1VHUA

Crystal structure of a putative phosphoesterase
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
192
structure length
192
Chain Sequence
MEVLFEAKVGDITLKLAQGDITQYPAKAIVNAANKRLEHGGGVAYAIAKACAGDAGLYTEISKKAMREQFGRDYIDHGEVVVTPAMNLEERGIKYVFHTVGPICSGMWSEELKEKLYKAFLGPLEKAEEMGVESIAFPAVSAGIYGCDLEKVVETFLEAVKNFKGSAVKEVALVIYDRKSAEVALKVFERSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF1521
total genus 70
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1vhuA00
4ZX8A 5CMSA 1LAPA 4GUAA 3ETIA 5CBMA 1SPVA 2LGRA 3IIDA 1LAMA 4J5QA 3EJFA 4ETKA 3T8WA 2L8RA 1VHUA 2J9AA 4GVVA 1TXZA 5D8NA 3KZWA 4ZY0A 4JCAA 3SIHA 5HIHA 3H8EA 4ABLA 3JZTA 4ZX9A 4R7MA 3EWRA 4ZY1A 3GQOA 4J5SA 1YD9A 1LCPA 1BLLE 4K3NA 5FSXA 1BPMA 3H8GA 1ZR5A 2FG1A 3EWPA 3SIJA 1ZR3A 1BPNA 2BFRA 3SIGA 2DX6A 2EWBA 5FSVA 5CB3A 2FAVA 4J4ZA 3SIIA 4KYBA 2FXKA 4ZY2A 3V2BA 4UMLA 4GVWA 4K0CA 2BFQA 3KQXA 1NJRA 3GPOA 4R6TA 5CB5A 2X47A 1TY8A 2XD7A 3H8FA 2EEEA 4JLLA 3EW5A 4TU0A 3GPGA 4ZI6A 3Q71A 3Q6ZA 3EWOA 3JRUA 4ESSA 1HJZA 3EKEA 5E3BA 4D86A 2VRIA 3IIFA 3IJ3A 3KR4A 4JGKA 4IQYA 5HOLA 4JVVA 4R76A 2AFCA 5FSZA 1LANA 3EJGA 4KSIA 3EWQA 5AILA 3KR5A 4ZYQA 4X2TA 5DUSA 5FSYA 4ETJA 1GYTA 3GPQA 4J5RA 3V45A 4ABKA 3VFQA 5FSUA 3KQZA 3PEIA 2ACFA 3GQEA
chains in the Genus database with same CATH superfamily
4ZX8A 5CMSA 1LAPA 4GUAA 3ETIA 5CBMA 1SPVA 2LGRA 3IIDA 2KQVA 1LAMA 4J5QA 3EJFA 4ETKA 3T8WA 2L8RA 1VHUA 2J9AA 4GVVA 1TXZA 5D8NA 3KZWA 4ZY0A 4JCAA 2JZFA 3SIHA 5HIHA 2JZDA 3H8EA 4ABLA 3JZTA 4ZX9A 4R7MA 3EWRA 4ZY1A 3GQOA 4J5SA 1YD9A 1LCPA 1BLLE 4K3NA 5FSXA 1BPMA 3H8GA 1ZR5A 2FG1A 3EWPA 2RNKA 1ZR3A 3SIJA 1BPNA 2BFRA 3SIGA 2DX6A 2EWBA 5FSVA 5CB3A 2FAVA 4J4ZA 3SIIA 4KYBA 2FXKA 4ZY2A 3V2BA 4UMLA 4GVWA 4K0CA 2BFQA 3KQXA 1NJRA 3GPOA 4R6TA 5CB5A 2X47A 1TY8A 2XD7A 3H8FA 2EEEA 4JLLA 3EW5A 2WCTA 4TU0A 3GPGA 4ZI6A 3Q71A 2JZEA 3Q6ZA 3EWOA 3JRUA 4ESSA 1HJZA 3EKEA 5E3BA 4D86A 2VRIA 3IIFA 3IJ3A 3KR4A 4JGKA 4IQYA 5HOLA 4JVVA 4R76A 2AFCA 5FSZA 1LANA 3EJGA 4KSIA 3EWQA 2W2GA 5AILA 3KR5A 4ZYQA 4X2TA 5DUSA 5FSYA 4ETJA 1GYTA 3GPQA 4J5RA 3V45A 4ABKA 3VFQA 5FSUA 3KQZA 3PEIA 2ACFA 3GQEA
chains in the Genus database with same CATH topology
4ZX8A 5CMSA 1LAPA 4GUAA 3ETIA 5CBMA 1SPVA 2LGRA 3IIDA 1LAMA 4J5QA 3EJFA 4ETKA 3T8WA 2L8RA 1VHUA 2J9AA 4GVVA 1TXZA 5D8NA 3KZWA 4ZY0A 4JCAA 3SIHA 5HIHA 3H8EA 4ABLA 3JZTA 4ZX9A 4R7MA 3EWRA 4ZY1A 3GQOA 4J5SA 1YD9A 1LCPA 1BLLE 4K3NA 5FSXA 1BPMA 3H8GA 1ZR5A 2FG1A 3EWPA 3SIJA 1ZR3A 1BPNA 2BFRA 3SIGA 2DX6A 2EWBA 5FSVA 5CB3A 2FAVA 4J4ZA 3SIIA 4KYBA 2FXKA 4ZY2A 3V2BA 4UMLA 4GVWA 4K0CA 2BFQA 3KQXA 1NJRA 3GPOA 4R6TA 5CB5A 2X47A 1TY8A 2XD7A 3H8FA 2EEEA 4JLLA 3EW5A 4TU0A 3GPGA 4ZI6A 3Q71A 3Q6ZA 3EWOA 3JRUA 4ESSA 1HJZA 3EKEA 5E3BA 4D86A 2VRIA 3IIFA 3IJ3A 3KR4A 4JGKA 4IQYA 5HOLA 4JVVA 4R76A 2AFCA 5FSZA 1LANA 3EJGA 4KSIA 3EWQA 5AILA 3KR5A 4ZYQA 4X2TA 5DUSA 5FSYA 4ETJA 1GYTA 3GPQA 4J5RA 3V45A 4ABKA 3VFQA 5FSUA 3KQZA 3PEIA 2ACFA 3GQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZX8 A;  5CMS A;  1LAP A;  4GUA A;  3ETI A;  5CBM A;  1SPV A;  2LGR A;  3IID A;  1LAM A;  4J5Q A;  3EJF A;  4ETK A;  3T8W A;  2L8R A;  1VHU A;  2J9A A;  4GVV A;  1TXZ A;  5D8N A;  3KZW A;  4ZY0 A;  4JCA A;  3SIH A;  5HIH A;  3H8E A;  4ABL A;  3JZT A;  4ZX9 A;  4R7M A;  3EWR A;  4ZY1 A;  3GQO A;  4J5S A;  1YD9 A;  1LCP A;  1BLL E;  4K3N A;  5FSX A;  1BPM A;  3H8G A;  1ZR5 A;  2FG1 A;  3EWP A;  3SIJ A;  1ZR3 A;  1BPN A;  2BFR A;  3SIG A;  2DX6 A;  2EWB A;  5FSV A;  5CB3 A;  2FAV A;  4J4Z A;  3SII A;  4KYB A;  2FXK A;  4ZY2 A;  3V2B A;  4UML A;  4GVW A;  4K0C A;  2BFQ A;  3KQX A;  1NJR A;  3GPO A;  4R6T A;  5CB5 A;  2X47 A;  1TY8 A;  2XD7 A;  3H8F A;  2EEE A;  4JLL A;  3EW5 A;  4TU0 A;  3GPG A;  4ZI6 A;  3Q71 A;  3Q6Z A;  3EWO A;  3JRU A;  4ESS A;  1HJZ A;  3EKE A;  5E3B A;  4D86 A;  2VRI A;  3IIF A;  3IJ3 A;  3KR4 A;  4JGK A;  4IQY A;  5HOL A;  4JVV A;  4R76 A;  2AFC A;  5FSZ A;  1LAN A;  3EJG A;  4KSI A;  3EWQ A;  5AIL A;  3KR5 A;  4ZYQ A;  4X2T A;  5DUS A;  5FSY A;  4ETJ A;  1GYT A;  3GPQ A;  4J5R A;  3V45 A;  4ABK A;  3VFQ A;  5FSU A;  3KQZ A;  3PEI A;  2ACF A;  3GQE A; 
#chains in the Genus database with same CATH topology
 4ZX8 A;  5CMS A;  1LAP A;  4GUA A;  3ETI A;  5CBM A;  1SPV A;  2LGR A;  3IID A;  2KQV A;  1LAM A;  4J5Q A;  3EJF A;  4ETK A;  3T8W A;  2L8R A;  1VHU A;  2J9A A;  4GVV A;  1TXZ A;  5D8N A;  3KZW A;  4ZY0 A;  4JCA A;  2JZF A;  3SIH A;  5HIH A;  2JZD A;  3H8E A;  4ABL A;  3JZT A;  4ZX9 A;  4R7M A;  3EWR A;  4ZY1 A;  3GQO A;  4J5S A;  1YD9 A;  1LCP A;  1BLL E;  4K3N A;  5FSX A;  1BPM A;  3H8G A;  1ZR5 A;  2FG1 A;  3EWP A;  2RNK A;  1ZR3 A;  3SIJ A;  1BPN A;  2BFR A;  3SIG A;  2DX6 A;  2EWB A;  5FSV A;  5CB3 A;  2FAV A;  4J4Z A;  3SII A;  4KYB A;  2FXK A;  4ZY2 A;  3V2B A;  4UML A;  4GVW A;  4K0C A;  2BFQ A;  3KQX A;  1NJR A;  3GPO A;  4R6T A;  5CB5 A;  2X47 A;  1TY8 A;  2XD7 A;  3H8F A;  2EEE A;  4JLL A;  3EW5 A;  2WCT A;  4TU0 A;  3GPG A;  4ZI6 A;  3Q71 A;  2JZE A;  3Q6Z A;  3EWO A;  3JRU A;  4ESS A;  1HJZ A;  3EKE A;  5E3B A;  4D86 A;  2VRI A;  3IIF A;  3IJ3 A;  3KR4 A;  4JGK A;  4IQY A;  5HOL A;  4JVV A;  4R76 A;  2AFC A;  5FSZ A;  1LAN A;  3EJG A;  4KSI A;  3EWQ A;  2W2G A;  5AIL A;  3KR5 A;  4ZYQ A;  4X2T A;  5DUS A;  5FSY A;  4ETJ A;  1GYT A;  3GPQ A;  4J5R A;  3V45 A;  4ABK A;  3VFQ A;  5FSU A;  3KQZ A;  3PEI A;  2ACF A;  3GQE A; 
#chains in the Genus database with same CATH homology
 4ZX8 A;  5CMS A;  1LAP A;  4GUA A;  3ETI A;  5CBM A;  1SPV A;  2LGR A;  3IID A;  1LAM A;  4J5Q A;  3EJF A;  4ETK A;  3T8W A;  2L8R A;  1VHU A;  2J9A A;  4GVV A;  1TXZ A;  5D8N A;  3KZW A;  4ZY0 A;  4JCA A;  3SIH A;  5HIH A;  3H8E A;  4ABL A;  3JZT A;  4ZX9 A;  4R7M A;  3EWR A;  4ZY1 A;  3GQO A;  4J5S A;  1YD9 A;  1LCP A;  1BLL E;  4K3N A;  5FSX A;  1BPM A;  3H8G A;  1ZR5 A;  2FG1 A;  3EWP A;  3SIJ A;  1ZR3 A;  1BPN A;  2BFR A;  3SIG A;  2DX6 A;  2EWB A;  5FSV A;  5CB3 A;  2FAV A;  4J4Z A;  3SII A;  4KYB A;  2FXK A;  4ZY2 A;  3V2B A;  4UML A;  4GVW A;  4K0C A;  2BFQ A;  3KQX A;  1NJR A;  3GPO A;  4R6T A;  5CB5 A;  2X47 A;  1TY8 A;  2XD7 A;  3H8F A;  2EEE A;  4JLL A;  3EW5 A;  4TU0 A;  3GPG A;  4ZI6 A;  3Q71 A;  3Q6Z A;  3EWO A;  3JRU A;  4ESS A;  1HJZ A;  3EKE A;  5E3B A;  4D86 A;  2VRI A;  3IIF A;  3IJ3 A;  3KR4 A;  4JGK A;  4IQY A;  5HOL A;  4JVV A;  4R76 A;  2AFC A;  5FSZ A;  1LAN A;  3EJG A;  4KSI A;  3EWQ A;  5AIL A;  3KR5 A;  4ZYQ A;  4X2T A;  5DUS A;  5FSY A;  4ETJ A;  1GYT A;  3GPQ A;  4J5R A;  3V45 A;  4ABK A;  3VFQ A;  5FSU A;  3KQZ A;  3PEI A;  2ACF A;  3GQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...