1VHSA

Crystal structure of a putative phosphinothricin n-acetyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
165
structure length
165
Chain Sequence
SLTLRLAEHRDLEAVVAIYNSTIASRMVTADTEPVTPEDRMEWFSGHTESRPLYVAEDENGNVAAWISFETFYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLMAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEMDGKRYDLKILGRELSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
molecule keywords similar to phosphinothricin acetyltransferase
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 41
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.3.1.183: Phosphinothricin acetyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1vhsA00
1CJWA 2K5TA 1YK3A 4MBUA 3VWDA 1Z9UA 3DR8A 3FYNA 4R87A 2D4PA 3CXSA 4GS4A 4JLYA 2PDOA 3TOAA 1CM0A 3ZJ0A 2BEIA 4KOVA 1PUAA 1U6MA 2ZXVA 4PSWA 2PRBA 3EC4A 2G3AA 3R9FA 4U5YA 2PC1A 4UWJA 1S7KA 4FD6A 2D4OA 2EVNA 2C27A 4AVAA 1R57A 4XNHB 3RYOA 1P0HA 4JJXA 4H89A 1KUYA 3FNCA 3DSBA 5F47A 4ONUA 1WWZA 1MJAA 3TFYA 4DNCA 2HQYA 5IV0A 2PR1A 2P6EA 4FD4A 3MGDA 4I49A 3OWCA 1YR0A 4OADA 3R9EA 4QUSA 1MJBA 1YLEA 2WPXA 4JD6A 3EY5A 3GY9A 2I79A 4IF5A 3F0AA 2Q7BA 4KUBA 2HV2A 4KOXA 1XEBA 1UFHA 2B3VA 4YRHA 1S60A 1K4JA 3DNSA 1M4IA 4CS0B 3PZJA 2B58A 5DWMA 3V8IA 3QB8A 4CAXA 2FIWA 3D2MA 3QAHA 5F48A 3GKRA 3C26A 1FY7A 4NSQA 4MI4A 3FIXA 4KLWA 2JDDA 1I1DA 4H6ZA 3NE7A 2OZUA 1YREA 3H4QA 3FRMA 4KORA 4KVOE 5E96A 2EUIA 4OAEA 1MK4A 4YGOA 3TE4A 2WPWA 2FT0A 1ON0A 4AVCA 4QBJA 4UA3A 1YGHA 2B4BA 4QVTA 3B8GA 4KLVA 4KOSA 2G0BA 4H6UA 1NE9A 4IUSA 3BJ8A 5FVJA 4OLLA 3BJ7A 3R95A 2B4DB 2P0WA 4M85A 3R1KA 1I21A 3S6FA 1GHEA 4UBRA 4HNWB 3TO7A 2IL4A 1IYKA 1XMTA 3TCVA 4KUAA 3IWGA 1IB1E 2ARHA 4J3GA 1QSMA 2J8MA 2A4NA 3JVNA 1YX0A 1XF8A 2ZW4A 4KVME 5CNPA 2VZYA 1Q2DA 3TTHA 3LODA 5DWNA 2OZHA 4ORFA 4XPDC 2REEA 2Q04A 1S5KA 3SXOA 3W6XA 3W6SA 4NEXA 2R98A 4F6AA 5C82A 4CAVA 4KOWA 2QIRA 2VI7A 1N71A 4QB9A 1BO4A 5GCNA 2J8NA 3TO6A 3R9GA 5HMNA 3CXPA 1TIQA 2FS5A 3T90A 2VZZA 3IGRA 2BL1A 2FCKA 2X7BA 1RO5A 2NMTA 5KTAA 4AG7A 2AE6A 1XE4A 1M44A 4UWIA 3DDDA 2O28A 2VQYA 1IYLA 1Q2YA 2QECA 2H5MA 1KZFA 1Q2CA 2GIVA 2G3TA 4MY3A 4PV6A 4ZBGA 4E8OA 4XPDB 5JPHA 4B5OA 3S6GA 4B5PB 2FIAA 3EFAA 3PGPA 4PK3A 2FXFA 4PK2A 4II9A 2J8RA 3VWEA 3FBUA 4KOUA 2FSRA 1QSOA 4XPLA 4KOTA 2Z0ZA 4R9MA 3FXTA 1S7NA 1KUVA 2PR8A 3JUWA 1J4JA 2BUEA 2BSWA 4CRYB 2CY2A 3TO9A 3N7ZA 4U9ZA 5EC4A 3D8PA 4MJ8A 1Z4RA 1PU9A 1I12A 5F49A 2FL4A 4YFJA 4AG9A 4E0AA 3R96A 1VHSA 1XIXA 2PQ8A 4F0YA 2GANA 1Y7RA 4R3KA 4HNYB 4JXRA 4R57A 2B4DA 2REFA 4L89A 1YVKA 5J8FA 2R7HA 3DR6A 1S7FA 2CNTA 3PP9A 4XPKA 4NF1A 3SXNA 1BOBA 4RI1A 1S3ZA 4FD5A 5H86A 1NMTA 1V0CA 1MJ9A 4Y49C 2CNMA 3SHPA 5F46A 1M4DA 2Q4YA 4JWPA 4NCZA 2Z11A 3I3GA 4R3LA 3KKWA 4BMHA 3UY5A 5JQ4A 3EXNA 2AJ6A 4CAWA 4KVXA 1KUXA 3D3SA 4M3SA 4AB7A 5ISVA 3LD2A 5IX3A 2VEZA 3F8KA 4FD7A 4QC6A 4MY0A 1OZPA 3W91A 1Y9WA 2R1IA 3WR7A 4RS2A 2PSWA 5H84A 2OU2A 2QMLA 2Z10A 5HH1A 1M1DA 5C88A 1VKCA 1WK4A 3P2HA 1P4NA 2RC4A 1LRZA 4KZTA 2B3UA 4EVYA 4Y49B 1S7LA 1YVOA 4AVBA 3ZZIA 2OZGA 2I00A 3EO4A 1Z4EA 4CRZB 2OH1A 3G3SA 4HKFA 4B5PA 3BLNA 2JEVA 2KCWA 2VBQA 3GYAA 3D2PA 1Y9KA 2ZPAA 1RXTA 2F5IA 5IB0A 4JXQA 2Q44A 1SQHA 2VXKA 3E0KA 4K30A 1QSNA 2ZW6A 2R8VA 4MHDA 3CXQA 2JDCA 3F5BA 1NSLA 2CNSA 2ZW7A 1B87A 4LX9A 2FE7A 2OB0A 3T9YA 1QSTA 3G8WA 1L0CA 2Q4VA 2B5GA 2B5GB 2DXQA 3TT2A 5KTCA 2GE3A 2ZW5A 5KTDA 4U9YA 5J8CA 3K9UA 4PSXA 4L8AA 3I9SA 5I0CA 2P6GA 2ATRA 1M4GA 2Y0MA 3FB3A 5EBVA 1B6BA 3S6HA 2Q0YA 4XNHC 2P6FA 2JLMA 4LUAA 1IIDA 2HUZA 1QSRA 1IICA 3P2FA 3S6KA 3TOBA 4X5KA 4E2AA 4HNXB 4NXYA 4KOYA
chains in the Genus database with same CATH superfamily
2JBJA 1F57A 3K2KA 1YLOA 5IB9A 1CJWA 2K5TA 1YK3A 4ZY1A 2AFZA 3IO1A 4UEEA 3WC6A 4MBUA 4UCPA 3VWDA 1Z9UA 3PEIA 5JH9A 1XBUA 3DR8A 2HC9A 3FYNA 4R87A 2D4PA 3KR5A 2C6PA 3CXSA 3H8FA 4GS4A 4JLYA 2PDOA 3TOAA 1FT7A 1CM0A 3VH9A 3ZJ0A 4CYQA 2BEIA 4KOVA 4UFXA 3TC8A 1PUAA 1U6MA 2ZXVA 4PSWA 2PRBA 4M6HA 3T8WA 3EC4A 2G3AA 3IEHA 3R9FA 2ZEHA 4U5YA 2PC1A 2QJ8A 4UWJA 2Z3NA 1S7KA 3NH8A 4FD6A 4TWEA 1Z8XA 1ARMA 1RTQA 2D4OA 5K8PA 3IJ3A 2ZELA 4MHPA 2EVNA 4F8ZA 2C27A 3SJEA 1DE4C 3PB4X 4AVAA 1R57A 4XNHB 5D29A 4C68A 5LRJA 1IY7A 1AUGA 1QMUA 2RFHA 3RYOA 4A32A 3IFEA 2OOTA 1CP6A 5EMIA 4F0XA 1P0HA 3JRUA 4JJXA 4H89A 4M6IA 1KUYA 4A31A 4RUHA 3FNCA 3PB9X 4MFZA 3DSBA 5F47A 4EWTA 4ONUA 2POKA 5A28A 1WWZA 1MJAA 4P4JA 3TFYA 2YGWA 4DNCA 2HQYA 2EO8A 3SI1A 5IV0A 2PR1A 2P6EA 4M6GA 4FD4A 3PB7X 3MGDA 4WWVA 4I49A 2PJ7A 4P10A 3OWCA 1JWQA 3FEDA 4P6YA 1YR0A 4OADA 3NH5A 3R9EA 3FF3A 4QUSA 1MJBA 1YLEA 2WPXA 1FNOA 4JD6A 3EY5A 2AFMA 3GY9A 2I79A 4IF5A 1CP7A 4MMOA 2DF5A 2V77A 3F0AA 4P45A 5JGFA 2Q7BA 4KUBA 1YW6A 2HV2A 1XEBA 4KOXA 3SJFA 4EFDA 1UFHA 4CAEA 2B3VA 4YRHA 1S60A 5K8MA 1K4JA 4MCPA 3PBBA 3DNSA 1M4IA 3PRTA 4MFJA 4Q38A 5CPAA 4CYPA 2BO9A 3GLJA 4CS0B 3S9NA 4MFLA 5AGEA 2PVVA 3PZJA 2B58A 5DWMA 3K9TA 3GUXA 3V8IA 3QB8A 2GREA 4CAXA 4Q36A 2FIWA 5HXDA 3I1UA 3D2MA 3QAHA 4A2ZA 1PCAA 5F48A 3GKRA 2C1CA 2DPSA 2GU2A 3C26A 4G1PA 1FY7A 3H8EA 3RO0A 2EBJA 3FVLA 4PXDA 3FMCA 2GFQA 4NSQA 3B7IA 4MI4A 2PCUA 3FIXA 4KLWA 3IU1A 2JDDA 3WABA 1I1DA 1VIXA 2GLFA 4H6ZA 3NE7A 2OZUA 1YREA 3H4QA 4JYWA 3FRMA 4KORA 4KVOE 5E96A 2YNCC 4NGMA 2G9DA 2EUIA 3IU2A 4OAEA 4P4DA 1LAPA 4BINA 1MK4A 4MRIA 4YGOA 2HB6A 2Z3KA 3TE4A 2WPWA 4NGTA 2FT0A 3NH4A 1ELLP 1VGYA 1ON0A 1JQGA 1TKJA 3RZAA 4AVCA 3H5ZA 2V8DA 4QBJA 1H8LA 3VARA 1BPMA 4A38A 3NA6A 1Y0YA 4PXBA 3B3VA 4UA3A 3SJXA 4ZY0A 4NGNA 4FBEA 1YGHA 2B4BA 2PIYA 4OKOA 4QVTA 3B8GA 4KLVA 5G22A 4KOSA 2G0BA 4H6UA 1DTDA 1NE9A 4P4EA 4NGPA 4IK2A 4IUSA 2CTBA 3BJ8A 4TNUA 5FVJA 4OLLA 3BJ7A 3S9MA 3R95A 2B4DB 2P0WA 2FVGA 4A94A 4M85A 4MXUA 2ZEOA 3R1KA 1I21A 1GYTA 3PB8X 1OBRA 3S6FA 1GHEA 4UBRA 5J1QA 4HNWB 5AG5A 4W9YA 3TO7A 2PIZA 2DPTA 1XFOA 2IL4A 4KSAA 2PJ3A 1LAMA 5HVHA 1IYKA 1XMTA 3TCVA 4CGNA 1BLLE 2Q51A 4KUAA 3IWGA 1IB1E 1Z8WA 2PVWA 2ARHA 1CPSA 3BI1A 3KL9A 4J3GA 4C7HA 1QSMA 2J8MA 2OR4A 2A4NA 3JVNA 1YQEA 4P44A 1YX0A 1XF8A 2ZW4A 4KVME 2BCOA 3BXMA 4MFQA 5CNPA 2YNCA 2VZYA 2Q4ZA 1Q2DA 3GB0A 2I3CA 3TTHA 3LODA 2ZEEA 2CXAA 5DWNA 2OZHA 2Z3OA 4MCQA 2PJCA 1XJOA 4ORFA 3JTKA 2QYVA 2REEA 2Q04A 1S5KA 3IC1A 4UFVA 4XPDC 3SXOA 3W6XA 4RN7A 3W6SA 5DS0A 4NEXA 1LOKA 4B6ZA 4PPZA 1CX8A 2ANPA 2R98A 4F6AA 2ZENA 2PJ8A 3PB6X 3FJUA 5C82A 4P4FA 3SJGA 3CPXA 3CZXA 4A30A 4CAVA 3KGQA 4KOWA 4NGQA 2QIRA 4R76A 4UF4A 2WSAA 4MHYA 3N5FA 2VI7A 4GM5A 2ZEPA 1N71A 4QB9A 1BO4A 2XEGA 5GCNA 1TKFA 3KASA 2J8NA 3B3CA 2PJAA 3R9GA 3TO6A 3WC7A 5HMNA 3KHXA 3CXPA 4OIWA 4WJBA 1QQ9A 1TIQA 3TX8A 3D4UA 2YNEA 4FUUA 2FS5A 3LACA 3T90A 2VZZA 3IGRA 3D7HA 2BL1A 2FCKA 2X7BA 4IHMA 1RO5A 2NMTA 1Z5RA 3GIUA 1XMBA 3S9LA 4CGLA 5KTAA 4AG7A 2AE6A 1XE4A 1M44A 4FAIA 1ZG8A 4UWIA 3DDDA 4NFRA 2O28A 4LQ6A 2VQYA 3L2NA 3V7ZA 3IWEA 1IYLA 3A9LA 1Q2YA 1YW4A 2NYQA 2QECA 2H5MA 2PJBA 3MRUA 5A27A 1TKHA 4NGSA 4B14A 1KZFA 1Q2CA 2GIVA 2G3TA 3HLPA 2Z3PA 3ISZA 4MY3A 5BWAB 2ZOGA 1AYEA 1Z8LA 4PV6A 4ZBGA 4E8OA 5AG4A 3BHXA 3LMSA 2F7VA 2PJ0A 4XPDB 4A37A 4B5OA 5JPHA 3S6GA 4B5PB 3FX6A 2FIAA 4F9VA 1IOIA 3EFAA 3PGPA 4KSIA 4PK3A 2FXFA 3D7GA 4PK2A 2PJ6A 4II9A 4H2KA 5ELYA 3VATA 2J8RA 3VWEA 2ZEGA 1X10A 3B3WA 3FBUA 4KOUA 5AG6A 4PXCA 2FSRA 1QSOA 4XPLA 4KOTA 4C2XA 2O53A 2Z0ZA 3RBUA 1Q7LA 4P4BA 3D7DA 4R9MA 3FXTA 4OC2A 4R6TA 5LYFA 3HUVA 1S7NA 1KUVA 2PR8A 3FEEA 1J4JA 3JUWA 4AXVA 4C2ZA 2BUEA 2BSWA 2ZEDA 5LYDA 5LYIA 4A95A 1XRYA 4CRYB 2IQ6A 5HVGA 3QAYA 2CY2A 2WUUA 4ZX9A 3N7ZA 4U9ZA 5EC4A 3TO9A 4CPAA 8CPAA 3D8PA 4KS9A 4MJ8A 1Z4RA 4B11A 1PU9A 4NJQA 2PJ2A 4UFWA 4PQAA 1I12A 2GLJA 2V8HA 4K3NA 3KI9A 4OMEA 5F49A 4B13A 1XOVA 2FL4A 4YU9A 4YFJA 4AG9A 4E0AA 3R96A 4CAFA 2C6GA 4IAVA 1F2PA 1VHSA 1ZO0A 4MFKA 1XIXA 5G20A 4BD9A 4GXHA 3IIBA 2PQ8A 4JZ0A 5I4MA 4F0YA 2GANA 3CDXA 1Y7RA 4OP4A 4Q7AA 4R3KA 1Z2LA 1IOFA 3D66A 4HNYB 4JXRA 3D67A 2B4DA 4R57A 2REFA 4X8IA 4L89A 1YVKA 4DUKA 5J8FA 1YMEA 2R7HA 3RNZA 2EWBA 3DR6A 1S7FA 4ZY2A 3KHZA 3KQZA 3QNVA 2CNTA 5CBMA 3PP9A 4XPKA 1CG2A 1ZLIA 4HPSA 3CPAA 4NF1A 2CF4A 3SXNA 1BOBA 4RI1A 1S3ZA 4FD5A 2V8GA 4X2TA 4A39A 5HVFA 5H86A 1NMTA 2AFUA 1V0CA 4MCSA 1PYTB 2IMOA 1NSAA 1MJ9A 2WZNA 4YWYA 4UCNA 4Y49C 1ARLA 1BPNA 2CNMA 2Z3MA 3SHPA 5F46A 2RB7A 3WC5A 5G1ZA 4C2YA 1M4DA 2Q7SA 2Q4YA 4NJRA 4JWPA 5LRKA 1R43A 4NCZA 2Z11A 3I3GA 4R3LA 4CYOA 7CPAA 4X3RA 1LCPA 1TXRA 2WYRA 2EK9A 2XEJA 3KKWA 4LQGA 1ZG9A 4BMHA 3UY5A 5K8OA 4OC4A 5JQ4A 1ZLHA 3EXNA 1UWYA 4BBHA 2AJ6A 3DGVA 4MHZA 2JEWA 4ONWA 2ZOFA 3DLJA 2AFOA 4CAWA 1X12A 4KVXA 1KUXA 3D3SA 4M3SA 1VHOA 4UEFA 5F09A 4AB7A 5ISVA 1Y7EA 2YNDA 3LD2A 2AFSA 4A33A 5IX3A 2VEZA 4O23A 3PBEA 3F8KA 4PXEA 2Q43A 5LRGA 3H8GA 1TF8A 4FD7A 4QC6A 4MY0A 1OZPA 2J9AA 3FH4A 3W91A 1Y9WA 2R1IA 3WR7A 3KZWA 4RS2A 2PSWA 5H84A 2OU2A 1HEEA 2O4HA 3B3SA 2QMLA 2Z10A 4DYOA 3V38A 1TF9A 4ZI6A 5HH1A 1M1DA 5C88A 1VKCA 3PFEA 1WK4A 4FWUA 3P2HA 1P4NA 1Z8TA 2RC4A 1LRZA 4KZTA 4MHNA 1LFWA 2C6CA 2NSMA 2PE3A 2B3UA 4EVYA 4OC5A 4Y49B 1S7LA 1YVOA 1IU8A 1CPXA 4AVBA 3ZZIA 2Z3LA 2OZGA 2I00A 2JBKA 3EO4A 1Z4EA 4EMEA 4CRZB 2OH1A 3G3SA 2AFWA 4HKFA 4B5PA 1IGBA 1F2OA 3BLNA 2VL1A 2JEVA 4CYNA 2KCWA 2PJ1A 2XEFA 3SI2A 1BAVA 2VBQA 3GYAA 3D2PA 4UEZA 4OC3A 1Y9KA 3MN8A 4R8FA 2ZPAA 2ODFA 4MFPA 1RXTA 2PJ4A 2IJZA 2F5IA 3NFZA 5IB0A 4B10A 4JXQA 4OC0A 3SI0A 3IWWA 2AFXA 2Q44A 1SQHA 3PFOA 2VXKA 3B35A 1KWMA 1M4LA 3E0KA 3KR4A 4K30A 1QSNA 2ZW6A 2R8VA 5G21A 5AG7A 1A2ZA 3CXQA 2JDCA 1AMPA 4MHDA 4P4IA 4B12A 2V8VA 3F5BA 2CTCA 2XEIA 2PJ5A 1NSLA 4CGPA 3KQXA 5K8NA 2CNSA 4KOYA 4Z65A 2ZW7A 1B87A 4LX9A 6CPAA 5JM6A 2FE7A 1YSJA 5LYLA 2OB0A 4UIBA 4ZX8A 3T9YA 1QSTA 3D68A 3G8WA 1L0CA 2EK8A 3B3TA 2Q4VA 1LANA 2B5GA 2B5GB 3ISXA 4UIAA 3WT4A 1HDUA 1Y0RA 2DXQA 3TT2A 5KTCA 2GE3A 2ZW5A 3B2YA 4C7IA 4NGRA 5KTDA 4U9YA 2ABZA 3K9UA 5J8CA 4MCRA 1CBXA 3RAMA 4UCMA 3BI0A 3LWUA 4PSXA 2PJ9A 4OC1A 3D7FA 4L8AA 2QVPA 3I9SA 2F8HA 4ZYQA 5I0CA 2P6GA 2ATRA 1M4GA 2Y0MA 2ZEMA 3FB3A 1EE3P 2PRQA 5EBVA 5D8NA 1B6BA 4R7MA 1HDQA 1ZG7A 4CGMA 4DJLA 4KSFA 4ZGYB 3S6HA 4CGOA 2Q0YA 4XNHC 4OIDA 2P6FA 2JLMA 4LUAA 1IIDA 5THWA 3FECA 2HUZA 1QSRA 2DEAA 3NE8A 1VHEA 1IICA 3P2FA 3S6KA 1ELMP 2CIJA 3TOBA 4F9UA 2BOAA 4X5KA 4E2AA 4HNXB 4NXYA 3CT9A 1R3NA 2ZEFA
chains in the Genus database with same CATH topology
1CJWA 2K5TA 1YK3A 4MBUA 4UCPA 3VWDA 1Z9UA 3DR8A 3FYNA 4R87A 2D4PA 3CXSA 4GS4A 4JLYA 2PDOA 3TOAA 1CM0A 3ZJ0A 4CYQA 2BEIA 4KOVA 4UFXA 1PUAA 1U6MA 2ZXVA 4PSWA 2PRBA 3EC4A 2G3AA 3R9FA 4U5YA 2PC1A 4UWJA 2Z3NA 1S7KA 4FD6A 2D4OA 2EVNA 2C27A 4AVAA 1R57A 4XNHB 4C68A 3RYOA 4A32A 4F0XA 1P0HA 4JJXA 4H89A 1KUYA 4A31A 3FNCA 4MFZA 3DSBA 5F47A 4ONUA 5A28A 1WWZA 1MJAA 3TFYA 2YGWA 4DNCA 2HQYA 5IV0A 2PR1A 2P6EA 4FD4A 3MGDA 4I49A 3OWCA 1YR0A 4OADA 3R9EA 4QUSA 1MJBA 1YLEA 2WPXA 4JD6A 3EY5A 3GY9A 2I79A 4IF5A 3F0AA 2Q7BA 4KUBA 2HV2A 4KOXA 1XEBA 1UFHA 4CAEA 2B3VA 4YRHA 1S60A 1K4JA 3DNSA 1M4IA 4MFJA 4Q38A 4CYPA 4CS0B 4MFLA 5AGEA 3PZJA 2B58A 5DWMA 3V8IA 3QB8A 4CAXA 4Q36A 2FIWA 3D2MA 3QAHA 4A2ZA 5F48A 3GKRA 2DPSA 3C26A 1FY7A 4NSQA 4MI4A 3FIXA 4KLWA 3IU1A 2JDDA 1I1DA 4H6ZA 3NE7A 2OZUA 1YREA 3H4QA 3FRMA 4KORA 4KVOE 5E96A 2YNCC 2EUIA 3IU2A 4OAEA 1MK4A 4YGOA 2Z3KA 3TE4A 2WPWA 2FT0A 1ON0A 4AVCA 3H5ZA 4QBJA 4UA3A 1YGHA 2B4BA 4QVTA 3B8GA 4KLVA 5G22A 4KOSA 2G0BA 4H6UA 1NE9A 4IUSA 3BJ8A 5FVJA 4OLLA 3BJ7A 3R95A 2B4DB 2P0WA 4M85A 3R1KA 1I21A 3S6FA 1GHEA 4UBRA 4HNWB 5AG5A 3TO7A 2DPTA 2IL4A 4KSAA 1IYKA 1XMTA 3TCVA 4CGNA 4KUAA 3IWGA 1IB1E 2ARHA 4J3GA 4C7HA 1QSMA 2J8MA 2A4NA 3JVNA 1YX0A 1XF8A 2ZW4A 4KVME 4MFQA 5CNPA 2YNCA 2VZYA 1Q2DA 3TTHA 3LODA 2CXAA 5DWNA 2OZHA 2Z3OA 4ORFA 3JTKA 2REEA 4XPDC 2Q04A 1S5KA 4UFVA 3SXOA 3W6XA 3W6SA 4NEXA 2R98A 4F6AA 5C82A 4A30A 4CAVA 4KOWA 2QIRA 2WSAA 2VI7A 1N71A 4QB9A 1BO4A 5GCNA 2J8NA 3TO6A 3R9GA 5HMNA 3CXPA 1TIQA 2YNEA 2FS5A 3T90A 2VZZA 3IGRA 2BL1A 2FCKA 2X7BA 1RO5A 2NMTA 4CGLA 5KTAA 4AG7A 2AE6A 1XE4A 1M44A 4UWIA 3DDDA 2O28A 2VQYA 3IWEA 1IYLA 3A9LA 1Q2YA 2QECA 2H5MA 5A27A 4B14A 1KZFA 1Q2CA 2GIVA 2G3TA 2Z3PA 4MY3A 5BWAB 4PV6A 4ZBGA 4E8OA 5AG4A 4XPDB 5JPHA 4B5OA 3S6GA 4B5PB 2FIAA 3EFAA 3PGPA 4PK3A 2FXFA 4PK2A 4II9A 2J8RA 3VWEA 3FBUA 4KOUA 5AG6A 2FSRA 1QSOA 4XPLA 4KOTA 4C2XA 2Z0ZA 4R9MA 3FXTA 1S7NA 1KUVA 2PR8A 3JUWA 1J4JA 4C2ZA 2BUEA 2BSWA 4CRYB 4A95A 2CY2A 2WUUA 3TO9A 3N7ZA 4U9ZA 5EC4A 3D8PA 4KS9A 4MJ8A 1Z4RA 4B11A 1PU9A 4UFWA 1I12A 5F49A 4B13A 2FL4A 4YFJA 4AG9A 4E0AA 3R96A 4CAFA 1VHSA 4MFKA 1ZO0A 5G20A 1XIXA 2PQ8A 4F0YA 2GANA 1Y7RA 4R3KA 4HNYB 4JXRA 4R57A 2B4DA 2REFA 4L89A 1YVKA 5J8FA 2R7HA 3DR6A 1S7FA 2CNTA 3PP9A 4XPKA 4NF1A 3SXNA 1BOBA 4RI1A 1S3ZA 4FD5A 5H86A 1NMTA 1V0CA 1MJ9A 4UCNA 4Y49C 2CNMA 2Z3MA 3SHPA 5F46A 5G1ZA 4C2YA 1M4DA 2Q4YA 4JWPA 4NCZA 2Z11A 3I3GA 4R3LA 4CYOA 3KKWA 4BMHA 3UY5A 5JQ4A 3EXNA 4BBHA 2AJ6A 4CAWA 4KVXA 1KUXA 3D3SA 4M3SA 4AB7A 5ISVA 2YNDA 3LD2A 4A33A 5IX3A 2VEZA 3F8KA 4FD7A 4QC6A 4MY0A 1OZPA 3W91A 1Y9WA 2R1IA 3WR7A 4RS2A 2PSWA 5H84A 2OU2A 2QMLA 2Z10A 5HH1A 1M1DA 5C88A 1VKCA 1WK4A 3P2HA 1P4NA 2RC4A 1LRZA 4KZTA 2B3UA 4EVYA 4Y49B 1S7LA 1YVOA 4AVBA 3ZZIA 2Z3LA 2OZGA 2I00A 3EO4A 1Z4EA 4CRZB 2OH1A 3G3SA 4HKFA 4B5PA 3BLNA 2JEVA 4CYNA 2KCWA 2VBQA 3GYAA 3D2PA 1Y9KA 2ZPAA 4MFPA 1RXTA 2F5IA 5IB0A 4B10A 4JXQA 2Q44A 1SQHA 2VXKA 3E0KA 4K30A 5G21A 1QSNA 2ZW6A 2R8VA 5AG7A 4MHDA 3CXQA 2JDCA 4B12A 3F5BA 1NSLA 4CGPA 2CNSA 2ZW7A 1B87A 4LX9A 2FE7A 2OB0A 3T9YA 1QSTA 3G8WA 1L0CA 2Q4VA 2B5GA 2B5GB 2DXQA 3TT2A 5KTCA 2GE3A 2ZW5A 4C7IA 5KTDA 4U9YA 5J8CA 3K9UA 4UCMA 4PSXA 4L8AA 3I9SA 5I0CA 2P6GA 2ATRA 1M4GA 2Y0MA 3FB3A 5EBVA 1B6BA 4CGMA 4KSFA 4ZGYB 3S6HA 4CGOA 2Q0YA 4XNHC 2P6FA 2JLMA 4LUAA 1IIDA 2HUZA 1QSRA 1IICA 3P2FA 3S6KA 3TOBA 4X5KA 4E2AA 4HNXB 4NXYA 4KOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJW A;  2K5T A;  1YK3 A;  4MBU A;  3VWD A;  1Z9U A;  3DR8 A;  3FYN A;  4R87 A;  2D4P A;  3CXS A;  4GS4 A;  4JLY A;  2PDO A;  3TOA A;  1CM0 A;  3ZJ0 A;  2BEI A;  4KOV A;  1PUA A;  1U6M A;  2ZXV A;  4PSW A;  2PRB A;  3EC4 A;  2G3A A;  3R9F A;  4U5Y A;  2PC1 A;  4UWJ A;  1S7K A;  4FD6 A;  2D4O A;  2EVN A;  2C27 A;  4AVA A;  1R57 A;  4XNH B;  3RYO A;  1P0H A;  4JJX A;  4H89 A;  1KUY A;  3FNC A;  3DSB A;  5F47 A;  4ONU A;  1WWZ A;  1MJA A;  3TFY A;  4DNC A;  2HQY A;  5IV0 A;  2PR1 A;  2P6E A;  4FD4 A;  3MGD A;  4I49 A;  3OWC A;  1YR0 A;  4OAD A;  3R9E A;  4QUS A;  1MJB A;  1YLE A;  2WPX A;  4JD6 A;  3EY5 A;  3GY9 A;  2I79 A;  4IF5 A;  3F0A A;  2Q7B A;  4KUB A;  2HV2 A;  4KOX A;  1XEB A;  1UFH A;  2B3V A;  4YRH A;  1S60 A;  1K4J A;  3DNS A;  1M4I A;  4CS0 B;  3PZJ A;  2B58 A;  5DWM A;  3V8I A;  3QB8 A;  4CAX A;  2FIW A;  3D2M A;  3QAH A;  5F48 A;  3GKR A;  3C26 A;  1FY7 A;  4NSQ A;  4MI4 A;  3FIX A;  4KLW A;  2JDD A;  1I1D A;  4H6Z A;  3NE7 A;  2OZU A;  1YRE A;  3H4Q A;  3FRM A;  4KOR A;  4KVO E;  5E96 A;  2EUI A;  4OAE A;  1MK4 A;  4YGO A;  3TE4 A;  2WPW A;  2FT0 A;  1ON0 A;  4AVC A;  4QBJ A;  4UA3 A;  1YGH A;  2B4B A;  4QVT A;  3B8G A;  4KLV A;  4KOS A;  2G0B A;  4H6U A;  1NE9 A;  4IUS A;  3BJ8 A;  5FVJ A;  4OLL A;  3BJ7 A;  3R95 A;  2B4D B;  2P0W A;  4M85 A;  3R1K A;  1I21 A;  3S6F A;  1GHE A;  4UBR A;  4HNW B;  3TO7 A;  2IL4 A;  1IYK A;  1XMT A;  3TCV A;  4KUA A;  3IWG A;  1IB1 E;  2ARH A;  4J3G A;  1QSM A;  2J8M A;  2A4N A;  3JVN A;  1YX0 A;  1XF8 A;  2ZW4 A;  4KVM E;  5CNP A;  2VZY A;  1Q2D A;  3TTH A;  3LOD A;  5DWN A;  2OZH A;  4ORF A;  4XPD C;  2REE A;  2Q04 A;  1S5K A;  3SXO A;  3W6X A;  3W6S A;  4NEX A;  2R98 A;  4F6A A;  5C82 A;  4CAV A;  4KOW A;  2QIR A;  2VI7 A;  1N71 A;  4QB9 A;  1BO4 A;  5GCN A;  2J8N A;  3TO6 A;  3R9G A;  5HMN A;  3CXP A;  1TIQ A;  2FS5 A;  3T90 A;  2VZZ A;  3IGR A;  2BL1 A;  2FCK A;  2X7B A;  1RO5 A;  2NMT A;  5KTA A;  4AG7 A;  2AE6 A;  1XE4 A;  1M44 A;  4UWI A;  3DDD A;  2O28 A;  2VQY A;  1IYL A;  1Q2Y A;  2QEC A;  2H5M A;  1KZF A;  1Q2C A;  2GIV A;  2G3T A;  4MY3 A;  4PV6 A;  4ZBG A;  4E8O A;  4XPD B;  5JPH A;  4B5O A;  3S6G A;  4B5P B;  2FIA A;  3EFA A;  3PGP A;  4PK3 A;  2FXF A;  4PK2 A;  4II9 A;  2J8R A;  3VWE A;  3FBU A;  4KOU A;  2FSR A;  1QSO A;  4XPL A;  4KOT A;  2Z0Z A;  4R9M A;  3FXT A;  1S7N A;  1KUV A;  2PR8 A;  3JUW A;  1J4J A;  2BUE A;  2BSW A;  4CRY B;  2CY2 A;  3TO9 A;  3N7Z A;  4U9Z A;  5EC4 A;  3D8P A;  4MJ8 A;  1Z4R A;  1PU9 A;  1I12 A;  5F49 A;  2FL4 A;  4YFJ A;  4AG9 A;  4E0A A;  3R96 A;  1VHS A;  1XIX A;  2PQ8 A;  4F0Y A;  2GAN A;  1Y7R A;  4R3K A;  4HNY B;  4JXR A;  4R57 A;  2B4D A;  2REF A;  4L89 A;  1YVK A;  5J8F A;  2R7H A;  3DR6 A;  1S7F A;  2CNT A;  3PP9 A;  4XPK A;  4NF1 A;  3SXN A;  1BOB A;  4RI1 A;  1S3Z A;  4FD5 A;  5H86 A;  1NMT A;  1V0C A;  1MJ9 A;  4Y49 C;  2CNM A;  3SHP A;  5F46 A;  1M4D A;  2Q4Y A;  4JWP A;  4NCZ A;  2Z11 A;  3I3G A;  4R3L A;  3KKW A;  4BMH A;  3UY5 A;  5JQ4 A;  3EXN A;  2AJ6 A;  4CAW A;  4KVX A;  1KUX A;  3D3S A;  4M3S A;  4AB7 A;  5ISV A;  3LD2 A;  5IX3 A;  2VEZ A;  3F8K A;  4FD7 A;  4QC6 A;  4MY0 A;  1OZP A;  3W91 A;  1Y9W A;  2R1I A;  3WR7 A;  4RS2 A;  2PSW A;  5H84 A;  2OU2 A;  2QML A;  2Z10 A;  5HH1 A;  1M1D A;  5C88 A;  1VKC A;  1WK4 A;  3P2H A;  1P4N A;  2RC4 A;  1LRZ A;  4KZT A;  2B3U A;  4EVY A;  4Y49 B;  1S7L A;  1YVO A;  4AVB A;  3ZZI A;  2OZG A;  2I00 A;  3EO4 A;  1Z4E A;  4CRZ B;  2OH1 A;  3G3S A;  4HKF A;  4B5P A;  3BLN A;  2JEV A;  2KCW A;  2VBQ A;  3GYA A;  3D2P A;  1Y9K A;  2ZPA A;  1RXT A;  2F5I A;  5IB0 A;  4JXQ A;  2Q44 A;  1SQH A;  2VXK A;  3E0K A;  4K30 A;  1QSN A;  2ZW6 A;  2R8V A;  4MHD A;  3CXQ A;  2JDC A;  3F5B A;  1NSL A;  2CNS A;  2ZW7 A;  1B87 A;  4LX9 A;  2FE7 A;  2OB0 A;  3T9Y A;  1QST A;  3G8W A;  1L0C A;  2Q4V A;  2B5G A;  2B5G B;  2DXQ A;  3TT2 A;  5KTC A;  2GE3 A;  2ZW5 A;  5KTD A;  4U9Y A;  5J8C A;  3K9U A;  4PSX A;  4L8A A;  3I9S A;  5I0C A;  2P6G A;  2ATR A;  1M4G A;  2Y0M A;  3FB3 A;  5EBV A;  1B6B A;  3S6H A;  2Q0Y A;  4XNH C;  2P6F A;  2JLM A;  4LUA A;  1IID A;  2HUZ A;  1QSR A;  1IIC A;  3P2F A;  3S6K A;  3TOB A;  4X5K A;  4E2A A;  4HNX B;  4NXY A;  4KOY A; 
#chains in the Genus database with same CATH topology
 2JBJ A;  1F57 A;  3K2K A;  1YLO A;  5IB9 A;  1CJW A;  2K5T A;  1YK3 A;  4ZY1 A;  2AFZ A;  3IO1 A;  4UEE A;  3WC6 A;  4MBU A;  4UCP A;  3VWD A;  1Z9U A;  3PEI A;  5JH9 A;  1XBU A;  3DR8 A;  2HC9 A;  3FYN A;  4R87 A;  2D4P A;  3KR5 A;  2C6P A;  3CXS A;  3H8F A;  4GS4 A;  4JLY A;  2PDO A;  3TOA A;  1FT7 A;  1CM0 A;  3VH9 A;  3ZJ0 A;  4CYQ A;  2BEI A;  4KOV A;  4UFX A;  3TC8 A;  1PUA A;  1U6M A;  2ZXV A;  4PSW A;  2PRB A;  4M6H A;  3T8W A;  3EC4 A;  2G3A A;  3IEH A;  3R9F A;  2ZEH A;  4U5Y A;  2PC1 A;  2QJ8 A;  4UWJ A;  2Z3N A;  1S7K A;  3NH8 A;  4FD6 A;  4TWE A;  1Z8X A;  1ARM A;  1RTQ A;  2D4O A;  5K8P A;  3IJ3 A;  2ZEL A;  4MHP A;  2EVN A;  4F8Z A;  2C27 A;  3SJE A;  1DE4 C;  3PB4 X;  4AVA A;  1R57 A;  4XNH B;  5D29 A;  4C68 A;  5LRJ A;  1IY7 A;  1AUG A;  1QMU A;  2RFH A;  3RYO A;  4A32 A;  3IFE A;  2OOT A;  1CP6 A;  5EMI A;  4F0X A;  1P0H A;  3JRU A;  4JJX A;  4H89 A;  4M6I A;  1KUY A;  4A31 A;  4RUH A;  3FNC A;  3PB9 X;  4MFZ A;  3DSB A;  5F47 A;  4EWT A;  4ONU A;  2POK A;  5A28 A;  1WWZ A;  1MJA A;  4P4J A;  3TFY A;  2YGW A;  4DNC A;  2HQY A;  2EO8 A;  3SI1 A;  5IV0 A;  2PR1 A;  2P6E A;  4M6G A;  4FD4 A;  3PB7 X;  3MGD A;  4WWV A;  4I49 A;  2PJ7 A;  4P10 A;  3OWC A;  1JWQ A;  3FED A;  4P6Y A;  1YR0 A;  4OAD A;  3NH5 A;  3R9E A;  3FF3 A;  4QUS A;  1MJB A;  1YLE A;  2WPX A;  1FNO A;  4JD6 A;  3EY5 A;  2AFM A;  3GY9 A;  2I79 A;  4IF5 A;  1CP7 A;  4MMO A;  2DF5 A;  2V77 A;  3F0A A;  4P45 A;  5JGF A;  2Q7B A;  4KUB A;  1YW6 A;  2HV2 A;  1XEB A;  4KOX A;  3SJF A;  4EFD A;  1UFH A;  4CAE A;  2B3V A;  4YRH A;  1S60 A;  5K8M A;  1K4J A;  4MCP A;  3PBB A;  3DNS A;  1M4I A;  3PRT A;  4MFJ A;  4Q38 A;  5CPA A;  4CYP A;  2BO9 A;  3GLJ A;  4CS0 B;  3S9N A;  4MFL A;  5AGE A;  2PVV A;  3PZJ A;  2B58 A;  5DWM A;  3K9T A;  3GUX A;  3V8I A;  3QB8 A;  2GRE A;  4CAX A;  4Q36 A;  2FIW A;  5HXD A;  3I1U A;  3D2M A;  3QAH A;  4A2Z A;  1PCA A;  5F48 A;  3GKR A;  2C1C A;  2DPS A;  2GU2 A;  3C26 A;  4G1P A;  1FY7 A;  3H8E A;  3RO0 A;  2EBJ A;  3FVL A;  4PXD A;  3FMC A;  2GFQ A;  4NSQ A;  3B7I A;  4MI4 A;  2PCU A;  3FIX A;  4KLW A;  3IU1 A;  2JDD A;  3WAB A;  1I1D A;  1VIX A;  2GLF A;  4H6Z A;  3NE7 A;  2OZU A;  1YRE A;  3H4Q A;  4JYW A;  3FRM A;  4KOR A;  4KVO E;  5E96 A;  2YNC C;  4NGM A;  2G9D A;  2EUI A;  3IU2 A;  4OAE A;  4P4D A;  1LAP A;  4BIN A;  1MK4 A;  4MRI A;  4YGO A;  2HB6 A;  2Z3K A;  3TE4 A;  2WPW A;  4NGT A;  2FT0 A;  3NH4 A;  1ELL P;  1VGY A;  1ON0 A;  1JQG A;  1TKJ A;  3RZA A;  4AVC A;  3H5Z A;  2V8D A;  4QBJ A;  1H8L A;  3VAR A;  1BPM A;  4A38 A;  3NA6 A;  1Y0Y A;  4PXB A;  3B3V A;  4UA3 A;  3SJX A;  4ZY0 A;  4NGN A;  4FBE A;  1YGH A;  2B4B A;  2PIY A;  4OKO A;  4QVT A;  3B8G A;  4KLV A;  5G22 A;  4KOS A;  2G0B A;  4H6U A;  1DTD A;  1NE9 A;  4P4E A;  4NGP A;  4IK2 A;  4IUS A;  2CTB A;  3BJ8 A;  4TNU A;  5FVJ A;  4OLL A;  3BJ7 A;  3S9M A;  3R95 A;  2B4D B;  2P0W A;  2FVG A;  4A94 A;  4M85 A;  4MXU A;  2ZEO A;  3R1K A;  1I21 A;  1GYT A;  3PB8 X;  1OBR A;  3S6F A;  1GHE A;  4UBR A;  5J1Q A;  4HNW B;  5AG5 A;  4W9Y A;  3TO7 A;  2PIZ A;  2DPT A;  1XFO A;  2IL4 A;  4KSA A;  2PJ3 A;  1LAM A;  5HVH A;  1IYK A;  1XMT A;  3TCV A;  4CGN A;  1BLL E;  2Q51 A;  4KUA A;  3IWG A;  1IB1 E;  1Z8W A;  2PVW A;  2ARH A;  1CPS A;  3BI1 A;  3KL9 A;  4J3G A;  4C7H A;  1QSM A;  2J8M A;  2OR4 A;  2A4N A;  3JVN A;  1YQE A;  4P44 A;  1YX0 A;  1XF8 A;  2ZW4 A;  4KVM E;  2BCO A;  3BXM A;  4MFQ A;  5CNP A;  2YNC A;  2VZY A;  2Q4Z A;  1Q2D A;  3GB0 A;  2I3C A;  3TTH A;  3LOD A;  2ZEE A;  2CXA A;  5DWN A;  2OZH A;  2Z3O A;  4MCQ A;  2PJC A;  1XJO A;  4ORF A;  3JTK A;  2QYV A;  2REE A;  2Q04 A;  1S5K A;  3IC1 A;  4UFV A;  4XPD C;  3SXO A;  3W6X A;  4RN7 A;  3W6S A;  5DS0 A;  4NEX A;  1LOK A;  4B6Z A;  4PPZ A;  1CX8 A;  2ANP A;  2R98 A;  4F6A A;  2ZEN A;  2PJ8 A;  3PB6 X;  3FJU A;  5C82 A;  4P4F A;  3SJG A;  3CPX A;  3CZX A;  4A30 A;  4CAV A;  3KGQ A;  4KOW A;  4NGQ A;  2QIR A;  4R76 A;  4UF4 A;  2WSA A;  4MHY A;  3N5F A;  2VI7 A;  4GM5 A;  2ZEP A;  1N71 A;  4QB9 A;  1BO4 A;  2XEG A;  5GCN A;  1TKF A;  3KAS A;  2J8N A;  3B3C A;  2PJA A;  3R9G A;  3TO6 A;  3WC7 A;  5HMN A;  3KHX A;  3CXP A;  4OIW A;  4WJB A;  1QQ9 A;  1TIQ A;  3TX8 A;  3D4U A;  2YNE A;  4FUU A;  2FS5 A;  3LAC A;  3T90 A;  2VZZ A;  3IGR A;  3D7H A;  2BL1 A;  2FCK A;  2X7B A;  4IHM A;  1RO5 A;  2NMT A;  1Z5R A;  3GIU A;  1XMB A;  3S9L A;  4CGL A;  5KTA A;  4AG7 A;  2AE6 A;  1XE4 A;  1M44 A;  4FAI A;  1ZG8 A;  4UWI A;  3DDD A;  4NFR A;  2O28 A;  4LQ6 A;  2VQY A;  3L2N A;  3V7Z A;  3IWE A;  1IYL A;  3A9L A;  1Q2Y A;  1YW4 A;  2NYQ A;  2QEC A;  2H5M A;  2PJB A;  3MRU A;  5A27 A;  1TKH A;  4NGS A;  4B14 A;  1KZF A;  1Q2C A;  2GIV A;  2G3T A;  3HLP A;  2Z3P A;  3ISZ A;  4MY3 A;  5BWA B;  2ZOG A;  1AYE A;  1Z8L A;  4PV6 A;  4ZBG A;  4E8O A;  5AG4 A;  3BHX A;  3LMS A;  2F7V A;  2PJ0 A;  4XPD B;  4A37 A;  4B5O A;  5JPH A;  3S6G A;  4B5P B;  3FX6 A;  2FIA A;  4F9V A;  1IOI A;  3EFA A;  3PGP A;  4KSI A;  4PK3 A;  2FXF A;  3D7G A;  4PK2 A;  2PJ6 A;  4II9 A;  4H2K A;  5ELY A;  3VAT A;  2J8R A;  3VWE A;  2ZEG A;  1X10 A;  3B3W A;  3FBU A;  4KOU A;  5AG6 A;  4PXC A;  2FSR A;  1QSO A;  4XPL A;  4KOT A;  4C2X A;  2O53 A;  2Z0Z A;  3RBU A;  1Q7L A;  4P4B A;  3D7D A;  4R9M A;  3FXT A;  4OC2 A;  4R6T A;  5LYF A;  3HUV A;  1S7N A;  1KUV A;  2PR8 A;  3FEE A;  1J4J A;  3JUW A;  4AXV A;  4C2Z A;  2BUE A;  2BSW A;  2ZED A;  5LYD A;  5LYI A;  4A95 A;  1XRY A;  4CRY B;  2IQ6 A;  5HVG A;  3QAY A;  2CY2 A;  2WUU A;  4ZX9 A;  3N7Z A;  4U9Z A;  5EC4 A;  3TO9 A;  4CPA A;  8CPA A;  3D8P A;  4KS9 A;  4MJ8 A;  1Z4R A;  4B11 A;  1PU9 A;  4NJQ A;  2PJ2 A;  4UFW A;  4PQA A;  1I12 A;  2GLJ A;  2V8H A;  4K3N A;  3KI9 A;  4OME A;  5F49 A;  4B13 A;  1XOV A;  2FL4 A;  4YU9 A;  4YFJ A;  4AG9 A;  4E0A A;  3R96 A;  4CAF A;  2C6G A;  4IAV A;  1F2P A;  1VHS A;  1ZO0 A;  4MFK A;  1XIX A;  5G20 A;  4BD9 A;  4GXH A;  3IIB A;  2PQ8 A;  4JZ0 A;  5I4M A;  4F0Y A;  2GAN A;  3CDX A;  1Y7R A;  4OP4 A;  4Q7A A;  4R3K A;  1Z2L A;  1IOF A;  3D66 A;  4HNY B;  4JXR A;  3D67 A;  2B4D A;  4R57 A;  2REF A;  4X8I A;  4L89 A;  1YVK A;  4DUK A;  5J8F A;  1YME A;  2R7H A;  3RNZ A;  2EWB A;  3DR6 A;  1S7F A;  4ZY2 A;  3KHZ A;  3KQZ A;  3QNV A;  2CNT A;  5CBM A;  3PP9 A;  4XPK A;  1CG2 A;  1ZLI A;  4HPS A;  3CPA A;  4NF1 A;  2CF4 A;  3SXN A;  1BOB A;  4RI1 A;  1S3Z A;  4FD5 A;  2V8G A;  4X2T A;  4A39 A;  5HVF A;  5H86 A;  1NMT A;  2AFU A;  1V0C A;  4MCS A;  1PYT B;  2IMO A;  1NSA A;  1MJ9 A;  2WZN A;  4YWY A;  4UCN A;  4Y49 C;  1ARL A;  1BPN A;  2CNM A;  2Z3M A;  3SHP A;  5F46 A;  2RB7 A;  3WC5 A;  5G1Z A;  4C2Y A;  1M4D A;  2Q7S A;  2Q4Y A;  4NJR A;  4JWP A;  5LRK A;  1R43 A;  4NCZ A;  2Z11 A;  3I3G A;  4R3L A;  4CYO A;  7CPA A;  4X3R A;  1LCP A;  1TXR A;  2WYR A;  2EK9 A;  2XEJ A;  3KKW A;  4LQG A;  1ZG9 A;  4BMH A;  3UY5 A;  5K8O A;  4OC4 A;  5JQ4 A;  1ZLH A;  3EXN A;  1UWY A;  4BBH A;  2AJ6 A;  3DGV A;  4MHZ A;  2JEW A;  4ONW A;  2ZOF A;  3DLJ A;  2AFO A;  4CAW A;  1X12 A;  4KVX A;  1KUX A;  3D3S A;  4M3S A;  1VHO A;  4UEF A;  5F09 A;  4AB7 A;  5ISV A;  1Y7E A;  2YND A;  3LD2 A;  2AFS A;  4A33 A;  5IX3 A;  2VEZ A;  4O23 A;  3PBE A;  3F8K A;  4PXE A;  2Q43 A;  5LRG A;  3H8G A;  1TF8 A;  4FD7 A;  4QC6 A;  4MY0 A;  1OZP A;  2J9A A;  3FH4 A;  3W91 A;  1Y9W A;  2R1I A;  3WR7 A;  3KZW A;  4RS2 A;  2PSW A;  5H84 A;  2OU2 A;  1HEE A;  2O4H A;  3B3S A;  2QML A;  2Z10 A;  4DYO A;  3V38 A;  1TF9 A;  4ZI6 A;  5HH1 A;  1M1D A;  5C88 A;  1VKC A;  3PFE A;  1WK4 A;  4FWU A;  3P2H A;  1P4N A;  1Z8T A;  2RC4 A;  1LRZ A;  4KZT A;  4MHN A;  1LFW A;  2C6C A;  2NSM A;  2PE3 A;  2B3U A;  4EVY A;  4OC5 A;  4Y49 B;  1S7L A;  1YVO A;  1IU8 A;  1CPX A;  4AVB A;  3ZZI A;  2Z3L A;  2OZG A;  2I00 A;  2JBK A;  3EO4 A;  1Z4E A;  4EME A;  4CRZ B;  2OH1 A;  3G3S A;  2AFW A;  4HKF A;  4B5P A;  1IGB A;  1F2O A;  3BLN A;  2VL1 A;  2JEV A;  4CYN A;  2KCW A;  2PJ1 A;  2XEF A;  3SI2 A;  1BAV A;  2VBQ A;  3GYA A;  3D2P A;  4UEZ A;  4OC3 A;  1Y9K A;  3MN8 A;  4R8F A;  2ZPA A;  2ODF A;  4MFP A;  1RXT A;  2PJ4 A;  2IJZ A;  2F5I A;  3NFZ A;  5IB0 A;  4B10 A;  4JXQ A;  4OC0 A;  3SI0 A;  3IWW A;  2AFX A;  2Q44 A;  1SQH A;  3PFO A;  2VXK A;  3B35 A;  1KWM A;  1M4L A;  3E0K A;  3KR4 A;  4K30 A;  1QSN A;  2ZW6 A;  2R8V A;  5G21 A;  5AG7 A;  1A2Z A;  3CXQ A;  2JDC A;  1AMP A;  4MHD A;  4P4I A;  4B12 A;  2V8V A;  3F5B A;  2CTC A;  2XEI A;  2PJ5 A;  1NSL A;  4CGP A;  3KQX A;  5K8N A;  2CNS A;  4KOY A;  4Z65 A;  2ZW7 A;  1B87 A;  4LX9 A;  6CPA A;  5JM6 A;  2FE7 A;  1YSJ A;  5LYL A;  2OB0 A;  4UIB A;  4ZX8 A;  3T9Y A;  1QST A;  3D68 A;  3G8W A;  1L0C A;  2EK8 A;  3B3T A;  2Q4V A;  1LAN A;  2B5G A;  2B5G B;  3ISX A;  4UIA A;  3WT4 A;  1HDU A;  1Y0R A;  2DXQ A;  3TT2 A;  5KTC A;  2GE3 A;  2ZW5 A;  3B2Y A;  4C7I A;  4NGR A;  5KTD A;  4U9Y A;  2ABZ A;  3K9U A;  5J8C A;  4MCR A;  1CBX A;  3RAM A;  4UCM A;  3BI0 A;  3LWU A;  4PSX A;  2PJ9 A;  4OC1 A;  3D7F A;  4L8A A;  2QVP A;  3I9S A;  2F8H A;  4ZYQ A;  5I0C A;  2P6G A;  2ATR A;  1M4G A;  2Y0M A;  2ZEM A;  3FB3 A;  1EE3 P;  2PRQ A;  5EBV A;  5D8N A;  1B6B A;  4R7M A;  1HDQ A;  1ZG7 A;  4CGM A;  4DJL A;  4KSF A;  4ZGY B;  3S6H A;  4CGO A;  2Q0Y A;  4XNH C;  4OID A;  2P6F A;  2JLM A;  4LUA A;  1IID A;  5THW A;  3FEC A;  2HUZ A;  1QSR A;  2DEA A;  3NE8 A;  1VHE A;  1IIC A;  3P2F A;  3S6K A;  1ELM P;  2CIJ A;  3TOB A;  4F9U A;  2BOA A;  4X5K A;  4E2A A;  4HNX B;  4NXY A;  3CT9 A;  1R3N A;  2ZEF A; 
#chains in the Genus database with same CATH homology
 1CJW A;  2K5T A;  1YK3 A;  4MBU A;  4UCP A;  3VWD A;  1Z9U A;  3DR8 A;  3FYN A;  4R87 A;  2D4P A;  3CXS A;  4GS4 A;  4JLY A;  2PDO A;  3TOA A;  1CM0 A;  3ZJ0 A;  4CYQ A;  2BEI A;  4KOV A;  4UFX A;  1PUA A;  1U6M A;  2ZXV A;  4PSW A;  2PRB A;  3EC4 A;  2G3A A;  3R9F A;  4U5Y A;  2PC1 A;  4UWJ A;  2Z3N A;  1S7K A;  4FD6 A;  2D4O A;  2EVN A;  2C27 A;  4AVA A;  1R57 A;  4XNH B;  4C68 A;  3RYO A;  4A32 A;  4F0X A;  1P0H A;  4JJX A;  4H89 A;  1KUY A;  4A31 A;  3FNC A;  4MFZ A;  3DSB A;  5F47 A;  4ONU A;  5A28 A;  1WWZ A;  1MJA A;  3TFY A;  2YGW A;  4DNC A;  2HQY A;  5IV0 A;  2PR1 A;  2P6E A;  4FD4 A;  3MGD A;  4I49 A;  3OWC A;  1YR0 A;  4OAD A;  3R9E A;  4QUS A;  1MJB A;  1YLE A;  2WPX A;  4JD6 A;  3EY5 A;  3GY9 A;  2I79 A;  4IF5 A;  3F0A A;  2Q7B A;  4KUB A;  2HV2 A;  4KOX A;  1XEB A;  1UFH A;  4CAE A;  2B3V A;  4YRH A;  1S60 A;  1K4J A;  3DNS A;  1M4I A;  4MFJ A;  4Q38 A;  4CYP A;  4CS0 B;  4MFL A;  5AGE A;  3PZJ A;  2B58 A;  5DWM A;  3V8I A;  3QB8 A;  4CAX A;  4Q36 A;  2FIW A;  3D2M A;  3QAH A;  4A2Z A;  5F48 A;  3GKR A;  2DPS A;  3C26 A;  1FY7 A;  4NSQ A;  4MI4 A;  3FIX A;  4KLW A;  3IU1 A;  2JDD A;  1I1D A;  4H6Z A;  3NE7 A;  2OZU A;  1YRE A;  3H4Q A;  3FRM A;  4KOR A;  4KVO E;  5E96 A;  2YNC C;  2EUI A;  3IU2 A;  4OAE A;  1MK4 A;  4YGO A;  2Z3K A;  3TE4 A;  2WPW A;  2FT0 A;  1ON0 A;  4AVC A;  3H5Z A;  4QBJ A;  4UA3 A;  1YGH A;  2B4B A;  4QVT A;  3B8G A;  4KLV A;  5G22 A;  4KOS A;  2G0B A;  4H6U A;  1NE9 A;  4IUS A;  3BJ8 A;  5FVJ A;  4OLL A;  3BJ7 A;  3R95 A;  2B4D B;  2P0W A;  4M85 A;  3R1K A;  1I21 A;  3S6F A;  1GHE A;  4UBR A;  4HNW B;  5AG5 A;  3TO7 A;  2DPT A;  2IL4 A;  4KSA A;  1IYK A;  1XMT A;  3TCV A;  4CGN A;  4KUA A;  3IWG A;  1IB1 E;  2ARH A;  4J3G A;  4C7H A;  1QSM A;  2J8M A;  2A4N A;  3JVN A;  1YX0 A;  1XF8 A;  2ZW4 A;  4KVM E;  4MFQ A;  5CNP A;  2YNC A;  2VZY A;  1Q2D A;  3TTH A;  3LOD A;  2CXA A;  5DWN A;  2OZH A;  2Z3O A;  4ORF A;  3JTK A;  2REE A;  4XPD C;  2Q04 A;  1S5K A;  4UFV A;  3SXO A;  3W6X A;  3W6S A;  4NEX A;  2R98 A;  4F6A A;  5C82 A;  4A30 A;  4CAV A;  4KOW A;  2QIR A;  2WSA A;  2VI7 A;  1N71 A;  4QB9 A;  1BO4 A;  5GCN A;  2J8N A;  3TO6 A;  3R9G A;  5HMN A;  3CXP A;  1TIQ A;  2YNE A;  2FS5 A;  3T90 A;  2VZZ A;  3IGR A;  2BL1 A;  2FCK A;  2X7B A;  1RO5 A;  2NMT A;  4CGL A;  5KTA A;  4AG7 A;  2AE6 A;  1XE4 A;  1M44 A;  4UWI A;  3DDD A;  2O28 A;  2VQY A;  3IWE A;  1IYL A;  3A9L A;  1Q2Y A;  2QEC A;  2H5M A;  5A27 A;  4B14 A;  1KZF A;  1Q2C A;  2GIV A;  2G3T A;  2Z3P A;  4MY3 A;  5BWA B;  4PV6 A;  4ZBG A;  4E8O A;  5AG4 A;  4XPD B;  5JPH A;  4B5O A;  3S6G A;  4B5P B;  2FIA A;  3EFA A;  3PGP A;  4PK3 A;  2FXF A;  4PK2 A;  4II9 A;  2J8R A;  3VWE A;  3FBU A;  4KOU A;  5AG6 A;  2FSR A;  1QSO A;  4XPL A;  4KOT A;  4C2X A;  2Z0Z A;  4R9M A;  3FXT A;  1S7N A;  1KUV A;  2PR8 A;  3JUW A;  1J4J A;  4C2Z A;  2BUE A;  2BSW A;  4CRY B;  4A95 A;  2CY2 A;  2WUU A;  3TO9 A;  3N7Z A;  4U9Z A;  5EC4 A;  3D8P A;  4KS9 A;  4MJ8 A;  1Z4R A;  4B11 A;  1PU9 A;  4UFW A;  1I12 A;  5F49 A;  4B13 A;  2FL4 A;  4YFJ A;  4AG9 A;  4E0A A;  3R96 A;  4CAF A;  1VHS A;  4MFK A;  1ZO0 A;  5G20 A;  1XIX A;  2PQ8 A;  4F0Y A;  2GAN A;  1Y7R A;  4R3K A;  4HNY B;  4JXR A;  4R57 A;  2B4D A;  2REF A;  4L89 A;  1YVK A;  5J8F A;  2R7H A;  3DR6 A;  1S7F A;  2CNT A;  3PP9 A;  4XPK A;  4NF1 A;  3SXN A;  1BOB A;  4RI1 A;  1S3Z A;  4FD5 A;  5H86 A;  1NMT A;  1V0C A;  1MJ9 A;  4UCN A;  4Y49 C;  2CNM A;  2Z3M A;  3SHP A;  5F46 A;  5G1Z A;  4C2Y A;  1M4D A;  2Q4Y A;  4JWP A;  4NCZ A;  2Z11 A;  3I3G A;  4R3L A;  4CYO A;  3KKW A;  4BMH A;  3UY5 A;  5JQ4 A;  3EXN A;  4BBH A;  2AJ6 A;  4CAW A;  4KVX A;  1KUX A;  3D3S A;  4M3S A;  4AB7 A;  5ISV A;  2YND A;  3LD2 A;  4A33 A;  5IX3 A;  2VEZ A;  3F8K A;  4FD7 A;  4QC6 A;  4MY0 A;  1OZP A;  3W91 A;  1Y9W A;  2R1I A;  3WR7 A;  4RS2 A;  2PSW A;  5H84 A;  2OU2 A;  2QML A;  2Z10 A;  5HH1 A;  1M1D A;  5C88 A;  1VKC A;  1WK4 A;  3P2H A;  1P4N A;  2RC4 A;  1LRZ A;  4KZT A;  2B3U A;  4EVY A;  4Y49 B;  1S7L A;  1YVO A;  4AVB A;  3ZZI A;  2Z3L A;  2OZG A;  2I00 A;  3EO4 A;  1Z4E A;  4CRZ B;  2OH1 A;  3G3S A;  4HKF A;  4B5P A;  3BLN A;  2JEV A;  4CYN A;  2KCW A;  2VBQ A;  3GYA A;  3D2P A;  1Y9K A;  2ZPA A;  4MFP A;  1RXT A;  2F5I A;  5IB0 A;  4B10 A;  4JXQ A;  2Q44 A;  1SQH A;  2VXK A;  3E0K A;  4K30 A;  5G21 A;  1QSN A;  2ZW6 A;  2R8V A;  5AG7 A;  4MHD A;  3CXQ A;  2JDC A;  4B12 A;  3F5B A;  1NSL A;  4CGP A;  2CNS A;  2ZW7 A;  1B87 A;  4LX9 A;  2FE7 A;  2OB0 A;  3T9Y A;  1QST A;  3G8W A;  1L0C A;  2Q4V A;  2B5G A;  2B5G B;  2DXQ A;  3TT2 A;  5KTC A;  2GE3 A;  2ZW5 A;  4C7I A;  5KTD A;  4U9Y A;  5J8C A;  3K9U A;  4UCM A;  4PSX A;  4L8A A;  3I9S A;  5I0C A;  2P6G A;  2ATR A;  1M4G A;  2Y0M A;  3FB3 A;  5EBV A;  1B6B A;  4CGM A;  4KSF A;  4ZGY B;  3S6H A;  4CGO A;  2Q0Y A;  4XNH C;  2P6F A;  2JLM A;  4LUA A;  1IID A;  2HUZ A;  1QSR A;  1IIC A;  3P2F A;  3S6K A;  3TOB A;  4X5K A;  4E2A A;  4HNX B;  4NXY A;  4KOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...