1VHSA

Crystal structure of a putative phosphinothricin n-acetyltransferase
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
165
structure length
165
Chain Sequence
SLTLRLAEHRDLEAVVAIYNSTIASRMVTADTEPVTPEDRMEWFSGHTESRPLYVAEDENGNVAAWISFETFYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLMAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEMDGKRYDLKILGRELSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords similar to phosphinothricin acetyltransferase
total genus 41
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.3.1.183: Phosphinothricin acetyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1vhsA00
1L0CA 3EC4A 4UWIA 2P6GA 4NXYA 3V8IA 3K9UA 1MJBA 3N7ZA 3JVNA 4KOSA 2FSRA 1Z4EA 3G8WA 5F46A 3G3SA 1QSTA 3TCVA 4YGOA 4NSQA 1PU9A 2JDCA 4FD5A 1I12A 4MY0A 2ZW4A 4NF1A 4BMHA 4JJXA 4F6AA 3R96A 4EVYA 1Z9UA 5EBVA 1IICA 4F0YA 1YLEA 1RXTA 2WPXA 3P2FA 1KUXA 3IWGA 1R57A 2AJ6A 2Q04A 4U9ZA 4U5YA 4CAXA 4NCZA 4JXRA 1S3ZA 3FIXA 3TO7A 4X5KA 4E2AA 5KTCA 1YR0A 2QECA 2VXKA 3D3SA 2OZHA 2FL4A 1YREA 4HNWB 2VBQA 1M4GA 2CNTA 4H89A 2PDOA 3TOBA 3R9FA 4J3GA 1VKCA 2CNSA 4KOVA 4IF5A 4KOYA 2ZW6A 4UWJA 4KUBA 2X7BA 2BUEA 4R57A 1UFHA 4CAVA 4KOWA 3TO6A 2Q4YA 4HNXB 2RC4A 4OLLA 1Q2YA 3MGDA 1V0CA 2HV2A 4MI4A 4M85A 4QBJA 1KZFA 1B87A 3NE7A 2J8MA 1I21A 4QVTA 2BSWA 1IIDA 1ON0A 3LODA 3FNCA 4XPLA 1S7FA 2BEIA 3TO9A 4GS4A 1YGHA 1NE9A 1M1DA 1FY7A 1BO4A 1IYLA 2R1IA 2QIRA 5J8FA 2G3AA 2HQYA 4PSWA 4U9YA 4HNYB 3TE4A 3DNSA 4NEXA 1QSNA 2R98A 3T90A 4KVOE 1WK4A 4E8OA 1K4JA 3DSBA 3FB3A 2O28A 1XMTA 2FCKA 3C26A 4YFJA 3F8KA 2PRBA 1M4IA 4PSXA 2REEA 2JDDA 4KORA 1QSMA 5HMNA 1M4DA 5F47A 2PQ8A 3DDDA 1IYKA 2JLMA 1YX0A 2ZPAA 1MK4A 2OU2A 1I1DA 4AG7A 4QC6A 4AVCA 5KTAA 1U6MA 5DWNA 4FD7A 2FE7A 4AB7A 2PR8A 1N71A 3BJ7A 4KZTA 5IB0A 4QUSA 2FXFA 3TOAA 2Z0ZA 4KUAA 3PP9A 3PGPA 1XF8A 3EFAA 3ZJ0A 1BOBA 1IB1E 4KOXA 3I3GA 4L8AA 1Z4RA 1KUYA 1Q2CA 3GKRA 5CNPA 3JUWA 2A4NA 4H6ZA 3KKWA 5J8CA 5ISVA 3FXTA 4MHDA 4PK2A 2OZUA 4H6UA 2Y0MA 1CJWA 1XEBA 2CNMA 3P2HA 1KUVA 3FBUA 2B3VA 3GY9A 1YVKA 4KLVA 2CY2A 3FYNA 2P6FA 1XE4A 2B5GB 4JLYA 4LUAA 3OWCA 2PR1A 2G0BA 4KVXA 1Y9KA 4QB9A 1MJ9A 4DNCA 2Q4VA 2GANA 3T9YA 4Y49B 1P0HA 2D4PA 5JQ4A 4CS0B 4CRYB 3DR8A 3R1KA 1S7LA 4AVAA 1B6BA 2AE6A 4R87A 2PC1A 4I49A 4FD6A 1P4NA 4XPKA 4IUSA 2J8NA 5I0CA 3BJ8A 2H5MA 1MJAA 3UY5A 3B8GA 4XNHB 3R9GA 3WR7A 3F5BA 4E0AA 4ZBGA 4B5OA 3SXOA 3TTHA 3CXSA 1LRZA 2ZW7A 5E96A 4AG9A 5HH1A 3S6HA 2OB0A 4R3KA 2I00A 2F5IA 3LD2A 1S7KA 4RI1A 4Y49C 1Y7RA 4AVBA 3R95A 3TT2A 1NMTA 1GHEA 4KVME 4KLWA 4HKFA 1YK3A 3F0AA 1J4JA 2K5TA 2B4BA 2ZW5A 2QMLA 2B4DB 4MBUA 4JD6A 2P6EA 2WPWA 2GE3A 1S60A 2FIWA 2KCWA 2VEZA 2FIAA 2IL4A 2ARHA 2FT0A 1WWZA 2DXQA 3PZJA 3QAHA 1M44A 2VQYA 2ZXVA 4KOUA 4UA3A 2OH1A 3QB8A 2VZZA 3VWEA 4XPDB 2B5GA 2HUZA 1OZPA 3S6FA 4OAEA 3BLNA 5H84A 3W91A 2B58A 4JWPA 3IGRA 2I79A 3R9EA 1VHSA 5DWMA 2FS5A 3GYAA 4II9A 4XPDC 3E0KA 3CXQA 3ZZIA 1S7NA 3H4QA 4PV6A 3D2PA 5F49A 2ATRA 3FRMA 4B5PB 2D4OA 5F48A 4B5PA 3S6GA 3VWDA 3S6KA 2B4DA 2EUIA 2BL1A 4L89A 2JEVA 2Q0YA 3EY5A 2Z10A 4JXQA 2GIVA 3EXNA 4M3SA 1RO5A 2J8RA 2C27A 3SXNA 4FD4A 4RS2A 1NSLA 4UBRA 1QSOA 4KOTA 2REFA 4MJ8A 4R9MA 4MY3A 4CRZB 5C82A 2Q7BA 4ORFA 4YRHA 2OZGA 3W6XA 1YVOA 1QSRA 3I9SA 4CAWA 2R7HA 2Q44A 2B3UA 5C88A 1SQHA 3TFYA 2EVNA 2NMTA 2G3TA 3RYOA 4R3LA 1S5KA 4OADA 2P0WA 1CM0A 3D8PA 5FVJA 4XNHC 2R8VA 5KTDA 2PSWA 3DR6A 2VI7A 4ONUA 3CXPA 1PUAA 3EO4A 3SHPA 4LX9A 5IV0A 4PK3A 3W6SA 5H86A 1Q2DA 2Z11A 1XIXA 1Y9WA 1TIQA 5GCNA 3D2MA 4K30A 5EC4A 2VZYA 5IX3A 5JPHA
chains in the Genus database with same CATH superfamily
4WJBA 2PIYA 1L0CA 3EC4A 1LFWA 2EK9A 4UWIA 2P6GA 4NXYA 4FAIA 3V8IA 1TKHA 4A30A 3K9UA 1MJBA 3S9NA 3B7IA 3LWUA 3IO1A 4TWEA 3N7ZA 3JVNA 4KOSA 2CF4A 2FSRA 1Z4EA 3G8WA 4KSIA 4OC1A 2PJAA 1QMUA 1QSTA 1M4LA 3G3SA 3TCVA 5A27A 5F46A 3SI0A 4F0XA 4YGOA 1CBXA 2I3CA 4Q38A 4NSQA 2Z3MA 1PU9A 2JDCA 4UEZA 2RFHA 4FD5A 1I12A 1QQ9A 2Z3NA 2PJ6A 4MY0A 3FMCA 2IQ6A 2ZW4A 1IY7A 4NF1A 3T8WA 4BMHA 3PBEA 4A33A 3BI0A 4JJXA 1Z8TA 2ZEGA 4F6AA 4MRIA 3R96A 4UEEA 4EVYA 1Z9UA 5EBVA 3IEHA 3KI9A 1IICA 3FECA 4F0YA 5AG6A 1YLEA 1FT7A 1RXTA 2WPXA 4ZGYB 4B10A 2XEIA 4ONWA 4NGPA 3P2FA 3CPXA 1KUXA 3IWGA 1R57A 1ARMA 1HEEA 3ISXA 3B3WA 2AJ6A 2Q04A 4U9ZA 4M6IA 4U5YA 4UCMA 3FX6A 4CAXA 4NCZA 1ZO0A 4JXRA 5AGEA 1S3ZA 2BOAA 3FIXA 3LACA 3TO7A 4X5KA 4E2AA 1YQEA 5KTCA 1YR0A 2QECA 2VXKA 3D3SA 2OZHA 1Y7EA 4UIBA 1TF9A 4Q36A 3ISZA 1ZLHA 1AUGA 2FL4A 4CGOA 1YREA 2C6PA 4CGNA 2PJ8A 4NGTA 1YSJA 2ZEDA 4HNWB 1HDQA 2VBQA 1M4GA 2AFXA 4CPAA 4K3NA 4C7IA 2CNTA 4PXDA 4C7HA 3B35A 2PDOA 4H89A 4LQ6A 3R9FA 3TOBA 7CPAA 2PRQA 4J3GA 1DTDA 1VKCA 2CNSA 4FWUA 4OC5A 1ZG7A 4KOVA 3VARA 4X8IA 4IF5A 3SJFA 3L2NA 4KOYA 3HUVA 2GFQA 2ZW6A 2GU2A 4UWJA 2V77A 2X7BA 4KUBA 2BUEA 4R57A 1UFHA 4CAVA 2ZENA 4OC2A 4P4FA 2PJ3A 4KOWA 3RO0A 3TO6A 2Q4YA 4O23A 4HNXB 2RC4A 2ANPA 4NJRA 5CBMA 4OLLA 4P45A 2EK8A 3D66A 4PXCA 1Q2YA 2HB6A 4A39A 3MGDA 3TC8A 1V0CA 3S9MA 2ZOFA 4P4DA 1LAPA 2HV2A 5ELYA 1FNOA 3RBUA 4EMEA 4A38A 3SI2A 3D4UA 5LYLA 4MI4A 4M85A 3NH4A 3S9LA 3PFEA 4QBJA 1KZFA 4KS9A 1B87A 4MFLA 3NE7A 4JZ0A 2J8MA 2Q43A 4LQGA 4UEFA 1I21A 4RN7A 4UFVA 4QVTA 2BSWA 4ZY1A 4UFXA 1IIDA 1ON0A 1CX8A 3LODA 3FNCA 1F57A 1XRYA 4XPLA 1S7FA 2BEIA 3RNZA 3TO9A 4PXEA 4MCQA 1OBRA 3VH9A 4GS4A 3D7GA 4YU9A 1CG2A 4HPSA 1YGHA 1NE9A 1M1DA 1BO4A 1FY7A 1BPNA 1IYLA 2R1IA 3A9LA 3FEDA 5AG4A 2QIRA 5J8FA 3D7FA 2G3AA 2HQYA 4PSWA 4B6ZA 2F7VA 4U9YA 4HNYB 3TE4A 4OC3A 1VGYA 3FJUA 3DNSA 4NEXA 1LAMA 1QSNA 2J9AA 2R98A 4JYWA 4DJLA 3T90A 1AYEA 3KHXA 1WK4A 2Z3OA 4KVOE 5CPAA 4OKOA 2V8GA 4E8OA 1K4JA 1PCAA 3PB6X 2CXAA 2GLJA 5LRKA 3SJEA 2AFUA 2O53A 3DSBA 5HVFA 1JQGA 2PJBA 5J1QA 3H5ZA 3FB3A 2O28A 1XMTA 2FCKA 3C26A 3CPAA 4YFJA 3F8KA 2PRBA 5LYFA 1CP6A 1M4IA 2EO8A 2REEA 1Z2LA 4PSXA 5G1ZA 2JDDA 2Z3KA 3JTKA 1VHOA 3K9TA 4KORA 4C68A 1IU8A 1QSMA 5HMNA 1M4DA 2PJ4A 2PJ7A 2PQ8A 5F47A 3K2KA 3DDDA 1IYKA 1XMBA 2JLMA 1YX0A 2PVWA 2ZPAA 1BAVA 1MK4A 2OU2A 6CPAA 1I1DA 4AG7A 3PB9X 2V8HA 4IAVA 4QC6A 3GUXA 4AVCA 2EWBA 3H8EA 4UCNA 1YW4A 4A2ZA 5KTAA 1U6MA 2DEAA 4F8ZA 3B3VA 5DWNA 4P4EA 4FD7A 2FE7A 3PFOA 3BHXA 4P4BA 4AB7A 2PR8A 4CAFA 1N71A 3BJ7A 4KZTA 5IB0A 4B13A 3KQXA 2POKA 4P4IA 4QUSA 2FXFA 3TOAA 5HVGA 2Z0ZA 4KUAA 4WWVA 4ZI6A 4NGQA 3PP9A 2WSAA 1XF8A 3IC1A 3PGPA 4BINA 3EFAA 5D8NA 2YNCA 4W9YA 4CAEA 3ZJ0A 3V7ZA 4EFDA 1BOBA 2YNDA 1IB1E 1Z5RA 3KQZA 3NFZA 2NYQA 3RZAA 3NH8A 5BWAB 4H2KA 4KOXA 2XEJA 2CTBA 3I3GA 4L8AA 4ZX9A 3WT4A 3CT9A 4M6HA 4CGPA 5A28A 1AMPA 1Z4RA 2PJ9A 5K8OA 1KUYA 4Z65A 5LYDA 1Q2CA 3GKRA 5CNPA 4B11A 4CYPA 3JUWA 4R6TA 2A4NA 2HC9A 4NGSA 2PJCA 4H6ZA 4ZYQA 3KKWA 3I1UA 5J8CA 3FEEA 5ISVA 2YGWA 1ZLIA 3FXTA 4MMOA 1TKFA 4MHDA 4PK2A 4NFRA 4B12A 2PVVA 2OZUA 4IHMA 2IMOA 4H6UA 4A94A 2Y0MA 4P10A 2RB7A 2JBJA 3IFEA 5I4MA 1CJWA 1XEBA 4DYOA 2CNMA 1EE3P 1TXRA 2ZEOA 2AFZA 3P2HA 1KUVA 3KR4A 3FBUA 2B3VA 1XBUA 3IU1A 4BD9A 3GY9A 1YVKA 4GM5A 4R76A 1CPSA 2CY2A 2G9DA 3FYNA 2P6FA 2CIJA 4KLVA 1XE4A 2B5GB 5DS0A 4JLYA 5G22A 3PEIA 4LUAA 4R7MA 3OWCA 2PR1A 4BBHA 4MCSA 2OOTA 2G0BA 2BCOA 1Y9KA 3FH4A 1MJ9A 3BI1A 3IJ3A 4KVXA 4QB9A 4DNCA 2Q4VA 2GANA 3T9YA 1LOKA 1P0HA 2D4PA 3B3CA 4Y49B 5JQ4A 4CS0B 3H8FA 4CRYB 3DR8A 3R1KA 1S7LA 2NSMA 4AXVA 3WABA 4AVAA 1B6BA 1Q7LA 3SJGA 2AE6A 2JEWA 4KSAA 1CP7A 5LRGA 4CYOA 3WC7A 4R87A 2FVGA 4OC4A 5JH9A 2PC1A 4I49A 2DPSA 4A32A 3H8GA 4FD6A 4GXHA 1P4NA 4XPKA 2PJ5A 4CYNA 4MXUA 3PB8X 1XFOA 4TNUA 2WYRA 2F8HA 2J8NA 4IUSA 4Q7AA 5I0CA 3BJ8A 1ELMP 2H5MA 1MJAA 1YW6A 3UY5A 3B8GA 4XNHB 3R9GA 3WR7A 3F5BA 2PCUA 4ZBGA 4E0AA 4MHZA 4B5OA 4MFKA 3DLJA 1ZG8A 3HLPA 3SXOA 3TTHA 3CXSA 3IWEA 5K8NA 1LRZA 2ZW7A 1XJOA 1H8LA 5E96A 5LYIA 3KZWA 3PB7X 5G20A 4AG9A 5HH1A 3S6HA 1R3NA 5AG7A 2OB0A 4R3KA 4FBEA 2ABZA 2I00A 4P44A 3LMSA 1KWMA 2VL1A 2F5IA 4MHYA 2C1CA 3LD2A 1S7KA 4RI1A 1ZG9A 1Y7RA 4Y49C 1A2ZA 4AVBA 1YMEA 3R95A 4CGMA 2ZEHA 3TT2A 1JWQA 2GREA 4MFZA 3NA6A 4ZY0A 1NMTA 1GHEA 2GLFA 4KVME 4NGRA 4KLWA 2PIZA 4UIAA 2IJZA 1BLLE 4HKFA 4IK2A 2XEFA 3WC6A 3JRUA 5D29A 1YK3A 3F0AA 1J4JA 2YNCC 4YWYA 4PPZA 2K5TA 3NE8A 4MHPA 2B4BA 2ZW5A 3VATA 2QMLA 2B4DB 4KSFA 4MBUA 3WC5A 4NGMA 4JD6A 5HXDA 2P6EA 1TKJA 2WPWA 2Z3PA 2ZOGA 5HVHA 2GE3A 3KHZA 2WUUA 1S60A 3GB0A 2FIWA 2KCWA 2VEZA 2JBKA 2FIAA 2IL4A 4MFQA 3CDXA 5AG5A 2ARHA 5F09A 2FT0A 1WWZA 4G1PA 4OIWA 4PQAA 2ZEMA 1IGBA 8CPAA 2DXQA 1YLOA 2CTCA 3PZJA 3GLJA 1M44A 2ZELA 1F2PA 3QAHA 4M6GA 3V38A 4X2TA 2VQYA 3CZXA 2ZXVA 2PE3A 4KOUA 2OH1A 4UA3A 3QB8A 1HDUA 2VZZA 1LANA 2WZNA 4F9VA 3VWEA 4MCPA 2B5GA 4XPDB 3KGQA 3QNVA 4NGNA 3PRTA 2HUZA 4A31A 1OZPA 3S6FA 2ZEFA 2O4HA 4RUHA 2C6GA 4OAEA 1R43A 4MFPA 1CPXA 3D67A 3BLNA 5H84A 4C2ZA 3W91A 2B58A 3KR5A 3IGRA 4JWPA 2DPTA 2I79A 3R9EA 1VHSA 3IU2A 5DWMA 2FS5A 2ZEPA 3GYAA 2BO9A 3N5FA 4XPDC 4DUKA 4II9A 4UF4A 3E0KA 3CXQA 2EBJA 3MRUA 3D68A 4MHNA 2AFMA 3ZZIA 4C2YA 1S7NA 3D7HA 3H4QA 2V8VA 4PV6A 1TF8A 1PYTB 3D2PA 5F49A 2ATRA 3FRMA 4B5PB 2D4OA 1LCPA 5F48A 4B5PA 3S6GA 3FVLA 3VWDA 3S6KA 5THWA 2B4DA 2EUIA 2BL1A 2PJ0A 4L89A 2JEVA 2Q4ZA 4CGLA 2Q0YA 3EY5A 5K8PA 2Z10A 4FUUA 4JXQA 4OC0A 2GIVA 3B3SA 3KL9A 3EXNA 4M3SA 4PXBA 1DE4C 3KASA 3B3TA 1X12A 1RO5A 2J8RA 2V8DA 2C27A 3PB4X 2OR4A 3SXNA 3B2YA 4FD4A 4RS2A 1NSLA 4UBRA 1QSOA 4KOTA 4UFWA 2REFA 2ZEEA 4MJ8A 4B14A 4R9MA 5K8MA 4MY3A 2ODFA 4MFJA 4CRZB 5C82A 2Q7BA 4ORFA 2AFWA 2Q7SA 3SJXA 4EWTA 4YRHA 2OZGA 3W6XA 1YVOA 1QSRA 2Q51A 1X10A 1Z8LA 3I9SA 4CAWA 2C6CA 2R7HA 2Q44A 2B3UA 1ARLA 5C88A 2Z3LA 5LRJA 2AFOA 4X3RA 1SQHA 2YNEA 3TFYA 2EVNA 2NMTA 2G3TA 3D7DA 1F2OA 3RYOA 1NSAA 4OMEA 4R3LA 5EMIA 1VIXA 2DF5A 1RTQA 4NJQA 2QVPA 1S5KA 1VHEA 2QJ8A 3GIUA 5JM6A 1ELLP 2XEGA 5JGFA 4OP4A 4OADA 3IWWA 1BPMA 2PJ2A 3BXMA 2PJ1A 1Y0YA 2P0WA 4A95A 1GYTA 3FF3A 1CM0A 3RAMA 4C2XA 3D8PA 1IOFA 4XNHC 2R8VA 5FVJA 5KTDA 2PSWA 3DR6A 4A37A 2VI7A 1Z8WA 3QAYA 4ONUA 4UCPA 3CXPA 3NH5A 1PUAA 2QYVA 3EO4A 5IB9A 3SHPA 4LX9A 5IV0A 4PK3A 5G21A 3W6SA 4F9UA 1Y0RA 5H86A 4MCRA 1Q2DA 3DGVA 2Z11A 1XOVA 1XIXA 1UWYA 1Z8XA 4CYQA 2AFSA 1Y9WA 1TIQA 3IIBA 4OIDA 4P4JA 5GCNA 3PBBA 4ZX8A 4P6YA 3D2MA 1IOIA 3MN8A 4K30A 5EC4A 3TX8A 2VZYA 4R8FA 4ZY2A 5IX3A 5JPHA 3SI1A
chains in the Genus database with same CATH topology
1L0CA 3EC4A 4UWIA 2P6GA 4NXYA 3V8IA 4A30A 3K9UA 1MJBA 3N7ZA 3JVNA 4KOSA 2FSRA 1Z4EA 3G8WA 5A27A 5F46A 3G3SA 1QSTA 3TCVA 4F0XA 4YGOA 4Q38A 4NSQA 2Z3MA 1PU9A 2JDCA 4FD5A 1I12A 2Z3NA 4MY0A 2ZW4A 4NF1A 4BMHA 4A33A 4JJXA 4F6AA 3R96A 4EVYA 1Z9UA 5EBVA 1IICA 4F0YA 5AG6A 1YLEA 1RXTA 2WPXA 4ZGYB 4B10A 3P2FA 1KUXA 3IWGA 1R57A 2AJ6A 2Q04A 4U9ZA 4UCMA 4U5YA 4CAXA 4NCZA 1ZO0A 4JXRA 5AGEA 1S3ZA 3FIXA 3TO7A 4X5KA 4E2AA 5KTCA 1YR0A 2QECA 2VXKA 3D3SA 2OZHA 4Q36A 2FL4A 4CGOA 1YREA 4CGNA 4HNWB 2VBQA 1M4GA 4C7IA 2CNTA 4C7HA 4H89A 2PDOA 3TOBA 3R9FA 4J3GA 1VKCA 2CNSA 4KOVA 4IF5A 4KOYA 2ZW6A 4UWJA 4KUBA 2X7BA 2BUEA 4R57A 1UFHA 4CAVA 4KOWA 3TO6A 2Q4YA 4HNXB 2RC4A 4OLLA 1Q2YA 3MGDA 1V0CA 2HV2A 4MI4A 4M85A 4QBJA 1KZFA 4KS9A 1B87A 4MFLA 3NE7A 2J8MA 4UFVA 1I21A 4QVTA 2BSWA 4UFXA 1IIDA 1ON0A 3LODA 3FNCA 4XPLA 1S7FA 2BEIA 3TO9A 4GS4A 1YGHA 1NE9A 1M1DA 1FY7A 1BO4A 1IYLA 2R1IA 3A9LA 5AG4A 2QIRA 5J8FA 2G3AA 2HQYA 4PSWA 4U9YA 4HNYB 3TE4A 3DNSA 4NEXA 1QSNA 2R98A 3T90A 4KVOE 1WK4A 2Z3OA 4E8OA 1K4JA 2CXAA 3DSBA 3H5ZA 3FB3A 2O28A 1XMTA 2FCKA 3C26A 4YFJA 3F8KA 2PRBA 1M4IA 4PSXA 2REEA 5G1ZA 2JDDA 2Z3KA 3JTKA 4C68A 4KORA 1QSMA 5HMNA 1M4DA 5F47A 2PQ8A 3DDDA 1IYKA 2JLMA 1YX0A 2ZPAA 1MK4A 2OU2A 1I1DA 4AG7A 4QC6A 4AVCA 4UCNA 4A2ZA 5KTAA 1U6MA 5DWNA 4FD7A 2FE7A 4AB7A 2PR8A 4CAFA 1N71A 3BJ7A 4KZTA 5IB0A 4B13A 4QUSA 2FXFA 3TOAA 2Z0ZA 4KUAA 3PP9A 2WSAA 1XF8A 3PGPA 3EFAA 2YNCA 4CAEA 3ZJ0A 1BOBA 2YNDA 1IB1E 5BWAB 4KOXA 3I3GA 4L8AA 4CGPA 5A28A 1Z4RA 1KUYA 4B11A 1Q2CA 3GKRA 5CNPA 4CYPA 3JUWA 2A4NA 4H6ZA 3KKWA 5J8CA 5ISVA 2YGWA 3FXTA 4MHDA 4PK2A 4B12A 2OZUA 4H6UA 2Y0MA 1CJWA 1XEBA 2CNMA 3P2HA 1KUVA 3FBUA 2B3VA 3IU1A 3GY9A 1YVKA 4KLVA 2CY2A 3FYNA 2P6FA 1XE4A 2B5GB 4JLYA 5G22A 4LUAA 3OWCA 2PR1A 4BBHA 2G0BA 4KVXA 1Y9KA 4QB9A 1MJ9A 4DNCA 2Q4VA 2GANA 3T9YA 4Y49B 1P0HA 2D4PA 5JQ4A 4CS0B 4CRYB 3DR8A 3R1KA 1S7LA 4AVAA 1B6BA 2AE6A 4KSAA 4CYOA 4R87A 2PC1A 4I49A 2DPSA 4A32A 4FD6A 1P4NA 4XPKA 4CYNA 4IUSA 2J8NA 5I0CA 3BJ8A 2H5MA 1MJAA 3UY5A 3B8GA 4XNHB 3R9GA 3WR7A 3F5BA 4E0AA 4ZBGA 4B5OA 4MFKA 3SXOA 3TTHA 3CXSA 3IWEA 1LRZA 2ZW7A 5E96A 5G20A 4AG9A 5HH1A 3S6HA 5AG7A 2OB0A 4R3KA 2I00A 2F5IA 3LD2A 1S7KA 4RI1A 4Y49C 1Y7RA 4AVBA 3R95A 4CGMA 3TT2A 4MFZA 1NMTA 1GHEA 4KVME 4KLWA 4HKFA 1YK3A 3F0AA 1J4JA 2YNCC 2K5TA 2B4BA 2ZW5A 2QMLA 2B4DB 4KSFA 4MBUA 4JD6A 2P6EA 2WPWA 2Z3PA 2GE3A 2WUUA 1S60A 2FIWA 2KCWA 2VEZA 2FIAA 2IL4A 4MFQA 5AG5A 2ARHA 2FT0A 1WWZA 2DXQA 3PZJA 3QAHA 1M44A 2VQYA 2ZXVA 4KOUA 4UA3A 2OH1A 3QB8A 2VZZA 3VWEA 4XPDB 2B5GA 4A31A 2HUZA 1OZPA 3S6FA 4OAEA 4MFPA 3BLNA 5H84A 4C2ZA 3W91A 2B58A 4JWPA 3IGRA 2DPTA 2I79A 3R9EA 1VHSA 3IU2A 5DWMA 2FS5A 3GYAA 4II9A 4XPDC 3E0KA 3CXQA 4C2YA 3ZZIA 1S7NA 3H4QA 4PV6A 3D2PA 5F49A 2ATRA 3FRMA 4B5PB 2D4OA 5F48A 4B5PA 3S6GA 3VWDA 3S6KA 2B4DA 2EUIA 2BL1A 4L89A 4CGLA 2JEVA 2Q0YA 3EY5A 2Z10A 4JXQA 2GIVA 3EXNA 4M3SA 1RO5A 2J8RA 2C27A 3SXNA 4FD4A 4RS2A 1NSLA 4UBRA 1QSOA 4KOTA 4UFWA 2REFA 4MJ8A 4B14A 4R9MA 4MY3A 4MFJA 4CRZB 5C82A 2Q7BA 4ORFA 4YRHA 2OZGA 3W6XA 1YVOA 1QSRA 3I9SA 4CAWA 2R7HA 2Q44A 2B3UA 5C88A 2Z3LA 1SQHA 2YNEA 3TFYA 2EVNA 2NMTA 2G3TA 3RYOA 4R3LA 1S5KA 4OADA 2P0WA 4A95A 1CM0A 4C2XA 3D8PA 5FVJA 4XNHC 2R8VA 5KTDA 2PSWA 3DR6A 2VI7A 4ONUA 4UCPA 3CXPA 1PUAA 3EO4A 3SHPA 4LX9A 5IV0A 4PK3A 5G21A 3W6SA 5H86A 1Q2DA 2Z11A 1XIXA 4CYQA 1Y9WA 1TIQA 5GCNA 3D2MA 4K30A 5EC4A 2VZYA 5IX3A 5JPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0C A;  3EC4 A;  4UWI A;  2P6G A;  4NXY A;  3V8I A;  3K9U A;  1MJB A;  3N7Z A;  3JVN A;  4KOS A;  2FSR A;  1Z4E A;  3G8W A;  5F46 A;  3G3S A;  1QST A;  3TCV A;  4YGO A;  4NSQ A;  1PU9 A;  2JDC A;  4FD5 A;  1I12 A;  4MY0 A;  2ZW4 A;  4NF1 A;  4BMH A;  4JJX A;  4F6A A;  3R96 A;  4EVY A;  1Z9U A;  5EBV A;  1IIC A;  4F0Y A;  1YLE A;  1RXT A;  2WPX A;  3P2F A;  1KUX A;  3IWG A;  1R57 A;  2AJ6 A;  2Q04 A;  4U9Z A;  4U5Y A;  4CAX A;  4NCZ A;  4JXR A;  1S3Z A;  3FIX A;  3TO7 A;  4X5K A;  4E2A A;  5KTC A;  1YR0 A;  2QEC A;  2VXK A;  3D3S A;  2OZH A;  2FL4 A;  1YRE A;  4HNW B;  2VBQ A;  1M4G A;  2CNT A;  4H89 A;  2PDO A;  3TOB A;  3R9F A;  4J3G A;  1VKC A;  2CNS A;  4KOV A;  4IF5 A;  4KOY A;  2ZW6 A;  4UWJ A;  4KUB A;  2X7B A;  2BUE A;  4R57 A;  1UFH A;  4CAV A;  4KOW A;  3TO6 A;  2Q4Y A;  4HNX B;  2RC4 A;  4OLL A;  1Q2Y A;  3MGD A;  1V0C A;  2HV2 A;  4MI4 A;  4M85 A;  4QBJ A;  1KZF A;  1B87 A;  3NE7 A;  2J8M A;  1I21 A;  4QVT A;  2BSW A;  1IID A;  1ON0 A;  3LOD A;  3FNC A;  4XPL A;  1S7F A;  2BEI A;  3TO9 A;  4GS4 A;  1YGH A;  1NE9 A;  1M1D A;  1FY7 A;  1BO4 A;  1IYL A;  2R1I A;  2QIR A;  5J8F A;  2G3A A;  2HQY A;  4PSW A;  4U9Y A;  4HNY B;  3TE4 A;  3DNS A;  4NEX A;  1QSN A;  2R98 A;  3T90 A;  4KVO E;  1WK4 A;  4E8O A;  1K4J A;  3DSB A;  3FB3 A;  2O28 A;  1XMT A;  2FCK A;  3C26 A;  4YFJ A;  3F8K A;  2PRB A;  1M4I A;  4PSX A;  2REE A;  2JDD A;  4KOR A;  1QSM A;  5HMN A;  1M4D A;  5F47 A;  2PQ8 A;  3DDD A;  1IYK A;  2JLM A;  1YX0 A;  2ZPA A;  1MK4 A;  2OU2 A;  1I1D A;  4AG7 A;  4QC6 A;  4AVC A;  5KTA A;  1U6M A;  5DWN A;  4FD7 A;  2FE7 A;  4AB7 A;  2PR8 A;  1N71 A;  3BJ7 A;  4KZT A;  5IB0 A;  4QUS A;  2FXF A;  3TOA A;  2Z0Z A;  4KUA A;  3PP9 A;  3PGP A;  1XF8 A;  3EFA A;  3ZJ0 A;  1BOB A;  1IB1 E;  4KOX A;  3I3G A;  4L8A A;  1Z4R A;  1KUY A;  1Q2C A;  3GKR A;  5CNP A;  3JUW A;  2A4N A;  4H6Z A;  3KKW A;  5J8C A;  5ISV A;  3FXT A;  4MHD A;  4PK2 A;  2OZU A;  4H6U A;  2Y0M A;  1CJW A;  1XEB A;  2CNM A;  3P2H A;  1KUV A;  3FBU A;  2B3V A;  3GY9 A;  1YVK A;  4KLV A;  2CY2 A;  3FYN A;  2P6F A;  1XE4 A;  2B5G B;  4JLY A;  4LUA A;  3OWC A;  2PR1 A;  2G0B A;  4KVX A;  1Y9K A;  4QB9 A;  1MJ9 A;  4DNC A;  2Q4V A;  2GAN A;  3T9Y A;  4Y49 B;  1P0H A;  2D4P A;  5JQ4 A;  4CS0 B;  4CRY B;  3DR8 A;  3R1K A;  1S7L A;  4AVA A;  1B6B A;  2AE6 A;  4R87 A;  2PC1 A;  4I49 A;  4FD6 A;  1P4N A;  4XPK A;  4IUS A;  2J8N A;  5I0C A;  3BJ8 A;  2H5M A;  1MJA A;  3UY5 A;  3B8G A;  4XNH B;  3R9G A;  3WR7 A;  3F5B A;  4E0A A;  4ZBG A;  4B5O A;  3SXO A;  3TTH A;  3CXS A;  1LRZ A;  2ZW7 A;  5E96 A;  4AG9 A;  5HH1 A;  3S6H A;  2OB0 A;  4R3K A;  2I00 A;  2F5I A;  3LD2 A;  1S7K A;  4RI1 A;  4Y49 C;  1Y7R A;  4AVB A;  3R95 A;  3TT2 A;  1NMT A;  1GHE A;  4KVM E;  4KLW A;  4HKF A;  1YK3 A;  3F0A A;  1J4J A;  2K5T A;  2B4B A;  2ZW5 A;  2QML A;  2B4D B;  4MBU A;  4JD6 A;  2P6E A;  2WPW A;  2GE3 A;  1S60 A;  2FIW A;  2KCW A;  2VEZ A;  2FIA A;  2IL4 A;  2ARH A;  2FT0 A;  1WWZ A;  2DXQ A;  3PZJ A;  3QAH A;  1M44 A;  2VQY A;  2ZXV A;  4KOU A;  4UA3 A;  2OH1 A;  3QB8 A;  2VZZ A;  3VWE A;  4XPD B;  2B5G A;  2HUZ A;  1OZP A;  3S6F A;  4OAE A;  3BLN A;  5H84 A;  3W91 A;  2B58 A;  4JWP A;  3IGR A;  2I79 A;  3R9E A;  1VHS A;  5DWM A;  2FS5 A;  3GYA A;  4II9 A;  4XPD C;  3E0K A;  3CXQ A;  3ZZI A;  1S7N A;  3H4Q A;  4PV6 A;  3D2P A;  5F49 A;  2ATR A;  3FRM A;  4B5P B;  2D4O A;  5F48 A;  4B5P A;  3S6G A;  3VWD A;  3S6K A;  2B4D A;  2EUI A;  2BL1 A;  4L89 A;  2JEV A;  2Q0Y A;  3EY5 A;  2Z10 A;  4JXQ A;  2GIV A;  3EXN A;  4M3S A;  1RO5 A;  2J8R A;  2C27 A;  3SXN A;  4FD4 A;  4RS2 A;  1NSL A;  4UBR A;  1QSO A;  4KOT A;  2REF A;  4MJ8 A;  4R9M A;  4MY3 A;  4CRZ B;  5C82 A;  2Q7B A;  4ORF A;  4YRH A;  2OZG A;  3W6X A;  1YVO A;  1QSR A;  3I9S A;  4CAW A;  2R7H A;  2Q44 A;  2B3U A;  5C88 A;  1SQH A;  3TFY A;  2EVN A;  2NMT A;  2G3T A;  3RYO A;  4R3L A;  1S5K A;  4OAD A;  2P0W A;  1CM0 A;  3D8P A;  5FVJ A;  4XNH C;  2R8V A;  5KTD A;  2PSW A;  3DR6 A;  2VI7 A;  4ONU A;  3CXP A;  1PUA A;  3EO4 A;  3SHP A;  4LX9 A;  5IV0 A;  4PK3 A;  3W6S A;  5H86 A;  1Q2D A;  2Z11 A;  1XIX A;  1Y9W A;  1TIQ A;  5GCN A;  3D2M A;  4K30 A;  5EC4 A;  2VZY A;  5IX3 A;  5JPH A; 
#chains in the Genus database with same CATH topology
 4WJB A;  2PIY A;  1L0C A;  3EC4 A;  1LFW A;  2EK9 A;  4UWI A;  2P6G A;  4NXY A;  4FAI A;  3V8I A;  1TKH A;  4A30 A;  3K9U A;  1MJB A;  3S9N A;  3B7I A;  3LWU A;  3IO1 A;  4TWE A;  3N7Z A;  3JVN A;  4KOS A;  2CF4 A;  2FSR A;  1Z4E A;  3G8W A;  4KSI A;  4OC1 A;  2PJA A;  1QMU A;  1QST A;  1M4L A;  3G3S A;  3TCV A;  5A27 A;  5F46 A;  3SI0 A;  4F0X A;  4YGO A;  1CBX A;  2I3C A;  4Q38 A;  4NSQ A;  2Z3M A;  1PU9 A;  2JDC A;  4UEZ A;  2RFH A;  4FD5 A;  1I12 A;  1QQ9 A;  2Z3N A;  2PJ6 A;  4MY0 A;  3FMC A;  2IQ6 A;  2ZW4 A;  1IY7 A;  4NF1 A;  3T8W A;  4BMH A;  3PBE A;  4A33 A;  3BI0 A;  4JJX A;  1Z8T A;  2ZEG A;  4F6A A;  4MRI A;  3R96 A;  4UEE A;  4EVY A;  1Z9U A;  5EBV A;  3IEH A;  3KI9 A;  1IIC A;  3FEC A;  4F0Y A;  5AG6 A;  1YLE A;  1FT7 A;  1RXT A;  2WPX A;  4ZGY B;  4B10 A;  2XEI A;  4ONW A;  4NGP A;  3P2F A;  3CPX A;  1KUX A;  3IWG A;  1R57 A;  1ARM A;  1HEE A;  3ISX A;  3B3W A;  2AJ6 A;  2Q04 A;  4U9Z A;  4M6I A;  4U5Y A;  4UCM A;  3FX6 A;  4CAX A;  4NCZ A;  1ZO0 A;  4JXR A;  5AGE A;  1S3Z A;  2BOA A;  3FIX A;  3LAC A;  3TO7 A;  4X5K A;  4E2A A;  1YQE A;  5KTC A;  1YR0 A;  2QEC A;  2VXK A;  3D3S A;  2OZH A;  1Y7E A;  4UIB A;  1TF9 A;  4Q36 A;  3ISZ A;  1ZLH A;  1AUG A;  2FL4 A;  4CGO A;  1YRE A;  2C6P A;  4CGN A;  2PJ8 A;  4NGT A;  1YSJ A;  2ZED A;  4HNW B;  1HDQ A;  2VBQ A;  1M4G A;  2AFX A;  4CPA A;  4K3N A;  4C7I A;  2CNT A;  4PXD A;  4C7H A;  3B35 A;  2PDO A;  4H89 A;  4LQ6 A;  3R9F A;  3TOB A;  7CPA A;  2PRQ A;  4J3G A;  1DTD A;  1VKC A;  2CNS A;  4FWU A;  4OC5 A;  1ZG7 A;  4KOV A;  3VAR A;  4X8I A;  4IF5 A;  3SJF A;  3L2N A;  4KOY A;  3HUV A;  2GFQ A;  2ZW6 A;  2GU2 A;  4UWJ A;  2V77 A;  2X7B A;  4KUB A;  2BUE A;  4R57 A;  1UFH A;  4CAV A;  2ZEN A;  4OC2 A;  4P4F A;  2PJ3 A;  4KOW A;  3RO0 A;  3TO6 A;  2Q4Y A;  4O23 A;  4HNX B;  2RC4 A;  2ANP A;  4NJR A;  5CBM A;  4OLL A;  4P45 A;  2EK8 A;  3D66 A;  4PXC A;  1Q2Y A;  2HB6 A;  4A39 A;  3MGD A;  3TC8 A;  1V0C A;  3S9M A;  2ZOF A;  4P4D A;  1LAP A;  2HV2 A;  5ELY A;  1FNO A;  3RBU A;  4EME A;  4A38 A;  3SI2 A;  3D4U A;  5LYL A;  4MI4 A;  4M85 A;  3NH4 A;  3S9L A;  3PFE A;  4QBJ A;  1KZF A;  4KS9 A;  1B87 A;  4MFL A;  3NE7 A;  4JZ0 A;  2J8M A;  2Q43 A;  4LQG A;  4UEF A;  1I21 A;  4RN7 A;  4UFV A;  4QVT A;  2BSW A;  4ZY1 A;  4UFX A;  1IID A;  1ON0 A;  1CX8 A;  3LOD A;  3FNC A;  1F57 A;  1XRY A;  4XPL A;  1S7F A;  2BEI A;  3RNZ A;  3TO9 A;  4PXE A;  4MCQ A;  1OBR A;  3VH9 A;  4GS4 A;  3D7G A;  4YU9 A;  1CG2 A;  4HPS A;  1YGH A;  1NE9 A;  1M1D A;  1BO4 A;  1FY7 A;  1BPN A;  1IYL A;  2R1I A;  3A9L A;  3FED A;  5AG4 A;  2QIR A;  5J8F A;  3D7F A;  2G3A A;  2HQY A;  4PSW A;  4B6Z A;  2F7V A;  4U9Y A;  4HNY B;  3TE4 A;  4OC3 A;  1VGY A;  3FJU A;  3DNS A;  4NEX A;  1LAM A;  1QSN A;  2J9A A;  2R98 A;  4JYW A;  4DJL A;  3T90 A;  1AYE A;  3KHX A;  1WK4 A;  2Z3O A;  4KVO E;  5CPA A;  4OKO A;  2V8G A;  4E8O A;  1K4J A;  1PCA A;  3PB6 X;  2CXA A;  2GLJ A;  5LRK A;  3SJE A;  2AFU A;  2O53 A;  3DSB A;  5HVF A;  1JQG A;  2PJB A;  5J1Q A;  3H5Z A;  3FB3 A;  2O28 A;  1XMT A;  2FCK A;  3C26 A;  3CPA A;  4YFJ A;  3F8K A;  2PRB A;  5LYF A;  1CP6 A;  1M4I A;  2EO8 A;  2REE A;  1Z2L A;  4PSX A;  5G1Z A;  2JDD A;  2Z3K A;  3JTK A;  1VHO A;  3K9T A;  4KOR A;  4C68 A;  1IU8 A;  1QSM A;  5HMN A;  1M4D A;  2PJ4 A;  2PJ7 A;  2PQ8 A;  5F47 A;  3K2K A;  3DDD A;  1IYK A;  1XMB A;  2JLM A;  1YX0 A;  2PVW A;  2ZPA A;  1BAV A;  1MK4 A;  2OU2 A;  6CPA A;  1I1D A;  4AG7 A;  3PB9 X;  2V8H A;  4IAV A;  4QC6 A;  3GUX A;  4AVC A;  2EWB A;  3H8E A;  4UCN A;  1YW4 A;  4A2Z A;  5KTA A;  1U6M A;  2DEA A;  4F8Z A;  3B3V A;  5DWN A;  4P4E A;  4FD7 A;  2FE7 A;  3PFO A;  3BHX A;  4P4B A;  4AB7 A;  2PR8 A;  4CAF A;  1N71 A;  3BJ7 A;  4KZT A;  5IB0 A;  4B13 A;  3KQX A;  2POK A;  4P4I A;  4QUS A;  2FXF A;  3TOA A;  5HVG A;  2Z0Z A;  4KUA A;  4WWV A;  4ZI6 A;  4NGQ A;  3PP9 A;  2WSA A;  1XF8 A;  3IC1 A;  3PGP A;  4BIN A;  3EFA A;  5D8N A;  2YNC A;  4W9Y A;  4CAE A;  3ZJ0 A;  3V7Z A;  4EFD A;  1BOB A;  2YND A;  1IB1 E;  1Z5R A;  3KQZ A;  3NFZ A;  2NYQ A;  3RZA A;  3NH8 A;  5BWA B;  4H2K A;  4KOX A;  2XEJ A;  2CTB A;  3I3G A;  4L8A A;  4ZX9 A;  3WT4 A;  3CT9 A;  4M6H A;  4CGP A;  5A28 A;  1AMP A;  1Z4R A;  2PJ9 A;  5K8O A;  1KUY A;  4Z65 A;  5LYD A;  1Q2C A;  3GKR A;  5CNP A;  4B11 A;  4CYP A;  3JUW A;  4R6T A;  2A4N A;  2HC9 A;  4NGS A;  2PJC A;  4H6Z A;  4ZYQ A;  3KKW A;  3I1U A;  5J8C A;  3FEE A;  5ISV A;  2YGW A;  1ZLI A;  3FXT A;  4MMO A;  1TKF A;  4MHD A;  4PK2 A;  4NFR A;  4B12 A;  2PVV A;  2OZU A;  4IHM A;  2IMO A;  4H6U A;  4A94 A;  2Y0M A;  4P10 A;  2RB7 A;  2JBJ A;  3IFE A;  5I4M A;  1CJW A;  1XEB A;  4DYO A;  2CNM A;  1EE3 P;  1TXR A;  2ZEO A;  2AFZ A;  3P2H A;  1KUV A;  3KR4 A;  3FBU A;  2B3V A;  1XBU A;  3IU1 A;  4BD9 A;  3GY9 A;  1YVK A;  4GM5 A;  4R76 A;  1CPS A;  2CY2 A;  2G9D A;  3FYN A;  2P6F A;  2CIJ A;  4KLV A;  1XE4 A;  2B5G B;  5DS0 A;  4JLY A;  5G22 A;  3PEI A;  4LUA A;  4R7M A;  3OWC A;  2PR1 A;  4BBH A;  4MCS A;  2OOT A;  2G0B A;  2BCO A;  1Y9K A;  3FH4 A;  1MJ9 A;  3BI1 A;  3IJ3 A;  4KVX A;  4QB9 A;  4DNC A;  2Q4V A;  2GAN A;  3T9Y A;  1LOK A;  1P0H A;  2D4P A;  3B3C A;  4Y49 B;  5JQ4 A;  4CS0 B;  3H8F A;  4CRY B;  3DR8 A;  3R1K A;  1S7L A;  2NSM A;  4AXV A;  3WAB A;  4AVA A;  1B6B A;  1Q7L A;  3SJG A;  2AE6 A;  2JEW A;  4KSA A;  1CP7 A;  5LRG A;  4CYO A;  3WC7 A;  4R87 A;  2FVG A;  4OC4 A;  5JH9 A;  2PC1 A;  4I49 A;  2DPS A;  4A32 A;  3H8G A;  4FD6 A;  4GXH A;  1P4N A;  4XPK A;  2PJ5 A;  4CYN A;  4MXU A;  3PB8 X;  1XFO A;  4TNU A;  2WYR A;  2F8H A;  2J8N A;  4IUS A;  4Q7A A;  5I0C A;  3BJ8 A;  1ELM P;  2H5M A;  1MJA A;  1YW6 A;  3UY5 A;  3B8G A;  4XNH B;  3R9G A;  3WR7 A;  3F5B A;  2PCU A;  4ZBG A;  4E0A A;  4MHZ A;  4B5O A;  4MFK A;  3DLJ A;  1ZG8 A;  3HLP A;  3SXO A;  3TTH A;  3CXS A;  3IWE A;  5K8N A;  1LRZ A;  2ZW7 A;  1XJO A;  1H8L A;  5E96 A;  5LYI A;  3KZW A;  3PB7 X;  5G20 A;  4AG9 A;  5HH1 A;  3S6H A;  1R3N A;  5AG7 A;  2OB0 A;  4R3K A;  4FBE A;  2ABZ A;  2I00 A;  4P44 A;  3LMS A;  1KWM A;  2VL1 A;  2F5I A;  4MHY A;  2C1C A;  3LD2 A;  1S7K A;  4RI1 A;  1ZG9 A;  1Y7R A;  4Y49 C;  1A2Z A;  4AVB A;  1YME A;  3R95 A;  4CGM A;  2ZEH A;  3TT2 A;  1JWQ A;  2GRE A;  4MFZ A;  3NA6 A;  4ZY0 A;  1NMT A;  1GHE A;  2GLF A;  4KVM E;  4NGR A;  4KLW A;  2PIZ A;  4UIA A;  2IJZ A;  1BLL E;  4HKF A;  4IK2 A;  2XEF A;  3WC6 A;  3JRU A;  5D29 A;  1YK3 A;  3F0A A;  1J4J A;  2YNC C;  4YWY A;  4PPZ A;  2K5T A;  3NE8 A;  4MHP A;  2B4B A;  2ZW5 A;  3VAT A;  2QML A;  2B4D B;  4KSF A;  4MBU A;  3WC5 A;  4NGM A;  4JD6 A;  5HXD A;  2P6E A;  1TKJ A;  2WPW A;  2Z3P A;  2ZOG A;  5HVH A;  2GE3 A;  3KHZ A;  2WUU A;  1S60 A;  3GB0 A;  2FIW A;  2KCW A;  2VEZ A;  2JBK A;  2FIA A;  2IL4 A;  4MFQ A;  3CDX A;  5AG5 A;  2ARH A;  5F09 A;  2FT0 A;  1WWZ A;  4G1P A;  4OIW A;  4PQA A;  2ZEM A;  1IGB A;  8CPA A;  2DXQ A;  1YLO A;  2CTC A;  3PZJ A;  3GLJ A;  1M44 A;  2ZEL A;  1F2P A;  3QAH A;  4M6G A;  3V38 A;  4X2T A;  2VQY A;  3CZX A;  2ZXV A;  2PE3 A;  4KOU A;  2OH1 A;  4UA3 A;  3QB8 A;  1HDU A;  2VZZ A;  1LAN A;  2WZN A;  4F9V A;  3VWE A;  4MCP A;  2B5G A;  4XPD B;  3KGQ A;  3QNV A;  4NGN A;  3PRT A;  2HUZ A;  4A31 A;  1OZP A;  3S6F A;  2ZEF A;  2O4H A;  4RUH A;  2C6G A;  4OAE A;  1R43 A;  4MFP A;  1CPX A;  3D67 A;  3BLN A;  5H84 A;  4C2Z A;  3W91 A;  2B58 A;  3KR5 A;  3IGR A;  4JWP A;  2DPT A;  2I79 A;  3R9E A;  1VHS A;  3IU2 A;  5DWM A;  2FS5 A;  2ZEP A;  3GYA A;  2BO9 A;  3N5F A;  4XPD C;  4DUK A;  4II9 A;  4UF4 A;  3E0K A;  3CXQ A;  2EBJ A;  3MRU A;  3D68 A;  4MHN A;  2AFM A;  3ZZI A;  4C2Y A;  1S7N A;  3D7H A;  3H4Q A;  2V8V A;  4PV6 A;  1TF8 A;  1PYT B;  3D2P A;  5F49 A;  2ATR A;  3FRM A;  4B5P B;  2D4O A;  1LCP A;  5F48 A;  4B5P A;  3S6G A;  3FVL A;  3VWD A;  3S6K A;  5THW A;  2B4D A;  2EUI A;  2BL1 A;  2PJ0 A;  4L89 A;  2JEV A;  2Q4Z A;  4CGL A;  2Q0Y A;  3EY5 A;  5K8P A;  2Z10 A;  4FUU A;  4JXQ A;  4OC0 A;  2GIV A;  3B3S A;  3KL9 A;  3EXN A;  4M3S A;  4PXB A;  1DE4 C;  3KAS A;  3B3T A;  1X12 A;  1RO5 A;  2J8R A;  2V8D A;  2C27 A;  3PB4 X;  2OR4 A;  3SXN A;  3B2Y A;  4FD4 A;  4RS2 A;  1NSL A;  4UBR A;  1QSO A;  4KOT A;  4UFW A;  2REF A;  2ZEE A;  4MJ8 A;  4B14 A;  4R9M A;  5K8M A;  4MY3 A;  2ODF A;  4MFJ A;  4CRZ B;  5C82 A;  2Q7B A;  4ORF A;  2AFW A;  2Q7S A;  3SJX A;  4EWT A;  4YRH A;  2OZG A;  3W6X A;  1YVO A;  1QSR A;  2Q51 A;  1X10 A;  1Z8L A;  3I9S A;  4CAW A;  2C6C A;  2R7H A;  2Q44 A;  2B3U A;  1ARL A;  5C88 A;  2Z3L A;  5LRJ A;  2AFO A;  4X3R A;  1SQH A;  2YNE A;  3TFY A;  2EVN A;  2NMT A;  2G3T A;  3D7D A;  1F2O A;  3RYO A;  1NSA A;  4OME A;  4R3L A;  5EMI A;  1VIX A;  2DF5 A;  1RTQ A;  4NJQ A;  2QVP A;  1S5K A;  1VHE A;  2QJ8 A;  3GIU A;  5JM6 A;  1ELL P;  2XEG A;  5JGF A;  4OP4 A;  4OAD A;  3IWW A;  1BPM A;  2PJ2 A;  3BXM A;  2PJ1 A;  1Y0Y A;  2P0W A;  4A95 A;  1GYT A;  3FF3 A;  1CM0 A;  3RAM A;  4C2X A;  3D8P A;  1IOF A;  4XNH C;  2R8V A;  5FVJ A;  5KTD A;  2PSW A;  3DR6 A;  4A37 A;  2VI7 A;  1Z8W A;  3QAY A;  4ONU A;  4UCP A;  3CXP A;  3NH5 A;  1PUA A;  2QYV A;  3EO4 A;  5IB9 A;  3SHP A;  4LX9 A;  5IV0 A;  4PK3 A;  5G21 A;  3W6S A;  4F9U A;  1Y0R A;  5H86 A;  4MCR A;  1Q2D A;  3DGV A;  2Z11 A;  1XOV A;  1XIX A;  1UWY A;  1Z8X A;  4CYQ A;  2AFS A;  1Y9W A;  1TIQ A;  3IIB A;  4OID A;  4P4J A;  5GCN A;  3PBB A;  4ZX8 A;  4P6Y A;  3D2M A;  1IOI A;  3MN8 A;  4K30 A;  5EC4 A;  3TX8 A;  2VZY A;  4R8F A;  4ZY2 A;  5IX3 A;  5JPH A;  3SI1 A; 
#chains in the Genus database with same CATH homology
 1L0C A;  3EC4 A;  4UWI A;  2P6G A;  4NXY A;  3V8I A;  4A30 A;  3K9U A;  1MJB A;  3N7Z A;  3JVN A;  4KOS A;  2FSR A;  1Z4E A;  3G8W A;  5A27 A;  5F46 A;  3G3S A;  1QST A;  3TCV A;  4F0X A;  4YGO A;  4Q38 A;  4NSQ A;  2Z3M A;  1PU9 A;  2JDC A;  4FD5 A;  1I12 A;  2Z3N A;  4MY0 A;  2ZW4 A;  4NF1 A;  4BMH A;  4A33 A;  4JJX A;  4F6A A;  3R96 A;  4EVY A;  1Z9U A;  5EBV A;  1IIC A;  4F0Y A;  5AG6 A;  1YLE A;  1RXT A;  2WPX A;  4ZGY B;  4B10 A;  3P2F A;  1KUX A;  3IWG A;  1R57 A;  2AJ6 A;  2Q04 A;  4U9Z A;  4UCM A;  4U5Y A;  4CAX A;  4NCZ A;  1ZO0 A;  4JXR A;  5AGE A;  1S3Z A;  3FIX A;  3TO7 A;  4X5K A;  4E2A A;  5KTC A;  1YR0 A;  2QEC A;  2VXK A;  3D3S A;  2OZH A;  4Q36 A;  2FL4 A;  4CGO A;  1YRE A;  4CGN A;  4HNW B;  2VBQ A;  1M4G A;  4C7I A;  2CNT A;  4C7H A;  4H89 A;  2PDO A;  3TOB A;  3R9F A;  4J3G A;  1VKC A;  2CNS A;  4KOV A;  4IF5 A;  4KOY A;  2ZW6 A;  4UWJ A;  4KUB A;  2X7B A;  2BUE A;  4R57 A;  1UFH A;  4CAV A;  4KOW A;  3TO6 A;  2Q4Y A;  4HNX B;  2RC4 A;  4OLL A;  1Q2Y A;  3MGD A;  1V0C A;  2HV2 A;  4MI4 A;  4M85 A;  4QBJ A;  1KZF A;  4KS9 A;  1B87 A;  4MFL A;  3NE7 A;  2J8M A;  4UFV A;  1I21 A;  4QVT A;  2BSW A;  4UFX A;  1IID A;  1ON0 A;  3LOD A;  3FNC A;  4XPL A;  1S7F A;  2BEI A;  3TO9 A;  4GS4 A;  1YGH A;  1NE9 A;  1M1D A;  1FY7 A;  1BO4 A;  1IYL A;  2R1I A;  3A9L A;  5AG4 A;  2QIR A;  5J8F A;  2G3A A;  2HQY A;  4PSW A;  4U9Y A;  4HNY B;  3TE4 A;  3DNS A;  4NEX A;  1QSN A;  2R98 A;  3T90 A;  4KVO E;  1WK4 A;  2Z3O A;  4E8O A;  1K4J A;  2CXA A;  3DSB A;  3H5Z A;  3FB3 A;  2O28 A;  1XMT A;  2FCK A;  3C26 A;  4YFJ A;  3F8K A;  2PRB A;  1M4I A;  4PSX A;  2REE A;  5G1Z A;  2JDD A;  2Z3K A;  3JTK A;  4C68 A;  4KOR A;  1QSM A;  5HMN A;  1M4D A;  5F47 A;  2PQ8 A;  3DDD A;  1IYK A;  2JLM A;  1YX0 A;  2ZPA A;  1MK4 A;  2OU2 A;  1I1D A;  4AG7 A;  4QC6 A;  4AVC A;  4UCN A;  4A2Z A;  5KTA A;  1U6M A;  5DWN A;  4FD7 A;  2FE7 A;  4AB7 A;  2PR8 A;  4CAF A;  1N71 A;  3BJ7 A;  4KZT A;  5IB0 A;  4B13 A;  4QUS A;  2FXF A;  3TOA A;  2Z0Z A;  4KUA A;  3PP9 A;  2WSA A;  1XF8 A;  3PGP A;  3EFA A;  2YNC A;  4CAE A;  3ZJ0 A;  1BOB A;  2YND A;  1IB1 E;  5BWA B;  4KOX A;  3I3G A;  4L8A A;  4CGP A;  5A28 A;  1Z4R A;  1KUY A;  4B11 A;  1Q2C A;  3GKR A;  5CNP A;  4CYP A;  3JUW A;  2A4N A;  4H6Z A;  3KKW A;  5J8C A;  5ISV A;  2YGW A;  3FXT A;  4MHD A;  4PK2 A;  4B12 A;  2OZU A;  4H6U A;  2Y0M A;  1CJW A;  1XEB A;  2CNM A;  3P2H A;  1KUV A;  3FBU A;  2B3V A;  3IU1 A;  3GY9 A;  1YVK A;  4KLV A;  2CY2 A;  3FYN A;  2P6F A;  1XE4 A;  2B5G B;  4JLY A;  5G22 A;  4LUA A;  3OWC A;  2PR1 A;  4BBH A;  2G0B A;  4KVX A;  1Y9K A;  4QB9 A;  1MJ9 A;  4DNC A;  2Q4V A;  2GAN A;  3T9Y A;  4Y49 B;  1P0H A;  2D4P A;  5JQ4 A;  4CS0 B;  4CRY B;  3DR8 A;  3R1K A;  1S7L A;  4AVA A;  1B6B A;  2AE6 A;  4KSA A;  4CYO A;  4R87 A;  2PC1 A;  4I49 A;  2DPS A;  4A32 A;  4FD6 A;  1P4N A;  4XPK A;  4CYN A;  4IUS A;  2J8N A;  5I0C A;  3BJ8 A;  2H5M A;  1MJA A;  3UY5 A;  3B8G A;  4XNH B;  3R9G A;  3WR7 A;  3F5B A;  4E0A A;  4ZBG A;  4B5O A;  4MFK A;  3SXO A;  3TTH A;  3CXS A;  3IWE A;  1LRZ A;  2ZW7 A;  5E96 A;  5G20 A;  4AG9 A;  5HH1 A;  3S6H A;  5AG7 A;  2OB0 A;  4R3K A;  2I00 A;  2F5I A;  3LD2 A;  1S7K A;  4RI1 A;  4Y49 C;  1Y7R A;  4AVB A;  3R95 A;  4CGM A;  3TT2 A;  4MFZ A;  1NMT A;  1GHE A;  4KVM E;  4KLW A;  4HKF A;  1YK3 A;  3F0A A;  1J4J A;  2YNC C;  2K5T A;  2B4B A;  2ZW5 A;  2QML A;  2B4D B;  4KSF A;  4MBU A;  4JD6 A;  2P6E A;  2WPW A;  2Z3P A;  2GE3 A;  2WUU A;  1S60 A;  2FIW A;  2KCW A;  2VEZ A;  2FIA A;  2IL4 A;  4MFQ A;  5AG5 A;  2ARH A;  2FT0 A;  1WWZ A;  2DXQ A;  3PZJ A;  3QAH A;  1M44 A;  2VQY A;  2ZXV A;  4KOU A;  4UA3 A;  2OH1 A;  3QB8 A;  2VZZ A;  3VWE A;  4XPD B;  2B5G A;  4A31 A;  2HUZ A;  1OZP A;  3S6F A;  4OAE A;  4MFP A;  3BLN A;  5H84 A;  4C2Z A;  3W91 A;  2B58 A;  4JWP A;  3IGR A;  2DPT A;  2I79 A;  3R9E A;  1VHS A;  3IU2 A;  5DWM A;  2FS5 A;  3GYA A;  4II9 A;  4XPD C;  3E0K A;  3CXQ A;  4C2Y A;  3ZZI A;  1S7N A;  3H4Q A;  4PV6 A;  3D2P A;  5F49 A;  2ATR A;  3FRM A;  4B5P B;  2D4O A;  5F48 A;  4B5P A;  3S6G A;  3VWD A;  3S6K A;  2B4D A;  2EUI A;  2BL1 A;  4L89 A;  4CGL A;  2JEV A;  2Q0Y A;  3EY5 A;  2Z10 A;  4JXQ A;  2GIV A;  3EXN A;  4M3S A;  1RO5 A;  2J8R A;  2C27 A;  3SXN A;  4FD4 A;  4RS2 A;  1NSL A;  4UBR A;  1QSO A;  4KOT A;  4UFW A;  2REF A;  4MJ8 A;  4B14 A;  4R9M A;  4MY3 A;  4MFJ A;  4CRZ B;  5C82 A;  2Q7B A;  4ORF A;  4YRH A;  2OZG A;  3W6X A;  1YVO A;  1QSR A;  3I9S A;  4CAW A;  2R7H A;  2Q44 A;  2B3U A;  5C88 A;  2Z3L A;  1SQH A;  2YNE A;  3TFY A;  2EVN A;  2NMT A;  2G3T A;  3RYO A;  4R3L A;  1S5K A;  4OAD A;  2P0W A;  4A95 A;  1CM0 A;  4C2X A;  3D8P A;  5FVJ A;  4XNH C;  2R8V A;  5KTD A;  2PSW A;  3DR6 A;  2VI7 A;  4ONU A;  4UCP A;  3CXP A;  1PUA A;  3EO4 A;  3SHP A;  4LX9 A;  5IV0 A;  4PK3 A;  5G21 A;  3W6S A;  5H86 A;  1Q2D A;  2Z11 A;  1XIX A;  4CYQ A;  1Y9W A;  1TIQ A;  5GCN A;  3D2M A;  4K30 A;  5EC4 A;  2VZY A;  5IX3 A;  5JPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...