  2IL4 A;  3R95 A;  3EY5 A;  1Y9W A;  4U9Y A;  4LUA A;  4FD6 A;  4H6Z A;  2OB0 A;  1YLE A;  2HQY A;  4H89 A;  4F0Y A;  2AE6 A;  5G22 A;  3DDD A;  3TFY A;  4CAX A;  1TIQ A;  2B4B A;  3E0K A;  2B3V A;  2REE A;  4B5O A;  1WK4 A;  1M4I A;  1XMT A;  4ZBG A;  2WUU A;  4CS0 B;  1WWZ A;  2HV2 A;  5F46 A;  3R9F A;  3UY5 A;  4KUB A;  1L0C A;  1NSL A;  2FL4 A;  4I49 A;  2G0B A;  3R96 A;  4CAW A;  1M1D A;  5I0C A;  3V8I A;  1Y7R A;  4A30 A;  4KOU A;  3FBU A;  2DXQ A;  1YX0 A;  2FCK A;  1XEB A;  2A4N A;  4CGM A;  2ZW6 A;  3TO7 A;  5G20 A;  4FD5 A;  2P6F A;  1S7F A;  2B5G B;  2ZW7 A;  2R7H A;  4ONU A;  4KOT A;  4L8A A;  1B6B A;  1UFH A;  1M44 A;  2Z3M A;  1S5K A;  2QIR A;  2G3T A;  2VXK A;  4Y49 B;  2HUZ A;  1S7N A;  2PQ8 A;  2VZY A;  3EO4 A;  3NE7 A;  2NMT A;  1PU9 A;  4QVT A;  3TO6 A;  1KUY A;  4OAD A;  3DSB A;  5GCN A;  2DPS A;  4CRY B;  2PC1 A;  4CYO A;  2PDO A;  4B5P B;  4E2A A;  2J8N A;  2AJ6 A;  4XPD B;  5C88 A;  3D3S A;  2J8R A;  3IWE A;  4MHD A;  3EFA A;  2Z3P A;  3GYA A;  3I3G A;  1IYK A;  4U5Y A;  3EXN A;  4C2Z A;  5AG4 A;  4B14 A;  4KSA A;  4U9Z A;  4KUA A;  3R9G A;  5G21 A;  1I12 A;  2X7B A;  5DWM A;  4C68 A;  2YNC A;  4XPL A;  1YVO A;  3QB8 A;  2OH1 A;  3S6H A;  2CNM A;  3VWD A;  4ZGY B;  3IGR A;  4UFW A;  4IUS A;  2JDC A;  2Z3O A;  2Y0M A;  2FIA A;  4E0A A;  1IYL A;  1I21 A;  1OZP A;  2Z3N A;  1YGH A;  4MY3 A;  4JWP A;  2EUI A;  5KTC A;  2B3U A;  3G3S A;  3IU2 A;  4F0X A;  4KZT A;  3FB3 A;  1YR0 A;  2B5G A;  3KKW A;  3CXP A;  1IIC A;  5HMN A;  1P4N A;  5F47 A;  1N71 A;  1M4D A;  3T9Y A;  2OU2 A;  2C27 A;  4R87 A;  5J8C A;  4H6U A;  2CNS A;  5H86 A;  1NMT A;  3S6K A;  4NEX A;  2R98 A;  4JJX A;  2D4O A;  2QML A;  4B5P A;  4F6A A;  4AVB A;  4FD7 A;  3S6G A;  4UFV A;  3I9S A;  4QC6 A;  1S7K A;  4R57 A;  4UBR A;  4MBU A;  4KOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...