1VHSA

Crystal structure of a putative phosphinothricin n-acetyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
165
structure length
165
Chain Sequence
SLTLRLAEHRDLEAVVAIYNSTIASRMVTADTEPVTPEDRMEWFSGHTESRPLYVAEDENGNVAAWISFETFYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLMAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEMDGKRYDLKILGRELSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords similar to phosphinothricin acetyltransferase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 41
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.3.1.183: Phosphinothricin acetyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1vhsA00
2Q7BA 3LD2A 1S7KA 2ZW6A 4KLWA 1GHEA 1QSMA 3BLNA 1S7FA 4HNYB 2QIRA 2PR8A 3CXPA 1YVKA 1MJBA 4CAXA 2Z11A 2PR1A 2A4NA 4LX9A 4B5PA 4Y49B 4AVBA 2VEZA 2RC4A 2PDOA 1J4JA 3VWEA 1Z4EA 2KCWA 1XMTA 2Q4YA 4NCZA 1XEBA 1P4NA 1MJ9A 4PV6A 2ZW4A 2X7BA 2QECA 1S5KA 1YX0A 2REFA 3SHPA 4QBJA 5ISVA 4E8OA 4KVOE 3TFYA 3W91A 1VKCA 4FD5A 1M1DA 2O28A 1RXTA 3PP9A 2PQ8A 5J8CA 4CRYB 3SXNA 2K5TA 4JLYA 4QC6A 3W6XA 2GE3A 2VI7A 1KUVA 1QSOA 1S7LA 2DXQA 2JDDA 2R1IA 3R1KA 4M3SA 4XNHC 4PSXA 3CXQA 4MY3A 4XPDB 3T9YA 1YREA 1MK4A 1Q2DA 3F0AA 1Q2CA 5HH1A 4K30A 2OZGA 2HQYA 3W6SA 1OZPA 1YK3A 2FXFA 3BJ7A 2FT0A 3R96A 1KUYA 2JDCA 4H89A 4YGOA 4E0AA 4Y49C 1KUXA 2WPWA 4NSQA 2REEA 4JJXA 4R3KA 5C82A 4JXQA 3D8PA 4KLVA 2ZXVA 4ONUA 3V8IA 3CXSA 3GKRA 1L0CA 2B3VA 3ZZIA 4B5OA 1U6MA 3D2MA 5I0CA 1RO5A 2VXKA 2ZW7A 3FIXA 5GCNA 4KZTA 4CS0B 1B87A 1P0HA 2AJ6A 2GANA 4NF1A 3ZJ0A 2B4DB 2G3AA 1CM0A 4IF5A 2NMTA 4NXYA 3QB8A 2VZZA 2Q44A 2EVNA 4AG9A 4KOSA 1Q2YA 4F0YA 3I3GA 3GY9A 2FL4A 1S7NA 1S60A 1B6BA 1WK4A 2Q4VA 2VQYA 4NEXA 4UWJA 3IWGA 5H84A 5IV0A 2OZHA 3TTHA 2B4BA 4R57A 3F8KA 3S6GA 1NSLA 2CY2A 4KOTA 4MHDA 4U9ZA 1Z4RA 4DNCA 1XF8A 1I21A 2VZYA 3KKWA 1VHSA 3TOBA 1IYKA 4BMHA 4H6ZA 1IICA 2FS5A 2PC1A 2ZW5A 3S6FA 1R57A 4PSWA 4F6AA 1YGHA 2P0WA 2D4OA 2B4DA 3C26A 2ARHA 1V0CA 2GIVA 3DDDA 3EY5A 4R3LA 2CNMA 2B3UA 1IIDA 4ORFA 2R98A 4CAWA 2FE7A 4MBUA 1S3ZA 4KOVA 2G3TA 2J8RA 1MJAA 5F46A 3D2PA 3EFAA 3P2HA 4U9YA 4FD4A 5HMNA 2OU2A 1PU9A 1K4JA 4LUAA 1NMTA 3FNCA 4R87A 4FD6A 3E0KA 3P2FA 4JXRA 1WWZA 2CNTA 2P6FA 2J8MA 3N7ZA 4QB9A 3TO9A 1UFHA 2Z10A 1Y9KA 3EXNA 4AG7A 3JUWA 3H4QA 1BOBA 1M4GA 2PRBA 4M85A 3QAHA 5IX3A 1XIXA 1N71A 2D4PA 2F5IA 4ZBGA 4KVXA 2J8NA 4KUAA 4HNXB 5KTCA 4X5KA 4OADA 4AVCA 2FSRA 3MGDA 5KTAA 3K9UA 4KOWA 2QMLA 2Y0MA 1QSNA 3EO4A 3TOAA 4YFJA 1BO4A 4KOXA 2FIAA 2C27A 3R95A 2Z0ZA 4IUSA 3D3SA 3I9SA 1I1DA 3FXTA 3RYOA 5F47A 1SQHA 3WR7A 4OLLA 1PUAA 1QSTA 2PSWA 1IYLA 5F48A 5H86A 3IGRA 2H5MA 2R7HA 2WPXA 3DNSA 4XNHB 2BEIA 3G8WA 2IL4A 3NE7A 2OZUA 2P6EA 4U5YA 4KORA 4YRHA 4XPDC 4L8AA 2BSWA 3LODA 2ATRA 4XPLA 1M4IA 4AVAA 2OH1A 4GS4A 4H6UA 4HKFA 2P6GA 4MJ8A 2B58A 1ON0A 4OAEA 2HUZA 1I12A 5DWMA 4XPKA 3SXOA 5JQ4A 4J3GA 2JLMA 1Y9WA 2EUIA 3UY5A 2CNSA 4EVYA 4CAVA 2JEVA 4JD6A 2Q04A 5KTDA 4RS2A 5F49A 2VBQA 4KOUA 4L89A 5CNPA 4KUBA 2BUEA 1YLEA 3BJ8A 1LRZA 2B5GB 4PK2A 5J8FA 3G3SA 2AE6A 5E96A 1IB1E 4MI4A 5EBVA 3R9FA 4R9MA 1YR0A 3FYNA 2I00A 3S6HA 3OWCA 2Q0YA 5FVJA 3S6KA 3TO7A 4CRZB 5IB0A 2ZPAA 5DWNA 4QVTA 2BL1A 4UWIA 5C88A 2HV2A 1TIQA 4KVME 4QUSA 3EC4A 1M4DA 5EC4A 3TE4A 4JWPA 4FD7A 4KOYA 3B8GA 4MY0A 3R9EA 3DR6A 3VWDA 2OB0A 3TCVA 4HNWB 1Z9UA 3DR8A 3TT2A 4E2AA 4B5PB 1NE9A 3FB3A 3JVNA 3TO6A 4PK3A 5JPHA 3F5BA 1M44A 3FBUA 1KZFA 2G0BA 2B5GA 2I79A 3PGPA 2R8VA 4I49A 3GYAA 1QSRA 4II9A 3PZJA 3R9GA 3FRMA 1FY7A 3DSBA 3T90A 2FIWA 4UA3A 1YVOA 1Y7RA 1CJWA 1XE4A 4RI1A 4AB7A 2FCKA 4UBRA
chains in the Genus database with same CATH superfamily
2Q7BA 3D67A 3LD2A 4C7HA 1H8LA 2EO8A 3T8WA 1LAMA 2ZEFA 4LQ6A 1S7KA 2ZW6A 4KLWA 4DUKA 4X3RA 2XEGA 1X12A 5JGFA 1GHEA 5LRGA 7CPAA 1QSMA 3CPXA 3BLNA 1S7FA 4HNYB 2QIRA 4ZY1A 2PR8A 1TKJA 5A27A 3CXPA 3PB4X 3IEHA 5G22A 4BBHA 2CF4A 1YVKA 1MJBA 1PCAA 4ZX8A 1X10A 4ZY0A 5AG6A 4CAXA 3FF3A 1ZG8A 2Z11A 2PR1A 2A4NA 1LCPA 4LX9A 4B5PA 4Q7AA 1Z8XA 4TNUA 4Y49B 1Y7EA 3B3WA 4MHPA 4AVBA 1Z2LA 2AFUA 3HUVA 2VEZA 2RC4A 3IWWA 2PDOA 1J4JA 2JBKA 3VWEA 1JWQA 1Z4EA 1CP7A 4EFDA 2KCWA 3PEIA 2ZEMA 3BI1A 5IB9A 1XMTA 2Q4YA 4O23A 4NCZA 1XEBA 1P4NA 2EK9A 4A94A 5A28A 1MJ9A 2IMOA 4PV6A 4ZYQA 2ZW4A 4NGTA 1CX8A 1KWMA 2IQ6A 2Z3NA 4W9YA 2X7BA 2NYQA 1S5KA 2QECA 1YX0A 2REFA 3SHPA 4QBJA 5ISVA 4E8OA 3K9TA 4KVOE 3TFYA 3W91A 2DPSA 1VKCA 2EWBA 4NGMA 5D8NA 4BINA 3S9LA 3FEDA 4OC0A 3N5FA 4A37A 4FD5A 3SJXA 2ZEPA 2I3CA 1M1DA 2O28A 3NA6A 4Q38A 1ZLIA 3IFEA 3JTKA 1RXTA 3PBBA 4UFVA 4F9UA 4JYWA 3PP9A 4NJQA 4ZX9A 2PQ8A 1Z8WA 2OR4A 5J8CA 4CRYB 4G1PA 3SXNA 3RNZA 2K5TA 4F8ZA 4CYNA 3LMSA 4JLYA 4QC6A 3W6XA 2GE3A 2VI7A 1KUVA 1QSOA 1S7LA 2DXQA 2JDDA 2R1IA 1Q7LA 3KQXA 2ODFA 3QNVA 1IY7A 3R1KA 4M3SA 4PSXA 4XNHC 4NGSA 3CXQA 4IK2A 3FX6A 4KSFA 4MY3A 4XPDB 3T9YA 1YREA 1AMPA 4OIWA 2V8DA 4C68A 4B13A 4X2TA 2ZELA 3CZXA 3D68A 1MK4A 1YW4A 2VL1A 1Q2DA 3F0AA 1XRYA 3SJGA 3S9NA 4CGPA 1Q2CA 4IAVA 4K30A 5HH1A 2DF5A 1BAVA 2OZGA 3NH4A 3SJFA 4MRIA 2HQYA 2WSAA 4X8IA 3W6SA 1OZPA 4RN7A 1YK3A 2FXFA 3BJ7A 2FT0A 3R96A 3B7IA 4EWTA 3B2YA 1TF9A 1RTQA 2IJZA 4TWEA 3NE8A 1KUYA 2JDCA 4H89A 4YGOA 3VATA 4E0AA 4KSAA 4Y49C 3SI2A 1KUXA 2PJ6A 2WPWA 2YGWA 4MHYA 3KI9A 3H8GA 2REEA 4NSQA 5LYIA 4JJXA 2ZEEA 4R3KA 5C82A 4JXQA 1M4LA 3D8PA 4KLVA 2ZXVA 3SJEA 4CGOA 5K8PA 1VGYA 4ONUA 3V8IA 4P4BA 3CXSA 5LRKA 3WC7A 1HDQA 1L0CA 3GKRA 2B3VA 3ZZIA 3H8FA 4B5OA 1U6MA 3D2MA 4UCMA 4UFWA 3FJUA 2Z3LA 3LACA 2PVVA 2V8HA 5I0CA 1RO5A 2VXKA 3KHZA 2PJAA 2ZW7A 3FIXA 3DLJA 1XFOA 4Q36A 1XOVA 2ANPA 4AXVA 3D7HA 5GCNA 4WWVA 1JQGA 4P4DA 4P4IA 1Y0YA 4KZTA 1LANA 4CS0B 3PB8X 2F8HA 1B87A 4F0XA 5AG5A 2V8VA 4A31A 4C7IA 2ZENA 1P0HA 2AJ6A 2GANA 2PVWA 3NFZA 4NF1A 3ZJ0A 2B4DB 2AFSA 2G3AA 1CM0A 4IF5A 2NMTA 4NXYA 3QB8A 2GLJA 5JM6A 5F09A 2VZZA 2Q44A 1AYEA 5J1QA 4YU9A 2XEJA 3KR5A 2EVNA 3D66A 2O4HA 4AG9A 5EMIA 4KOSA 1Q2YA 4F0YA 3I3GA 3HLPA 4MMOA 2C1CA 4PXDA 3GY9A 2Q4ZA 5CPAA 4A95A 4MXUA 2FL4A 4KS9A 1S7NA 1S60A 3IWEA 1B6BA 1WK4A 4OKOA 2Q4VA 2VQYA 4CGMA 2RFHA 3RBUA 4NEXA 5D29A 1LOKA 2PJ5A 4UWJA 3IWGA 4CGLA 3MRUA 3PFEA 2Q51A 3QAYA 5H84A 3RAMA 2FVGA 1YMEA 5IV0A 4FAIA 2PIZA 1AUGA 2OZHA 5HVFA 3TTHA 2B4BA 4MCQA 4UCNA 1XBUA 4R57A 5LYLA 1ARMA 3F8KA 2ZEGA 3S6GA 1NSLA 2CY2A 2QVPA 4KOTA 4MHDA 4U9ZA 3KR4A 1Z4RA 5JH9A 2Z3OA 2PRQA 1IOFA 4B14A 2XEFA 3I1UA 4DNCA 1Y0RA 1XF8A 1I21A 4UIBA 4P4EA 5AG4A 4PXBA 4GM5A 2PE3A 3D4UA 2NSMA 1F57A 3CPAA 5G20A 3D7DA 3JRUA 4PXCA 4JZ0A 5ELYA 2VZYA 3KKWA 1FNOA 4M6GA 1VHSA 3TOBA 1IYKA 4BMHA 2PJ7A 4P45A 4UFXA 2BO9A 4F9VA 4H6ZA 1IICA 2FS5A 5LRJA 2PC1A 5HVGA 1ELMP 2ZW5A 3S6FA 1R57A 3BXMA 4A30A 1YQEA 2JBJA 4PSWA 4F6AA 1YGHA 2P0WA 3FECA 3PRTA 2D4OA 1CP6A 2B4DA 3C26A 2ARHA 1V0CA 3PB6X 4MFJA 2GIVA 3MN8A 2AFOA 1BLLE 1OBRA 3DDDA 3EY5A 2J9AA 2C6CA 4R3LA 2CNMA 2B3UA 3B3SA 1IIDA 4BD9A 1IGBA 2R98A 4ORFA 4ZY2A 4CAWA 2FE7A 3IC1A 1S3ZA 1ZG9A 4MBUA 4CYQA 4KOVA 2G3TA 2J8RA 1MJAA 2PCUA 2PJ2A 5F46A 5K8NA 2WYRA 3IJ3A 4B10A 3D2PA 3GLJA 4FUUA 4OIDA 2PIYA 2EK8A 3EFAA 4CAFA 3P2HA 4M6IA 4U9YA 3DGVA 4FD4A 4CPAA 2ABZA 2CIJA 2OU2A 5HMNA 3KASA 5DS0A 1PU9A 1K4JA 3IO1A 2YNCA 4LUAA 2ZEHA 1NMTA 3FNCA 4PPZA 5THWA 3BHXA 4R87A 2QJ8A 4FD6A 2WUUA 3E0KA 3P2FA 4MCSA 4JXRA 1WWZA 2CNTA 2DEAA 2P6FA 2J8MA 3N7ZA 4QB9A 2PJ1A 3TO9A 1UFHA 4M6HA 2Z10A 1TKFA 1Y9KA 1VIXA 2YNEA 3EXNA 4KSIA 4AG7A 4DYOA 3JUWA 3H4QA 4HPSA 3WC5A 3WABA 3SI1A 1BOBA 1M4GA 2PRBA 4M85A 3QAHA 5IX3A 1XIXA 1N71A 4PQAA 4MHNA 1ARLA 2D4PA 1ELLP 2F5IA 3PB9X 3ISZA 5AG7A 3H8EA 4ZBGA 1YW6A 4KVXA 3WC6A 2J8NA 4KUAA 4HNXB 5KTCA 4X5KA 5LYFA 2PJCA 4IHMA 4OADA 2PJ9A 4UIAA 4AVCA 2FSRA 3MGDA 1UWYA 3K9UA 4KOWA 4OC2A 2QMLA 5KTAA 2PJ8A 2Y0MA 1QSNA 5K8MA 3EO4A 3TOAA 4YFJA 1BO4A 4KOXA 2AFZA 2FIAA 2C27A 3R95A 1Z5RA 4NGNA 4P44A 2Z0ZA 4IUSA 4P10A 3D3SA 3I9SA 3VARA 1CPXA 1I1DA 3FXTA 2CTBA 3GB0A 3PB7X 4UEFA 1VHOA 3RYOA 5G21A 5F47A 3TC8A 1SQHA 2ZEDA 3WR7A 4OLLA 1BPMA 1PUAA 1R3NA 5BWAB 1QSTA 2PSWA 3ISXA 4R7MA 1IYLA 5F48A 1Z8LA 1LFWA 5H86A 2XEIA 6CPAA 3IGRA 3SI0A 2H5MA 3FVLA 2R7HA 2WPXA 1TXRA 4MHZA 4MFKA 3DNSA 4MCPA 2BEIA 3G8WA 3B3CA 4LQGA 4XNHB 4UCPA 2IL4A 3NE7A 2OZUA 2P6EA 2DPTA 3BI0A 3K2KA 4KORA 4U5YA 3VH9A 4B11A 1F2OA 2AFWA 2V77A 3CDXA 4MCRA 4YRHA 2PJBA 2Q43A 3KL9A 4XPDC 3TX8A 3KZWA 2BOAA 2C6PA 4L8AA 1XJOA 2BSWA 4NGRA 3LODA 1R43A 5I4MA 1CG2A 2ATRA 3B3TA 2POKA 4XPLA 1M4IA 4OC5A 4P4JA 4A38A 1ZO0A 2YNDA 4OC3A 4AVAA 2CXAA 2OH1A 4GS4A 2O53A 4H6UA 4HKFA 3FEEA 2P6GA 4MJ8A 2F7VA 2OOTA 3NH8A 3S9MA 2B58A 2C6GA 2Q7SA 4P4FA 1F2PA 1ON0A 4OAEA 1YSJA 4A39A 3B35A 2Z3MA 1LAPA 2HUZA 1I12A 5DWMA 4XPKA 1QQ9A 3SXOA 3WT4A 5JQ4A 4J3GA 4RUHA 4FBEA 2JLMA 1Y9WA 5G1ZA 3IIBA 2EUIA 4P6YA 4ZI6A 8CPAA 5LYDA 1EE3P 2HC9A 3UY5A 4A32A 4EMEA 2CNSA 4EVYA 4CAVA 2JEVA 4JD6A 4Z65A 2Q04A 5KTDA 4UF4A 4RS2A 4CGNA 5F49A 2BCOA 2VBQA 3KGQA 4KOUA 4L89A 5CNPA 4KUBA 1ZG7A 2Z3PA 2BUEA 1YLEA 3BJ8A 4NFRA 4NJRA 1LRZA 2B5GB 4PK2A 4R6TA 3D7FA 4R76A 5CBMA 5J8FA 3G3SA 3IU1A 1VHEA 4UEZA 4DJLA 1CPSA 2AE6A 3GIUA 4C2XA 5E96A 1IU8A 1IB1E 1QMUA 4MI4A 4NGPA 5EBVA 3R9FA 4R9MA 1YR0A 3FYNA 2AFMA 3KHXA 3V7ZA 2I00A 3S6HA 3OWCA 2Q0YA 5FVJA 3L2NA 4B12A 4YWYA 2AFXA 4K3NA 3S6KA 4C2ZA 1TF8A 3TO7A 4CRZB 5IB0A 2PJ4A 4PXEA 2ZPAA 1YLOA 3IU2A 5DWNA 4QVTA 2BL1A 2HB6A 4UWIA 4OC4A 5C88A 1Z8TA 4ZGYB 1DTDA 1A2ZA 2HV2A 2PJ3A 1TIQA 2GU2A 3CT9A 4FWUA 4KVME 5AGEA 3NH5A 2Z3KA 4QUSA 3EC4A 4OP4A 3RZAA 4B6ZA 1M4DA 4NGQA 5EC4A 3FH4A 4WJBA 3TE4A 2QYVA 4JWPA 4FD7A 4KOYA 4CYPA 1FT7A 3B8GA 1DE4C 1PYTB 4MY0A 4CAEA 3R9EA 2YNCC 2G9DA 2GFQA 3DR6A 3VWDA 2GLFA 2OB0A 3TCVA 4HNWB 2PJ0A 1Z9UA 3DR8A 3TT2A 1XMBA 2JEWA 4GXHA 4E2AA 4B5PB 4A2ZA 2ZEOA 1NE9A 4UEEA 5K8OA 1NSAA 3FB3A 3FMCA 5HXDA 1GYTA 4OMEA 3JVNA 3TO6A 3KQZA 4PK3A 3D7GA 5JPHA 5HVHA 4OC1A 4H2KA 3F5BA 3PFOA 3GUXA 4ONWA 4A33A 1M44A 4R8FA 3FBUA 1CBXA 2RB7A 2CTCA 3V38A 3H5ZA 3RO0A 1KZFA 2G0BA 2B5GA 2GREA 1ZLHA 2WZNA 2I79A 4MFZA 3PGPA 2EBJA 2R8VA 4I49A 4CYOA 1HDUA 3GYAA 3PBEA 1BPNA 1QSRA 4II9A 3PZJA 3LWUA 3R9GA 3FRMA 1FY7A 3DSBA 1IOIA 3T90A 2FIWA 4UA3A 2V8GA 2ZOGA 1YVOA 1Y7RA 1HEEA 4MFPA 1CJWA 3B3VA 1XE4A 3A9LA 4MFQA 4RI1A 2ZOFA 1TKHA 2FCKA 4UBRA 4AB7A 4MFLA 4C2YA
chains in the Genus database with same CATH topology
2Q7BA 3LD2A 4C7HA 1S7KA 2ZW6A 4KLWA 1GHEA 1QSMA 3BLNA 1S7FA 4HNYB 2QIRA 2PR8A 5A27A 3CXPA 5G22A 4BBHA 1YVKA 1MJBA 5AG6A 4CAXA 2Z11A 2PR1A 2A4NA 4LX9A 4B5PA 4Y49B 4AVBA 2VEZA 2RC4A 2PDOA 1J4JA 3VWEA 1Z4EA 2KCWA 1XMTA 2Q4YA 4NCZA 1XEBA 1P4NA 5A28A 1MJ9A 4PV6A 2ZW4A 2Z3NA 2X7BA 2QECA 1S5KA 1YX0A 2REFA 3SHPA 4QBJA 5ISVA 4E8OA 4KVOE 3TFYA 3W91A 2DPSA 1VKCA 4FD5A 4Q38A 1M1DA 2O28A 3JTKA 1RXTA 4UFVA 3PP9A 2PQ8A 5J8CA 4CRYB 3SXNA 2K5TA 4CYNA 4JLYA 4QC6A 3W6XA 2GE3A 2VI7A 1KUVA 1QSOA 1S7LA 2DXQA 2JDDA 2R1IA 3R1KA 4M3SA 4XNHC 4PSXA 3CXQA 4KSFA 4MY3A 4XPDB 3T9YA 1YREA 4C68A 4B13A 1MK4A 1Q2DA 3F0AA 4CGPA 1Q2CA 5HH1A 4K30A 2OZGA 2HQYA 2WSAA 3W6SA 1OZPA 1YK3A 2FXFA 3BJ7A 2FT0A 3R96A 1KUYA 2JDCA 4H89A 4YGOA 4E0AA 4KSAA 4Y49C 1KUXA 2WPWA 2YGWA 4NSQA 2REEA 4JJXA 4R3KA 5C82A 4JXQA 3D8PA 4KLVA 2ZXVA 4CGOA 4ONUA 3V8IA 3CXSA 3GKRA 1L0CA 2B3VA 3ZZIA 4B5OA 1U6MA 3D2MA 4UCMA 4UFWA 2Z3LA 5I0CA 1RO5A 2VXKA 2ZW7A 3FIXA 4Q36A 5GCNA 4KZTA 4CS0B 1B87A 4F0XA 5AG5A 4A31A 4C7IA 1P0HA 2AJ6A 2GANA 4NF1A 3ZJ0A 2B4DB 2G3AA 1CM0A 4IF5A 2NMTA 4NXYA 3QB8A 2VZZA 2Q44A 2EVNA 4AG9A 4KOSA 1Q2YA 4F0YA 3I3GA 3GY9A 4A95A 2FL4A 4KS9A 1S7NA 1S60A 3IWEA 1B6BA 1WK4A 2Q4VA 2VQYA 4CGMA 4NEXA 4UWJA 3IWGA 4CGLA 5H84A 5IV0A 2OZHA 3TTHA 2B4BA 4UCNA 4R57A 3F8KA 3S6GA 1NSLA 2CY2A 4KOTA 4MHDA 4U9ZA 1Z4RA 2Z3OA 4B14A 4DNCA 1XF8A 1I21A 5AG4A 5G20A 2VZYA 3KKWA 1VHSA 3TOBA 1IYKA 4BMHA 4UFXA 4H6ZA 1IICA 2FS5A 2PC1A 2ZW5A 3S6FA 1R57A 4A30A 4PSWA 4F6AA 1YGHA 2P0WA 2D4OA 2B4DA 3C26A 2ARHA 1V0CA 4MFJA 2GIVA 3DDDA 3EY5A 4R3LA 2CNMA 2B3UA 1IIDA 4ORFA 2R98A 4CAWA 2FE7A 4MBUA 1S3ZA 4CYQA 4KOVA 2G3TA 2J8RA 1MJAA 5F46A 4B10A 3D2PA 3EFAA 4CAFA 3P2HA 4U9YA 4FD4A 5HMNA 2OU2A 1PU9A 1K4JA 2YNCA 4LUAA 1NMTA 3FNCA 4R87A 4FD6A 2WUUA 3E0KA 3P2FA 4JXRA 1WWZA 2CNTA 2P6FA 3N7ZA 2J8MA 4QB9A 3TO9A 1UFHA 2Z10A 1Y9KA 2YNEA 3EXNA 4AG7A 3JUWA 3H4QA 1BOBA 1M4GA 2PRBA 4M85A 3QAHA 5IX3A 1XIXA 1N71A 2D4PA 2F5IA 5AG7A 4ZBGA 4KVXA 2J8NA 4KUAA 4HNXB 5KTCA 4X5KA 4OADA 4AVCA 2FSRA 3MGDA 5KTAA 3K9UA 4KOWA 2QMLA 2Y0MA 1QSNA 3EO4A 3TOAA 4YFJA 1BO4A 4KOXA 2FIAA 2C27A 3R95A 2Z0ZA 4IUSA 3D3SA 3I9SA 1I1DA 3FXTA 3RYOA 5G21A 5F47A 1SQHA 3WR7A 4OLLA 1PUAA 5BWAB 1QSTA 2PSWA 1IYLA 5F48A 5H86A 3IGRA 2H5MA 2R7HA 2WPXA 4MFKA 3DNSA 4XNHB 2BEIA 3G8WA 4UCPA 2IL4A 3NE7A 2OZUA 2P6EA 2DPTA 4U5YA 4KORA 4B11A 4YRHA 4XPDC 4L8AA 2BSWA 3LODA 2ATRA 4XPLA 1M4IA 1ZO0A 2YNDA 4AVAA 2CXAA 2OH1A 4GS4A 4H6UA 4HKFA 2P6GA 4MJ8A 2B58A 1ON0A 4OAEA 2Z3MA 2HUZA 1I12A 5DWMA 4XPKA 3SXOA 5JQ4A 4J3GA 2JLMA 1Y9WA 5G1ZA 2EUIA 3UY5A 4A32A 2CNSA 4EVYA 4CAVA 2JEVA 4JD6A 2Q04A 5KTDA 4CGNA 4RS2A 5F49A 2VBQA 4KOUA 4L89A 5CNPA 4KUBA 2Z3PA 2BUEA 1YLEA 3BJ8A 1LRZA 2B5GB 4PK2A 5J8FA 3G3SA 3IU1A 2AE6A 4C2XA 5E96A 1IB1E 4MI4A 5EBVA 3R9FA 4R9MA 1YR0A 3FYNA 2I00A 3S6HA 3OWCA 2Q0YA 5FVJA 4B12A 4C2ZA 3S6KA 3TO7A 4CRZB 5IB0A 2ZPAA 3IU2A 5DWNA 4QVTA 2BL1A 4UWIA 5C88A 4ZGYB 2HV2A 1TIQA 4KVME 5AGEA 2Z3KA 4QUSA 3EC4A 1M4DA 5EC4A 3TE4A 4JWPA 4FD7A 4KOYA 4CYPA 3B8GA 4MY0A 4CAEA 3R9EA 2YNCC 3DR6A 3VWDA 2OB0A 3TCVA 4HNWB 1Z9UA 3DR8A 3TT2A 4E2AA 4B5PB 4A2ZA 1NE9A 3FB3A 3JVNA 3TO6A 4PK3A 5JPHA 3F5BA 4A33A 1M44A 3FBUA 3H5ZA 1KZFA 2G0BA 2B5GA 2I79A 4MFZA 3PGPA 2R8VA 4I49A 4CYOA 3GYAA 1QSRA 4II9A 3PZJA 3R9GA 3FRMA 1FY7A 3DSBA 3T90A 2FIWA 4UA3A 1YVOA 1Y7RA 4MFPA 1CJWA 1XE4A 3A9LA 4MFQA 4RI1A 4AB7A 2FCKA 4UBRA 4MFLA 4C2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7B A;  3LD2 A;  1S7K A;  2ZW6 A;  4KLW A;  1GHE A;  1QSM A;  3BLN A;  1S7F A;  4HNY B;  2QIR A;  2PR8 A;  3CXP A;  1YVK A;  1MJB A;  4CAX A;  2Z11 A;  2PR1 A;  2A4N A;  4LX9 A;  4B5P A;  4Y49 B;  4AVB A;  2VEZ A;  2RC4 A;  2PDO A;  1J4J A;  3VWE A;  1Z4E A;  2KCW A;  1XMT A;  2Q4Y A;  4NCZ A;  1XEB A;  1P4N A;  1MJ9 A;  4PV6 A;  2ZW4 A;  2X7B A;  2QEC A;  1S5K A;  1YX0 A;  2REF A;  3SHP A;  4QBJ A;  5ISV A;  4E8O A;  4KVO E;  3TFY A;  3W91 A;  1VKC A;  4FD5 A;  1M1D A;  2O28 A;  1RXT A;  3PP9 A;  2PQ8 A;  5J8C A;  4CRY B;  3SXN A;  2K5T A;  4JLY A;  4QC6 A;  3W6X A;  2GE3 A;  2VI7 A;  1KUV A;  1QSO A;  1S7L A;  2DXQ A;  2JDD A;  2R1I A;  3R1K A;  4M3S A;  4XNH C;  4PSX A;  3CXQ A;  4MY3 A;  4XPD B;  3T9Y A;  1YRE A;  1MK4 A;  1Q2D A;  3F0A A;  1Q2C A;  5HH1 A;  4K30 A;  2OZG A;  2HQY A;  3W6S A;  1OZP A;  1YK3 A;  2FXF A;  3BJ7 A;  2FT0 A;  3R96 A;  1KUY A;  2JDC A;  4H89 A;  4YGO A;  4E0A A;  4Y49 C;  1KUX A;  2WPW A;  4NSQ A;  2REE A;  4JJX A;  4R3K A;  5C82 A;  4JXQ A;  3D8P A;  4KLV A;  2ZXV A;  4ONU A;  3V8I A;  3CXS A;  3GKR A;  1L0C A;  2B3V A;  3ZZI A;  4B5O A;  1U6M A;  3D2M A;  5I0C A;  1RO5 A;  2VXK A;  2ZW7 A;  3FIX A;  5GCN A;  4KZT A;  4CS0 B;  1B87 A;  1P0H A;  2AJ6 A;  2GAN A;  4NF1 A;  3ZJ0 A;  2B4D B;  2G3A A;  1CM0 A;  4IF5 A;  2NMT A;  4NXY A;  3QB8 A;  2VZZ A;  2Q44 A;  2EVN A;  4AG9 A;  4KOS A;  1Q2Y A;  4F0Y A;  3I3G A;  3GY9 A;  2FL4 A;  1S7N A;  1S60 A;  1B6B A;  1WK4 A;  2Q4V A;  2VQY A;  4NEX A;  4UWJ A;  3IWG A;  5H84 A;  5IV0 A;  2OZH A;  3TTH A;  2B4B A;  4R57 A;  3F8K A;  3S6G A;  1NSL A;  2CY2 A;  4KOT A;  4MHD A;  4U9Z A;  1Z4R A;  4DNC A;  1XF8 A;  1I21 A;  2VZY A;  3KKW A;  1VHS A;  3TOB A;  1IYK A;  4BMH A;  4H6Z A;  1IIC A;  2FS5 A;  2PC1 A;  2ZW5 A;  3S6F A;  1R57 A;  4PSW A;  4F6A A;  1YGH A;  2P0W A;  2D4O A;  2B4D A;  3C26 A;  2ARH A;  1V0C A;  2GIV A;  3DDD A;  3EY5 A;  4R3L A;  2CNM A;  2B3U A;  1IID A;  4ORF A;  2R98 A;  4CAW A;  2FE7 A;  4MBU A;  1S3Z A;  4KOV A;  2G3T A;  2J8R A;  1MJA A;  5F46 A;  3D2P A;  3EFA A;  3P2H A;  4U9Y A;  4FD4 A;  5HMN A;  2OU2 A;  1PU9 A;  1K4J A;  4LUA A;  1NMT A;  3FNC A;  4R87 A;  4FD6 A;  3E0K A;  3P2F A;  4JXR A;  1WWZ A;  2CNT A;  2P6F A;  2J8M A;  3N7Z A;  4QB9 A;  3TO9 A;  1UFH A;  2Z10 A;  1Y9K A;  3EXN A;  4AG7 A;  3JUW A;  3H4Q A;  1BOB A;  1M4G A;  2PRB A;  4M85 A;  3QAH A;  5IX3 A;  1XIX A;  1N71 A;  2D4P A;  2F5I A;  4ZBG A;  4KVX A;  2J8N A;  4KUA A;  4HNX B;  5KTC A;  4X5K A;  4OAD A;  4AVC A;  2FSR A;  3MGD A;  5KTA A;  3K9U A;  4KOW A;  2QML A;  2Y0M A;  1QSN A;  3EO4 A;  3TOA A;  4YFJ A;  1BO4 A;  4KOX A;  2FIA A;  2C27 A;  3R95 A;  2Z0Z A;  4IUS A;  3D3S A;  3I9S A;  1I1D A;  3FXT A;  3RYO A;  5F47 A;  1SQH A;  3WR7 A;  4OLL A;  1PUA A;  1QST A;  2PSW A;  1IYL A;  5F48 A;  5H86 A;  3IGR A;  2H5M A;  2R7H A;  2WPX A;  3DNS A;  4XNH B;  2BEI A;  3G8W A;  2IL4 A;  3NE7 A;  2OZU A;  2P6E A;  4U5Y A;  4KOR A;  4YRH A;  4XPD C;  4L8A A;  2BSW A;  3LOD A;  2ATR A;  4XPL A;  1M4I A;  4AVA A;  2OH1 A;  4GS4 A;  4H6U A;  4HKF A;  2P6G A;  4MJ8 A;  2B58 A;  1ON0 A;  4OAE A;  2HUZ A;  1I12 A;  5DWM A;  4XPK A;  3SXO A;  5JQ4 A;  4J3G A;  2JLM A;  1Y9W A;  2EUI A;  3UY5 A;  2CNS A;  4EVY A;  4CAV A;  2JEV A;  4JD6 A;  2Q04 A;  5KTD A;  4RS2 A;  5F49 A;  2VBQ A;  4KOU A;  4L89 A;  5CNP A;  4KUB A;  2BUE A;  1YLE A;  3BJ8 A;  1LRZ A;  2B5G B;  4PK2 A;  5J8F A;  3G3S A;  2AE6 A;  5E96 A;  1IB1 E;  4MI4 A;  5EBV A;  3R9F A;  4R9M A;  1YR0 A;  3FYN A;  2I00 A;  3S6H A;  3OWC A;  2Q0Y A;  5FVJ A;  3S6K A;  3TO7 A;  4CRZ B;  5IB0 A;  2ZPA A;  5DWN A;  4QVT A;  2BL1 A;  4UWI A;  5C88 A;  2HV2 A;  1TIQ A;  4KVM E;  4QUS A;  3EC4 A;  1M4D A;  5EC4 A;  3TE4 A;  4JWP A;  4FD7 A;  4KOY A;  3B8G A;  4MY0 A;  3R9E A;  3DR6 A;  3VWD A;  2OB0 A;  3TCV A;  4HNW B;  1Z9U A;  3DR8 A;  3TT2 A;  4E2A A;  4B5P B;  1NE9 A;  3FB3 A;  3JVN A;  3TO6 A;  4PK3 A;  5JPH A;  3F5B A;  1M44 A;  3FBU A;  1KZF A;  2G0B A;  2B5G A;  2I79 A;  3PGP A;  2R8V A;  4I49 A;  3GYA A;  1QSR A;  4II9 A;  3PZJ A;  3R9G A;  3FRM A;  1FY7 A;  3DSB A;  3T90 A;  2FIW A;  4UA3 A;  1YVO A;  1Y7R A;  1CJW A;  1XE4 A;  4RI1 A;  4AB7 A;  2FCK A;  4UBR A; 
#chains in the Genus database with same CATH topology
 2Q7B A;  3D67 A;  3LD2 A;  4C7H A;  1H8L A;  2EO8 A;  3T8W A;  1LAM A;  2ZEF A;  4LQ6 A;  1S7K A;  2ZW6 A;  4KLW A;  4DUK A;  4X3R A;  2XEG A;  1X12 A;  5JGF A;  1GHE A;  5LRG A;  7CPA A;  1QSM A;  3CPX A;  3BLN A;  1S7F A;  4HNY B;  2QIR A;  4ZY1 A;  2PR8 A;  1TKJ A;  5A27 A;  3CXP A;  3PB4 X;  3IEH A;  5G22 A;  4BBH A;  2CF4 A;  1YVK A;  1MJB A;  1PCA A;  4ZX8 A;  1X10 A;  4ZY0 A;  5AG6 A;  4CAX A;  3FF3 A;  1ZG8 A;  2Z11 A;  2PR1 A;  2A4N A;  1LCP A;  4LX9 A;  4B5P A;  4Q7A A;  1Z8X A;  4TNU A;  4Y49 B;  1Y7E A;  3B3W A;  4MHP A;  4AVB A;  1Z2L A;  2AFU A;  3HUV A;  2VEZ A;  2RC4 A;  3IWW A;  2PDO A;  1J4J A;  2JBK A;  3VWE A;  1JWQ A;  1Z4E A;  1CP7 A;  4EFD A;  2KCW A;  3PEI A;  2ZEM A;  3BI1 A;  5IB9 A;  1XMT A;  2Q4Y A;  4O23 A;  4NCZ A;  1XEB A;  1P4N A;  2EK9 A;  4A94 A;  5A28 A;  1MJ9 A;  2IMO A;  4PV6 A;  4ZYQ A;  2ZW4 A;  4NGT A;  1CX8 A;  1KWM A;  2IQ6 A;  2Z3N A;  4W9Y A;  2X7B A;  2NYQ A;  1S5K A;  2QEC A;  1YX0 A;  2REF A;  3SHP A;  4QBJ A;  5ISV A;  4E8O A;  3K9T A;  4KVO E;  3TFY A;  3W91 A;  2DPS A;  1VKC A;  2EWB A;  4NGM A;  5D8N A;  4BIN A;  3S9L A;  3FED A;  4OC0 A;  3N5F A;  4A37 A;  4FD5 A;  3SJX A;  2ZEP A;  2I3C A;  1M1D A;  2O28 A;  3NA6 A;  4Q38 A;  1ZLI A;  3IFE A;  3JTK A;  1RXT A;  3PBB A;  4UFV A;  4F9U A;  4JYW A;  3PP9 A;  4NJQ A;  4ZX9 A;  2PQ8 A;  1Z8W A;  2OR4 A;  5J8C A;  4CRY B;  4G1P A;  3SXN A;  3RNZ A;  2K5T A;  4F8Z A;  4CYN A;  3LMS A;  4JLY A;  4QC6 A;  3W6X A;  2GE3 A;  2VI7 A;  1KUV A;  1QSO A;  1S7L A;  2DXQ A;  2JDD A;  2R1I A;  1Q7L A;  3KQX A;  2ODF A;  3QNV A;  1IY7 A;  3R1K A;  4M3S A;  4PSX A;  4XNH C;  4NGS A;  3CXQ A;  4IK2 A;  3FX6 A;  4KSF A;  4MY3 A;  4XPD B;  3T9Y A;  1YRE A;  1AMP A;  4OIW A;  2V8D A;  4C68 A;  4B13 A;  4X2T A;  2ZEL A;  3CZX A;  3D68 A;  1MK4 A;  1YW4 A;  2VL1 A;  1Q2D A;  3F0A A;  1XRY A;  3SJG A;  3S9N A;  4CGP A;  1Q2C A;  4IAV A;  4K30 A;  5HH1 A;  2DF5 A;  1BAV A;  2OZG A;  3NH4 A;  3SJF A;  4MRI A;  2HQY A;  2WSA A;  4X8I A;  3W6S A;  1OZP A;  4RN7 A;  1YK3 A;  2FXF A;  3BJ7 A;  2FT0 A;  3R96 A;  3B7I A;  4EWT A;  3B2Y A;  1TF9 A;  1RTQ A;  2IJZ A;  4TWE A;  3NE8 A;  1KUY A;  2JDC A;  4H89 A;  4YGO A;  3VAT A;  4E0A A;  4KSA A;  4Y49 C;  3SI2 A;  1KUX A;  2PJ6 A;  2WPW A;  2YGW A;  4MHY A;  3KI9 A;  3H8G A;  2REE A;  4NSQ A;  5LYI A;  4JJX A;  2ZEE A;  4R3K A;  5C82 A;  4JXQ A;  1M4L A;  3D8P A;  4KLV A;  2ZXV A;  3SJE A;  4CGO A;  5K8P A;  1VGY A;  4ONU A;  3V8I A;  4P4B A;  3CXS A;  5LRK A;  3WC7 A;  1HDQ A;  1L0C A;  3GKR A;  2B3V A;  3ZZI A;  3H8F A;  4B5O A;  1U6M A;  3D2M A;  4UCM A;  4UFW A;  3FJU A;  2Z3L A;  3LAC A;  2PVV A;  2V8H A;  5I0C A;  1RO5 A;  2VXK A;  3KHZ A;  2PJA A;  2ZW7 A;  3FIX A;  3DLJ A;  1XFO A;  4Q36 A;  1XOV A;  2ANP A;  4AXV A;  3D7H A;  5GCN A;  4WWV A;  1JQG A;  4P4D A;  4P4I A;  1Y0Y A;  4KZT A;  1LAN A;  4CS0 B;  3PB8 X;  2F8H A;  1B87 A;  4F0X A;  5AG5 A;  2V8V A;  4A31 A;  4C7I A;  2ZEN A;  1P0H A;  2AJ6 A;  2GAN A;  2PVW A;  3NFZ A;  4NF1 A;  3ZJ0 A;  2B4D B;  2AFS A;  2G3A A;  1CM0 A;  4IF5 A;  2NMT A;  4NXY A;  3QB8 A;  2GLJ A;  5JM6 A;  5F09 A;  2VZZ A;  2Q44 A;  1AYE A;  5J1Q A;  4YU9 A;  2XEJ A;  3KR5 A;  2EVN A;  3D66 A;  2O4H A;  4AG9 A;  5EMI A;  4KOS A;  1Q2Y A;  4F0Y A;  3I3G A;  3HLP A;  4MMO A;  2C1C A;  4PXD A;  3GY9 A;  2Q4Z A;  5CPA A;  4A95 A;  4MXU A;  2FL4 A;  4KS9 A;  1S7N A;  1S60 A;  3IWE A;  1B6B A;  1WK4 A;  4OKO A;  2Q4V A;  2VQY A;  4CGM A;  2RFH A;  3RBU A;  4NEX A;  5D29 A;  1LOK A;  2PJ5 A;  4UWJ A;  3IWG A;  4CGL A;  3MRU A;  3PFE A;  2Q51 A;  3QAY A;  5H84 A;  3RAM A;  2FVG A;  1YME A;  5IV0 A;  4FAI A;  2PIZ A;  1AUG A;  2OZH A;  5HVF A;  3TTH A;  2B4B A;  4MCQ A;  4UCN A;  1XBU A;  4R57 A;  5LYL A;  1ARM A;  3F8K A;  2ZEG A;  3S6G A;  1NSL A;  2CY2 A;  2QVP A;  4KOT A;  4MHD A;  4U9Z A;  3KR4 A;  1Z4R A;  5JH9 A;  2Z3O A;  2PRQ A;  1IOF A;  4B14 A;  2XEF A;  3I1U A;  4DNC A;  1Y0R A;  1XF8 A;  1I21 A;  4UIB A;  4P4E A;  5AG4 A;  4PXB A;  4GM5 A;  2PE3 A;  3D4U A;  2NSM A;  1F57 A;  3CPA A;  5G20 A;  3D7D A;  3JRU A;  4PXC A;  4JZ0 A;  5ELY A;  2VZY A;  3KKW A;  1FNO A;  4M6G A;  1VHS A;  3TOB A;  1IYK A;  4BMH A;  2PJ7 A;  4P45 A;  4UFX A;  2BO9 A;  4F9V A;  4H6Z A;  1IIC A;  2FS5 A;  5LRJ A;  2PC1 A;  5HVG A;  1ELM P;  2ZW5 A;  3S6F A;  1R57 A;  3BXM A;  4A30 A;  1YQE A;  2JBJ A;  4PSW A;  4F6A A;  1YGH A;  2P0W A;  3FEC A;  3PRT A;  2D4O A;  1CP6 A;  2B4D A;  3C26 A;  2ARH A;  1V0C A;  3PB6 X;  4MFJ A;  2GIV A;  3MN8 A;  2AFO A;  1BLL E;  1OBR A;  3DDD A;  3EY5 A;  2J9A A;  2C6C A;  4R3L A;  2CNM A;  2B3U A;  3B3S A;  1IID A;  4BD9 A;  1IGB A;  2R98 A;  4ORF A;  4ZY2 A;  4CAW A;  2FE7 A;  3IC1 A;  1S3Z A;  1ZG9 A;  4MBU A;  4CYQ A;  4KOV A;  2G3T A;  2J8R A;  1MJA A;  2PCU A;  2PJ2 A;  5F46 A;  5K8N A;  2WYR A;  3IJ3 A;  4B10 A;  3D2P A;  3GLJ A;  4FUU A;  4OID A;  2PIY A;  2EK8 A;  3EFA A;  4CAF A;  3P2H A;  4M6I A;  4U9Y A;  3DGV A;  4FD4 A;  4CPA A;  2ABZ A;  2CIJ A;  2OU2 A;  5HMN A;  3KAS A;  5DS0 A;  1PU9 A;  1K4J A;  3IO1 A;  2YNC A;  4LUA A;  2ZEH A;  1NMT A;  3FNC A;  4PPZ A;  5THW A;  3BHX A;  4R87 A;  2QJ8 A;  4FD6 A;  2WUU A;  3E0K A;  3P2F A;  4MCS A;  4JXR A;  1WWZ A;  2CNT A;  2DEA A;  2P6F A;  2J8M A;  3N7Z A;  4QB9 A;  2PJ1 A;  3TO9 A;  1UFH A;  4M6H A;  2Z10 A;  1TKF A;  1Y9K A;  1VIX A;  2YNE A;  3EXN A;  4KSI A;  4AG7 A;  4DYO A;  3JUW A;  3H4Q A;  4HPS A;  3WC5 A;  3WAB A;  3SI1 A;  1BOB A;  1M4G A;  2PRB A;  4M85 A;  3QAH A;  5IX3 A;  1XIX A;  1N71 A;  4PQA A;  4MHN A;  1ARL A;  2D4P A;  1ELL P;  2F5I A;  3PB9 X;  3ISZ A;  5AG7 A;  3H8E A;  4ZBG A;  1YW6 A;  4KVX A;  3WC6 A;  2J8N A;  4KUA A;  4HNX B;  5KTC A;  4X5K A;  5LYF A;  2PJC A;  4IHM A;  4OAD A;  2PJ9 A;  4UIA A;  4AVC A;  2FSR A;  3MGD A;  1UWY A;  3K9U A;  4KOW A;  4OC2 A;  2QML A;  5KTA A;  2PJ8 A;  2Y0M A;  1QSN A;  5K8M A;  3EO4 A;  3TOA A;  4YFJ A;  1BO4 A;  4KOX A;  2AFZ A;  2FIA A;  2C27 A;  3R95 A;  1Z5R A;  4NGN A;  4P44 A;  2Z0Z A;  4IUS A;  4P10 A;  3D3S A;  3I9S A;  3VAR A;  1CPX A;  1I1D A;  3FXT A;  2CTB A;  3GB0 A;  3PB7 X;  4UEF A;  1VHO A;  3RYO A;  5G21 A;  5F47 A;  3TC8 A;  1SQH A;  2ZED A;  3WR7 A;  4OLL A;  1BPM A;  1PUA A;  1R3N A;  5BWA B;  1QST A;  2PSW A;  3ISX A;  4R7M A;  1IYL A;  5F48 A;  1Z8L A;  1LFW A;  5H86 A;  2XEI A;  6CPA A;  3IGR A;  3SI0 A;  2H5M A;  3FVL A;  2R7H A;  2WPX A;  1TXR A;  4MHZ A;  4MFK A;  3DNS A;  4MCP A;  2BEI A;  3G8W A;  3B3C A;  4LQG A;  4XNH B;  4UCP A;  2IL4 A;  3NE7 A;  2OZU A;  2P6E A;  2DPT A;  3BI0 A;  3K2K A;  4KOR A;  4U5Y A;  3VH9 A;  4B11 A;  1F2O A;  2AFW A;  2V77 A;  3CDX A;  4MCR A;  4YRH A;  2PJB A;  2Q43 A;  3KL9 A;  4XPD C;  3TX8 A;  3KZW A;  2BOA A;  2C6P A;  4L8A A;  1XJO A;  2BSW A;  4NGR A;  3LOD A;  1R43 A;  5I4M A;  1CG2 A;  2ATR A;  3B3T A;  2POK A;  4XPL A;  1M4I A;  4OC5 A;  4P4J A;  4A38 A;  1ZO0 A;  2YND A;  4OC3 A;  4AVA A;  2CXA A;  2OH1 A;  4GS4 A;  2O53 A;  4H6U A;  4HKF A;  3FEE A;  2P6G A;  4MJ8 A;  2F7V A;  2OOT A;  3NH8 A;  3S9M A;  2B58 A;  2C6G A;  2Q7S A;  4P4F A;  1F2P A;  1ON0 A;  4OAE A;  1YSJ A;  4A39 A;  3B35 A;  2Z3M A;  1LAP A;  2HUZ A;  1I12 A;  5DWM A;  4XPK A;  1QQ9 A;  3SXO A;  3WT4 A;  5JQ4 A;  4J3G A;  4RUH A;  4FBE A;  2JLM A;  1Y9W A;  5G1Z A;  3IIB A;  2EUI A;  4P6Y A;  4ZI6 A;  8CPA A;  5LYD A;  1EE3 P;  2HC9 A;  3UY5 A;  4A32 A;  4EME A;  2CNS A;  4EVY A;  4CAV A;  2JEV A;  4JD6 A;  4Z65 A;  2Q04 A;  5KTD A;  4UF4 A;  4RS2 A;  4CGN A;  5F49 A;  2BCO A;  2VBQ A;  3KGQ A;  4KOU A;  4L89 A;  5CNP A;  4KUB A;  1ZG7 A;  2Z3P A;  2BUE A;  1YLE A;  3BJ8 A;  4NFR A;  4NJR A;  1LRZ A;  2B5G B;  4PK2 A;  4R6T A;  3D7F A;  4R76 A;  5CBM A;  5J8F A;  3G3S A;  3IU1 A;  1VHE A;  4UEZ A;  4DJL A;  1CPS A;  2AE6 A;  3GIU A;  4C2X A;  5E96 A;  1IU8 A;  1IB1 E;  1QMU A;  4MI4 A;  4NGP A;  5EBV A;  3R9F A;  4R9M A;  1YR0 A;  3FYN A;  2AFM A;  3KHX A;  3V7Z A;  2I00 A;  3S6H A;  3OWC A;  2Q0Y A;  5FVJ A;  3L2N A;  4B12 A;  4YWY A;  2AFX A;  4K3N A;  3S6K A;  4C2Z A;  1TF8 A;  3TO7 A;  4CRZ B;  5IB0 A;  2PJ4 A;  4PXE A;  2ZPA A;  1YLO A;  3IU2 A;  5DWN A;  4QVT A;  2BL1 A;  2HB6 A;  4UWI A;  4OC4 A;  5C88 A;  1Z8T A;  4ZGY B;  1DTD A;  1A2Z A;  2HV2 A;  2PJ3 A;  1TIQ A;  2GU2 A;  3CT9 A;  4FWU A;  4KVM E;  5AGE A;  3NH5 A;  2Z3K A;  4QUS A;  3EC4 A;  4OP4 A;  3RZA A;  4B6Z A;  1M4D A;  4NGQ A;  5EC4 A;  3FH4 A;  4WJB A;  3TE4 A;  2QYV A;  4JWP A;  4FD7 A;  4KOY A;  4CYP A;  1FT7 A;  3B8G A;  1DE4 C;  1PYT B;  4MY0 A;  4CAE A;  3R9E A;  2YNC C;  2G9D A;  2GFQ A;  3DR6 A;  3VWD A;  2GLF A;  2OB0 A;  3TCV A;  4HNW B;  2PJ0 A;  1Z9U A;  3DR8 A;  3TT2 A;  1XMB A;  2JEW A;  4GXH A;  4E2A A;  4B5P B;  4A2Z A;  2ZEO A;  1NE9 A;  4UEE A;  5K8O A;  1NSA A;  3FB3 A;  3FMC A;  5HXD A;  1GYT A;  4OME A;  3JVN A;  3TO6 A;  3KQZ A;  4PK3 A;  3D7G A;  5JPH A;  5HVH A;  4OC1 A;  4H2K A;  3F5B A;  3PFO A;  3GUX A;  4ONW A;  4A33 A;  1M44 A;  4R8F A;  3FBU A;  1CBX A;  2RB7 A;  2CTC A;  3V38 A;  3H5Z A;  3RO0 A;  1KZF A;  2G0B A;  2B5G A;  2GRE A;  1ZLH A;  2WZN A;  2I79 A;  4MFZ A;  3PGP A;  2EBJ A;  2R8V A;  4I49 A;  4CYO A;  1HDU A;  3GYA A;  3PBE A;  1BPN A;  1QSR A;  4II9 A;  3PZJ A;  3LWU A;  3R9G A;  3FRM A;  1FY7 A;  3DSB A;  1IOI A;  3T90 A;  2FIW A;  4UA3 A;  2V8G A;  2ZOG A;  1YVO A;  1Y7R A;  1HEE A;  4MFP A;  1CJW A;  3B3V A;  1XE4 A;  3A9L A;  4MFQ A;  4RI1 A;  2ZOF A;  1TKH A;  2FCK A;  4UBR A;  4AB7 A;  4MFL A;  4C2Y A; 
#chains in the Genus database with same CATH homology
 2Q7B A;  3LD2 A;  4C7H A;  1S7K A;  2ZW6 A;  4KLW A;  1GHE A;  1QSM A;  3BLN A;  1S7F A;  4HNY B;  2QIR A;  2PR8 A;  5A27 A;  3CXP A;  5G22 A;  4BBH A;  1YVK A;  1MJB A;  5AG6 A;  4CAX A;  2Z11 A;  2PR1 A;  2A4N A;  4LX9 A;  4B5P A;  4Y49 B;  4AVB A;  2VEZ A;  2RC4 A;  2PDO A;  1J4J A;  3VWE A;  1Z4E A;  2KCW A;  1XMT A;  2Q4Y A;  4NCZ A;  1XEB A;  1P4N A;  5A28 A;  1MJ9 A;  4PV6 A;  2ZW4 A;  2Z3N A;  2X7B A;  2QEC A;  1S5K A;  1YX0 A;  2REF A;  3SHP A;  4QBJ A;  5ISV A;  4E8O A;  4KVO E;  3TFY A;  3W91 A;  2DPS A;  1VKC A;  4FD5 A;  4Q38 A;  1M1D A;  2O28 A;  3JTK A;  1RXT A;  4UFV A;  3PP9 A;  2PQ8 A;  5J8C A;  4CRY B;  3SXN A;  2K5T A;  4CYN A;  4JLY A;  4QC6 A;  3W6X A;  2GE3 A;  2VI7 A;  1KUV A;  1QSO A;  1S7L A;  2DXQ A;  2JDD A;  2R1I A;  3R1K A;  4M3S A;  4XNH C;  4PSX A;  3CXQ A;  4KSF A;  4MY3 A;  4XPD B;  3T9Y A;  1YRE A;  4C68 A;  4B13 A;  1MK4 A;  1Q2D A;  3F0A A;  4CGP A;  1Q2C A;  5HH1 A;  4K30 A;  2OZG A;  2HQY A;  2WSA A;  3W6S A;  1OZP A;  1YK3 A;  2FXF A;  3BJ7 A;  2FT0 A;  3R96 A;  1KUY A;  2JDC A;  4H89 A;  4YGO A;  4E0A A;  4KSA A;  4Y49 C;  1KUX A;  2WPW A;  2YGW A;  4NSQ A;  2REE A;  4JJX A;  4R3K A;  5C82 A;  4JXQ A;  3D8P A;  4KLV A;  2ZXV A;  4CGO A;  4ONU A;  3V8I A;  3CXS A;  3GKR A;  1L0C A;  2B3V A;  3ZZI A;  4B5O A;  1U6M A;  3D2M A;  4UCM A;  4UFW A;  2Z3L A;  5I0C A;  1RO5 A;  2VXK A;  2ZW7 A;  3FIX A;  4Q36 A;  5GCN A;  4KZT A;  4CS0 B;  1B87 A;  4F0X A;  5AG5 A;  4A31 A;  4C7I A;  1P0H A;  2AJ6 A;  2GAN A;  4NF1 A;  3ZJ0 A;  2B4D B;  2G3A A;  1CM0 A;  4IF5 A;  2NMT A;  4NXY A;  3QB8 A;  2VZZ A;  2Q44 A;  2EVN A;  4AG9 A;  4KOS A;  1Q2Y A;  4F0Y A;  3I3G A;  3GY9 A;  4A95 A;  2FL4 A;  4KS9 A;  1S7N A;  1S60 A;  3IWE A;  1B6B A;  1WK4 A;  2Q4V A;  2VQY A;  4CGM A;  4NEX A;  4UWJ A;  3IWG A;  4CGL A;  5H84 A;  5IV0 A;  2OZH A;  3TTH A;  2B4B A;  4UCN A;  4R57 A;  3F8K A;  3S6G A;  1NSL A;  2CY2 A;  4KOT A;  4MHD A;  4U9Z A;  1Z4R A;  2Z3O A;  4B14 A;  4DNC A;  1XF8 A;  1I21 A;  5AG4 A;  5G20 A;  2VZY A;  3KKW A;  1VHS A;  3TOB A;  1IYK A;  4BMH A;  4UFX A;  4H6Z A;  1IIC A;  2FS5 A;  2PC1 A;  2ZW5 A;  3S6F A;  1R57 A;  4A30 A;  4PSW A;  4F6A A;  1YGH A;  2P0W A;  2D4O A;  2B4D A;  3C26 A;  2ARH A;  1V0C A;  4MFJ A;  2GIV A;  3DDD A;  3EY5 A;  4R3L A;  2CNM A;  2B3U A;  1IID A;  4ORF A;  2R98 A;  4CAW A;  2FE7 A;  4MBU A;  1S3Z A;  4CYQ A;  4KOV A;  2G3T A;  2J8R A;  1MJA A;  5F46 A;  4B10 A;  3D2P A;  3EFA A;  4CAF A;  3P2H A;  4U9Y A;  4FD4 A;  5HMN A;  2OU2 A;  1PU9 A;  1K4J A;  2YNC A;  4LUA A;  1NMT A;  3FNC A;  4R87 A;  4FD6 A;  2WUU A;  3E0K A;  3P2F A;  4JXR A;  1WWZ A;  2CNT A;  2P6F A;  3N7Z A;  2J8M A;  4QB9 A;  3TO9 A;  1UFH A;  2Z10 A;  1Y9K A;  2YNE A;  3EXN A;  4AG7 A;  3JUW A;  3H4Q A;  1BOB A;  1M4G A;  2PRB A;  4M85 A;  3QAH A;  5IX3 A;  1XIX A;  1N71 A;  2D4P A;  2F5I A;  5AG7 A;  4ZBG A;  4KVX A;  2J8N A;  4KUA A;  4HNX B;  5KTC A;  4X5K A;  4OAD A;  4AVC A;  2FSR A;  3MGD A;  5KTA A;  3K9U A;  4KOW A;  2QML A;  2Y0M A;  1QSN A;  3EO4 A;  3TOA A;  4YFJ A;  1BO4 A;  4KOX A;  2FIA A;  2C27 A;  3R95 A;  2Z0Z A;  4IUS A;  3D3S A;  3I9S A;  1I1D A;  3FXT A;  3RYO A;  5G21 A;  5F47 A;  1SQH A;  3WR7 A;  4OLL A;  1PUA A;  5BWA B;  1QST A;  2PSW A;  1IYL A;  5F48 A;  5H86 A;  3IGR A;  2H5M A;  2R7H A;  2WPX A;  4MFK A;  3DNS A;  4XNH B;  2BEI A;  3G8W A;  4UCP A;  2IL4 A;  3NE7 A;  2OZU A;  2P6E A;  2DPT A;  4U5Y A;  4KOR A;  4B11 A;  4YRH A;  4XPD C;  4L8A A;  2BSW A;  3LOD A;  2ATR A;  4XPL A;  1M4I A;  1ZO0 A;  2YND A;  4AVA A;  2CXA A;  2OH1 A;  4GS4 A;  4H6U A;  4HKF A;  2P6G A;  4MJ8 A;  2B58 A;  1ON0 A;  4OAE A;  2Z3M A;  2HUZ A;  1I12 A;  5DWM A;  4XPK A;  3SXO A;  5JQ4 A;  4J3G A;  2JLM A;  1Y9W A;  5G1Z A;  2EUI A;  3UY5 A;  4A32 A;  2CNS A;  4EVY A;  4CAV A;  2JEV A;  4JD6 A;  2Q04 A;  5KTD A;  4CGN A;  4RS2 A;  5F49 A;  2VBQ A;  4KOU A;  4L89 A;  5CNP A;  4KUB A;  2Z3P A;  2BUE A;  1YLE A;  3BJ8 A;  1LRZ A;  2B5G B;  4PK2 A;  5J8F A;  3G3S A;  3IU1 A;  2AE6 A;  4C2X A;  5E96 A;  1IB1 E;  4MI4 A;  5EBV A;  3R9F A;  4R9M A;  1YR0 A;  3FYN A;  2I00 A;  3S6H A;  3OWC A;  2Q0Y A;  5FVJ A;  4B12 A;  4C2Z A;  3S6K A;  3TO7 A;  4CRZ B;  5IB0 A;  2ZPA A;  3IU2 A;  5DWN A;  4QVT A;  2BL1 A;  4UWI A;  5C88 A;  4ZGY B;  2HV2 A;  1TIQ A;  4KVM E;  5AGE A;  2Z3K A;  4QUS A;  3EC4 A;  1M4D A;  5EC4 A;  3TE4 A;  4JWP A;  4FD7 A;  4KOY A;  4CYP A;  3B8G A;  4MY0 A;  4CAE A;  3R9E A;  2YNC C;  3DR6 A;  3VWD A;  2OB0 A;  3TCV A;  4HNW B;  1Z9U A;  3DR8 A;  3TT2 A;  4E2A A;  4B5P B;  4A2Z A;  1NE9 A;  3FB3 A;  3JVN A;  3TO6 A;  4PK3 A;  5JPH A;  3F5B A;  4A33 A;  1M44 A;  3FBU A;  3H5Z A;  1KZF A;  2G0B A;  2B5G A;  2I79 A;  4MFZ A;  3PGP A;  2R8V A;  4I49 A;  4CYO A;  3GYA A;  1QSR A;  4II9 A;  3PZJ A;  3R9G A;  3FRM A;  1FY7 A;  3DSB A;  3T90 A;  2FIW A;  4UA3 A;  1YVO A;  1Y7R A;  4MFP A;  1CJW A;  1XE4 A;  3A9L A;  4MFQ A;  4RI1 A;  4AB7 A;  2FCK A;  4UBR A;  4MFL A;  4C2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...