1VHSA

Crystal structure of a putative phosphinothricin n-acetyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
165
structure length
165
Chain Sequence
SLTLRLAEHRDLEAVVAIYNSTIASRMVTADTEPVTPEDRMEWFSGHTESRPLYVAEDENGNVAAWISFETFYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLMAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEMDGKRYDLKILGRELSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords similar to phosphinothricin acetyltransferase
total genus 41
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.3.1.183: Phosphinothricin acetyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1vhsA00
4MBUA 2G0BA 1YVKA 2VQYA 5GCNA 4KORA 3TOBA 4JXQA 4OLLA 2D4OA 1NSLA 3MGDA 2JDDA 1MJ9A 4AG7A 4UWJA 5KTDA 1M44A 2REFA 1CM0A 1I21A 1U6MA 4LUAA 1MJBA 4NEXA 1XEBA 5DWNA 3VWEA 1M4GA 3R1KA 2ZXVA 3DDDA 3S6FA 2B4BA 2FT0A 1MJAA 3S6KA 4LX9A 4JWPA 1PUAA 1WK4A 2HUZA 3BJ7A 4NF1A 4R3LA 2OZHA 1YVOA 2CNMA 4MY3A 2P0WA 2EVNA 1XE4A 3RYOA 2VEZA 4PK3A 3TCVA 5J8FA 2BSWA 1MK4A 2KCWA 1Q2CA 4E8OA 1UFHA 4UBRA 2AJ6A 3FYNA 1YREA 5E96A 3I9SA 1FY7A 3WR7A 3F5BA 3W91A 1V0CA 1J4JA 2ZW6A 3GKRA 4RI1A 1B6BA 2VI7A 4B5OA 2I00A 3G8WA 1BO4A 4JXRA 5IX3A 3LD2A 4U5YA 3UY5A 3VWDA 2B3UA 4ORFA 3FRMA 3W6XA 2Q4YA 4JLYA 1M4DA 1NMTA 4KOSA 1GHEA 2J8NA 3FBUA 2C27A 3QB8A 3TO7A 1S7FA 1I12A 1Y9WA 1KUXA 4F0YA 3CXQA 1QSMA 4E0AA 3F8KA 3LODA 3P2FA 3TTHA 5FVJA 4CS0B 1OZPA 2QIRA 4QB9A 2VXKA 2B4DB 4XPKA 2FSRA 5F46A 3K9UA 4KVOE 1YX0A 5HH1A 5J8CA 3PZJA 4H6UA 4NSQA 2CY2A 1VHSA 2PDOA 4X5KA 2WPWA 4QVTA 2OZGA 5KTCA 4PV6A 1L0CA 2AE6A 2HQYA 3R96A 2ZPAA 2VZZA 4UWIA 2PC1A 4PK2A 4OAEA 1S3ZA 2Q7BA 2BUEA 1NE9A 4HNYB 1YR0A 2B4DA 4CAVA 5C88A 3NE7A 2JDCA 4MY0A 2ZW7A 5H86A 2Z10A 4KLWA 5H84A 1Q2YA 2J8MA 3GYAA 4AVBA 2RC4A 4F6AA 4K30A 4MJ8A 3FXTA 2FCKA 3D8PA 1Y9KA 1IYLA 5DWMA 4U9YA 4MI4A 3TO9A 4CAWA 1KUVA 3DR6A 3TFYA 4QC6A 4XNHB 1RXTA 3TT2A 2OU2A 2OH1A 1KZFA 2O28A 3D2MA 4FD7A 2FIWA 3T9YA 4KOXA 1M4IA 2B5GA 2VBQA 5EBVA 2B5GB 1M1DA 1XF8A 2P6GA 3EO4A 3QAHA 1Z4EA 4KOVA 4KOWA 2F5IA 1IYKA 1P0HA 5KTAA 5ISVA 2R1IA 3V8IA 2A4NA 2QECA 4AG9A 4II9A 3OWCA 3EY5A 3IGRA 2Q0YA 3D3SA 1QSOA 4IUSA 2Y0MA 2PQ8A 2FIAA 2X7BA 1Z4RA 2Q44A 1BOBA 4PSXA 5C82A 4R9MA 3TOAA 4CRYB 3W6SA 1K4JA 3FB3A 4FD5A 2REEA 1Z9UA 1R57A 1CJWA 3DSBA 1IB1E 4J3GA 4KUAA 4R57A 5IB0A 4I49A 4KLVA 4XPDB 3KKWA 4BMHA 2PR8A 5F49A 2P6EA 2OB0A 5HMNA 1S7KA 2WPXA 3R9GA 4RS2A 2Q04A 3ZJ0A 4L89A 3I3GA 4L8AA 4XPLA 1WWZA 3FNCA 5EC4A 3BLNA 4JD6A 1Y7RA 2CNSA 4YFJA 4CRZB 3EFAA 4M85A 4NXYA 2BL1A 2D4PA 1YGHA 2FE7A 2GIVA 4B5PB 1B87A 4KOYA 1P4NA 3SHPA 2PRBA 2K5TA 2VZYA 1RO5A 2Q4VA 3H4QA 1N71A 5F48A 1IIDA 4AVAA 4NCZA 2B3VA 4HNWB 4Y49C 4ONUA 4R3KA 1YLEA 4U9ZA 4QUSA 4HNXB 2G3AA 4XPDC 1LRZA 2R98A 2FL4A 1KUYA 4FD4A 4KOTA 3JUWA 2JLMA 4EVYA 3IWGA 3CXSA 4HKFA 2JEVA 3DNSA 4KVXA 3DR8A 3ZZIA 4UA3A 1S7NA 2ATRA 3PGPA 1I1DA 2GANA 2HV2A 4IF5A 2J8RA 3R9FA 2FS5A 2B58A 3TO6A 4DNCA 4QBJA 4AVCA 4CAXA 2ZW5A 1XMTA 4XNHC 2OZUA 2CNTA 2EUIA 4M3SA 4ZBGA 3D2PA 5IV0A 3S6HA 3E0KA 3N7ZA 2Z0ZA 4R87A 2BEIA 2ZW4A 3R9EA 3PP9A 4OADA 2R8VA 3JVNA 3F0AA 4KZTA 3P2HA 3SXOA 1S60A 3EXNA 4YGOA 1VKCA 3EC4A 3C26A 2PR1A 1ON0A 3GY9A 1PU9A 1QSTA 4KUBA 4GS4A 3FIXA 1QSRA 4B5PA 2G3TA 3TE4A 3S6GA 4YRHA 2IL4A 4Y49B 3SXNA 2ARHA 4AB7A 1IICA 1S7LA 2PSWA 2R7HA 4H6ZA 2DXQA 3BJ8A 3R95A 1Q2DA 2GE3A 3B8GA 3CXPA 1SQHA 2Z11A 1S5KA 2NMTA 1YK3A 2QMLA 4KVME 5JPHA 4E2AA 3G3SA 1TIQA 2FXFA 4H89A 2H5MA 5F47A 3T90A 5JQ4A 5CNPA 1XIXA 4KOUA 1QSNA 4MHDA 2P6FA 4JJXA 4FD6A 5I0CA 2I79A 4PSWA
chains in the Genus database with same CATH superfamily
4MBUA 2G0BA 1YVKA 3DLJA 2PIZA 3D7GA 2VQYA 5GCNA 1LAPA 4KORA 3TOBA 4JXQA 4P4BA 4UF4A 3ISZA 4OLLA 2IJZA 3A9LA 2D4OA 3IJ3A 1NSLA 5G1ZA 3MGDA 2JDDA 4C2YA 4X3RA 1MJ9A 4IHMA 4UWJA 5D8NA 4AG7A 4A38A 2XEGA 5K8MA 3MN8A 5THWA 5K8OA 2AFMA 5KTDA 1M44A 2REFA 2GFQA 1CM0A 1I21A 3GIUA 3H8FA 2C1CA 3KL9A 5D29A 5JH9A 4R76A 4MCSA 1U6MA 4LUAA 1MJBA 4NEXA 1EE3P 2PRQA 1XEBA 4NJQA 1QQ9A 5DWNA 2PJ0A 3VWEA 1M4GA 2CXAA 3R1KA 2ZXVA 4YU9A 4GXHA 4ZY2A 2ABZA 3DDDA 3S6FA 4P4DA 3S9NA 2B4BA 2FT0A 4IAVA 1MJAA 4PQAA 2PE3A 5G21A 3S6KA 4F0XA 3D4UA 4LX9A 4MFJA 4JWPA 3B3SA 1HDUA 1PUAA 1WK4A 2HUZA 3BJ7A 4NF1A 2ZOFA 4R3LA 2OZHA 4A30A 1YVOA 4YWYA 2CNMA 2Z3PA 3QNVA 4MY3A 2P0WA 2EVNA 1XE4A 5G22A 3RYOA 2VEZA 2PJ3A 4EMEA 1CG2A 4NGNA 3B3VA 4PK3A 3TCVA 3B2YA 3WT4A 3H5ZA 5J8FA 2BSWA 4UIBA 1ELMP 2CTBA 3SJEA 1MK4A 2BCOA 5HVFA 2KCWA 1TKJA 1Q2CA 3JTKA 4E8OA 4P4IA 1UFHA 2JBKA 2PJ4A 3B3CA 1HEEA 4UBRA 2Q43A 4NJRA 1LFWA 2AJ6A 3VARA 3CZXA 3FYNA 1YREA 5E96A 2GLJA 3D68A 4P4EA 4MFKA 2ZEHA 4WWVA 3I9SA 1TKHA 3H8GA 1M4LA 1FY7A 2Z3LA 3D7HA 1YW6A 4UCNA 2EK8A 1XOVA 4JZ0A 2Z3KA 5F09A 4MFZA 4UFXA 2PJ6A 5JGFA 2WZNA 1OBRA 3FEEA 3PRTA 3KI9A 4A37A 1AUGA 3F5BA 3WR7A 2G9DA 3W91A 5IB9A 1V0CA 1R3NA 1J4JA 2ZW6A 3GKRA 4RI1A 1B6BA 2O4HA 4TWEA 2VI7A 1F57A 3GUXA 4B5OA 2I00A 3K9TA 1JQGA 4P44A 1GYTA 1YMEA 2YNDA 2PJCA 1CPXA 2I79A 3G8WA 2Q51A 5HXDA 3CPAA 2QYVA 1Y0YA 1BO4A 4JXRA 2V8HA 4CGNA 4MHNA 1XBUA 5IX3A 2ZEEA 1XMBA 3LD2A 4U5YA 3UY5A 3VWDA 2B3UA 2QVPA 3PB9X 4OP4A 1Q7LA 4ORFA 4FBEA 3FRMA 4FUUA 3B7IA 5CPAA 3W6XA 4MXUA 2Q4YA 4HPSA 1X12A 3RAMA 2GU2A 4JLYA 3BI1A 4LQ6A 1M4DA 1NMTA 4KOSA 2PCUA 1YSJA 1GHEA 2J8NA 3D67A 3FBUA 2C27A 3QB8A 5LRGA 1S7FA 1I12A 1Y9WA 5AG7A 1KUXA 3TO7A 5CBMA 2JEWA 4F0YA 3CXQA 1JWQA 1QSMA 4E0AA 4A95A 3NA6A 3F8KA 5BWAB 3B35A 3WC6A 2BOAA 3LODA 3P2FA 2PJBA 3PEIA 5FVJA 3TTHA 4A2ZA 1Y0RA 5A28A 1CBXA 4CS0B 1OZPA 2QIRA 4QB9A 2VXKA 2B4DB 4XPKA 2FSRA 3PFEA 4DYOA 4F9UA 5F46A 3NH8A 4OIDA 1BAVA 2WYRA 3K9UA 4UEFA 3CDXA 4UIAA 4DJLA 2XEIA 4KVOE 3H8EA 5J1QA 1YX0A 1YLOA 2PJ7A 5HH1A 4BINA 2HC9A 5J8CA 4CGLA 3PZJA 5LYLA 4H6UA 4NSQA 2CY2A 3V38A 1VHSA 5LYIA 4NGSA 1ARMA 4OC1A 2PDOA 4X5KA 1AYEA 2AFWA 2WPWA 4QVTA 2ZOGA 3B3TA 2OZGA 2PJ2A 4PV6A 1A2ZA 5KTCA 2AFXA 1L0CA 4P10A 2NSMA 2AE6A 2HQYA 4ZX8A 4ZI6A 4OC5A 1DE4C 2C6GA 3R96A 2ZEFA 2VZZA 2ZPAA 4UWIA 2EBJA 3L2NA 1YW4A 3FX6A 4EWTA 4UEZA 1CP7A 3NH5A 4OC3A 2PC1A 3GB0A 3KQXA 4B10A 2GLFA 4NGRA 3NE8A 5K8NA 1VHOA 4MFQA 3N5FA 4PK2A 4OAEA 1S3ZA 4PXDA 2BUEA 2Q7BA 2V8DA 1NE9A 4HNYB 1YR0A 2B4DA 4CAVA 4UFWA 5C88A 6CPAA 3NE7A 3PBBA 1ARLA 3IFEA 2Q7SA 2JDCA 4OMEA 4MY0A 4ZX9A 2ODFA 2ZW7A 5H86A 2Z10A 4KLWA 4R6TA 5H84A 1NSAA 1Q2YA 2J8MA 3GYAA 4AVBA 1XJOA 4CGOA 1Z8WA 2RC4A 2YGWA 4F6AA 4K30A 4MJ8A 3FXTA 2FCKA 2OOTA 2PJ1A 3D8PA 1Y9KA 1IYLA 4MHYA 4C2ZA 5DWMA 4Q7AA 4M6IA 1Z8XA 2Z3NA 4P4FA 3RO0A 4MCRA 4U9YA 5DS0A 2V8GA 4MI4A 2HB6A 3HLPA 3TO9A 4CAWA 3KR5A 3SI2A 4B12A 1KUVA 3DR6A 3TFYA 4ZYQA 4QC6A 2RB7A 1X10A 3S9MA 3D66A 2CTCA 1RXTA 3D7FA 4XNHB 5AG6A 2OU2A 3TT2A 2OH1A 3I1UA 2PJ9A 1KZFA 2O28A 4Z65A 3D2MA 4FD7A 4BBHA 2FIWA 3B3WA 3KGQA 3T9YA 4KOXA 1M4IA 2XEFA 1VIXA 3SJFA 2B5GA 3IO1A 4B6ZA 2VBQA 1Z5RA 5EBVA 2XEJA 3IWWA 3D7DA 4MRIA 2B5GB 2F8HA 4MMOA 1M1DA 1XF8A 2PVVA 3IU1A 2P6GA 1LAMA 3EO4A 3QAHA 3IWEA 1CP6A 1Z4EA 4KOVA 2I3CA 4KSIA 4KOWA 3FEDA 2DEAA 3FF3A 4X2TA 2F5IA 4PPZA 4O23A 2ZEMA 1IYKA 5AG5A 1P0HA 5KTAA 5ISVA 2R1IA 3V8IA 2A4NA 2QECA 3TC8A 4AG9A 3RNZA 3RBUA 4II9A 3OWCA 1ZG9A 4ONWA 2YNCC 3EY5A 4K3NA 4CYOA 4OIWA 3FH4A 2Q0YA 1AMPA 3IGRA 4M6GA 3D3SA 1QSOA 3ISXA 5LRJA 2ZENA 3IEHA 4IUSA 2Y0MA 4CYNA 2PQ8A 4R8FA 2FIAA 2PVWA 2X7BA 3FVLA 4RN7A 3KHXA 1DTDA 5AGEA 1Z4RA 2Q44A 1BOBA 3PFOA 2Z3OA 4PSXA 3GLJA 5C82A 4R9MA 3TOAA 4C68A 4CRYB 3W6SA 4X8IA 1K4JA 3FB3A 1Z2LA 4FD5A 4FWUA 4A33A 2OR4A 2REEA 1Z9UA 2ANPA 3KQZA 7CPAA 2V8VA 1R57A 2O53A 1CJWA 4UFVA 3DSBA 1IB1E 4J3GA 4KUAA 4R57A 2GREA 3HUVA 5IB0A 1FT7A 4I49A 4KLVA 4XPDB 2EO8A 3KKWA 1H8LA 4BMHA 2ZEOA 2PR8A 5F49A 2P6EA 3CT9A 2OB0A 2ZEPA 1TKFA 1BLLE 4PXEA 4CPAA 1S7KA 2WSAA 5HMNA 5HVHA 2WPXA 3DGVA 3PB4X 3R9GA 5K8PA 2PJAA 4RS2A 5I4MA 2Q04A 1BPMA 3ZJ0A 2DF5A 4LQGA 4L89A 3MRUA 3I3GA 4MHZA 4L8AA 2Q4ZA 4Q36A 2YNCA 1CPSA 2EK9A 4P4JA 4XPLA 2PJ8A 4GM5A 1WWZA 3FNCA 5EC4A 3BLNA 4JD6A 1Y7RA 3TX8A 4C7HA 3KASA 2CNSA 4YFJA 1IGBA 4CRZB 3EFAA 4M85A 3QAYA 2BL1A 4NXYA 2D4PA 1YGHA 2FE7A 2GIVA 4B5PB 1B87A 4UCMA 5A27A 4KOYA 1P4NA 3IC1A 4P45A 5LRKA 4IK2A 3SHPA 2PRBA 2K5TA 2VZYA 4KSAA 4H2KA 4MCPA 1RTQA 4MFPA 1RO5A 2Q4VA 2ZEDA 1IOIA 3H4QA 4C7IA 4ZY1A 1N71A 5F48A 2NYQA 2FVGA 1IIDA 4AVAA 2ZEGA 4NCZA 3BI0A 3NH4A 4NGMA 2B3VA 4CAFA 3VATA 2AFOA 2J9AA 4HNWB 1ZG7A 4ONUA 4Y49C 3LMSA 4R3KA 1YLEA 2IQ6A 1HDQA 4B13A 3WC7A 3NFZA 4U9ZA 4F8ZA 3PB6X 4QUSA 4HNXB 2G3AA 2RFHA 4XPDC 1LRZA 1ZO0A 2R98A 1IU8A 2FL4A 2PJ5A 1KUYA 4FD4A 3SJGA 5JM6A 4KOTA 1LOKA 2Z3MA 1ZLHA 5LYDA 3JUWA 2YNEA 2JLMA 4C2XA 4EVYA 3IWGA 1VGYA 4JYWA 2POKA 3CXSA 4NFRA 1R43A 3FECA 4HKFA 4BD9A 4MFLA 3BXMA 2JEVA 3DNSA 2CF4A 4KVXA 2ZELA 4G1PA 4NGQA 3DR8A 3SI1A 1TF9A 3ZZIA 4UA3A 1S7NA 2ATRA 4A32A 3PGPA 1I1DA 2PIYA 1IOFA 2GANA 3VH9A 1YQEA 2HV2A 4IF5A 1KWMA 1QMUA 4FAIA 2J8RA 3R9FA 2FS5A 2B58A 3TO6A 1CX8A 4W9YA 4PXCA 4DNCA 4QBJA 4M6HA 3PB8X 4AVCA 2F7VA 2ZW5A 4CAXA 1XMTA 3FJUA 1Y7EA 4XNHC 2OZUA 2CNTA 2EUIA 4CGMA 5LYFA 1TXRA 1ELLP 4NGPA 4M3SA 4WJBA 3BHXA 4ZBGA 4CAEA 3D2PA 5EMIA 5IV0A 4Q38A 4P6YA 1Z8TA 2C6PA 3S6HA 2QJ8A 3JRUA 3E0KA 3N7ZA 4RUHA 4ZY0A 2Z0ZA 4OC2A 1PCAA 1TF8A 2BEIA 2ZW4A 4R87A 3PP9A 4OADA 3R9EA 4A94A 2R8VA 5G20A 4AXVA 1IY7A 2WUUA 3JVNA 4OC4A 3IU2A 1LANA 3F0AA 4KZTA 1XFOA 2BO9A 4OKOA 4PXBA 3P2HA 3PB7X 4TNUA 4B14A 3KZWA 3SXOA 1S60A 3EXNA 4YGOA 2AFUA 4OC0A 1ZG8A 1VKCA 3EC4A 3C26A 3LWUA 2PR1A 1Z8LA 1ON0A 3GY9A 1PU9A 4MCQA 1FNOA 3FMCA 1QSTA 4KUBA 2EWBA 4GS4A 5AG4A 2C6CA 2V77A 3FIXA 3KHZA 1BPNA 3KR4A 1QSRA 4B5PA 3RZAA 4CYQA 2G3TA 1F2PA 3S6GA 3TE4A 4A31A 2AFZA 4B11A 4F9VA 4YRHA 2IL4A 4Y49B 5ELYA 3SXNA 4R7MA 3WC5A 2ARHA 4AB7A 1IICA 1S7LA 2PSWA 2R7HA 4KS9A 3SI0A 4H6ZA 2DXQA 3BJ8A 3R95A 2DPSA 1Q2DA 1PYTB 1VHEA 2DPTA 2GE3A 3B8GA 4KSFA 3CXPA 4ZGYB 3CPXA 1SQHA 4DUKA 2AFSA 2IMOA 2Z11A 3S9LA 4CGPA 1S5KA 4A39A 2NMTA 5HVGA 3WABA 3K2KA 1YK3A 1UWYA 2QMLA 1LCPA 3V7ZA 1XRYA 3LACA 4KVME 2JBJA 2VL1A 5JPHA 4E2AA 4UEEA 8CPAA 3G3SA 4EFDA 1TIQA 2FXFA 4H89A 2H5MA 5F47A 3T90A 5JQ4A 3T8WA 3IIBA 3SJXA 5CNPA 3PBEA 4NGTA 1XIXA 4UCPA 4KOUA 1F2OA 1QSNA 2P6FA 4MHDA 4JJXA 4FD6A 2CIJA 4MHPA 5I0CA 1ZLIA 4PSWA 4CYPA
chains in the Genus database with same CATH topology
4MBUA 2G0BA 1YVKA 2VQYA 5GCNA 4KORA 3TOBA 4JXQA 4OLLA 3A9LA 2D4OA 1NSLA 5G1ZA 3MGDA 2JDDA 4C2YA 1MJ9A 4AG7A 4UWJA 5KTDA 1M44A 2REFA 1CM0A 1I21A 1U6MA 4LUAA 1MJBA 4NEXA 1XEBA 5DWNA 3VWEA 1M4GA 2CXAA 3R1KA 2ZXVA 3DDDA 3S6FA 2B4BA 2FT0A 5G21A 1MJAA 4F0XA 3S6KA 4LX9A 4MFJA 4JWPA 1PUAA 1WK4A 2HUZA 3BJ7A 4NF1A 4R3LA 2OZHA 4A30A 1YVOA 2CNMA 2Z3PA 4MY3A 2P0WA 2EVNA 1XE4A 5G22A 3RYOA 2VEZA 4PK3A 3TCVA 5J8FA 3H5ZA 2BSWA 1MK4A 2KCWA 1Q2CA 3JTKA 4E8OA 1UFHA 4UBRA 2AJ6A 3FYNA 1YREA 5E96A 4MFKA 3I9SA 1FY7A 2Z3LA 4UCNA 2Z3KA 4MFZA 4UFXA 3WR7A 3F5BA 3W91A 1V0CA 1J4JA 2ZW6A 3GKRA 4RI1A 1B6BA 2VI7A 4B5OA 2I00A 2YNDA 3G8WA 1BO4A 4JXRA 4CGNA 5IX3A 3LD2A 4U5YA 3UY5A 3VWDA 2B3UA 4ORFA 3FRMA 3W6XA 2Q4YA 4JLYA 1M4DA 1NMTA 4KOSA 1GHEA 2J8NA 3FBUA 2C27A 3QB8A 3TO7A 1S7FA 1I12A 1Y9WA 5AG7A 1KUXA 4F0YA 3CXQA 1QSMA 4E0AA 4A95A 3F8KA 5BWAB 3LODA 3P2FA 3TTHA 5FVJA 4A2ZA 5A28A 4CS0B 1OZPA 2QIRA 4QB9A 2VXKA 2B4DB 4XPKA 2FSRA 5F46A 3K9UA 4KVOE 1YX0A 5HH1A 5J8CA 4CGLA 3PZJA 4H6UA 4NSQA 2CY2A 1VHSA 2PDOA 4X5KA 2WPWA 4QVTA 2OZGA 5KTCA 4PV6A 1L0CA 2AE6A 2HQYA 3R96A 2ZPAA 2VZZA 4UWIA 2PC1A 4B10A 4MFQA 4PK2A 4OAEA 1S3ZA 2Q7BA 2BUEA 1NE9A 4HNYB 1YR0A 2B4DA 4CAVA 4UFWA 5C88A 3NE7A 2JDCA 4MY0A 2ZW7A 5H86A 2Z10A 4KLWA 5H84A 1Q2YA 2J8MA 3GYAA 4AVBA 4CGOA 2RC4A 2YGWA 4F6AA 4K30A 4MJ8A 3FXTA 2FCKA 3D8PA 1Y9KA 1IYLA 4C2ZA 5DWMA 2Z3NA 4U9YA 4MI4A 3TO9A 4CAWA 4B12A 1KUVA 3DR6A 3TFYA 4QC6A 4XNHB 1RXTA 3TT2A 5AG6A 2OU2A 2OH1A 1KZFA 2O28A 3D2MA 4FD7A 4BBHA 2FIWA 3T9YA 4KOXA 1M4IA 2B5GA 2VBQA 5EBVA 2B5GB 1M1DA 1XF8A 3IU1A 2P6GA 3EO4A 3QAHA 3IWEA 1Z4EA 4KOVA 4KOWA 2F5IA 1IYKA 5AG5A 1P0HA 5KTAA 5ISVA 2R1IA 3V8IA 2A4NA 2QECA 4AG9A 4II9A 3OWCA 2YNCC 3EY5A 4CYOA 3IGRA 2Q0YA 3D3SA 1QSOA 4IUSA 2Y0MA 4CYNA 2PQ8A 2FIAA 2X7BA 5AGEA 1Z4RA 2Q44A 1BOBA 2Z3OA 4PSXA 5C82A 4R9MA 3TOAA 4C68A 4CRYB 3W6SA 1K4JA 3FB3A 4FD5A 4A33A 2REEA 1Z9UA 1R57A 1CJWA 4UFVA 3DSBA 1IB1E 4J3GA 4KUAA 4R57A 5IB0A 4I49A 4KLVA 4XPDB 3KKWA 4BMHA 2PR8A 5F49A 2P6EA 2OB0A 5HMNA 1S7KA 2WSAA 2WPXA 3R9GA 4RS2A 2Q04A 3ZJ0A 4L89A 3I3GA 4L8AA 4Q36A 2YNCA 4XPLA 1WWZA 3FNCA 5EC4A 3BLNA 4JD6A 1Y7RA 4C7HA 2CNSA 4YFJA 4CRZB 3EFAA 4M85A 4NXYA 2BL1A 2D4PA 1YGHA 2FE7A 2GIVA 4B5PB 1B87A 4UCMA 5A27A 4KOYA 1P4NA 3SHPA 2PRBA 2K5TA 2VZYA 4KSAA 4MFPA 1RO5A 2Q4VA 3H4QA 4C7IA 1N71A 5F48A 1IIDA 4AVAA 4NCZA 2B3VA 4CAFA 4HNWB 4Y49C 4ONUA 4R3KA 1YLEA 4B13A 4U9ZA 4QUSA 4HNXB 2G3AA 4XPDC 1LRZA 1ZO0A 2R98A 2FL4A 1KUYA 4FD4A 4KOTA 2Z3MA 3JUWA 2YNEA 2JLMA 4C2XA 4EVYA 3IWGA 3CXSA 4HKFA 4MFLA 2JEVA 3DNSA 4KVXA 3DR8A 3ZZIA 4UA3A 1S7NA 2ATRA 4A32A 3PGPA 1I1DA 2GANA 2HV2A 4IF5A 2J8RA 3R9FA 2FS5A 2B58A 3TO6A 4DNCA 4QBJA 4AVCA 4CAXA 2ZW5A 1XMTA 4XNHC 2OZUA 2CNTA 2EUIA 4CGMA 4M3SA 4ZBGA 4CAEA 3D2PA 5IV0A 4Q38A 3S6HA 3E0KA 3N7ZA 2Z0ZA 4R87A 2BEIA 2ZW4A 3R9EA 3PP9A 4OADA 2R8VA 5G20A 2WUUA 3JVNA 3IU2A 3F0AA 4KZTA 3P2HA 4B14A 3SXOA 1S60A 3EXNA 4YGOA 1VKCA 3EC4A 3C26A 2PR1A 1ON0A 3GY9A 1PU9A 1QSTA 4KUBA 4GS4A 5AG4A 3FIXA 4CYQA 1QSRA 4B5PA 2G3TA 3TE4A 3S6GA 4A31A 4B11A 4YRHA 2IL4A 4Y49B 3SXNA 2ARHA 4AB7A 1IICA 4KS9A 1S7LA 2PSWA 2R7HA 4H6ZA 2DXQA 3BJ8A 3R95A 2DPSA 1Q2DA 4KSFA 2DPTA 2GE3A 3B8GA 3CXPA 4ZGYB 1SQHA 2Z11A 4CGPA 1S5KA 2NMTA 1YK3A 2QMLA 4KVME 5JPHA 4E2AA 3G3SA 1TIQA 2FXFA 4H89A 2H5MA 5F47A 3T90A 5JQ4A 5CNPA 1XIXA 4UCPA 4KOUA 1QSNA 4MHDA 2P6FA 4JJXA 4FD6A 5I0CA 2I79A 4PSWA 4CYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBU A;  2G0B A;  1YVK A;  2VQY A;  5GCN A;  4KOR A;  3TOB A;  4JXQ A;  4OLL A;  2D4O A;  1NSL A;  3MGD A;  2JDD A;  1MJ9 A;  4AG7 A;  4UWJ A;  5KTD A;  1M44 A;  2REF A;  1CM0 A;  1I21 A;  1U6M A;  4LUA A;  1MJB A;  4NEX A;  1XEB A;  5DWN A;  3VWE A;  1M4G A;  3R1K A;  2ZXV A;  3DDD A;  3S6F A;  2B4B A;  2FT0 A;  1MJA A;  3S6K A;  4LX9 A;  4JWP A;  1PUA A;  1WK4 A;  2HUZ A;  3BJ7 A;  4NF1 A;  4R3L A;  2OZH A;  1YVO A;  2CNM A;  4MY3 A;  2P0W A;  2EVN A;  1XE4 A;  3RYO A;  2VEZ A;  4PK3 A;  3TCV A;  5J8F A;  2BSW A;  1MK4 A;  2KCW A;  1Q2C A;  4E8O A;  1UFH A;  4UBR A;  2AJ6 A;  3FYN A;  1YRE A;  5E96 A;  3I9S A;  1FY7 A;  3WR7 A;  3F5B A;  3W91 A;  1V0C A;  1J4J A;  2ZW6 A;  3GKR A;  4RI1 A;  1B6B A;  2VI7 A;  4B5O A;  2I00 A;  3G8W A;  1BO4 A;  4JXR A;  5IX3 A;  3LD2 A;  4U5Y A;  3UY5 A;  3VWD A;  2B3U A;  4ORF A;  3FRM A;  3W6X A;  2Q4Y A;  4JLY A;  1M4D A;  1NMT A;  4KOS A;  1GHE A;  2J8N A;  3FBU A;  2C27 A;  3QB8 A;  3TO7 A;  1S7F A;  1I12 A;  1Y9W A;  1KUX A;  4F0Y A;  3CXQ A;  1QSM A;  4E0A A;  3F8K A;  3LOD A;  3P2F A;  3TTH A;  5FVJ A;  4CS0 B;  1OZP A;  2QIR A;  4QB9 A;  2VXK A;  2B4D B;  4XPK A;  2FSR A;  5F46 A;  3K9U A;  4KVO E;  1YX0 A;  5HH1 A;  5J8C A;  3PZJ A;  4H6U A;  4NSQ A;  2CY2 A;  1VHS A;  2PDO A;  4X5K A;  2WPW A;  4QVT A;  2OZG A;  5KTC A;  4PV6 A;  1L0C A;  2AE6 A;  2HQY A;  3R96 A;  2ZPA A;  2VZZ A;  4UWI A;  2PC1 A;  4PK2 A;  4OAE A;  1S3Z A;  2Q7B A;  2BUE A;  1NE9 A;  4HNY B;  1YR0 A;  2B4D A;  4CAV A;  5C88 A;  3NE7 A;  2JDC A;  4MY0 A;  2ZW7 A;  5H86 A;  2Z10 A;  4KLW A;  5H84 A;  1Q2Y A;  2J8M A;  3GYA A;  4AVB A;  2RC4 A;  4F6A A;  4K30 A;  4MJ8 A;  3FXT A;  2FCK A;  3D8P A;  1Y9K A;  1IYL A;  5DWM A;  4U9Y A;  4MI4 A;  3TO9 A;  4CAW A;  1KUV A;  3DR6 A;  3TFY A;  4QC6 A;  4XNH B;  1RXT A;  3TT2 A;  2OU2 A;  2OH1 A;  1KZF A;  2O28 A;  3D2M A;  4FD7 A;  2FIW A;  3T9Y A;  4KOX A;  1M4I A;  2B5G A;  2VBQ A;  5EBV A;  2B5G B;  1M1D A;  1XF8 A;  2P6G A;  3EO4 A;  3QAH A;  1Z4E A;  4KOV A;  4KOW A;  2F5I A;  1IYK A;  1P0H A;  5KTA A;  5ISV A;  2R1I A;  3V8I A;  2A4N A;  2QEC A;  4AG9 A;  4II9 A;  3OWC A;  3EY5 A;  3IGR A;  2Q0Y A;  3D3S A;  1QSO A;  4IUS A;  2Y0M A;  2PQ8 A;  2FIA A;  2X7B A;  1Z4R A;  2Q44 A;  1BOB A;  4PSX A;  5C82 A;  4R9M A;  3TOA A;  4CRY B;  3W6S A;  1K4J A;  3FB3 A;  4FD5 A;  2REE A;  1Z9U A;  1R57 A;  1CJW A;  3DSB A;  1IB1 E;  4J3G A;  4KUA A;  4R57 A;  5IB0 A;  4I49 A;  4KLV A;  4XPD B;  3KKW A;  4BMH A;  2PR8 A;  5F49 A;  2P6E A;  2OB0 A;  5HMN A;  1S7K A;  2WPX A;  3R9G A;  4RS2 A;  2Q04 A;  3ZJ0 A;  4L89 A;  3I3G A;  4L8A A;  4XPL A;  1WWZ A;  3FNC A;  5EC4 A;  3BLN A;  4JD6 A;  1Y7R A;  2CNS A;  4YFJ A;  4CRZ B;  3EFA A;  4M85 A;  4NXY A;  2BL1 A;  2D4P A;  1YGH A;  2FE7 A;  2GIV A;  4B5P B;  1B87 A;  4KOY A;  1P4N A;  3SHP A;  2PRB A;  2K5T A;  2VZY A;  1RO5 A;  2Q4V A;  3H4Q A;  1N71 A;  5F48 A;  1IID A;  4AVA A;  4NCZ A;  2B3V A;  4HNW B;  4Y49 C;  4ONU A;  4R3K A;  1YLE A;  4U9Z A;  4QUS A;  4HNX B;  2G3A A;  4XPD C;  1LRZ A;  2R98 A;  2FL4 A;  1KUY A;  4FD4 A;  4KOT A;  3JUW A;  2JLM A;  4EVY A;  3IWG A;  3CXS A;  4HKF A;  2JEV A;  3DNS A;  4KVX A;  3DR8 A;  3ZZI A;  4UA3 A;  1S7N A;  2ATR A;  3PGP A;  1I1D A;  2GAN A;  2HV2 A;  4IF5 A;  2J8R A;  3R9F A;  2FS5 A;  2B58 A;  3TO6 A;  4DNC A;  4QBJ A;  4AVC A;  4CAX A;  2ZW5 A;  1XMT A;  4XNH C;  2OZU A;  2CNT A;  2EUI A;  4M3S A;  4ZBG A;  3D2P A;  5IV0 A;  3S6H A;  3E0K A;  3N7Z A;  2Z0Z A;  4R87 A;  2BEI A;  2ZW4 A;  3R9E A;  3PP9 A;  4OAD A;  2R8V A;  3JVN A;  3F0A A;  4KZT A;  3P2H A;  3SXO A;  1S60 A;  3EXN A;  4YGO A;  1VKC A;  3EC4 A;  3C26 A;  2PR1 A;  1ON0 A;  3GY9 A;  1PU9 A;  1QST A;  4KUB A;  4GS4 A;  3FIX A;  1QSR A;  4B5P A;  2G3T A;  3TE4 A;  3S6G A;  4YRH A;  2IL4 A;  4Y49 B;  3SXN A;  2ARH A;  4AB7 A;  1IIC A;  1S7L A;  2PSW A;  2R7H A;  4H6Z A;  2DXQ A;  3BJ8 A;  3R95 A;  1Q2D A;  2GE3 A;  3B8G A;  3CXP A;  1SQH A;  2Z11 A;  1S5K A;  2NMT A;  1YK3 A;  2QML A;  4KVM E;  5JPH A;  4E2A A;  3G3S A;  1TIQ A;  2FXF A;  4H89 A;  2H5M A;  5F47 A;  3T90 A;  5JQ4 A;  5CNP A;  1XIX A;  4KOU A;  1QSN A;  4MHD A;  2P6F A;  4JJX A;  4FD6 A;  5I0C A;  2I79 A;  4PSW A; 
#chains in the Genus database with same CATH topology
 4MBU A;  2G0B A;  1YVK A;  3DLJ A;  2PIZ A;  3D7G A;  2VQY A;  5GCN A;  1LAP A;  4KOR A;  3TOB A;  4JXQ A;  4P4B A;  4UF4 A;  3ISZ A;  4OLL A;  2IJZ A;  3A9L A;  2D4O A;  3IJ3 A;  1NSL A;  5G1Z A;  3MGD A;  2JDD A;  4C2Y A;  4X3R A;  1MJ9 A;  4IHM A;  4UWJ A;  5D8N A;  4AG7 A;  4A38 A;  2XEG A;  5K8M A;  3MN8 A;  5THW A;  5K8O A;  2AFM A;  5KTD A;  1M44 A;  2REF A;  2GFQ A;  1CM0 A;  1I21 A;  3GIU A;  3H8F A;  2C1C A;  3KL9 A;  5D29 A;  5JH9 A;  4R76 A;  4MCS A;  1U6M A;  4LUA A;  1MJB A;  4NEX A;  1EE3 P;  2PRQ A;  1XEB A;  4NJQ A;  1QQ9 A;  5DWN A;  2PJ0 A;  3VWE A;  1M4G A;  2CXA A;  3R1K A;  2ZXV A;  4YU9 A;  4GXH A;  4ZY2 A;  2ABZ A;  3DDD A;  3S6F A;  4P4D A;  3S9N A;  2B4B A;  2FT0 A;  4IAV A;  1MJA A;  4PQA A;  2PE3 A;  5G21 A;  3S6K A;  4F0X A;  3D4U A;  4LX9 A;  4MFJ A;  4JWP A;  3B3S A;  1HDU A;  1PUA A;  1WK4 A;  2HUZ A;  3BJ7 A;  4NF1 A;  2ZOF A;  4R3L A;  2OZH A;  4A30 A;  1YVO A;  4YWY A;  2CNM A;  2Z3P A;  3QNV A;  4MY3 A;  2P0W A;  2EVN A;  1XE4 A;  5G22 A;  3RYO A;  2VEZ A;  2PJ3 A;  4EME A;  1CG2 A;  4NGN A;  3B3V A;  4PK3 A;  3TCV A;  3B2Y A;  3WT4 A;  3H5Z A;  5J8F A;  2BSW A;  4UIB A;  1ELM P;  2CTB A;  3SJE A;  1MK4 A;  2BCO A;  5HVF A;  2KCW A;  1TKJ A;  1Q2C A;  3JTK A;  4E8O A;  4P4I A;  1UFH A;  2JBK A;  2PJ4 A;  3B3C A;  1HEE A;  4UBR A;  2Q43 A;  4NJR A;  1LFW A;  2AJ6 A;  3VAR A;  3CZX A;  3FYN A;  1YRE A;  5E96 A;  2GLJ A;  3D68 A;  4P4E A;  4MFK A;  2ZEH A;  4WWV A;  3I9S A;  1TKH A;  3H8G A;  1M4L A;  1FY7 A;  2Z3L A;  3D7H A;  1YW6 A;  4UCN A;  2EK8 A;  1XOV A;  4JZ0 A;  2Z3K A;  5F09 A;  4MFZ A;  4UFX A;  2PJ6 A;  5JGF A;  2WZN A;  1OBR A;  3FEE A;  3PRT A;  3KI9 A;  4A37 A;  1AUG A;  3F5B A;  3WR7 A;  2G9D A;  3W91 A;  5IB9 A;  1V0C A;  1R3N A;  1J4J A;  2ZW6 A;  3GKR A;  4RI1 A;  1B6B A;  2O4H A;  4TWE A;  2VI7 A;  1F57 A;  3GUX A;  4B5O A;  2I00 A;  3K9T A;  1JQG A;  4P44 A;  1GYT A;  1YME A;  2YND A;  2PJC A;  1CPX A;  2I79 A;  3G8W A;  2Q51 A;  5HXD A;  3CPA A;  2QYV A;  1Y0Y A;  1BO4 A;  4JXR A;  2V8H A;  4CGN A;  4MHN A;  1XBU A;  5IX3 A;  2ZEE A;  1XMB A;  3LD2 A;  4U5Y A;  3UY5 A;  3VWD A;  2B3U A;  2QVP A;  3PB9 X;  4OP4 A;  1Q7L A;  4ORF A;  4FBE A;  3FRM A;  4FUU A;  3B7I A;  5CPA A;  3W6X A;  4MXU A;  2Q4Y A;  4HPS A;  1X12 A;  3RAM A;  2GU2 A;  4JLY A;  3BI1 A;  4LQ6 A;  1M4D A;  1NMT A;  4KOS A;  2PCU A;  1YSJ A;  1GHE A;  2J8N A;  3D67 A;  3FBU A;  2C27 A;  3QB8 A;  5LRG A;  1S7F A;  1I12 A;  1Y9W A;  5AG7 A;  1KUX A;  3TO7 A;  5CBM A;  2JEW A;  4F0Y A;  3CXQ A;  1JWQ A;  1QSM A;  4E0A A;  4A95 A;  3NA6 A;  3F8K A;  5BWA B;  3B35 A;  3WC6 A;  2BOA A;  3LOD A;  3P2F A;  2PJB A;  3PEI A;  5FVJ A;  3TTH A;  4A2Z A;  1Y0R A;  5A28 A;  1CBX A;  4CS0 B;  1OZP A;  2QIR A;  4QB9 A;  2VXK A;  2B4D B;  4XPK A;  2FSR A;  3PFE A;  4DYO A;  4F9U A;  5F46 A;  3NH8 A;  4OID A;  1BAV A;  2WYR A;  3K9U A;  4UEF A;  3CDX A;  4UIA A;  4DJL A;  2XEI A;  4KVO E;  3H8E A;  5J1Q A;  1YX0 A;  1YLO A;  2PJ7 A;  5HH1 A;  4BIN A;  2HC9 A;  5J8C A;  4CGL A;  3PZJ A;  5LYL A;  4H6U A;  4NSQ A;  2CY2 A;  3V38 A;  1VHS A;  5LYI A;  4NGS A;  1ARM A;  4OC1 A;  2PDO A;  4X5K A;  1AYE A;  2AFW A;  2WPW A;  4QVT A;  2ZOG A;  3B3T A;  2OZG A;  2PJ2 A;  4PV6 A;  1A2Z A;  5KTC A;  2AFX A;  1L0C A;  4P10 A;  2NSM A;  2AE6 A;  2HQY A;  4ZX8 A;  4ZI6 A;  4OC5 A;  1DE4 C;  2C6G A;  3R96 A;  2ZEF A;  2VZZ A;  2ZPA A;  4UWI A;  2EBJ A;  3L2N A;  1YW4 A;  3FX6 A;  4EWT A;  4UEZ A;  1CP7 A;  3NH5 A;  4OC3 A;  2PC1 A;  3GB0 A;  3KQX A;  4B10 A;  2GLF A;  4NGR A;  3NE8 A;  5K8N A;  1VHO A;  4MFQ A;  3N5F A;  4PK2 A;  4OAE A;  1S3Z A;  4PXD A;  2BUE A;  2Q7B A;  2V8D A;  1NE9 A;  4HNY B;  1YR0 A;  2B4D A;  4CAV A;  4UFW A;  5C88 A;  6CPA A;  3NE7 A;  3PBB A;  1ARL A;  3IFE A;  2Q7S A;  2JDC A;  4OME A;  4MY0 A;  4ZX9 A;  2ODF A;  2ZW7 A;  5H86 A;  2Z10 A;  4KLW A;  4R6T A;  5H84 A;  1NSA A;  1Q2Y A;  2J8M A;  3GYA A;  4AVB A;  1XJO A;  4CGO A;  1Z8W A;  2RC4 A;  2YGW A;  4F6A A;  4K30 A;  4MJ8 A;  3FXT A;  2FCK A;  2OOT A;  2PJ1 A;  3D8P A;  1Y9K A;  1IYL A;  4MHY A;  4C2Z A;  5DWM A;  4Q7A A;  4M6I A;  1Z8X A;  2Z3N A;  4P4F A;  3RO0 A;  4MCR A;  4U9Y A;  5DS0 A;  2V8G A;  4MI4 A;  2HB6 A;  3HLP A;  3TO9 A;  4CAW A;  3KR5 A;  3SI2 A;  4B12 A;  1KUV A;  3DR6 A;  3TFY A;  4ZYQ A;  4QC6 A;  2RB7 A;  1X10 A;  3S9M A;  3D66 A;  2CTC A;  1RXT A;  3D7F A;  4XNH B;  5AG6 A;  2OU2 A;  3TT2 A;  2OH1 A;  3I1U A;  2PJ9 A;  1KZF A;  2O28 A;  4Z65 A;  3D2M A;  4FD7 A;  4BBH A;  2FIW A;  3B3W A;  3KGQ A;  3T9Y A;  4KOX A;  1M4I A;  2XEF A;  1VIX A;  3SJF A;  2B5G A;  3IO1 A;  4B6Z A;  2VBQ A;  1Z5R A;  5EBV A;  2XEJ A;  3IWW A;  3D7D A;  4MRI A;  2B5G B;  2F8H A;  4MMO A;  1M1D A;  1XF8 A;  2PVV A;  3IU1 A;  2P6G A;  1LAM A;  3EO4 A;  3QAH A;  3IWE A;  1CP6 A;  1Z4E A;  4KOV A;  2I3C A;  4KSI A;  4KOW A;  3FED A;  2DEA A;  3FF3 A;  4X2T A;  2F5I A;  4PPZ A;  4O23 A;  2ZEM A;  1IYK A;  5AG5 A;  1P0H A;  5KTA A;  5ISV A;  2R1I A;  3V8I A;  2A4N A;  2QEC A;  3TC8 A;  4AG9 A;  3RNZ A;  3RBU A;  4II9 A;  3OWC A;  1ZG9 A;  4ONW A;  2YNC C;  3EY5 A;  4K3N A;  4CYO A;  4OIW A;  3FH4 A;  2Q0Y A;  1AMP A;  3IGR A;  4M6G A;  3D3S A;  1QSO A;  3ISX A;  5LRJ A;  2ZEN A;  3IEH A;  4IUS A;  2Y0M A;  4CYN A;  2PQ8 A;  4R8F A;  2FIA A;  2PVW A;  2X7B A;  3FVL A;  4RN7 A;  3KHX A;  1DTD A;  5AGE A;  1Z4R A;  2Q44 A;  1BOB A;  3PFO A;  2Z3O A;  4PSX A;  3GLJ A;  5C82 A;  4R9M A;  3TOA A;  4C68 A;  4CRY B;  3W6S A;  4X8I A;  1K4J A;  3FB3 A;  1Z2L A;  4FD5 A;  4FWU A;  4A33 A;  2OR4 A;  2REE A;  1Z9U A;  2ANP A;  3KQZ A;  7CPA A;  2V8V A;  1R57 A;  2O53 A;  1CJW A;  4UFV A;  3DSB A;  1IB1 E;  4J3G A;  4KUA A;  4R57 A;  2GRE A;  3HUV A;  5IB0 A;  1FT7 A;  4I49 A;  4KLV A;  4XPD B;  2EO8 A;  3KKW A;  1H8L A;  4BMH A;  2ZEO A;  2PR8 A;  5F49 A;  2P6E A;  3CT9 A;  2OB0 A;  2ZEP A;  1TKF A;  1BLL E;  4PXE A;  4CPA A;  1S7K A;  2WSA A;  5HMN A;  5HVH A;  2WPX A;  3DGV A;  3PB4 X;  3R9G A;  5K8P A;  2PJA A;  4RS2 A;  5I4M A;  2Q04 A;  1BPM A;  3ZJ0 A;  2DF5 A;  4LQG A;  4L89 A;  3MRU A;  3I3G A;  4MHZ A;  4L8A A;  2Q4Z A;  4Q36 A;  2YNC A;  1CPS A;  2EK9 A;  4P4J A;  4XPL A;  2PJ8 A;  4GM5 A;  1WWZ A;  3FNC A;  5EC4 A;  3BLN A;  4JD6 A;  1Y7R A;  3TX8 A;  4C7H A;  3KAS A;  2CNS A;  4YFJ A;  1IGB A;  4CRZ B;  3EFA A;  4M85 A;  3QAY A;  2BL1 A;  4NXY A;  2D4P A;  1YGH A;  2FE7 A;  2GIV A;  4B5P B;  1B87 A;  4UCM A;  5A27 A;  4KOY A;  1P4N A;  3IC1 A;  4P45 A;  5LRK A;  4IK2 A;  3SHP A;  2PRB A;  2K5T A;  2VZY A;  4KSA A;  4H2K A;  4MCP A;  1RTQ A;  4MFP A;  1RO5 A;  2Q4V A;  2ZED A;  1IOI A;  3H4Q A;  4C7I A;  4ZY1 A;  1N71 A;  5F48 A;  2NYQ A;  2FVG A;  1IID A;  4AVA A;  2ZEG A;  4NCZ A;  3BI0 A;  3NH4 A;  4NGM A;  2B3V A;  4CAF A;  3VAT A;  2AFO A;  2J9A A;  4HNW B;  1ZG7 A;  4ONU A;  4Y49 C;  3LMS A;  4R3K A;  1YLE A;  2IQ6 A;  1HDQ A;  4B13 A;  3WC7 A;  3NFZ A;  4U9Z A;  4F8Z A;  3PB6 X;  4QUS A;  4HNX B;  2G3A A;  2RFH A;  4XPD C;  1LRZ A;  1ZO0 A;  2R98 A;  1IU8 A;  2FL4 A;  2PJ5 A;  1KUY A;  4FD4 A;  3SJG A;  5JM6 A;  4KOT A;  1LOK A;  2Z3M A;  1ZLH A;  5LYD A;  3JUW A;  2YNE A;  2JLM A;  4C2X A;  4EVY A;  3IWG A;  1VGY A;  4JYW A;  2POK A;  3CXS A;  4NFR A;  1R43 A;  3FEC A;  4HKF A;  4BD9 A;  4MFL A;  3BXM A;  2JEV A;  3DNS A;  2CF4 A;  4KVX A;  2ZEL A;  4G1P A;  4NGQ A;  3DR8 A;  3SI1 A;  1TF9 A;  3ZZI A;  4UA3 A;  1S7N A;  2ATR A;  4A32 A;  3PGP A;  1I1D A;  2PIY A;  1IOF A;  2GAN A;  3VH9 A;  1YQE A;  2HV2 A;  4IF5 A;  1KWM A;  1QMU A;  4FAI A;  2J8R A;  3R9F A;  2FS5 A;  2B58 A;  3TO6 A;  1CX8 A;  4W9Y A;  4PXC A;  4DNC A;  4QBJ A;  4M6H A;  3PB8 X;  4AVC A;  2F7V A;  2ZW5 A;  4CAX A;  1XMT A;  3FJU A;  1Y7E A;  4XNH C;  2OZU A;  2CNT A;  2EUI A;  4CGM A;  5LYF A;  1TXR A;  1ELL P;  4NGP A;  4M3S A;  4WJB A;  3BHX A;  4ZBG A;  4CAE A;  3D2P A;  5EMI A;  5IV0 A;  4Q38 A;  4P6Y A;  1Z8T A;  2C6P A;  3S6H A;  2QJ8 A;  3JRU A;  3E0K A;  3N7Z A;  4RUH A;  4ZY0 A;  2Z0Z A;  4OC2 A;  1PCA A;  1TF8 A;  2BEI A;  2ZW4 A;  4R87 A;  3PP9 A;  4OAD A;  3R9E A;  4A94 A;  2R8V A;  5G20 A;  4AXV A;  1IY7 A;  2WUU A;  3JVN A;  4OC4 A;  3IU2 A;  1LAN A;  3F0A A;  4KZT A;  1XFO A;  2BO9 A;  4OKO A;  4PXB A;  3P2H A;  3PB7 X;  4TNU A;  4B14 A;  3KZW A;  3SXO A;  1S60 A;  3EXN A;  4YGO A;  2AFU A;  4OC0 A;  1ZG8 A;  1VKC A;  3EC4 A;  3C26 A;  3LWU A;  2PR1 A;  1Z8L A;  1ON0 A;  3GY9 A;  1PU9 A;  4MCQ A;  1FNO A;  3FMC A;  1QST A;  4KUB A;  2EWB A;  4GS4 A;  5AG4 A;  2C6C A;  2V77 A;  3FIX A;  3KHZ A;  1BPN A;  3KR4 A;  1QSR A;  4B5P A;  3RZA A;  4CYQ A;  2G3T A;  1F2P A;  3S6G A;  3TE4 A;  4A31 A;  2AFZ A;  4B11 A;  4F9V A;  4YRH A;  2IL4 A;  4Y49 B;  5ELY A;  3SXN A;  4R7M A;  3WC5 A;  2ARH A;  4AB7 A;  1IIC A;  1S7L A;  2PSW A;  2R7H A;  4KS9 A;  3SI0 A;  4H6Z A;  2DXQ A;  3BJ8 A;  3R95 A;  2DPS A;  1Q2D A;  1PYT B;  1VHE A;  2DPT A;  2GE3 A;  3B8G A;  4KSF A;  3CXP A;  4ZGY B;  3CPX A;  1SQH A;  4DUK A;  2AFS A;  2IMO A;  2Z11 A;  3S9L A;  4CGP A;  1S5K A;  4A39 A;  2NMT A;  5HVG A;  3WAB A;  3K2K A;  1YK3 A;  1UWY A;  2QML A;  1LCP A;  3V7Z A;  1XRY A;  3LAC A;  4KVM E;  2JBJ A;  2VL1 A;  5JPH A;  4E2A A;  4UEE A;  8CPA A;  3G3S A;  4EFD A;  1TIQ A;  2FXF A;  4H89 A;  2H5M A;  5F47 A;  3T90 A;  5JQ4 A;  3T8W A;  3IIB A;  3SJX A;  5CNP A;  3PBE A;  4NGT A;  1XIX A;  4UCP A;  4KOU A;  1F2O A;  1QSN A;  2P6F A;  4MHD A;  4JJX A;  4FD6 A;  2CIJ A;  4MHP A;  5I0C A;  1ZLI A;  4PSW A;  4CYP A; 
#chains in the Genus database with same CATH homology
 4MBU A;  2G0B A;  1YVK A;  2VQY A;  5GCN A;  4KOR A;  3TOB A;  4JXQ A;  4OLL A;  3A9L A;  2D4O A;  1NSL A;  5G1Z A;  3MGD A;  2JDD A;  4C2Y A;  1MJ9 A;  4AG7 A;  4UWJ A;  5KTD A;  1M44 A;  2REF A;  1CM0 A;  1I21 A;  1U6M A;  4LUA A;  1MJB A;  4NEX A;  1XEB A;  5DWN A;  3VWE A;  1M4G A;  2CXA A;  3R1K A;  2ZXV A;  3DDD A;  3S6F A;  2B4B A;  2FT0 A;  5G21 A;  1MJA A;  4F0X A;  3S6K A;  4LX9 A;  4MFJ A;  4JWP A;  1PUA A;  1WK4 A;  2HUZ A;  3BJ7 A;  4NF1 A;  4R3L A;  2OZH A;  4A30 A;  1YVO A;  2CNM A;  2Z3P A;  4MY3 A;  2P0W A;  2EVN A;  1XE4 A;  5G22 A;  3RYO A;  2VEZ A;  4PK3 A;  3TCV A;  5J8F A;  3H5Z A;  2BSW A;  1MK4 A;  2KCW A;  1Q2C A;  3JTK A;  4E8O A;  1UFH A;  4UBR A;  2AJ6 A;  3FYN A;  1YRE A;  5E96 A;  4MFK A;  3I9S A;  1FY7 A;  2Z3L A;  4UCN A;  2Z3K A;  4MFZ A;  4UFX A;  3WR7 A;  3F5B A;  3W91 A;  1V0C A;  1J4J A;  2ZW6 A;  3GKR A;  4RI1 A;  1B6B A;  2VI7 A;  4B5O A;  2I00 A;  2YND A;  3G8W A;  1BO4 A;  4JXR A;  4CGN A;  5IX3 A;  3LD2 A;  4U5Y A;  3UY5 A;  3VWD A;  2B3U A;  4ORF A;  3FRM A;  3W6X A;  2Q4Y A;  4JLY A;  1M4D A;  1NMT A;  4KOS A;  1GHE A;  2J8N A;  3FBU A;  2C27 A;  3QB8 A;  3TO7 A;  1S7F A;  1I12 A;  1Y9W A;  5AG7 A;  1KUX A;  4F0Y A;  3CXQ A;  1QSM A;  4E0A A;  4A95 A;  3F8K A;  5BWA B;  3LOD A;  3P2F A;  3TTH A;  5FVJ A;  4A2Z A;  5A28 A;  4CS0 B;  1OZP A;  2QIR A;  4QB9 A;  2VXK A;  2B4D B;  4XPK A;  2FSR A;  5F46 A;  3K9U A;  4KVO E;  1YX0 A;  5HH1 A;  5J8C A;  4CGL A;  3PZJ A;  4H6U A;  4NSQ A;  2CY2 A;  1VHS A;  2PDO A;  4X5K A;  2WPW A;  4QVT A;  2OZG A;  5KTC A;  4PV6 A;  1L0C A;  2AE6 A;  2HQY A;  3R96 A;  2ZPA A;  2VZZ A;  4UWI A;  2PC1 A;  4B10 A;  4MFQ A;  4PK2 A;  4OAE A;  1S3Z A;  2Q7B A;  2BUE A;  1NE9 A;  4HNY B;  1YR0 A;  2B4D A;  4CAV A;  4UFW A;  5C88 A;  3NE7 A;  2JDC A;  4MY0 A;  2ZW7 A;  5H86 A;  2Z10 A;  4KLW A;  5H84 A;  1Q2Y A;  2J8M A;  3GYA A;  4AVB A;  4CGO A;  2RC4 A;  2YGW A;  4F6A A;  4K30 A;  4MJ8 A;  3FXT A;  2FCK A;  3D8P A;  1Y9K A;  1IYL A;  4C2Z A;  5DWM A;  2Z3N A;  4U9Y A;  4MI4 A;  3TO9 A;  4CAW A;  4B12 A;  1KUV A;  3DR6 A;  3TFY A;  4QC6 A;  4XNH B;  1RXT A;  3TT2 A;  5AG6 A;  2OU2 A;  2OH1 A;  1KZF A;  2O28 A;  3D2M A;  4FD7 A;  4BBH A;  2FIW A;  3T9Y A;  4KOX A;  1M4I A;  2B5G A;  2VBQ A;  5EBV A;  2B5G B;  1M1D A;  1XF8 A;  3IU1 A;  2P6G A;  3EO4 A;  3QAH A;  3IWE A;  1Z4E A;  4KOV A;  4KOW A;  2F5I A;  1IYK A;  5AG5 A;  1P0H A;  5KTA A;  5ISV A;  2R1I A;  3V8I A;  2A4N A;  2QEC A;  4AG9 A;  4II9 A;  3OWC A;  2YNC C;  3EY5 A;  4CYO A;  3IGR A;  2Q0Y A;  3D3S A;  1QSO A;  4IUS A;  2Y0M A;  4CYN A;  2PQ8 A;  2FIA A;  2X7B A;  5AGE A;  1Z4R A;  2Q44 A;  1BOB A;  2Z3O A;  4PSX A;  5C82 A;  4R9M A;  3TOA A;  4C68 A;  4CRY B;  3W6S A;  1K4J A;  3FB3 A;  4FD5 A;  4A33 A;  2REE A;  1Z9U A;  1R57 A;  1CJW A;  4UFV A;  3DSB A;  1IB1 E;  4J3G A;  4KUA A;  4R57 A;  5IB0 A;  4I49 A;  4KLV A;  4XPD B;  3KKW A;  4BMH A;  2PR8 A;  5F49 A;  2P6E A;  2OB0 A;  5HMN A;  1S7K A;  2WSA A;  2WPX A;  3R9G A;  4RS2 A;  2Q04 A;  3ZJ0 A;  4L89 A;  3I3G A;  4L8A A;  4Q36 A;  2YNC A;  4XPL A;  1WWZ A;  3FNC A;  5EC4 A;  3BLN A;  4JD6 A;  1Y7R A;  4C7H A;  2CNS A;  4YFJ A;  4CRZ B;  3EFA A;  4M85 A;  4NXY A;  2BL1 A;  2D4P A;  1YGH A;  2FE7 A;  2GIV A;  4B5P B;  1B87 A;  4UCM A;  5A27 A;  4KOY A;  1P4N A;  3SHP A;  2PRB A;  2K5T A;  2VZY A;  4KSA A;  4MFP A;  1RO5 A;  2Q4V A;  3H4Q A;  4C7I A;  1N71 A;  5F48 A;  1IID A;  4AVA A;  4NCZ A;  2B3V A;  4CAF A;  4HNW B;  4Y49 C;  4ONU A;  4R3K A;  1YLE A;  4B13 A;  4U9Z A;  4QUS A;  4HNX B;  2G3A A;  4XPD C;  1LRZ A;  1ZO0 A;  2R98 A;  2FL4 A;  1KUY A;  4FD4 A;  4KOT A;  2Z3M A;  3JUW A;  2YNE A;  2JLM A;  4C2X A;  4EVY A;  3IWG A;  3CXS A;  4HKF A;  4MFL A;  2JEV A;  3DNS A;  4KVX A;  3DR8 A;  3ZZI A;  4UA3 A;  1S7N A;  2ATR A;  4A32 A;  3PGP A;  1I1D A;  2GAN A;  2HV2 A;  4IF5 A;  2J8R A;  3R9F A;  2FS5 A;  2B58 A;  3TO6 A;  4DNC A;  4QBJ A;  4AVC A;  4CAX A;  2ZW5 A;  1XMT A;  4XNH C;  2OZU A;  2CNT A;  2EUI A;  4CGM A;  4M3S A;  4ZBG A;  4CAE A;  3D2P A;  5IV0 A;  4Q38 A;  3S6H A;  3E0K A;  3N7Z A;  2Z0Z A;  4R87 A;  2BEI A;  2ZW4 A;  3R9E A;  3PP9 A;  4OAD A;  2R8V A;  5G20 A;  2WUU A;  3JVN A;  3IU2 A;  3F0A A;  4KZT A;  3P2H A;  4B14 A;  3SXO A;  1S60 A;  3EXN A;  4YGO A;  1VKC A;  3EC4 A;  3C26 A;  2PR1 A;  1ON0 A;  3GY9 A;  1PU9 A;  1QST A;  4KUB A;  4GS4 A;  5AG4 A;  3FIX A;  4CYQ A;  1QSR A;  4B5P A;  2G3T A;  3TE4 A;  3S6G A;  4A31 A;  4B11 A;  4YRH A;  2IL4 A;  4Y49 B;  3SXN A;  2ARH A;  4AB7 A;  1IIC A;  4KS9 A;  1S7L A;  2PSW A;  2R7H A;  4H6Z A;  2DXQ A;  3BJ8 A;  3R95 A;  2DPS A;  1Q2D A;  4KSF A;  2DPT A;  2GE3 A;  3B8G A;  3CXP A;  4ZGY B;  1SQH A;  2Z11 A;  4CGP A;  1S5K A;  2NMT A;  1YK3 A;  2QML A;  4KVM E;  5JPH A;  4E2A A;  3G3S A;  1TIQ A;  2FXF A;  4H89 A;  2H5M A;  5F47 A;  3T90 A;  5JQ4 A;  5CNP A;  1XIX A;  4UCP A;  4KOU A;  1QSN A;  4MHD A;  2P6F A;  4JJX A;  4FD6 A;  5I0C A;  2I79 A;  4PSW A;  4CYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...