1VHWA

Crystal structure of purine nucleoside phosphorylase with adenosine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
237
structure length
237
Chain Sequence
b'ATPHINAQMGDFADVVLMPGDPLRAKYIAENFLDNAVQVCDVRNMFGYTGTYKGRRISVMGHGMGIPSCSIYVTELIKDYGVKKIIRVGSCGAVNEGIKVRDVVIGMGACTDSKVNRIRFKDHDFAAIADYKMVKAAEEAAKARGIDVKVGNLFSAELFYTPDPSMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALAICTVSDHIKTGEQTTSEERQNTFNEMIEIALDSVLIGDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine nucleoside phosphorylase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase
total genus 84
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vhwA00
4DA0A 3KUKA 2RJ3A 4H1TA 1PK7A 1FXUA 2PGAA 1PR5A 3PNSA 5B7PA 3IOMA 4YNBA 1JPVA 1ECPA 1ODKA 2HWUA 3OZEA 1I80A 1PR2A 2A8YA 1A69A 4BMZA 1RXSA 4GMHA 2OECA 1U1GA 3DDOA 4M7WA 5CYFA 3DPSA 1SD2A 4LDNA 3FNQA 3T94A 3OPVA 1A9OA 4OJTA 2QDKA 4D98A 1V2HE 1OTYA 2QPLA 4TTAA 3IEXA 3PNPA 1PR4A 4OY3A 1V45E 3FWPA 4LZWA 4RJ2A 1V41E 1Z35A 3NM6B 4G41A 5K1ZA 1U1FA 5F7JA 3OZDA 1NW4A 4DAOA 1OVGA 4MCHA 5DK6A 1Y1SA 1QE5A 1Y1TA 1N3IA 3E9RA 3GB9A 2OC4A 3LGSA 3DP9A 1ULAA 3O6VA 1ZL2A 1U1DA 1JYSA 1PKEA 4F2PA 4OF4A 5IFKA 3KVVA 3PHCA 1A9QA 5CYGA 3O4VA 4OGLA 3NM5A 4YMLA 1A9TA 2QTTA 3BJEA 4LNHA 4BN0A 1LX7A 5KB3A 2XRFA 1JDUA 1Z38A 3TL6A 3E9ZA 5CCDA 3NM4A 1TGYA 4TXMA 3UAYA 2Q7OE 4TS9A 4P54A 2ISCA 4G8JA 4TXLA 4QARA 1ODJA 3FAZA 1M73E 3ONVA 4WKNA 1Z34A 4DARA 4JP5A 4I2VA 5CCEA 1K9SA 3OOHA 4WKPA 1YR3A 4D9HA 3EUFA 4F3KA 4F2WA 1PR6A 4MCIA 4BMXA 5EPUA 1T8RA 2I8AA 1TCVA 5F77A 4UC0A 3U40A 1Z37A 1CG6A 4QAQA 1RXYA 1XE3A 1PF7E 1WTAA 4TXHA 3P0EA 1Z39A 2H8GA 4F3CA 1YRYE 1JE1A 2A0YA 4G89A 4ECEA 4DA6A 3F8WA 3KVYA 4TYMA 5F7XA 1T8SA 1JP7A 1ODIA 1LV8A 1T0UA 3BL6A 3E0QA 3FUCA 4D8XA 1Y6RA 1OTXA 5JPCA 1SJ9A 1OV6A 1RYZA 1G2OA 4PNPA 5CXSA 3SCZA 1Y6QA 5IU6A 2QTGA 1Y1QA 1PR1A 4L5CA 4D8VA 3UAXA 4D8YA 1Z36A 1K27A 5CXQA 4LKRA 3ODGA 3NBQA 5F7ZA 1NC1A 1RSZA 1ZOSA 1PW7A 4YO8A 1TCUA 4DAEA 1OUMA 3DJFA 3EEIA 2ON6A 3C74A 2P4SA 1ULBA 4K6OA 1JDZA 1YQUA 4FFSA 1YBFA 2HN9A 3UT6A 1LVUA 1VHJA 4WKOA 3OCCA 5FAKA 4L5YA 1U1EA 4LNAA 4QEZA 4R31A 4OGKA 4R2WA 3OF3A 3LBAA 3BSFA 1T8YA 4JOSA 1PWYE 1JDTA 1SD1A 3KU4A 2A0XA 4KN5A 3D1VA 1RXUA 5B7NA 1B8NA 3UAWA 4JWTA 3KVRA 2HRDA 1VHWA 5F73A 3MMSA 1TD1A 4M3NA 1Y1RA 4NY1A 4EB8A 1A9SA 4TXNA 4PR3A 4QATA 2B94A 2IQ5A 1SQ6A 5C80A 4DA7A 5F78A 1Z5PA 5ETJA 4MARA 3EMVA 3FOWA 4EARA 1Z5OA 1RR6A 5EUBA 2AI2A 3UAZA 1ODLA 2I4TA 4OEHA 1YQQA 1K3FA 5I3CA 3KHSA 4DA8A 1Z33A 2AI1A 1TGVA 4DABA 1OU4A 1V4NA 4IP0A 1Q1GA 5B7QA 4L5AA 1C3XA 1JDVA 4WKBA 2AI3A 3BGSA 1V3QE 4DANA 1B8OA 1A9RA 4L0MA 4X24A 3PHBE 1NC3A 3OZBA 4L6IA 3DF9A 4TS3A 3UAVA 3K8QA 4R2XA 1VFNA 4BMYA 1VMKA 4M1EA 4TXJA 3QPBA 2BSXA 5F76A 3LA8A 1RCTE 4QASA 4F1WA 5EFOA 4QFBA 3MB8A 1JDSA 1PR0A 4TTJA 1JE0A 4TTIA 4WKCA 1U1CA 4NSNA 3K8OE 1A9PA 3ENZA 2AC7A 2A0WA 2QSUA 3EUEA 3INYA 4U2KA 2OXFA 3FB1A 1RFGE 4NS1A 5B7GA 4E1VA 4GKAA 3OZCA 1CB0A 2GUWA 4GLFA 2HSWA 4YJKA 3OOEA 1V48A 1RXCA 3GGSA 5F7OA 1RT9A 1Z5NA 1T8WA 4GLJA 1PBNA 1PK9A 3P0FA 2OC9A
chains in the Genus database with same CATH superfamily
4DHEA 1RKBA 4UHHA 2UUPA 3GGOA 5EUCA 5HZMA 5JC1A 2G1KA 1DLIA 3VPCA 5IAAA 3L8DA 2DU8A 2DRIA 1CY8A 5FUWA 1N8TA 3KUUA 5BSVA 4ZO6A 2R68A 4YTEA 3FOCA 3GEGA 3MQFA 2FWIA 5CM8B 4N6NA 1US8B 1CS0B 4QYMA 3I23A 2ZUTA 2BKLA 3R7LA 2PZJA 1U7PA 2YXBA 4FCVA 2Y8EA 2XE6A 3LP6A 2GK3A 1GPWB 1QZUA 2NU9B 3GLIB 1Z6QA 3MAJA 1SXQA 4J94A 1TK2A 3FYUC 5TJ9A 3VYWA 2ZBPA 4GI3A 3ZCVA 3UHFA 1XWWA 1RKVA 1KL7A 1U2QA 2V03A 3AIMA 3PJRA 1JLRA 3IDQA 1QIHA 1HKUA 4IIFA 1IVYA 2J6HA 2XXBA 4ZK2A 1AO0A 4R83A 3VZCA 3LQ2A 1HGXA 1CUZA 3T0GA 3GT4A 3WLSA 3CEMA 4WK4B 1UC8A 3I9KA 3MJSA 5BSKA 3B3QA 1W93A 3ULKA 2OM6A 5CLFA 3BE6A 4TWBA 2FZGA 1CUUA 2H4FA 4CQLA 3W0LB 2RGAA 4D44A 2AWOA 2I2BA 1GEGA 1SWVA 4OI1A 4A7PA 5FTLA 2HMTA 1PZNA 721PA 4PCVA 3LXMA 1AZWA 2CMGA 3PA6A 2Y27A 5I48A 3DZHA 5HE8A 3Q87B 5DT9A 3NHFA 1IJBA 2GPSA 1TC2A 4Q7JB 3V4FA 5BUZA 4BVEA 4RWEA 4D8WA 1CLUA 1TO2E 3AFNA 4ETIA 5C1DA 1MAWA 5KYTA 4LNUA 3FWPA 4U2BA 4GMXA 3MTJA 5BPHA 1FFEA 5HZHA 2G9RA 1V41E 2E4XA 3X1MA 4C0KA 5DBOA 2M1ZA 3NM6B 3USZA 1UAAA 1X7XA 3EUAA 4O2RA 2GRJA 2N9UA 4RPLA 3IEPA 1U1FA 5J4HA 1W46A 3PUIA 2O05A 2ZJ6A 3IERA 1TKBA 1FYXA 3KTFA 3FY4A 3QBTA 4OQNA 5LZ7A 1CRPA 1L7AA 4RIHA 2AR7A 4ZDIA 3T4UA 2E37A 1ZD5A 2OSBA 1Y1TA 2Q1SA 4XIFA 5DSXA 4C6TA 3HKEB 4CKZA 3ON5A 2AF3C 3AKEA 3IAAA 4S1OA 4TVKA 4Y1RB 5IASA 5JRDS 1RCUA 4HMOA 3AZPA 4N9WA 1I5EA 4S24A 4ZOLA 2ANBA 5G1OA 2MSWA 3WQRA 2FSVC 2YFYA 3HV0A 3LDGA 1CF2O 2II6A 3KBBA 4MSUA 5I9MA 4M86A 1VPTA 4XQ0A 3UGQA 2PV0A 1CUBA 2ADFA 2WJ6A 3B5EA 3BK7A 3SSAA 4AY3A 2DWQA 4MVJF 2GYYA 4CCAA 1ZRHA 4LPKA 3KYIB 3Q5DA 1MIOA 1KEEA 4UNRA 3G7UA 2OHJA 4X1OA 1W9HA 4DWJA 4O8CA 1XZEA 1EXWA 2B1IA 1UT5A 3GPBA 2NU8B 3DO6A 3KKQA 2QRNA 5AOCA 4ALNA 4DIEA 1YU6A 5TE9A 1ECJA 1QP7A 1IAVA 2AW5A 1ZU4A 1J06A 4MKGA 5ELXA 4J6EA 1YULA 4QXRA 4INAA 4BKPA 1AX9A 1H2XA 3ZDQA 4COOA 3PDIA 2VHCA 3DMNA 4FX2A 1J5PA 5DP1A 5F3DA 5H81A 5K6AA 5KSWB 1ZVMA 4E09A 2ZRFA 3L1VA 2FPXA 4M9UA 5TB5A 2DETA 3KCQA 4QPDA 3D1LA 1RS0A 3TG2A 1LX7A 2Q49A 1JI0A 2XUDA 3JQ6A 3GJZA 4E07A 1XG5A 4RZSA 1JHMA 1EFVA 1TM7E 1DI0A 1JFLA 1FX0B 1R6DA 2BKAA 3IOYA 3RVLA 2XCTB 1QQAA 4JJGA 5HF5A 1XTUA 2HA2A 2Q1WA 1AKQA 3L9WA 2CLMB 4MV6A 3AF2A 5CCDA 2ZBGA 5A3SA 5TGZA 2HIHA 4AJKA 1ISIA 4IOKA 3LC7O 4E88A 2UXDB 2VPWA 5BSFA 3T1TA 1UF9A 2VDLB 3MWDB 1E8MA 3KDAA 3E5MA 4P2GA 3REQB 3TB6A 3LGAA 4FPXA 3MWEB 4V0LA 3LOPA 2RMKA 3EASA 1K4MA 3FPCA 2IHKA 1PFGA 4EW1A 4M1QA 1GSAA 5G3YA 4AQDA 4B3SB 3FGOA 3OJFA 3CLKA 4ARAA 3UCXA 2JAOA 4Z8XA 1UBUS 3EA4A 5FHQA 3PX7A 3GLQA 5DW3A 2ZBVA 1RC1A 3CO0S 3RWOA 2G40A 3F2IA 1A8HA 1TUGA 2BHTA 4YRBA 4KQXA 1XCLA 1E2NA 4N5LA 4QTXA 2K7FA 3LFHA 3FAZA 1C4KA 4YA6A 4YBRA 4WZAE 3SNKA 5JCXA 1E79A 1Z4IA 1E5TA 5TF0A 5MGBA 1K8XB 2WJGA 4JLBA 1T6NA 2PQ0A 2D3WA 3IYLW 1WF6A 1A7KA 1IAQA 3C98A 4EKIA 4I2VA 3VX4A 3CM0A 1NSTA 2WSYB 4C0SA 1KI1A 5DWVA 3HYLA 3KYDB 4YS6A 3HN7A 4EMUA 5ECDA 4M8NE 4QU9A 1R66A 3JPYA 3QH4A 2A14A 4IGFA 3NHMA 4B31A 4C29A 4BE4A 3CF0A 5AR1A 4PSVA 4Q3AA 4F6RA 3GLSA 3ZDXB 3AKZA 1VYVA 2R5FA 1PR6A 2FX2A 2V6IA 2FMKA 4C7XA 3V3KA 1ZCFA 3ED5A 1RE0A 1ZQ9A 1UKAA 2ORIA 5TXGA 2FUKA 4EZBA 3D4OA 3TQTA 1CCWA 3V48A 3BT7A 4JJKA 5ALRA 3ONWA 1SCUA 4EI9A 2EF1A 1EFPB 2Q4RA 4Z4GA 2JGIA 3QSYA 3COZA 5ALZA 4B4DA 3SU8A 2C31A 2YZ2A 3LT1A 4MGIR 3E8SA 1RXYA 3WLEA 4DQUA 3FW1A 4CKCB 2CCJA 1M2EA 4F06A 3IKJA 3PNMA 3OE7D 2HJSA 2GPTA 4FC7A 1PUXA 1U2TA 4G0NA 1GTJ1 4KVFA 4KXQA 4XUDA 1Q7EA 3KWJA 4US2R 3SWWA 1HI9A 3V4RA 4Q3DA 4UTZA 4NNJA 4GSYA 1ONSA 1XOIA 3CNNA 4A6EA 2ZRMA 2SKEA 4F60A 4AXXA 2L17A 3H97A 2ES4A 1CJMA 2P3QA 3KZCA 2VJMA 4EHJA 1HE8B 2VHZA 3G17A 4TMZA 1ODIA 3U7GA 4BZWA 3N76A 1R0XA 4MYHA 5DTIA 2F3SA 4B6RA 2JFGA 2QVCA 1N2GA 3WB1A 3SYNA 4PX2A 3R9XA 3CX3A 3E0QA 3KBOA 1NHWA 5C1BA 1E66A 2HMWA 4F11A 5F5LA 3AEUA 4XSGA 3FFAA 3HSSA 1XZDA 4NU0A 4AJ2A 5F5XA 3P2EA 3TR5A 2O8BB 3F8TA 2J8ZA 2IELA 1K3UB 2FF5A 2V6BA 3EMBA 1JR4A 1DZIA 4QVGA 3DOEA 5AHKA 5J58A 2QDXA 1SRRA 4BQQA 5CD9A 1GNSA 2B21A 4LRTB 3PR1A 4FP9A 2BZGA 1N6PA 3KEQA 4J0JA 2DQSA 2QD5A 5JD4A 3GZTB 2QZZA 4YRRA 4W1SA 1J5XA 4BATA 3EPLA 1YB4A 3K1JA 3V80A 4BNDB 2C9OA 4UAGA 3M1IA 1D1SA 4E5SA 4ON9A 4TKVB 2O5RA 4W5NA 1TUBB 2Y0PA 4HNGA 3KZMA 2CJPA 4BAGA 3Q3VA 4QXAA 4P36A 4F04A 2I6QA 3Q9SA 4M55A 5D2CA 2BGTA 2PHZA 3BRSA 5LBTA 4WECA 3THYA 3DMTC 2QJRA 3B12A 4A82A 1MJNA 3DULA 3PYMA 4NEQA 3IAM6 1MFZA 3AONB 5ALKA 4W1RA 5CDTA 2MSKA 2QBYB 3LKVA 5JXIA 3K9GA 1RBQA 5LP1A 2I7XA 2GD1O 1L7QA 5JQGA 5KQLA 3FM9A 3ICPA 1I4OA 2ODWA 3UHAA 1AD2A 3TQIA 2BSQA 3LY8A 1DPGA 4U6QA 4TZ0A 4IRUB 5KC8A 4IS3A 3KEGA 3DDWA 4G5FA 4IQ8A 2B8EA 5B30A 1QONA 3BWEA 3SSOA 3V2GA 3PVCA 2FETA 1DT3A 1U2GA 3DNPA 3PXAA 4MKIA 5J2UF 4IF4A 5H3HA 3U81A 3Q12A 4BVGA 4B74A 1NM5C 1L5RA 4LVUA 1M2JA 3TSYA 1R8JA 2GPWA 5GZ6A 1QYDA 4IDAA 3I09A 1FUKA 5TR9A 1UBGA 4RMNA 2YYAA 4PN7A 2N0SA 1AQYA 1G6KA 3WA6A 3D8RA 1TI7A 3B5IA 4CT4B 3OLZA 1FNCA 4YRPA 4D9NA 5IKMA 2SBTA 2IOHA 1OBVA 1U8UA 2Z5GA 2ZRPA 1A96A 5JDCC 5L7WA 1MPTA 4FVTA 4LWZA 2JFVA 2JH9A 2WVJA 2LW7A 2QYSA 3F6PA 5DGIA 1QXSA 1YS7A 3JQ9A 1JN0A 2RJOA 3EH2A 1FY2A 2EEPA 2IF0A 3GZ4A 3L8HA 4GVPA 1GZ7A 3T52A 4KO4S 3KP1A 2CL7X 4JVLA 3OZWA 5E38A 1P1FA 4U4AA 3R4CA 4B3RB 2C5AA 4CCWA 5F73A 3Q5GA 2GBGA 1QH9A 3O95A 4W7HA 3T35A 4E5DA 1ZY2A 1JIIA 1W0KA 4UAVA 1A9SA 1L9XA 2PPLA 3VHLB 2CDCA 3IX7A 3OY7A 1W5BA 5FLKA 5B3JA 1NT4A 3R8CA 4MUIA 4H15A 4V3BA 1XWFA 4WK6A 4ZU1X 3E15A 5KEIA 3B5JA 1OWMA 2WP8J 1E1CA 1KU6A 2E9SA 1UDBA 2PX3A 1XRQA 1ONPA 3NKVA 4M1KA 1RIIA 4XQEA 2ZJ4A 4IHJF 1G5FA 5CRIA 1XVVA 2RK6A 4IIXA 4AN1A 1QP4A 4QRIA 4FLEA 2RD2A 5DTQA 5GWXA 1AQ6A 3OFJA 2RAPA 5KBYA 2ZRKA 4NMMA 3LWBA 3RHSA 4GM1A 3AH8A 3HGQA 3R20A 1T1RA 2AKEA 3VJRA 1D4FA 3INGA 5GV7A 3L2OB 3P9IA 2IEBA 4TZ6A 4G85A 4CMIA 5BN4B 2FR1A 1L3IA 1QPGA 4C2UA 3KZVA 4CETA 2AI1A 4CI9A 1QAMA 1K97A 4F12A 2H1WA 3ESZA 5FUBA 1RTKA 3C3MA 2PFGA 3EZ7A 4NYIQ 4OHZA 4YDQA 1XXHE 3UA4A 2O7RA 4Y2GA 2F4NA 4COKA 2C5BA 1AVTA 4R8RA 4JGBA 3ZWYA 3EAFA 5BQ3A 3PYXA 2TMKA 1DRVA 5EKTA 3UWMA 3WBKA 3NJ4A 5TT1A 1E1LA 3DUWA 2IV7A 5C5DA 5LQKA 1UMBB 2EKQA 1XC7A 2G06A 4JYZA 3PFKA 3Q7RA 2XDYA 4WLVA 4JC8A 1KDZA 3OLXA 4Q34A 2YV5A 1IMJA 4Y8VA 1VG8A 5D1NA 3F90A 3TLMA 2J0VA 3P52A 2QPTA 3QKRB 1W4CA 3BEDA 1T34A 4FFNA 4DB4A 4DR7B 1WU8A 3PF8A 1ZX1A 5CG2A 2N47A 2IYEA 3R3VA 4PSCA 4LBZA 3HCRA 3E6AA 3EPHA 3EXFB 1E5XA 4MO9A 1WBBA 4IKOA 3PGJA 4XX0B 3SZUA 1KP3A 1ENOA 1L5WA 5SICE 4EIWA 1NLUA 1FNBA 2WKQA 3QE3A 1UKCA 2J9FB 1QGZA 4EHNA 3HO6A 1VFNA 1YAJA 2PGDA 1RWMA 2ZOSA 3JR3A 3LPAA 4M6WA 2A6PA 1MORA 3DMGA 3OOYA 2AJTA 4B0PA 4LVCA 3WYBA 3AW8A 1ZMOA 3MPUA 4K86A 1TM3E 5FO0A 1LPBB 5F23A 1L2TA 3Q11A 4N6OA 4US0R 3ETHA 3LA8A 2ZULA 4IWYA 3A6EA 3S8YA 2ZJZA 1QYIA 4DMMA 4L9RA 1RJDA 5KKCA 3I2HA 4UBIA 1YS2X 2AFVA 5AW7A 4QGSA 5C8YF 4QUIA 3FCOA 1XGKA 2VJLA 3EZYA 3K8YA 5DXJA 2XVAA 5NULA 2AC7A 3VSEA 2DUMA 4BP8A 5F98A 1XJWA 5KCZA 5F3RA 1N2CE 4P84A 1XMVA 5DHFA 1ZIOA 4L0QA 3GT0A 1SBYA 4QXPA 4I5FA 5HBRA 3V7NA 5I8WA 3PEWA 1WSBA 4H3SA 5FFMA 2OCGA 3R5SA 3H2HA 2PUAA 3CLUD 1GTMA 5IYZB 4ZRNA 1YVEI 2Z30A 5LWQA 3ME5A 3M83A 3OWXA 3WGGA 2XWBF 3QU4A 2C7BA 1IC6A 1WCIA 3UPUA 1KMHB 2RIRA 3QVXA 3B6IA 1XD8A 1ZVJA 2BZSA 1OLSA 4RZXA 1EIZA 3K8ZA 2LR0A 3H7AA 4V3CA 5EP3A 5FWXB 2OYRA 2QUZA 3CONA 3D4PA 1GADO 3DAOA 2IS4A 2B9EA 4V02A 3Q7QA 1T0PA 4RVFA 2FGKA 3I9V6 3DYIA 3Q0TA 3OETA 4K40A 4OYHA 1P5HA 4U7FA 1PL8A 2WZQA 5EHXA 1YFKA 1RRPA 2WJ4A 4HS4A 1V26A 3OU2A 3LQFA 3MCAA 3NNSA 4GXTA 3M6IA 5GGXA 3SMVA 6YASA 2YFQA 3AU8A 4R54A 5J40A 3KOUA 4AUEA 4F72A 3DHNA 3OOEA 3FCUB 2D0IA 2CSXA 1NQ5A 2ST1A 1RT9A 2R8RA 3AJ9A 3CUWA 1A76A 3K0CA 4FMCB 4G4GA 1G66A 4PG6A 1TPZA 4L27A 2PH5A 3VSBA 2M98A 2P0EA 3O8DA 4C14A 1XMOB 1OFGA 3DKVA 1OW3B 4UOQA 4AN4A 2AW3A 1VDZA 2YXLA 1JFVA 2H57A 5L95A 1BXKA 5CDFE 5I9IA 2Q5LA 2O2EA 3URMA 4YJFA 4QYTA 4CLEA 1C7IA 2WYVA 4J75A 4RK1A 4C22A 2TYSB 3KCNA 4QQKA 1AB6A 4AULA 2JL1A 1J5EB 2G4CA 3C3BA 1ZWLA 2H2GA 4KUGA 1QO9A 3DE3X 3EXEB 3EDMA 2FWNA 4HMPA 1DO0A 3VAZA 1RABA 1E5DA 3IJEB 2FRDA 4RA9B 1ECPA 2C78A 1ZKDA 2C5EA 2YQZA 2ZWAA 2BPOA 3DBHB 2VCEA 2VXCA 3ISVA 3DDHA 3OCZA 3O83A 4HJRA 4MV3A 4Y6LA 1F51E 3OSZA 4HC4A 5EIBD 2HW8A 4QD3A 3ESDA 4MRSA 1CZLA 3RYIB 3V8MA 1CBUA 3QE0A 3KOWA 2W0SA 2P9TA 2DT8A 3GELA 2P3OA 2Q5IA 5LQNA 1WHTB 3TRFA 4QRDA 4PBRA 3UFBA 2AOVA 4E0BA 4DR4B 2VZ9A 5KHLB 5EMMA 3VO9A 2PH1A 1U1GA 3P97A 3L7AA 3EIHA 3W5JA 2MTBA 2HLDD 3CGGA 4FDLA 1PJ4A 2W71A 4MUHA 1NRXA 5KNBH 5GVSA 1I5RA 3WOHA 4C4RA 1SXGA 2Z5VA 2G6BA 3OPVA 1H1DA 4MUMA 3A1WA 3HBNA 5CEJA 2X42A 3NCHA 1N2JA 1QHIA 3KYCA 2XECA 4Z4QA 4QECA 3O21A 4LDAA 3P0RA 4II7A 2YVQA 2RCNA 4ZI2A 1U0BB 4HEA6 2JJ8A 4RA6B 2BEUB 2VJQA 1NN5A 3IOEA 4HAVA 3O73A 4CV0A 1KOFA 1MO3A 4H16A 3RH0A 2DHRA 1HFWA 3F9CA 4BVJA 1RWKA 2QRVA 4RSHA 1S0UA 5E1DA 5K3DA 1KI4A 5JYCA 1NW7A 4RIGA 3KQMA 1RYEA 3VZSA 2NV2B 1G2QA 4IICA 1RRKA 3RV3A 4BNFA 1GAWA 1TAQA 2UZAA 4RJ2A 5ALMA 1X8KA 5EWJB 1LDEA 5TEVA 1E7MA 3TDMA 4CN8A 4YMGA 3PQ5A 1Z3IX 2WQ7A 3QFFA 5TNXA 3TIFA 2NXEA 1JA0A 1N3BA 3HJRA 4FMDB 4CM3A 2O5EA 2I34A 2OKGA 3UO8B 4DAOA 3UMMA 2DR3A 4LAFA 3ZIUA 3AEQB 3VBEA 1SVNA 2PIAA 3S2YA 3N2LA 1K5GA 3PFCA 2DBRA 1SUFA 1K3TA 3D81A 5C8ZA 1JH9A 1OLXA 3D1JA 4FGSA 4A0GA 3GEEA 1L4LA 1H8ED 3KT6A 3MGGA 3LGSA 2QN7A 2WKWA 3KQYA 2ZR9A 1XZQA 4UE2A 5AVYA 1WVGA 4N12A 4ER0A 1NR7A 4MMZB 2UUCB 2PX5A 2YHUA 1YTLA 3KKZA 2FPGA 3UXMA 1X70A 1LLCA 3N0RA 4G97A 1ZRMA 3PRHA 4N7RA 3HK2A 1JYSA 1I10A 1SVLA 2OVFA 2WLTA 3E22A 4CW7A 4FI3C 1O57A 4MROA 3VHXB 3ZGNA 2ORED 3FLEA 3LWDA 1GCUA 1VBMA 2ISQA 4RXMA 5EVJA 2QORA 4IO0A 3LL4A 5CYGA 1KQ3A 2H59A 3SXUB 1C2YA 4LMAA 1M2VB 5HGXA 3AVPA 3JZDA 1SUPA 4NENA 3G5LA 2Q3MA 3I6BA 2ZSJA 2F48A 3IP6A 5DNUA 4ZVPA 4FGKA 4HNVA 2C3OA 2QTTA 4I8DA 2JFFA 3IJRA 5A9RA 1I0LA 1QJCA 3J7TA 3QVOA 4JDPA 4RQUA 5A6VA 2QUBA 4KREA 3LOQA 4M36A 2B35A 5KB3A 3SQDA 2XYRA 1NN3A 3IEUA 4MWSA 2WIBA 3O82A 4CPDA 5DGHA 4MRNA 3EZFA 3LUPA 1ECGA 4HJXA 2L42A 2WWFA 3CNOA 4TL6A 2FR0A 1JDJA 4YJ2B 3DT6A 1RYBA 3A4VA 4I3HA 1RJWA 2VQ6A 3N0WA 1H6CA 1G5QA 1HOXA 4O8ZA 4YQYA 1NG1A 4GXQA 4WINA 2X0DA 1WHSA 3BQNB 5HQTA 1NJGA 2FEKA 1YR6A 3D6UA 3IPCA 4EO4A 5AKIA 4EJ0A 2ONZA 5DIZA 4EHDA 3H1AA 3LPCA 3QVGA 1Y3BE 1REQA 3CCFA 3IUPA 1U3TA 2E55A 1B8PA 1G8FA 3KKKA 1GV0A 3SIXA 5L6LB 1X1CA 1XP5A 4YLGA 2XRYA 1ZINA 2BI8A 2ZB3A 4QSHA 4QPPA 2IXGA 2QXUA 3NHYA 3D2LA 2PRSA 4E7OA 2D4HA 3GC6A 3G0IA 4IGKA 4I1YA 4CWAA 4G0OA 1JEDA 2AA3A 1L9KA 3DEFA 1LBTA 2GNOA 4QDXA 3ZTYA 5JWOA 1APBA 3UWSA 4CQMB 1RWNA 3ZZ1A 5FWNA 4MQBA 1IUOA 4YJDA 1ABBA 4YJ3F 1BXGA 3EMKA 1PGOA 3PCTA 2CV0A 4MV0A 1KI7A 4I4LA 3Q3GE 3G5TA 2XGMA 2YUIA 3HA7A 4ND6A 3S2ZA 3N70A 4IJ5A 4FNAA 1B4DA 1SVMA 1GPDG 3H2KA 1H4SA 2A0KA 3EDYA 4OKNA 3MCUA 4ES6A 3BMQB 1Y1KE 5AVSA 1G38A 4MW2A 5CDSA 4FWIB 2O06A 3F5SA 2GHRA 2Q3BA 2P27A 3RLFA 1JEQA 1AXRA 4CTKA 3NT5A 3PE4A 4KEAA 3PIIA 5FWYB 5AQ1A 1UKZA 3IJ5A 4R8VA 3OEED 1JHZA 3IE2A 4MS4A 5KU7A 5KYYB 1N9KA 1T3TA 4PYOA 5EKUA 3RRFA 7ABPA 5T3YA 4AZ0A 4BNNA 4B6OA 1NPDA 1XA4A 2NQ2C 4G0PA 5IP5A 4WN3A 4P0QB 1MB2A 2JLAA 3NCTA 1Q92A 4N5HX 1OAOC 2A5JA 4W1QA 3OF5A 1L4FA 1YDEA 4B3IA 2HBYA 4BJ1A 1PJSA 4RHCA 3ZHZA 1U5AA 5KWEA 4RPKA 4ZYZA 1UXOA 2FWAA 4WT7A 5J1TB 3ZD9A 1Y42X 1M9NA 2M9MA 5KINB 1GAEO 2Y6UA 1ADGA 3MRVA 1J1IA 3DWIA 4G89A 4R1LA 3BFJA 4WEOA 1IN4A 1NW6A 1O2DA 3AETB 4F0JA 2Q0QA 3H6HA 1M0EA 1P5RA 3DEJA 4X3PA 2D62A 4FQ7A 5EIFA 2YN4A 3T7RA 1T8SA 3E9YA 3VR6H 1EFTA 3V6MA 2CY0A 4QJ3A 8OHMA 1Z0ZA 5LYJB 3BRQA 1Y3AA 1KJ8A 1R4AA 3LPLA 5KYWB 1XTPA 1WW3A 4OA5A 1F2TA 1ZXBA 5EE1A 3WIOA 2BTEA 1S6YA 2HADA 4DDKA 4KQKA 1J2RA 3KTAB 5EMJA 1TYZA 1E6MA 1A7UA 3D6MA 1E4VA 4RLFA 3F6YA 1EQAA 4R0VA 3RAFC 3BDVA 3KYBA 2AOXA 3HJUA 4LJ6A 4Q5IA 2QM0A 4QDOA 1Y6QA 4CL2A 5IU6A 4OK5A 1ILEA 3ORYA 2J9RA 1Y7LA 4L5CA 4MI9A 5FOQA 1P7YA 3KKOA 3D4IA 1Y3DE 2BZ1A 4ZCSA 4ZVNA 2I4MA 3OJWA 5KDLA 5D84A 3W7BA 4B9AA 5IHXA 4FQ8A 3GYGA 3WX0A 4B35A 3VR2D 2HD4A 2OCXA 121PA 3HE3A 3HM9A 2EYQA 2GZ1A 1XU4A 2JJ1D 4Z0HO 2Y67A 3VX3A 2WNHA 3KXIA 3MG9A 5KPDA 3NEAA 4IZ6A 1UDXA 4ZIRB 1Q7RA 3BC1A 3GH3A 2K2WA 3DWEX 5AH0A 1LSOA 5HMLA 1ENZA 1ZMRA 5GONF 1J0EA 4A6DA 3A6DA 4XCXA 1KAOA 3TAHA 5A06A 3EGXA 1ORHA 5IKPA 4RDCA 2OMKA 3D0RA 3DJFA 4AX8A 3KPVA 2IY7A 3ESCA 5A02A 5K0TA 2ON6A 2G08A 2H63A 4EEZA 4J76A 1M2FA 1Q1ZA 4O63O 4PQGA 4UAJA 5HDBB 3CFYA 5HIJA 2P4HX 3WKAA 3LXUX 2NO4A 5KUTA 3OZAA 3DE0X 4JN6B 2HLDA 3EHDA 1II8A 3PQ2A 1BS1A 4L0DA 3G8DA 3NBZC 3VGPA 4ZJYA 5A03A 3S8EA 3SY8A 1B8VA 1ZC3A 3RTDA 1ISFA 3SFVA 3VYRB 5CYOA 1Z0IA 1P0PA 5CX1A 3H6GA 1HF3A 4MQUA 4QWMA 1IJEA 3A2LA 2B99A 5JLAA 2P6UA 4JIMA 2FH5B 4I36A 4X1YA 4KOEC 2JI4A 2IZ6A 4YJHB 4M38A 3ZS9A 2F64A 4PHCA 1VKOA 2XZPA 3BEOA 2C1EA 2YYYA 5KAPA 3WNVA 2RGXA 3JQ8A 4KQFA 2X6QA 3ROZA 5HW0A 4BRZA 4N76A 4H27A 4YV7A 1VL1A 4ZPXA 5JH7B 1IBRA 3C7TA 3UOGA 2GEFA 3W7AA 3GV0A 3LMKA 4WBNF 4H1WA 1WUJS 2HRRA 2Y93A 4IIEA 3JQGB 1Z5ZA 5E7IA 1XPJA 3VPXA 1EJ2A 4JLDA 4Y2RA 1R12A 1Z0UA 1LJUA 4O2BB 5CK4A 3UK0A 1GIAA 3F6EX 1T5BA 2EZTA 4XW2A 4X7RA 1GRCA 2V4MA 4BB0A 4CIVA 4IIJA 3LDAA 1U8AA 4GDFA 4LV5B 1Y3CE 5CVCA 1KK3A 3HCFA 3QELB 5ELLA 1KMCA 1H8EA 2P69A 2PZFA 4JI7B 4LHVA 1T9ZA 1T8UA 4DPLA 4Y6RA 4AKSA 3TIVA 1F0YA 2MINB 4U2FA 4P80A 5I7FA 2Q2VA 1G5RA 2P62A 1WJGA 1FYWA 2AD1A 3TW8A 4YPVA 3QPVA 1IXRC 2B0CA 3W9BA 2W2XA 2YZNA 4P3PA 1M72A 1TU0A 2XWQA 3GI1A 2GKSA 2ZS9A 3PUVA 4LSWA 4NMLA 1B6TA 2W2VA 4JSRA 2XRZA 1BU5A 1UT6A 3R76A 2FWJA 4J0GA 2QQFA 1EEXB 1VC2A 2FFRA 4QOJA 4URUR 1NUAA 5B1YA 6ADHA 5UKDA 1HYEA 1U3VA 3AOGA 3KZNA 3BWVA 3LVRE 4N1AA 2OQVA 2CNOA 4HX5A 2SNIE 5I5GA 4QHTA 4AJLA 1AQIA 5FTNA 5T6MA 1MB3A 3M34A 4RABA 3AG6A 4I6JA 2OD2A 2O8CA 2F3UA 4Q39A 5DH9A 2GXUA 3Q0EA 2IOQA 3OHSX 2JAXA 2I55A 2GGSA 2YWXA 1DO8A 2HPAA 4B48A 4OKIA 3ZDBA 3GT3A 3A3KA 3OECA 3TSAA 2JJ2D 1YQQA 4F9TA 1ZGZA 2BFBB 3AF1A 3QJYA 3T3MB 5LD2B 2XD4A 4KMMA 4F1JA 1M2NA 2Z2IA 2VDJA 3U37A 4F85A 3WYDA 4BBAA 4LJ5A 3K53A 3PXXA 1VE6A 1TIPA 1OAKA 4WXHA 4BZQA 4R8KA 5JAPA 1V4NA 4B6GA 5JAUA 3C8UA 5EHZA 2EGHA 2HUPA 3AK4A 2H2DA 4QT0A 2XUQA 3H9EO 4QBFA 1KPIA 5DT2A 1W94A 4U5XA 4L5AA 1XYGA 1HSOA 4QDKA 1CP3A 1C3XA 3L7BA 2DSTA 3SE0A 3UKDA 4XPIA 5T7BA 1U0NA 4RFSA 5B2ZA 4DC9A 4JR2A 3BGSA 1N2IA 3OIFA 4AT1A 4DANA 4KYVA 2H1VA 2FXVA 3KUDA 1NYTA 3M8KA 4EFKA 3VV2A 3RRBA 1B8OA 1U2ZA 2P35A 2ZJBA 3ZWVA 1CS4C 3U6BA 2VRBA 3C5HA 1IATA 1QTRA 1LZLA 4YXFA 2Q6KA 3V4VB 1Z62A 1GARA 1L3CA 3CSSA 3GYBA 4DIDA 3QKIA 1NC3A 3EY9A 3OZBA 4L6IA 1TJ5A 2OGTA 5AXBA 5H3CA 1UBKS 3VVBA 3BIJA 3P9PA 3WYAA 4DG9A 4FGZA 5G4LA 1EXNA 3HEAA 3N8KA 5EMLA 2OP0A 3BRCA 3VU9A 1VGQA 4KI0A 4LRUA 3L0BA 3NB0A 2OBFA 1NZDA 4L4ZA 1AK1A 4OQ4A 1U4SA 3N74A 1E4OA 3W2FA 1Y5MA 1YGPA 2OB1A 2YY7A 1NVXQ 3E5NA 3MS7A 1OB2A 5FOVA 4DUPA 2WT9A 4L0CA 5CB8A 3OEEA 3JD4A 4QASA 1LVHA 2YWDA 3R0VA 2YWGA 4BNVA 2JLUA 1S8AA 4X66B 1YDMA 4JLOA 1YBMA 3EDOA 1DDGA 4Q19A 2JJQA 4X6UA 4CF4A 4FOTA 3TNDA 4YAEA 3IMFA 4GYYA 2EL7A 4GOND 4O4HB 2VYVD 1SUCA 1E1NA 4N6GA 3K4HA 2QYHA 3MZ0A 2J7KA 4ARUA 3ZDCA 4MQLA 1KZ1A 3KO8A 1F14A 4XDZA 4KLZA 4GAEA 4B0OA 1JIXA 3OOWA 4Y2QA 4KJZA 1NFFA 3OQIB 4OAOA 5LM3A 3WWPA 2E1PA 4KL8S 2I54A 2PSJA 1Q1NA 3R44A 4J1QA 4PQYA 3WGYA 4ZC8A 4EAQA 3SC6A 1AURA 1C14A 2VNJA 3QU9A 3TO5A 4PO9A 3QWFA 1P1JA 1QG0A 4KSYA 4F84A 4DV6B 1A27A 3BIOA 3BORA 1I94B 2DTEA 1I3OA 2XQIA 3JQAD 5LA6A 1Z6PA 1T1IA 2X8JB 3B3GA 3PQFA 2P77A 4M76B 5EY5B 3GJ6A 3ZWPA 4DQ0A 2BKUA 1ZH4A 3KM0A 4V0MA 5FP0A 3ZVNA 3GMTA 1NFQA 1O8CA 2FYTA 2WVGA 3LLMA 4KFRA 4M0UA 4NWIA 5CIWA 3S2IA 2PQ2A 1XCPA 2HA7A 1QG4A 2D4AA 4ZQGA 4CTNA 5CCBA 5IBQA 4FT4A 4MEJA 4DY6A 2VHUA 4DGSA 5HTOA 1FYDA 2BY4A 5SYMA 3F5QA 1DUSA 1CJUC 2G5CA 1RXCA 1WCYA 5TMDA 1EDEA 2H4WA 4KDRA 5T8KA 5F7OA 4DA4A 1XTZA 1ST2A 2FSVA 4J4TA 5JFOA 4LF6B 1DAPA 3KJFA 3RVKA 4KDEA 1IEQA 1JQAA 1GTSA 1Y6ZA 2FQYA 2O8FA 4EGAA 5HILA 4UEQA 2X8BA 4GEGA 5CTAA 3DHEA 3VR2A 4YDRA 4Q7MB 8ADHA 1X8LA 1W29A 4HNAB 4N3AA 3WP0A 4CXMA 5BQPA 3R8XA 1N1EA 1XCBA 2P4UA 1U0RA 2B8NA 2WWRA 2JJ1A 4M22A 4UCFA 2PGAA 3W3AH 4E6PA 5AVQA 1DCFA 3KNZA 3WLQA 5KO2A 5HM6A 1MB0A 1E1MA 4EG8A 2JVJA 3KX2A 4BGIA 3EC1A 4V0RA 4MJ3A 5ED4A 2P65A 2XNKA 3AUUA 4I50F 2WQ6A 4BVFA 1S2NA 2X5NA 3C3YA 1I2ZA 5CBKA 1XZNA 2E21A 3KPWA 4PCUA 3KOXA 4INZA 1DARA 2VO1A 2VF8A 3A0UA 3NETA 2F8LA 2QLTA 4H6PA 4BP3A 3DWFA 5AUQA 1Z6AA 3KQUA 2V4UA 4G0XA 3BAZA 4URFA 4U2DA 2ZYGA 2ZJAA 3QVWA 2VNIA 2OT3B 1H6DA 4P22A 1OH5A 4HVTA 4DHWA 1M6VA 4GPZA 1DC5A 4HI0E 5SY4A 5ER9A 2IPAB 3OOJA 1ORWA 1VLZA 4PQFA 1NQAO 5A4MS 4R0MA 1SA0A 3MBOA 1A9OA 2JZOA 4Q9NA 5KJ6A 1KZ9A 1E98A 3SOZA 1QH0A 3ZQUA 2YN2A 5T57A 2J3IA 4HG2A 1ZMBA 2JAWA 5HE9A 5ICMA 5M2QA 3I4CA 4YY3B 1DC6A 1O5TA 2AFIA 3CKLA 1R6UA 3H3FA 3RVPA 2R0QC 3B6MA 4K3VA 3IEXA 1FP4B 3O3MB 2VAPA 5BSUA 3A9UA 1YA6A 3PPVA 4Y9SA 1LK5A 1ULSA 3E05A 5BR8B 5LD2C 2ZI5A 3AEXA 4Q3NA 4QTUB 3BSYA 4M1OA 2D8MA 5L3QA 3PHHA 3WLPA 1R0SA 2P9FA 3TBFA 4DS3A 1E2KA 1DTSA 3EZ2A 4N7BA 1EBFA 2ZRGA 3OZDA 1EUDB 5LLSA 5B4VA 5IG2A 3IR5A 4ARSA 5FNVA 3RIGA 4OK6A 2C5FA 3ABRB 1J8FA 5AJHA 3SF8A 1W25A 2AK2A 4GL2A 4O4LB 4NJEA 3HUDA 4POAA 1VE1A 1XTSA 4TV9A 1NKTA 4U8HA 5DLEA 1P2DA 1SRQA 2E87A 4FWBA 3T1YB 2GSWA 1MVLA 3EXIB 4LHWA 1OJ7A 1NYQA 2ZJFA 2PWAA 5AOBA 3A6GA 1YBHA 3EQ7A 2GZ2A 3E35A 5HUHA 1RQGA 1YC5A 1CY1A 1XTRA 1BH2A 4JL8A 4QJ5A 3R41A 2Y77A 2G9NA 2EAUA 1FK8A 1JWAB 3ITEA 1E6KA 4K9OA 2PLAA 2O2GA 3JAKA 3NP9A 3MBIA 2IEAA 1JSXA 5T3UA 5CXXA 4CLDA 2I3BA 1N2XA 1ZKMA 4UHBA 1U3WA 5EWMB 3HMQA 2WPNA 2YZGA 3L0IB 2V97A 3ZLBA 2YX1A 2CV2A 1G8SA 1WDLA 1IHXA 5K8LA 1Z75A 1BG6A 1U4OA 1US8A 3TR0A 1XSEA 1PVOA 2X8AA 4PHHA 1XTJA 3M49A 2NU9A 4RGBA 3SKYA 3GLIA 1QB8A 1WZIA 1V9SA 2FMUA 2ZIUB 4RKYA 3FZEA 1EAMA 2C96A 3WYGA 4BNLA 4DLLA 1MV5A 3JQCA 2JJ2A 4AY2A 4D9EA 3OO0A 1KETA 1YBVA 2XSZD 4MAAA 4JI6B 1GPAA 2C98A 4YONB 3U3RA 4FSDA 3E9ZA 2GEBA 2YXEA 5EHIA 3X2SA 2QMHA 4NZOA 1G6OA 1MNAA 4D97A 1Q20A 3BWXA 2NTJA 4PSKA 3ZGYA 4J1TC 5IJ9B 3ITNA 3WIEA 1C9MA 2ZAIA 3G2JA 3LKZA 3HUFA 2V65A 1AKYA 2QRHA 4YLEA 6GPBA 2KBFA 5HJ7A 4TYYA 2GDJA 4JLVA 3BF8A 1XMSA 1A4UA 1J7KA 3R6LA 1L3BA 2WIFA 2L0XA 3E8MA 2VOEA 3KOMA 3LRTA 4ICIA 4I9HA 2X19A 2CVFA 3ABZA 3R4VA 3V46A 3KIPA 3CVUA 2EOAA 1MP0A 1NIJA 5K2OA 3Q6MA 4OU4A 3QQPA 4OHUA 1WLYA 3FMGA 2GZMA 3NOQA 1PFWA 5IBRA 1UQUA 3GUYA 2I2DA 2W2KB 4P7FA 3DL0A 1BGXT 3AR2A 2CFCA 3N2GB 4P5DA 1QNLA 4ZKDA 1ODJA 1CQIB 1OXTA 2DFVA 1QBKC 1KBQA 421PA 2HHHB 5EJ9A 4G5HA 1WVMA 5K4GA 1PNOA 1FC0A 3RT1A 1TW2A 3AILA 3VTAA 5L3VA 3IQIX 4AD8A 1I0ZA 2WRZA 2VKQA 2MIIA 3QBVA 2CT8A 4BEBA 3F2VA 2R751 3HKDA 3N07A 3RU9A 1ZR2A 1T3SA 2PTGA 1CTQA 5DLDA 3QX3A 2VUIB 5LSAA 3V8VA 1BW9B 3VVMA 4MPDA 3KKLA 1B76A 3E1SA 4NAHA 2ADMA 2OZLB 2PS3A 3PDUA 3U7FB 1X1BA 2E49A 2GCOB 4C30A 2A9JA 1CEXA 1K5DA 2E4UA 3Q40A 2QUJA 5EIBC 1DIRA 2O1WA 4G2NA 4XGKA 1F12A 3OI7A 1H2WA 2ZKIA 2DUNA 3B9QA 2B5OA 3O4HA 3P4UA 1C29B 4IOMA 3H1EA 4N0QA 5TPZA 3BZWA 2SKCA 4DXHA 4Q4CA 1MO6A 1LNQA 1U28C 1W5TA 2B1JA 2K2QB 3EXHA 3HEMA 2VYVA 3TEMA 3W78A 4PVDA 4EUFA 2I2CA 2Y9MB 3WADA 4LDPA 1K0UA 1OZFA 2ZUWA 4B81A 2PS9A 1Z0SA 1M54A 1I2MA 3OMXA 2NOAA 1B3BA 2VNKA 3Q5EA 2PX6A 4KTTE 1DRKA 4L7VA 3KKNA 4XSVA 3TL2A 1Q0QA 1QTQA 5DFAA 1MVNA 4D81A 3ADCA 4BFZA 1TMKA 3M7IA 3EVFA 4IH1A 4M46A 4TUYB 5ES4B 1YFLA 1ACLA 4PE5B 2VJOA 4OHKA 4R3WA 1OXVA 4PLHA 3UT5B 3EE6A 3JQAA 4KXYA 4XM2A 4R1NA 3SX4A 1T0UA 3LF2A 3LZCA 1FX0A 1CF4A 1HXHA 1D9ZA 2IYXA 3H0EA 4R9VA 5FR2A 4YRZA 2K4MA 1FB5A 2ORWA 3KDPA 4R9SA 4YWHA 4PGFA 1TM4E 2HPZA 2YV3A 4Z2YA 4RV9A 1RQLA 4XVHA 5KWSA 1U7XA 4YR7A 1TLLA 3AF5A 3WGJA 2PLNA 1DAOA 1J56A 3BXHA 4PRKA 4BS9A 4Z2AA 1I4TD 3EODA 3EQ6A 3QEMB 1L1EA 4KN6A 3FE2A 3ZEAA 1NVUQ 3CF4G 4EPYA 3EEOA 1X15A 3W6NA 3DMYA 4AG5A 1JB1A 4AU1A 4HDMA 4IQFA 4MVJI 4BX2A 1GPKA 1TUIA 3A11A 4HEJA 4J0IA 3UMSA 4D1YA 2IZ7A 2Y2UA 4YP1A 2DFTA 2I65A 2JZCA 3UVEA 1WP4A 4XWYA 4MVCA 3TW0A 2WW8A 3M5WA 4KE7A 3SHOA 3MUFA 4PCAA 3CKKA 1ACJA 1AZTA 4WBSA 4W5TA 4B3TB 4KPYA 2IU3A 2VT7A 2B4KA 3GJ3A 2JBWA 5BWBA 2R44A 3UV6A 4DR6B 4HLUA 1RQ7A 1OKKA 1X80B 3L18A 1NC1A 1BEEA 3C3AA 4X8HA 3KYDA 2PUFA 1OTHA 3QXCA 4Q3CA 1P17A 1KMMA 2V7UA 1KYWA 4MA0A 2HU7A 1SB9A 3P9SA 4QGFA 3F46A 2IF2A 1RRVA 2GNPA 1UIMA 3HS3A 2FP3A 3LBNA 1PG0A 3IR7A 2WM3A 4YRMA 3ETLA 4F21A 1GPLA 2GVDC 2WA1A 4JP1A 1M7GA 4URYR 2W2LD 4CF3A 3F6SA 4BMNA 1GGMA 4XIIA 3DXZA 3MJRA 3GLHA 2VPTA 5BYJA 5EJGA 3VNVA 1QO0D 3LC2O 1VJCA 2Q2WA 1B16A 4AWXA 3FIUA 2NZVG 4JXXA 1JIQA 1EGHA 3LKBA 4KAFA 3ID6C 3ZLTA 3DR3A 2G36A 1U5BB 4CKCA 4BEWA 4ZYXA 1DG1G 5LMNB 3NIBA 3PCXA 3PFGA 4JBXA 1UWCA 2Q27A 5GINE 2HLPA 4WERA 4EGJA 3CKYA 3ILXA 3O3CA 1O0BA 3OMWA 4NI5A 3ICEA 4IVQA 3LUDA 3ZGZA 1JDBB 4PICA 4IW3B 3G88A 1I4LD 3ETCA 4MUNA 2EC5A 3BJRA 2RSLA 2PLRA 1K9VF 3D6TB 4KQ2A 5HIAA 2ANCA 1WMSA 2QJWA 1J2TA 1ZIPA 4KPUA 3RRMA 4OMFG 2YCBA 1NG9A 2A0XA 5DTRA 4B79A 4Z99A 3OQBA 4RF5A 4TYNA 2FRXA 2G77B 1K92A 4IMPA 4DLRA 4DCJA 1YF3A 3OC6A 3T1VA 3KT8A 2W2OA 1M2WA 3PNVA 4RKRA 3IRVA 2BOVA 1FZQA 3C5EA 2O8BA 5E7MA 5HKOA 2D2XA 3WS7A 4UVIA 3DLHA 2GPJA 2VDWA 4G84A 3DBLA 2PZEA 1XZGA 3IAS1 4UM9D 5A2GA 4RTLA 4PF1A 2EW1A 2HQOA 5IMBA 2XYVA 3ST7A 4BNTA 1IN5A 4DIBA 1THGA 2O19A 1JBQA 1RQRA 3S99A 3NU1A 3W9SA 1GN9A 4CM7A 2R2AA 2OCBA 3L8YA 2ZSAA 4RS3A 4PS1A 2DX7A 4C4ZA 3LIIA 4TKVA 5BW8A 1M1NA 5A4AA 3BGDA 1QDEA 4YMVA 4NDNE 4WUVA 2CD9A 5J4YA 1G59A 1LV7A 3G9ZA 4YRDA 1G5PA 5ALGA 3LLUA 3Q10A 3QQ5A 2GXSA 3II6X 1XZKA 2AUTA 4KYUA 1OXSC 4OHMA 5F51A 3T3GA 4BFYA 2GM5A 2Q1XA 2YASA 2CEAA 5JY1A 1V0JA 2ERCA 2Q4OA 1K66A 2R1VB 4JVSB 3W77A 2QBYA 2HTEA 2XSZA 3RC2A 4LJ9A 5MN4A 1FS6A 3CX6A 3EA0A 2PKCA 1YK1A 4HY3A 5FPYA 4JCOA 3WLHA 4IIDA 3L40A 5FEMA 4F7WA 3PITA 2Y1EA 2RGEA 4ND2A 1VE3A 4GP7A 1QK3A 3RUDA 1UINA 2EX0A 1E6CA 4DNFA 2V45A 4X93A 3MJFA 3U49A 1JKFA 1X7DA 2W6PA 2I87A 5B7QA 3C85A 4BJ3A 5K03A 1A8UA 2BE9A 2HLNA 3AT1A 4HXYA 4IF6A 4X94A 4N47A 3S4YA 1Z8NA 4BFVA 4WJLA 4RPIA 3H05A 3GWZA 5G40A 3SX2A 3TIGA 1ZP6A 2D1SA 2WC1A 2I33A 2QTBA 4MUYA 4KUHA 5LOVF 1P6UA 1CEQA 2PANA 4CM1A 1I24A 2FX5A 5H83A 1Q21A 4QUJA 1ZSYA 5DF1A 3ZE6A 2AUMA 4IDNA 4P0TA 5IT4A 4BYMA 3NP7A 4EUSA 4L0MA 2NACA 2I2AA 1YFJA 1T3LA 4W6QA 3G1WA 1KJ9A 1E62A 3HXLA 3KYJB 4TS3A 5LKRA 1M5TA 2IK8A 4ZVUA 3KB1A 4PZ9A 3ZU4A 1QK4A 3LVQE 1TZ2A 1KIFA 1T5OA 3DCNA 3O2SB 4GR9A 5G41A 3DYVA 3RGGA 2YJ5A 3U7JA 1VMKA 1FJ2A 3ZR4B 1N4AA 3AINA 4TTTS 4KHZA 2H4JA 3PUYA 2F8MA 3ADPA 2VDMB 4J2OA 5ELMA 4QNNA 5BWMA 1RJ9B 3DW3X 1G8PA 2G9ZA 1GQOA 1RCTE 4HB4A 4K8RB 1U3GA 3TB4A 4RV4A 1QP8A 2W2QA 4XLLA 1G7CA 2FPLA 4L78A 4ZI7B 4ZAWA 1L4EA 1KY3A 4FB5A 3LAWA 4LFBB 3PFFA 5AJXA 4Z3OA 3NDBB 3MUOA 1W19A 2BGRA 1ZJ5A 2A0FA 1LC3A 1LGYA 3CNQS 4MVXA 4GX0A 4U6SA 3ZE9A 2PPVA 3B1FA 5L3SB 2DQYA 4DLNA 1T6XA 4G5GA 1E9CA 4N0MA 3S7TA 3V4PB 2BMJA 3OTQA 2VTKA 1TIBA 3INYA 5J43A 2FQ1A 2VOJA 2W6NA 3BD6A 4LF7B 4Y3UA 1DXHA 1EK2A 2GYUA 3QMWA 1HORA 4JZKA 4NS1A 2XT0A 4RMIA 5IBPA 1FDVA 3SBXA 1B74A 1PN3A 3ER9A 4BDTA 2FE1A 1NWCA 4C6RA 1DWOA 2ID8A 2J3LA 4NG4A 1SCDA 2H65A 3JD3A 4RVHA 2PBLA 3K6RA 2OPBA 5BN4A 1QM5A 1E5VA 1R7RA 3BZUA 4LYFA 2ZBEA 1XTQA 2QS9A 4UZEA 4K88A 5CB6A 3GW8A 2W6ZA 5ALXA 5FUQA 1TYCA 4GLFA 5MHTA 4QE3A 4R7ZA 2Q5EA 1P91A 4DIFA 2AUNA 5GZ1A 1Y81A 5D85A 5G0WA 5FQOA 2VJPA 1P6QA 4TPKA 1J99A 4CV2A 1RAAA 3ANLA 1HEIA 1B2LA 2X8WA 4LE1A 3NDPA 4W9RA 1H2AS 1QHNA 3FOEC 3H9UA 2A9FA 1J09A 2IYFA 1HY3A 4F5YA 3F4BA 4QTZA 4BFWA 1N1MA 1GPBA 3O7WA 2XCRB 2VJCA 5E3JA 1YHYA 2C59A 3L92A 1JDBC 1EFRD 3FCAA 2KMLA 3QKRA 4RACA 5KC9A 2F8SA 2A5LA 2YQ4A 4TWJA 1ZK0A 2M6RA 4N5DA 1VJ1A 3IGFA 4QTTB 4LDJA 5IM5A 4RHFA 4BNXA 1ZD8A 2POQX 3EXFA 4W1PA 4DRZA 3R6WA 3ETEA 2NZYA 5J2UA 3GRKA 2DE0X 2DT5A 1CETA 4BLUA 3SQWA 1KSJA 2HZ7A 4TV8F 4IZIA 2LE0A 2IUSA 4KXXA 4Y7DA 5ES3A 5B7PA 2HQ1A 1RZVA 1I80A 5CAEB 3T1OA 1STOA 4EHFA 4CG3A 2Z6QA 2QG6A 4ITUA 5B3AA 3TBKA 3D6HA 5EXPA 2VDQB 1IWBB 2R7AA 2FSSA 2W2LA 2Z9BA 3RWBA 4BMZA 4HNUA 2JCBA 3FPKA 1UOQA 2W58A 1AUXA 1NMZA 1QC5B 2F9MA 3CNHA 4IQ4A 1USKA 4KMOA 3ESBA 3WL7A 1O9BA 2EATA 4PNZA 3A2KA 3T94A 1A04A 1XU9A 3QSGA 1UC5B 2AQKA 1UOOA 5JSFA 3U2QA 4MJLA 4NH0A 3PK0A 2FE4A 5FTKA 1NFRA 2HNKA 2VHQA 4L3VA 1PR3A 4WA7A 4JX8A 4YP7A 4EHKA 1P31A 1WMDA 1X87A 5AK5A 4XM1A 5DTMA 4UVEA 5BRAA 5JIBA 4R1PA 5IYZA 4N5IX 5KMGB 4Z53A 2CXXA 2ZR0A 3HABA 2HJWA 3EBLA 2IYVA 2JHPA 3K0AB 2QPLA 1Z4KA 2FZ5A 1KMHA 2RHWA 1ZGCA 2V5VA 4PGAA 2FJ0A 2H17A 2JVKA 3JYOA 5KKAA 3D5EA 5C1OA 4EF4A 3OZTA 3RS4A 5JAZA 1BKSB 3OQHA 1U31A 4JC0A 1R8QA 2FW8A 5DGDA 4ZFNA 5KCMA 2NU7B 4ATNA 5EIEA 2F62A 4F3TA 2QRKA 4Q48A 1PE0A 4YRNA 4W5HA 5IXJA 1N25A 3KKEA 1E6EA 2BCEA 3BKXA 2W98A 2Z2XA 3ORHA 4FN4A 5K3FB 2FZLA 2GLTA 1W36B 3P96A 1E1QD 4CEIA 3WLOA 2X8LA 3DP9A 4KBYA 5AFSA 2R85A 3C7DB 4NHEA 5JD6A 2W7TA 3NPMA 4ZHQA 4D5GA 4YRCA 5FL3A 2C2MA 4G23A 5CXUA 1WQ3A 4W63A 4U0JA 3K0SA 1U1DA 3B1VA 1QTIA 1G291 1OAOA 2MSEB 3RVQA 2VJKA 3H5AA 4DDHA 3K0FB 1AV7A 3KVVA 1JU4A 4LRXA 1QRUA 1PFUA 4LSMA 1YC2A 5FBLB 4HUQB 1HNZB 3ZKAA 1V43A 1RC8A 4MX8A 3UCFA 3MYRA 2LKDA 1P9OA 2GAFA 1F48A 2AN1A 3EXEA 4OXNA 2XCSB 3G0HA 3PC2A 3A3PA 3TNYA 3SQXA 5EAIA 4RA9A 2HXGA 1KDPA 1WRBA 3D3KA 2G04A 3BJEA 3DBHA 1AGPA 3H7IA 3K5IA 4UCQA 4J8PA 4HWTA 3WGLA 4JBNA 4IQGA 2OO5C 3FNHA 3ROPA 3ZPXA 4CM4B 3DBVO 2PKEA 5IT5A 1JI3A 1OWOA 5JS2A 1Y37A 2I6FA 2XCOA 5JV5A 2JGJA 1ZRNA 3MWLA 4U9IS 3OPYI 1M1UA 3WDSA 1ZSVA 1A1VA 5AVXA 5KSPA 2FJUA 2GVNA 2A9OA 3RPEA 4PU0A 1UMCB 3U9TA 2Q0SA 3VYTB 4B8ZA 3OD5A 1MOQA 1LLUA 2FOXA 5A5VA 1FL9A 2DLDA 3QPDA 1C8VB 2B4QA 3SJUA 4TKLA 3TLKA 1WSWA 1R6BX 5FI5A 3ZY6A 1J1ZA 3PHJA 4EKYA 4L73A 2HMYB 3RUIA 3IT2A 3KSZO 5F3WB 3VR4A 5CT5A 2NUTB 2RHMA 3AF6A 2YXPX 3B13B 3NBFA 2IH2A 2XUOA 2BRUA 2H7VA 3QI2A 2WG2A 4RZ3A 4QVKA 4GOMD 4HLQB 1S7CA 2BEUA 1PEAA 1CUVA 2H1IA 5BMVB 5JCJA 1FMFA 3UH1A 1B8UA 3FYCA 4ZAVA 1GL3A 1RZRA 2ID9A 3GEPA 1HDOA 3RSZA 1WMEA 2HHLA 4RTPA 1NUUA 4HNSA 4WKNA 1N8NA 4HDRA 1KP9A 2Q9UA 3MIZA 4YXWD 2EFYA 2DFPA 1YNSA 5EWJA 3S1AB 3UUFA 4R8LA 1L7OA 1OFVA 3GN2A 4RSMA 1YZQA 3CEPB 1FDOA 5KNDD 1MH1A 1GEEA 3PKJA 5CVEA 2EBHX 2DWCA 3AWIA 1TM5E 1ZM9A 3AEQA 1UK6A 2MMCA 3GR6A 5AKEA 3CZQA 4FFMA 2JFQA 3EFEA 3FHJA 5CGQB 5EIOA 3WLTA 4W9MC 2WMDA 2ZM5A 1QHHB 1V3VA 1RBYA 3J81A 1W30A 1XRRA 5G0SA 1OROA 1SK9A 2XF8A 3CG0A 3O3OB 1TCVA 2Z83A 2IXDA 3RV4A 2VHXA 4MMYB 3N87A 1SC1A 2ZRIA 5MF6A 2IY8A 3L8ZA 3BMOB 3ETNA 3KPJA 3WV5A 1Z15A 2A92A 2HMSA 3D8NA 2J3KA 4MV1A 1PGJA 1NE7A 3HO1A 2NVBA 3PX3A 4J6FA 2HDNB 2JEOA 3STUA 5CPFA 2FI1A 3AOEC 3OPNA 1M2VA 2WIAA 2HR1A 5JJKA 2B98A 3MS4A 2AVDA 1Z39A 2ECKA 2WFMA 4RZUA 5IKOA 2FWPA 4ZZ1A 4QHSA 3MFYA 1YRYE 3N7UA 4IY1A 2MJLA 2OGWA 1JW9B 1LW7A 1T2DA 1Y4UA 2Z0MA 4R0NA 4D6XA 1BCSB 1B73A 2NZJA 1NQUA 2QAGC 3CWQA 3OD1A 4R2JA 2NTEA 3TQCA 3VKFA 1EKXA 2PLWA 3BICA 3N86A 2HA3A 3JRXA 1P1BA 5TMEA 4I5DA 4Q03A 1YNOA 3IS3A 4CG0A 4ENWA 3LM8A 1U0JA 3BL6A 3RF7A 4IM7A 3ZVLA 4I55F 2H31A 1FDWA 4DSAA 1DADA 1BWPA 3IA2A 4UDYX 3HWX1 1HT2E 2IEGA 2W6OA 4ZARA 4WZBB 5HK8A 4F9GA 2Q3JA 1DINA 2EARA 3DVQX 4UE6A 1XIVA 3ZTTA 1Q3TA 4MGEA 1E61A 4R8MA 1RVV1 2I29A 4F92B 3F96A 4D9JA 2GJSA 3GQBA 3Q0IA 2HI0A 1RYZA 3F5MA 3KR1A 2OKCA 4XYEA 2RI1A 2D5LA 2ZDHA 5AKJA 3UFXB 3VM6A 1V9LA 3PWZA 4WFKA 1YDGA 1JLSA 1LWNA 1YR7A 5HM8A 3TLYA 4KP7A 3THXB 3U3XA 3RVJA 3SHWA 4FIDA 4W6ZA 1ZAYA 3UAXA 1EFRA 3OBIA 1KQFA 2E48A 4FSXA 3V6LA 3WNDA 5FT9A 3BHJA 5FNZA 1K27A 1GPUA 1WWKA 3ZY4A 4C4XA 4CQMA 3BILA 1MTZA 3RJMA 1HQCA 2X0IA 5E1BA 4X41A 3LHIA 5A71A 4D26A 1FP6A 1GAJA 1V1MB 5F4BA 1KE2A 1FDIA 1NQOA 2ZANA 3BMQA 4CM5A 2RHBA 3WGOA 2JFWA 4HX2A 1E9AA 4NV0A 3TCNA 1WNFA 5DWQA 4F2DA 1ZONA 3G7NA 2IOYA 5FWYA 5CLHA 4BCDA 1ORDA 3QX7A 1UFKA 1W36C 1DP4A 2IUEA 2OL4A 4HB2A 1IUKA 4LX8A 4GKJB 1DQSA 1PX0A 2TMYA 3DOOA 4J9UE 2P4SA 1L8XA 1NXSA 4KSBA 1X1DA 4O4JB 3V1NA 1KAGA 1Y4ZA 2J9ZB 1DEHA 1FQJA 4RUKA 1J23A 4HQOA 3W79A 5FBKA 1IN8A 4L1KA 1JEAA 4FK8A 1VMEA 1RADA 1YQUA 2H00A 4ZRMA 5TF4A 3VR5H 4DC1A 4FFSA 5LQUA 4FHCA 5F35A 4OU5A 4DV2B 4HKTA 3LUFA 1OWLA 1FNNA 1ZNZA 3PU6A 4IHJB 4EGQA 1KYZA 2DBVO 2EP5A 2OFFA 1RM3A 4A16A 2CFIA 4E1AA 1Z8FA 4OXQA 1QHXA 1TJNA 3B38A 4Y2JA 1WPGA 5FFNA 1L7EA 3LCJA 5REQA 2P2CA 3AETA 3MSXA 4Y30A 1Z0AA 1I9CA 1FLVA 2EFCB 1RXEA 3OPQA 1X39A 4ZEOA 1Z6ZA 2HQRA 1RVDA 3CV3A 4GW3A 4QNMA 5J2TF 4EA8A 1E9DA 2YJGA 3MWKA 3QLVC 5LYJA 2VTDA 3W8DA 4G1MB 4HDCA 5L9AA 1YJCA 2PXCA 3V42A 1IPFA 3FKQA 4NU8X 4LYAA 2X3YA 1PS9A 2W5UA 3RYCB 1RW4A 4YK7A 1IPEA 2WAAA 4JJAA 1GL9B 3U3JA 3TKYA 1CYDA 3UMYA 4EW2A 2AQHA 3DDCA 3HN2A 4FKBA 3KTAA 2ZROA 4PZUA 2Q9BA 3F1KA 2FW0A 4YUYA 3FNEA 2J0UB 4RE5A 1L7RA 4XDYA 1NI3A 1TMGE 1GCOA 4MZDA 1V6AA 4BGDA 2PLFA 2VSYA 1L5KA 3A6FA 4MVJG 4BO4A 3I01A 3RTGA 2C00A 1HEYA 1I01A 1EDZA 2ZGVA 2PUVA 3HO8A 4U00A 1TJPB 1UPUA 2IHJA 2BMAA 2OHGA 1TLTA 3ETDA 4NY1A 4D5EA 4E5VA 1JS1X 4XXHA 1WZNA 4JNCA 3GDHA 4RHTA 1Y7PA 3HNRA 4YMWA 4B2PA 5I45A 3EYWA 1Z8DA 2X5KO 4GM4A 4LVNA 1SCNE 3HBJA 1NVEA 3Q8XB 1EDBA 1MX3A 1UBLS 3DE6X 3PGMA 2P2GA 1BKYA 1BKDR 1G0OA 4GRAA 5HWSA 4Q6BA 3KEOA 2BEKA 5J47A 2JK0A 2C2WA 3RROA 2X0FA 1R4ZA 1ESZA 1EE2A 1IG3A 3P4XA 1TX4B 3MRTA 4H1VA 4J4BA 1M75A 3GLFE 3OQOA 4RY2A 1DBRA 4C3OB 5F78A 1Z5PA 3VSDA 1R9NA 3RJZA 2WUWE 4BHTA 4Z6KA 1EFKA 4UZSA 1IEVA 5JVDB 3V1LA 4H9GA 4UTRA 2WWXA 1YZLA 3DMHA 5DNWA 2I80A 3FYSA 2W70A 4NABA 2PUBA 1SUBA 3AB8A 4J9VA 1RR6A 4NATA 3SSMA 1GGNA 1ODLA 1JMKC 3MJHA 1AK2A 1P3JA 2FDXA 2GK7A 5JMWA 1E1KA 1IHDA 5HIKA 2X2EA 3P20A 4JXZA 5A6SB 4ZT2A 4L4UA 5A9SB 4NULA 4BUZA 1A95A 2XQJA 2G1PA 3F8SA 2HFKA 2QM8A 3RVRA 4EJSB 1E77A 1KA9H 1T26A 1EU1A 1NVMB 1WTCA 2PX2A 1Y1LA 5KSOA 1TTPB 4IILA 4J43A 4L74A 1DKNA 4MULA 1MRNA 2MOKA 3E7XA 3DO5A 2GOYA 3M33A 5J59A 3OE1A 1UFOA 2SCUA 3CO5A 3VO8A 3E3AA 3BYZA 4Q4JB 2C07A 3F7TA 3KJXA 3I01M 3UN1A 2WMYA 4GBJA 4BTEA 2E3JA 4DLPA 4I4TF 2QQEA 4NCNA 2OAEA 3A6KA 5JH7A 4M7OA 3ZLJA 4JGIA 4PQRA 3GFTA 4HFMA 1DBWA 1RYHA 3JQGA 1E9RA 4N5MA 5HJ2A 4EATA 2V3CC 4D79A 1FQOA 1N4DA 4FS8A 1MRSA 3OCYA 2AZDA 3OPYB 2BR5A 4YPFA 3TLGA 3QV1A 3RU3A 3JZMA 1X38A 1YB6A 1YCGA 5TS2A 4ER7A 4YYEA 5CFQA 2XVZA 5GTDA 4AECA 4MQ5A 1QVRA 5J1SB 3ENWA 1I3MA 4JFAA 1FDRA 1JU3A 1O0CA 4YBZA 4AY4A 1O3YA 1WXXA 1YKFA 1U80A 2JKZA 1JLMA 2OAP1 2XYPA 5ADWA 3JZFA 4US1R 2FU5C 5TV2A 4AO7A 4JI0B 5KQSA 4XWTA 2W48A 2BSXA 1XRMA 2FZKA 1N5IA 2G8NA 4NBKA 3DVRX 2FN4A 4QOFA 3VNSA 4EY5A 1N6NA 3PQ7A 3ZK7A 4LY0A 1SULA 2BELA 5BSRA 1S2MA 1I13A 2OWEA 2OWDA 3T99A 4Q4HA 4OP2A 3K9HA 5CNJA 4NLLA 1VA4A 4WE3A 1U1CA 4NSNA 2HAEA 2M6SA 2ZBUA 4U2CA 3MINB 5DMXA 4EPRA 2G63A 2RB5A 1WQ1R 2X1VA 2NQTA 4DSZA 2C1XA 1M7HA 3U17A 4IDCA 1ANKA 2PWBA 1D4OA 4XGNA 2OHVA 3HRHA 2OXFA 2GN8A 4OUKX 4HRXA 5L7TA 3H11B 4LXGA 1VYTA 3SIWA 3ZUGA 1H2RS 5IAKA 4MKZA 1M66A 3LK6A 4PIPA 3WJ1A 3FWNA 1VIVA 2O1SA 3KELA 3JQQA 4FZ3A 2C2ZA 1OLOA 2H0RA 2GEJA 3COYA 3T7CA 4QWWA 1BOFA 1OX6A 5AM0A 1AF4A 4Q9AA 5IH3A 3RB8A 3T3NA 3LQKA 4IDQA 1S5PA 4L22A 2QTZA 2GUWA 2AJBA 5CNIA 2H1FA 4XD7D 1HYQA 4RLQA 4XYMA 5ALPA 4C7JA 1T3ZA 2YJ6A 4HAUA 4BBPA 3GOQA 1FX1A 4IUBS 2OUIA 1H0KA 2PDAA 2WWIA 1MFPA 3R75A 1NVVQ 3P0HA 2BFWA 3RRJA 3F1LA 1BIFA 3UK2A 4S0ZA 5EFZA 2ZXUA 3A1NA 5IF3A 2ZCUA 2CB0A 1SELA 3VU0A 5FOWA 4HGRA 1V9CA 2DHDA 3HA5A 3PS9A 4KOAA 1NXPA 3L77A 2RJNA 4RSGA 3LS2A 3OTOB 1UPXA 4DMGA 1BMDA 2AQIA 2E6KA 5C5CA 2QTVB 5JPIA 3C1OA 5K3EA 1YI0A 5HKKD 3VKUA 3GXBA 1G20A 4LW8A 3KUKA 5H70A 2E5LB 4XRRA 4E2WA 1GT6A 2H1HA 3DOJA 1DCMA 1O6BA 1DQPA 3LRPA 4PO1A 2JCGA 5F2KA 3ETJA 4Y2VA 3JVDA 1E69A 4QIHA 1JRLA 1Q50A 2PO7A 5T5QA 3AP1A 3WP1B 1DCKA 5F1OA 4RHXA 3A05A 3DV9A 3OZGA 1GCAA 2W6CX 4QQNA 5KHAA 4AMGA 3WC4A 4GHWA 3MB5A 4MVJE 4B6JA 4AAYA 5H7XA 3OZEA 2P8JA 3H8SA 3LY7A 5J9FA 2BEWB 4RNDB 3ZJVA 5IVDA 5CA0F 4YCBA 4ZJPA 2JC3A 5JE8A 4ZYTA 2WUVA 3HEBA 3R7AA 3AF3A 3CF4A 1PNRA 1CDZA 4NKRA 4FR2A 3ORSA 3L0YA 2QP4A 3TOCA 3QU2A 2EKDA 5FYQA 4GUAA 1QZZA 1R9GA 4KNWA 3DDOA 4BNGA 4J1NA 5JNWA 2J46A 5AHXA 3ZI4A 4UHEA 3ZWCA 4O4HA 1UP6A 1KAMA 2JEZA 4KQEA 3RVOA 4YH1A 1FFAA 2PSDA 1UPFA 1EB9A 1ONBA 1ZIXA 4WJZA 1M2KA 4BCBA 1EK6A 2I6TA 3HP7A 1MABB 3BK2A 4GRDA 4OREX 5REQB 4BGUA 5F64A 4F4DA 1CEEA 1H4QA 3GEMA 4C01A 3OQIA 2PM8A 1A0OA 3K9NA 3WO1A 3H5IA 5HVNA 3AB3A 4XM0A 5ALTA 3INRA 1XVUA 5BW4A 3GRPA 3KWMA 4Q7EA 1RLTA 3G02A 5GIOE 3I64A 1LNZA 2KB0A 1Q7BA 2R1TA 3A4LA 1IXYA 4AURA 3JAWB 3WSTA 1H6AA 4MYSA 1Z5VA 4TMTA 3TSWA 2X0NA 2X8JA 3IC5A 4ADSG 5IN4A 2W9XA 3E9NA 1PJZA 4H1HA 4F4CA 2P2NA 1JHVA 4FBLA 1PFQA 2MSNA 4JBWA 4U2GA 1ZM3A 4QSMA 3S2GA 4EJSC 5BN5A 5ARBA 1FTQA 2J08A 1LW6E 4FN5A 3ZJ5A 2DH6A 4G5YA 3RCBA 1T8TA 3E27A 3ORRA 3A6JA 2WY2D 1JU9A 1QKKA 3AGPA 2RHCA 4KX3A 5EZSA 5BYKA 2VBFA 1HBJA 3HB5X 3X1YA 1ZD9A 1DAGA 1SBQA 4M0DA 1QIEA 2QLMA 1XRJA 2KHZA 2FUEA 3DNFA 3NBXX 3LNTA 4M99A 4XUGB 1PJ3A 5KOYA 4KFTA 5CA1F 2FDCA 1O96B 1DWUA 1PKEA 4NH4A 5E6UA 3OCJA 3UIEA 1DG9A 2FQQA 2QENA 3IQEA 5JMOA 4FILA 1CHNA 5EJ2A 4IAOA 4L3OA 1T5TA 2G9QA 2JRLA 3VR6D 1I2CA 1D04A 3EHEA 3OBBA 3EWNA 1VIYA 1YVRA 1R8YA 2BE7A 2GF0A 4M0EA 3GLGB 5I9SA 1RHMA 5HCNA 4BV2A 4EFDA 4K0KB 2AFHB 4X60A 1NQTA 3W5UA 4EKEA 2DM6A 4WIAA 4B40A 5DASA 2ONYA 4JELA 1YA4A 3D3WB 1J8VA 1SG9A 2AX4A 2D3TA 1U0SY 2CHVA 1E2IA 1BDBA 2VNHA 4PO3X 2J9GA 3M6UA 1Z38A 3MXTA 5TS3A 3SM9A 3TQHA 3ZVRA 4G0ZA 3DKPA 4IMRA 1GQRA 1JFTA 1NOKA 1XP8A 1U2PA 4AG3A 4RY8A 5TGDA 2HQBA 1DOHA 2W2NA 2EWVA 1L7XA 4P4TA 1BZYA 4CNQA 5C8VA 1D03A 4NG5A 1XKLA 3MT0A 3QF4A 3LW8A 1FJGB 2YVLA 1Y9EA 4I8XA 1X7YB 4DQDA 4PZEA 3A37A 3U0VA 4DDMA 6REQA 1MJFA 3O0DA 4KU4A 2NX2A 5FPQA 5I7AA 3OQ6A 3OOSA 4PNEA 5DK4A 3N8HA 4YP5A 1ZR4A 2YHSA 1E63A 1WABA 2BM1A 3TEFA 1YTUA 1WEKA 2QWXA 4U7TB 7GPBA 1QAQA 1FVXA 5MGNA 3ILYA 4TXLA 3HDHA 2QVZX 2VHVA 3LFUA 1YJQA 3KU1A 1IVNA 4XEUA 5E3IA 1QU3A 1J20A 5TQ0B 1N6RA 4G5SA 2WYHA 3WKBA 4L9SA 2BONA 5D3ZA 1GQYA 1TF7A 2QJTA 4LZJA 1TT5A 4WTOA 3IMEA 3SD7A 4PZLA 4BZXA 1USVA 3TLZA 4Q18A 4AIRA 1CUHA 3IPRA 2GEKA 2I7DA 3FR7A 1UK7A 3QKUA 4OQZA 5AI6A 3UBMA 4F9FA 1JG7A 2RKWA 2AEMA 3CSUA 5G2OA 5CB0A 4KZKA 1MGPA 2E4VA 4YMHA 1HMYA 2AN3A 4EYGA 4K9RA 2UDPA 1O4WA 2IDZA 3E2IA 5IVHA 1C9EA 1YUMA 2ZWPA 3IVAA 2ZJ0A 3P9ZA 3PG5A 2J3HA 4Q00A 4QC2A 1N2SA 1TAHA 1USUA 1Q44A 3A7EA 4RO0A 4S2EA 2C4NA 3O75A 3FRHA 2PSSA 4FE3A 3ZV3A 5KNBA 1EB8A 1YIOA 3IIIA 4EGFA 4LKOA 4PN3A 4E2ZA 3I3SR 2FUNB 1WW2A 3I6QA 1Z6TA 3R5KA 2I1QA 3KALA 1WO8A 2WWVD 4AJPA 2G9UA 4FGLA 4BLRA 1NRIA 1NSFA 5HRAA 1P2TA 2W93A 4Z9AA 1RU3A 3VSCA 5JJCA 1Z37A 1CJVC 3ISJA 2J5QA 3HR7A 2FUCA 3NHSA 1CLEA 4EH1A 1E3SA 5JTUA 2BBWA 4GQAA 3FMIA 3QOXA 4RGQA 3T9FA 2FLKA 3R1IA 2VR1A 3TG8A 5EWMA 3T7SA 1C4XA 4Q9JA 4M53A 1ZUWA 1SKQA 1YB2A 1SN7A 3SLRA 3DBRB 1ODFA 1THMA 3MYYA 2XEDA 1C7RA 5EIAA 2A0YA 1T9KA 3A70A 3B2QA 4I99A 5IM4A 1R18A 1LSSA 1WA5A 1UC9A 1ZI6A 3AKDA 4CVNA 1MH9A 2PV7A 4OMDA 2JAUA 1QGDA 1IQPA 1ZI9A 4JJ8A 4TYMA 4ZOLF 3TGWA 1DBSA 4WZBE 4A0FA 2AVNA 1JP7A 2ATXA 4P6VF 4D4IA 4R7TA 3SOPA 3WGMA 1VMAA 2AX3A 2JLCA 4S04A 2C1ZA 3ICQB 9ABPA 4MUEA 3GVCA 3ZI7A 4FYMA 5AK4A 1GNLA 2ZRBA 1QGOA 5DHAA 2K5UA 2IGTA 2YMQA 3CZ9A 1I4DD 1RNLA 3L79A 1U0GA 3FUCA 3RWMB 5IJ9A 1A9YA 4FHEA 1Z2NX 5EMHA 4I50A 1SVIA 1WPRA 2APJA 2TRSB 4QYSA 4YROA 2FWRA 2GHQA 5JPCA 4ZT5A 1T9GR 1EP9A 5EUMA 3F3SA 4I1RA 1NNEA 1D2GA 4KG7A 4S12A 3F6RA 4JLMA 3EEYA 4IJ6A 4KQCA 5GV8A 1GRRA 2NNWB 4BYGA 5BO5A 3FUTA 1IN6A 3DEIA 1ZICA 4WBNB 2GH1A 3MVEA 3DV0A 3N2GA 4IIYA 1QGUB 1CQIA 3QPAA 4F93B 5HK9A 1XTTA 4JYAB 2ETXA 3CVYA 5BUCA 4JR1A 3SIPA 4TMWA 3ROFA 3QG5A 1UPTA 1WNTA 4FJ2A 1UJ5A 1KE1A 1WUTA 2HBZA 5CBPB 3PGVA 3OSUA 4D2IA 2PSFA 4RH0A 4JA2A 2CNNA 1D6MA 5CITA 1BW9A 1IRIA 4YO8A 1SWWA 4OGWA 1HYGA 1E9EA 2Z57A 3AJEA 4L4RA 3DL4A 3WL8A 5AW2A 3CRRA 3S68A 2OZLA 4DAEA 3KETA 3E4CA 2DFDA 3DVLA 3THOA 3KVNA 2PGLA 4J0DA 2A1UA 1XD2B 3O26A 4NBUA 4D0GA 4EYOA 2QVLA 5BSMA 4AKGA 3G9UA 5LMZA 5ERYA 3ZGXA 4TTSA 4F2GA 1I6MA 1YRAA 4Z3DA 3QVSA 4OJYA 3LECA 4YV2A 4JBIA 4K6OA 1JDZA 2E0IA 2Q6IA 2KS6A 2XH8A 2ZYUX 1KHHA 3M4ZA 4XH9B 4A2CA 5A04A 4X5OA 3STWA 4ITRC 1BFUA 3RSFA 1BTOA 1RAFA 1PZXA 1GNVA 3HDTA 4KGVA 2H54A 3U60B 2JHGA 1THZA 3CH4B 3JARB 4TTVA 4P4LA 1C4OA 3VU1A 1KC1A 2Y1GA 2QNBA 4AKTA 1ZSNA 4L4SA 2E4YA 3C3DA 3G8CA 3MTAA 1R0BA 4J29A 3OCCA 4ARVA 4Q4LA 1A71A 2ONJA 2O7VA 3GPIA 4AF6A 1M1YA 5BV0A 2JIMA 2Z1DA 4QEZA 4Y7CA 4DCUA 3CR3C 4R2WA 4E46A 3OF3A 1OHHD 2WILA 4DCMA 1I8TA 3I37X 3UT5A 2YTZA 3IVMA 4G3XA 1T8YA 4Z4HA 5JYDA 1Y9JA 2DAPA 3ED1A 2Q5QA 3S2UA 4ZP1A 4BU0A 1ATIA 1OXKB 2HY7A 3DFIA 3D1VA 3F4KA 4A10A 1X86B 3AR5A 5IEBA 4XOIA 2CLLB 2FMIA 1R5JA 2IBMA 4QREA 3WLRA 1VL6A 2OVBA 4I6GA 4EHLA 3QEMA 1F1BA 4DNQA 1W87A 2ZBQA 2BDTA 3H9JA 2BF7A 3C5CA 3IPLA 1C30B 1FTYA 2A9VA 4OQYA 3WMGA 4DLWA 5D8DA 4U7GA 1C1DB 4PLZA 1KIAA 1SHTX 4RMGA 2GF9A 2F3QA 4YP6A 1HTTA 3N2IA 1AUPA 3L6RA 2XA1A 4ZYVA 2WWWA 4CRWB 2B6NA 2PT6A 3EIWA 2JANA 3JAMA 4BO8A 3EGWA 3WL5A 2EFEB 4GC9A 1R4MA 1XHLA 521PA 4C3VA 4QDJA 2XR1A 3WMEA 1XZAA 3AHHA 1SQ6A 2OG1A 3E18A 4IV5A 3L4EA 3N6RA 4XIYA 4DZZA 5K51A 1KJNA 4KNVA 5C80A 3GVPA 1E2PA 1H2BA 2P6MA 3BE5A 4DLBA 1W6UA 2HIAA 3HJAA 2QLBA 4PLVA 3VR6A 1X80A 4C0XA 1KFEB 5BSTA 4DLXA 5LNK6 3Q6NA 5ETJA 621PA 4AXBA 1TJ4A 1ZH0A 5LKAA 1QG6A 4IUDS 1GYPA 2VHWA 1MKYA 2ZKLA 3RUFA 2ODPA 3JQRA 4LQ4A 2DQ4A 2JVIA 2FP4B 2PBZA 1UBCA 3CYFA 4A8HA 4MO2A 2EZ9A 4O0LA 3ZX5A 4DDWA 1XDWA 2PGNA 5EP2A 2VQSA 3MOIA 3OF2A 3NBAA 1UWLA 3IBTA 4G4IA 4XDHA 2RGRA 4DQXA 4OUDA 1X9HA 5A2QA 1IULA 1PG5A 3EIQA 2C7QA 1XQ1A 1AY0A 1JXOA 3SDBA 1A5AB 1Q1GA 1X3SA 1U5BA 2AZTA 4U1RA 1EFCA 3SIRA 1SOUA 2YNMC 1XALA 5FTJA 5LC1A 2ZYVX 1OBFO 4O0MA 4UQOA 2W2PA 4KXLA 2O3UA 1IM8A 4PLWA 1D6SA 2EW8A 4HV4A 3QX8A 1O95C 2IX3A 1EFLA 1BJRE 1QWOA 1RQ2A 1Y7HA 2AJLI 5E9AA 3TOXA 3UJHA 5AVUA 2PGJA 3HXOA 1WCWA 5SY9A 2X13A 3LRXA 4MKRA 3TZQA 1JALA 2JFYA 3U13A 4G0YA 1CDOA 4B4WA 4KGXA 4QPNA 4REQB 1U0OC 5JQGF 4WOJA 1UXIA 2WK1A 2CXQA 2RGYA 3VDMA 1QH1B 2XNDD 1VIMA 3EVZA 4M83A 3W5CA 5IC6A 2A9PA 1Z83A 1RWBA 2FMXA 2FW1A 3D3EA 3QXXA 1V37A 2E18A 3K8QA 3PRYA 4R2XA 4NQZA 2JFBA 3GEBA 3TZBA 3TM4A 3IBCA 1E2FA 3RM3A 2JDIA 1C8LA 4F5ZA 3K2IA 4K3UA 3AX6A 2QYOA 1L7PA 2CFSA 2WUFA 4E6EA 2ZE8A 2OOSA 4MR8A 1SVUA 5LIRA 4FM9A 5F76A 1JILA 1UC4B 2HA5A 3SEAA 4YRFA 2G9VA 2PZMA 5IAGA 4AWAA 5KOHB 1QDLB 2EKZA 5AOAA 2WJYA 3TLXA 1KJZA 1F4VA 4UD6A 4PGGA 2O6HA 3AUTA 4TTIA 2DERA 2RBEA 3OE4A 3G1TA 3NC4A 1PDVA 4IINA 1AUQA 1YQEA 3NAGA 2V58A 3D54D 3WRYC 1N0IA 2CHQA 1O89A 2I62A 4RJTA 1H23A 1QB7A 1NKVA 3HI6A 2ZDQA 1A50B 1RI1A 3MS2A 3OZFA 3Q3IA 2C7PA 2VK2A 1HLFA 2CLFB 2C7VA 5ESRA 3TTTA 1OASA 3BWYA 4D3DA 2HL6A 1XQ9A 2B9VA 3I8OA 2Y99A 3F5FA 5K3BA 4ZCTA 1N2EA 1NBHA 1O7JA 1X1RA 2HJHA 4D41A 1Q14A 1Z4MA 2O2JA 2Q6VA 3N2EA 2R1VA