1VHWA

Crystal structure of purine nucleoside phosphorylase with adenosine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
237
structure length
237
Chain Sequence
ATPHINAQMGDFADVVLMPGDPLRAKYIAENFLDNAVQVCDVRNMFGYTGTYKGRRISVMGHGMGIPSCSIYVTELIKDYGVKKIIRVGSCGAVNEGIKVRDVVIGMGACTDSKVNRIRFKDHDFAAIADYKMVKAAEEAAKARGIDVKVGNLFSAELFYTPDPSMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALAICTVSDHIKTGEQTTSEERQNTFNEMIEIALDSVLIGDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords purine nucleoside phosphorylase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Vibrio cholerae
total genus 84
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vhwA00
3OPVA 3GGSA 4MCHA 1B8OA 1Y6QA 1LX7A 3OCCA 3DDOA 3U40A 1T8YA 1XE3A 4BN0A 5F78A 1SD2A 2OXFA 1T8SA 1V45E 4WKBA 1RXUA 4WKPA 1JE0A 4WKOA 1ODKA 1U1FA 2QSUA 1OV6A 1A9QA 3K8QA 1PR4A 1Y1QA 3ONVA 4DA8A 1WTAA 4PNPA 2A0YA 4TTIA 2HWUA 1ZOSA 4NSNA 1YR3A 4BMYA 3BSFA 3OZCA 3E9RA 3UAWA 3UAZA 3DP9A 2AI2A 1Q1GA 5CCEA 1RT9A 1V41E 1JE1A 1TCVA 2I4TA 4DANA 5KB3A 2AI1A 4LZWA 3DF9A 4OF4A 1A9PA 3PHBE 1QE5A 3TL6A 5FAKA 4GLJA 1U1EA 4LNAA 4R2XA 3D1VA 1A69A 4TTJA 1K27A 1A9RA 3OZBA 2A8YA 3BGSA 1OVGA 4L6IA 1NC3A 3NM6B 1ULBA 3EMVA 3GB9A 5B7NA 1VFNA 4TXLA 1SJ9A 4PR3A 3E0QA 4ECEA 3P0EA 5B7PA 1K9SA 3NBQA 4IP0A 1T8RA 4P54A 3FNQA 4QAQA 4DAEA 1OTXA 1TGVA 4QASA 1Y6RA 1A9SA 3LA8A 3O4VA 3PNSA 4MCIA 5B7GA 4TXJA 1TCUA 4TXMA 5CYGA 3FOWA 4GLFA 1FXUA 3EEIA 4OJTA 3KU4A 4QEZA 1G2OA 4DA7A 5ETJA 1JDTA 5F7JA 3UAXA 4D98A 4RJ2A 4E1VA 3FB1A 1U1DA 1OU4A 1PR1A 3OOEA 5F7ZA 3IEXA 3F8WA 1JPVA 5F7XA 4L0MA 2HRDA 1Y1RA 5CCDA 4FFSA 4L5YA 5F73A 2OC4A 5IFKA 4F2PA 1Z35A 2QTTA 3MB8A 4G8JA 4BMXA 4EB8A 4D8VA 5F76A 4QARA 1JDZA 2BSXA 1VHJA 1RXSA 5EFOA 1C3XA 3NM5A 4TS9A 5EPUA 4LKRA 3EUEA 1VHWA 2OC9A 4M7WA 3OF3A 1JDUA 2H8GA 3E9ZA 4M3NA 5EUBA 1PK7A 4R2WA 1NC1A 1OTYA 4UC0A 3UT6A 3BJEA 3UAYA 1VMKA 3FAZA 4TXHA 5CXSA 1RXYA 2QDKA 3EUFA 1V48A 2PGAA 4DABA 1JDSA 5CYFA 1U1GA 1U1CA 3K8OE 4NS1A 4DAOA 3KVVA 1V4NA 2IQ5A 4WKNA 4D9HA 3ODGA 4YMLA 3PHCA 3O6VA 2RJ3A 2Q7OE 4M1EA 1PR0A 2XRFA 4F3CA 5DK6A 2QTGA 4F3KA 3DPSA 1YRYE 4L5AA 2B94A 1K3FA 1PWYE 1YQQA 3P0FA 4D8XA 4DA6A 4YO8A 4NY1A 3OZDA 3QPBA 1ECPA 4I2VA 1JDVA 1Z33A 3T94A 1SQ6A 3BL6A 1ZL2A 1PF7E 4YJKA 1ODJA 1Z5OA 2GUWA 1A9OA 1Z34A 3MMSA 1CG6A 2OECA 1LVUA 1PW7A 3NM4A 3IOMA 4R31A 4F2WA 2AI3A 1N3IA 1OUMA 1RYZA 2ISCA 5F7OA 1PR5A 4JP5A 5C80A 1PR6A 1PK9A 5IU6A 1ODLA 4TTAA 4TXNA 1RR6A 4L5CA 3LBAA 4K6OA 4TS3A 1PBNA 4BMZA 4DARA 4OY3A 4JWTA 3KVRA 2AC7A 4GKAA 4F1WA 1TGYA 1PR2A 1T0UA 3UAVA 2I8AA 4G89A 4D8YA 4QATA 3FUCA 5K1ZA 5F77A 1Z39A 3DJFA 4JOSA 4GMHA 1I80A 5I3CA 2A0WA 1M73E 3SCZA 3OZEA 4LDNA 1NW4A 1LV8A 4OGKA 4KN5A 4YNBA 1Y1SA 3OOHA 3ENZA 1A9TA 4X24A 1RXCA 1PKEA 1JYSA 1ULAA 1Z5PA 3C74A 4WKCA 4QFBA 3LGSA 1V2HE 4DA0A 1YQUA 4MARA 1YBFA 1RCTE 1JP7A 3KHSA 1Z37A 5JPCA 2HSWA 3FWPA 4H1TA 1T8WA 5B7QA 2ON6A 1ODIA 1Z38A 3KUKA 1Z36A 4OEHA 2A0XA 4TYMA 2P4SA 2QPLA 1B8NA 1RFGE 1CB0A 1RSZA 1V3QE 4LNHA 5CXQA 4G41A 4EARA 2HN9A 1SD1A 4U2KA 1TD1A 3KVYA 4OGLA 1Z5NA 3INYA 1Y1TA 3PNPA
chains in the Genus database with same CATH superfamily
2PMEA 4IQ0A 5BYAA 1GU0A 1V47A 1S5PA 2XCSB 2F6RA 2W2KA 4X84A 1RHQA 1W9MA 4TLDA 1S2GA 2Y9MB 1D1PA 1UIMA 2HR1A 2IELA 5KVVA 3PYLA 4RKQA 1OWMA 5TGTA 2UXCB 1R66A 4O29A 3ZI4A 5KKCA 3AHJA 1I0IA 1E2IA 3IC5A 2FPUA 1BGWA 2E4XA 2WLSA 2P6PA 3MIIA 3P5SA 4RBNA 2J4FA 3U3JA 3EXIB 3ZGNA 4DRZA 3U19A 3B20A 3Q9NA 1TM7E 3RKSA 2IU6A 1MN6A 3VKFA 1DC5A 1XZPA 1FFSA 2VKQA 5A04A 1PGJA 3T1TA 1QM5A 1Z4PX 4GG1A 3VJKA 4OAPA 3INTA 1OJLA 3KLNA 3OZUA 2G28A 3PQ2A 1UAGA 4KYTA 1D4AA 2AW3A 3LHDA 1IXZA 4WCDA 3RS3A 3T3HA 1NFRA 3PPVA 4JX9A 1JKJA 2V3WA 4BRUA 2ZB3A 1ODKA 3T3MB 2V4UA 3L5KA 2BLNA 3JARA 4JDPA 4NVRA 4B5KA 3H1AA 4JYZA 2QTVB 5K0TA 3S29A 2PS9A 3TQQA 5JSUA 3U1BA 3O8QB 2ZUEA 5EEHA 2OM2A 1HFEL 1ISSA 2VEDA 5F5NA 5KSYA 3HXKA 1AQJA 1FQKA 3JQCA 5T5QA 4LOJA 4F8YA 4URVR 1OV6A 1WMDA 4D97A 2PWZA 2EW1A 3QX7A 2JIRA 2C8KA 4TKVB 2Q3DA 3UXYA 3ET5A 5LLSA 4JA2A 2RH4A 2XDWA 3ONVA 3A27A 4QLOA 2XA9A 3FMOB 5EE3A 3I09A 1HR0B 3SD7A 1AVTA 2D5BA 1YU6A 3B1YA 4DNPA 2BEJA 2HUPA 3LWZA 3PZRA 2QQ5A 1HYHA 4DWVA 2GPYA 3NRBA 3WLEA 4P4NA 3EPJA 1UFKA 4AO7A 3R7AA 1G21A 3OU6A 2FSGA 2GYWA 1L7MA 2XDQA 4LE2A 2OLKA 1JW9B 3TRDA 2K5UA 3M6AA 3AIIA 5FWXB 3B7GA 1Y7IA 5H9WA 1FB5A 4FR0A 3V33A 2JCXA 4EUFA 3QF7A 4LY0A 4ASUD 5P8WA 3I45A 2SKCA 3QEMA 3AYZB 4UMEA 4WNAB 5KS2A 3U44A 3I2KA 1EPUA 4LXUA 1U0TA 1ECJA 1N7IA 2AVNA 5F23A 2D7CA 4AMYA 1P7CA 3LX5A 1YF3A 2QY9A 3VOAA 1RYNA 3P4YA 1G2QA 1ZZEA 4G09A 1P45A 2UVQA 1Y6ZA 2QN2A 3VU9B 4G0VA 4S35A 2G6BA 1Z16A 4XYGA 4Y2QA 3TECE 1PTKA 3VX3A 1OGYA 4BKUA 2X4LA 1O2DA 4HX2A 1KC1A 2JGIA 3P27A 2P2GA 3IOBA 2OCDA 1YMUA 2XPCA 4ZOBA 3OG9A 2F4VB 1HYGA 4IZOA 2NXCA 3DWIA 1S4QA 2YHBA 3O7WA 3PUIA 4L8VA 2HTEA 2EW8A 2ZAYA 4R2IA 1RLMA 1XMPA 2WG1A 2IU0A 3RTAA 4CG0A 3OLQA 2O6HA 5ARBA 1F6BA 3BZUA 4QPCA 5BQFA 1HE8B 5JNSA 3K09A 2O3SA 1JLKA 2LNDA 5H83A 1W75A 2H17A 3CO5A 3OBIA 4PTLA 3B2EA 5ECGC 3GF4A 4HPJB 2IF2A 2IDMA 4L5JA 4Y2VA 2X6QA 1UJ2A 3E7PA 4NIMA 4PR3A 4EX6A 4EY8A 3MZ0A 3PG5A 2QRUA 5KPJA 3GP8A 3F2VA 3JQAD 2G25A 1K9SA 5I7SA 3GVCA 2P11A 3OPYA 4BGIA 2ATVA 2OLJA 4I8DA 3ZUPA 3ZVNA 2AUMA 4DVJA 2WR8A 3VNRA 1DKOA 3BE8A 3WDKA 4BLOA 3SAJA 5DN6A 3E61A 1MC4A 3L0CA 5T64A 4NE7A 3UK1A 1Y7PA 4PICA 4C7JA 4KMRA 3GCWA 4B3MB 3LA8A 4MVJE 5JNVA 4E0BA 4G0UA 4G5OA 4H16A 3LUBA 1J8DA 2Z5LA 4NZYA 4IEFB 1RRKA 1T5OA 3TVDA 2VDPB 4Z9AA 1QVRA 3VV3A 2H07A 3K1JA 4TXMA 3ZLTA 1U8CB 1X1CA 2XUZA 3AEQA 4HPWA 4FK8A 3NGXA 2CNOA 1TECE 1G8MA 3WGOA 4BO7A 4U4AA 3FBTA 1WP9A 3FDJA 1UK9A 4G9BA 4KFRA 4UHCA 1KIMA 5EP4A 1T3ZA 4QBFA 5AVOA 3WQHA 1XZIA 2JAWA 4DA7A 3ADCA 2VDLB 3NAGA 2I8LA 2JVKA 3FLBA 4UPDA 3WHIA 2HGZA 5J4VA 2QS9A 3JYNA 3P19A 4OATA 1NGSA 5JOQA 1Q1AA 4EFLA 3AHIA 1NMQA 3OOEA 4LE1A 4JR0A 1E58A 1AGXA 2JIZD 3P2EA 4ZP1A 4YONB 3BXFA 1NXVA 2EJBA 4KJXA 5TR9A 4HDMA 5BT8A 1TI7A 2ZI7A 4IKOA 1DAEA 4ZOAA 4UDYX 4YN3A 2WSBA 2XA1A 3FWHA 3HXLA 5U1PA 2XCRB 3FKSA 1OZHA 3SU8A 4MJ3A 1DJOA 2CFSA 2YN0A 2AOTA 5FKJA 4ZKDA 1FFXA 3AL0C 1SKYB 2NU7B 1E62A 3JD3A 4JP2A 5TF4A 1DU4A 2COUA 4JBNA 3NRCA 4IDNA 2ZBUA 4NH0A 4AJKA 3DC2A 4I1VA 1XAGA 2YC2C 3GA7A 3K16A 5BN5B 1ZS9A 2IEAA 3IAM1 3DZIA 3KG2A 1ORIA 1M54A 4UOEA 1FMJA 1SVSA 1I2CA 1IG0A 3HCOA 3HJTA 5F76A 1HV8A 1DRKA 1LBTA 3MJRA 5JVDA 1A76A 3WLAA 4B4OA 2HA7A 1KO4A 1P1BA 3OC6A 1CUEA 2A57A 4YB8A 2FEXA 4N0DA 3V42A 3VGPA 1KY3A 3BZWA 1T3LA 1VHWA 1ZJ5A 2OG1A 2J4DA 1ZFNA 1R4MB 2GRUA 4KXWA 4Z0TA 5FI1B 5C2JB 2GM3A 4MVJA 4Z4QA 1TEVA 4FFDA 4J1NA 2H8GA 2X15A 1E5XA 1G2PA 1K6MA 1OWOA 3PNVA 4R2WA 2ECOA 4RDCA 4Q3OA 2PMWB 4ZO9A 4WN3A 4PZ9A 4ZZ3A 5DLPA 4M6WA 4DR4B 1EVEA 4NMWA 2OZLA 3ZQ4A 4Q3LA 2WFLB 3PR1A 3GZJA 3ZZNA 3K4QA 1XB2A 4Z3OA 1UFOA 3DCIA 5MF6A 4JLPA 4RDXA 1KMCA 3IHWA 2FQXA 1ZCZA 3Q7SA 1V39A 3QZUA 4NDZA 4WOCA 3ZY6A 4LBYA 1EGQA 4QAJA 1E0DA 2XUHA 2A4KA 3EUFA 2OA0A 3V7FA 2ORYA 1KOGA 4CZ2A 3G6WA 3QXCA 4PS1A 2INGX 3PNLA 3WVNA 5CYFA 4QA9A 5ALWA 3FFBA 3RJ5A 4Y6RA 4ZDKA 1NM5A 1WMSA 1II0A 1NUAA 2OYSA 1V96A 3MHTA 1F38A 2EBFX 3SSMA 1W6RA 2YN2A 4MKZA 2JLSA 1U1CA 3AEXA 3NBXX 3E5HA 1SRRA 2V65A 2G9QA 3AUAA 3EXEA 5BQ3A 5FJIA 3EDMA 2ZCVA 1H42A 1NI5A 4UAVA 2BEUA 1R4AA 4RSMA 2H4JA 4BNDA 1NI4B 1ZJYA 3IBTA 3IDZA 3THSA 3AR4A 4M98A 2X1LA 3EFHA 3KYCA 2DXIA 4ODIA 1KYVA 3NHWA 4EG4A 4AS1A 5A5VA 3RD5A 1KORA 4CKCA 2R86A 2REQA 4PNEA 3OCJA 4DKJA 1B7GO 3NDPA 3IJPA 4LVUA 4AZ3B 3TGLA 3U4MA 1XV5A 1FK8A 2EHDA 2B94A 2DJIA 2ENUA 1U8XX 3KPYA 4ND3A 2H48A 3GEIA 3IR5A 1IZ9A 3R9IA 1M6HA 5BY2A 2BPOA 3RYTC 4X1OA 3QOWA 1AOXA 5TMDA 3GFRA 1RMYA 5IBPA 1GGEA 2JGMA 3E3MA 4HX9A 4CEHB 2GPAA 3S3TA 2PLAA 3S1SA 1KOFA 1NMYA 4TSRA 4AECA 1CIPA 1J0CA 3DOFA 1DPGA 3VDMA 3OQJA 1YBVA 3N3BC 1K9VF 3HGQA 4J0FA 1ECPA 3PNKA 3UMBA 2FF7A 5HQTA 3QVVA 4QM6A 4Q66C 1VHDA 1H8ED 3PK0A 4BCCA 2V97A 2ZB8A 3QG1A 4TMZA 5KTSA 1JDVA 5IRCD 2GCGA 5EIXA 1BZYA 5ALGA 4CHGA 1XQ1A 1G8PA 2UYQA 4CIVA 2H7VA 1XO1A 1N33B 4JLBA 4Y2XA 1E6UA 1TO1E 1YB6A 3V1LA 2A5GA 1NDHA 3H99A 3U13A 4JGBA 2NVBA 2A3RA 2RHHA 3SM9A 1RYYA 5JRDS 3IEKA 1V11A 3GAFA 4BEJA 4U9IS 4IJVA 1WXEA 1Z34A 3ZH9B 2QTRA 4I1UA 3OZVA 4U6QA 2H2AA 4LDQA 3UMRA 4U2DA 4K8OA 4DHEA 3IESA 5JU6A 1OWNA 2ZIGA 1TA9A 4HNUA 3N75A 2QT1A 1NUHA 3DWEX 4ZT6A 3ZHRA 3Q41A 1TEHA 2P35A 4JP3A 2ZJ5A 1JJBA 4R9VA 3S0JA 2VYFA 2GJ9A 2QWXA 3U4AA 3DEYX 3HBNA 2PRZA 4GU5A 3HVRA 1CUZA 4KAFA 3AY3A 4DQKA 5DLYA 3ZWBA 1SXJE 3MOIA 4IWNA 3U4IA 1HZJA 4I4TA 1DJMA 2FEPA 2P9CA 4EGQA 5C80A 2DLDA 4ZIRA 1NE2A 3P0HA 3R24A 3WICA 2PUFA 3N2YA 7REQB 1QKJA 1KIFA 2Z0MA 4KE7A 1X13A 3NP7A 3ZTTA 4Q4CA 4CM4A 2EGHA 4L5CA 1GFSA 4KLRA 3RTCA 5JHHB 1I7NA 5KUTA 3BCSA 4CW7A 3H2YA 1NNSA 1R6BX 1TUGA 3OU7A 4CUKA 3JQGA 1ZM7A 4KSBA 2VBGA 4MI3A 4QU9A 4QNRA 1Q2XA 3HA5A 1QG4A 3CSDA 2X7XA 4C88A 3L4KA 3ZVKA 3LQYA 3ZBUA 1A1SA 3OCYA 3CNBA 2EKQA 5EWMB 3DPUA 5DTQA 2QX9A 2AC7A 1JEOA 1LQTA 4Q3EA 3QY9A 2NSDA 2YIMA 5CX1A 3WNZA 4UFPA 1RVV1 4WOKA 1YS9A 4DM7A 1F8UA 3IXLA 4UTXA 3ECSA 3LUFA 2H4WA 4JSYA 5HBGA 1PT5A 2J33A 2WJGA 1HPLA 1XAJA 2WQ6A 3G7NA 3UAVA 2I8AA 2WRZA 2O9JA 1U0LA 5H9VA 1EK6A 2B4TO 3AGQA 2PRIA 3AR5A 5ENZA 4N65A 4WE3A 1BCRA 1SCJA 5IDQA 1TZ2A 1RPTA 3EA4A 5HW0A 2GZ2A 2J46A 4JOSA 4N5IX 1J9EA 3OO1A 2QOEA 4QUKA 3EF3A 1U98A 1QYVA 4V02A 3DUFA 4Q47A 2VH1A 3NC1C 1R64A 3WOVA 1BX3A 1AKNA 1PT7A 2C03A 2VYQA 4QBHA 5IBRA 5JTTA 2BE9A 4HFRA 2R44A 5T4EA 3OOYA 3OZEA 1QIKA 2UUCB 2VOJA 4MUEA 3HRKA 1KYZA 1SQGA 1U99A 4DC0A 1B0UA 1SXJA 1T9KA 2B1JA 3R5XA 5BSHA 4LY9A 1OH7A 3IIEA 5FOVA 2C7GA 1PKXA 1ABBA 4ANFA 1LNSA 2W43A 1CEXA 3BE4A 4CRWB 5L4SA 1RXVA 1WKBA 1DTEA 1ZVJA 3MS7A 1Y1SA 3IPXA 4O1MA 3GLHA 1M2JA 5BNZA 2R87A 2GEVA 1V8FA 2IHZA 1KAHA 2RB4A 4WKGA 2F8TA 4JLVA 1J2TA 1GPUA 3BAFA 2LXNA 3D9QX 3DDNA 4WFQA 1AHHA 3PXCX 4OB7A 5JAUA 5IAJA 2CMDA 3RB8A 1U9YA 4H0CA 4PN7A 3BGWA 3QGMA 4J0JA 5DSTA 3Q5GA 4CV1A 3RFVA 2GJSA 3HCNA 1GHTA 4EHAA 5MFPA 5GIPE 1ZVQA 2GBIA 3AKCA 1TK3A 4EZBA 2HU7A 4ARUA 1SOWA 5AW7A 4YRQA 5I51A 4JCOA 4PW0A 5IVPA 2IEIA 3V2HA 3WKCA 5EUCA 1ATZA 2VUUA 1EDDA 3IXMA 4C6TB 5J4YA 2XZLA 4OLJA 5IASA 4V38A 3CZAA 1JHDA 5G4LA 1GXSB 1SY7A 5I7WA 1KKLA 3AYXB 3DBVO 1HQDA 2A9RA 1D7AA 1GQOA 2Z2JA 3WKEA 4EJSB 4ZZ1A 3PEFA 5BR4A 1GUBA 2O2YA 1V3VA 3EY4A 3ZKWA 3DQPA 4HNGA 2V4ZA 3RWOA 4HJXA 4X00A 1NKSA 1OLUB 5C37A 2LIVA 1OD6A 1RXIA 2REOA 4C1BA 5MGNA 3AK4A 3GFSA 1O5IA 1Z36A 3DBLA 3JX9A 1L4FA 3AM4A 4EG7A 2PZGA 2H5LA 4NCJA 1H5UA 2HA3A 2OGTA 4AKHA 1J2JA 2IYTA 3TNFA 4S1VA 1A0OA 5BRNA 4M21A 3P71T 4C20A 1QU3A 1JIUA 1GPMA 2H7CA 3NTOA 5FO0A 3L1HA 2Z4RA 1DWOA 3PFBA 4R8MA 4M1TA 2O3UA 2HDWA 3CGGA 1ELOA 3H8VA 3WLLA 2R00A 1PV4A 3G5AA 4M54A 1S2MA 2OV6A 3BRWA 4HJRA 4L5BA 1PVVA 5DFAA 1UC5B 4L2IB 5HUQA 2WTBA 3ACCA 1NVBA 2JK1A 2H4ZA 1ZD2P 1IH8A 4PYKA 1H2EA 4EYOA 1ZIOA 3PHGA 3R9KA 3WLFA 1AN9A 1ZH4A 3SLKA 3IFSA 3SYRA 3CVUA 2J7KA 2BFEA 2BFCB 3OPVA 4TKUA 5CDUA 1UQTA 2J87A 2QD3A 1C0KA 3NI2A 4FN5A 1NONA 3KUDA 3S1AB 4BCBA 1BE6A 1E7SA 1D2MA 1O0SA 1WPRA 3ABRB 1UF9A 3CIFA 4IIVA 3VBCA 5JSHA 2BKUA 4A82A 1Q0UA 1GU7A 1BG6A 3R3YA 3UJDA 1E3IA 1UKCA 2MYTA 1Z82A 2GPSA 1C4OA 1OLXB 3JZIA 5THQA 1LPPA 4NWIA 1RQLA 1XTSA 3G0GA 1GUYA 4RPKA 1F2VA 1ADYA 1QYIA 2VDKB 5KSPA 1X7XA 4N3AA 3WLHA 3J80A 4KLNA 4LYHA 2HJHA 4PAGA 2CUNA 3E9CA 4D6XA 3KQYA 2KPOA 3NWEA 2Z2XA 1GQYA 3IQFA 2D54A 2VH2A 3RLIA 5P21A 2HDHA 3LZ6A 1XXLA 4ZI7F 1TB4A 3N0WA 3C3BA 5IN5A 2BKXA 1GZ4A 3A1DA 3WWCA 4YRCA 3JQ9C 3LUDA 3HDTA 3W2FA 3ZQKA 2VT2A 3WL7A 4FFNA 1I3KA 2FSFA 3Q0EA 3R77A 1M1YE 1E3WA 2PU7A 1TPZA 2HQRA 3MWLA 4YLYA 2V1UA 1SXIA 3LDUA 1VMDA 1NU8A 1QHHA 3BCHA 3KJNA 1WBJB 3QTBA 5E6RB 2DHEA 1ZUNA 2DUNA 3IQXA 3EFOB 1XMQB 1D03A 2YRXA 4CMEC 4KCGA 2CVQA 3CH4B 3KHKA 1JFRA 4NPHA 5HZKA 3JVUA 2VH5R 3QMMA 2A0YA 2QI9C 2X1VA 3B6MA 1D2RA 3IQEA 1AKTA 1ULZA 1USUA 3IP1A 4IEEA 4LNUB 2X0FA 2HLNA 1XZCA 4O02B 2QGZA 4ZYXA 1K6XA 4QQRA 4Z49A 2KHZA 4N9QA 1KEEB 2QTLA 2NUBA 1P7YA 3JALB 4LBWA 3FSGA 1BQ4A 4MR7A 2EX1A 4CMHA 1V16A 5A6SB 4AUEA 4BX0A 1CQIB 2WFAA 4KPEC 2PXCA 2FUKA 1RU3A 1KR2A 2NO9A 2CHEA 2QLLA 3HDYA 4FD3A 4GGPA 1X7WB 1J8MF 1IHDA 1VSUA 4L6CA 4MV5A 5CCEA 4PQYA 4LCBA 3UJPA 4FFBB 2Q3EA 1QYXA 4CLOA 4F8JA 1SHKA 5TRTA 1FZTA 3VPBA 4BJ6A 1ZM4A 3NALA 4C7XA 4XUEA 4W5JA 2ARKA 3OPXA 3BXXA 1A4UA 1ZBQA 2VJDA 4MR8B 5AXBA 3QYJA 4BLUA 4FCWA 3CW9A 3BWCA 4R8SA 5G0SA 3WK7A 1PTJC 1PGQA 4WERA 1UQUA 1X87A 2X8WA 2YNMD 3CH6A 2I3AA 3TL6A 2WOOA 1XLTA 4FSDA 4JYAB 4KQ9A 3ZLBA 2IUTA 1V37A 2X19A 3LWNA 3K2QA 3QKIA 2UXDB 3VOTA 2PWPA 2AMJA 1P2GA 1R9NA 3DO5A 5IZ4A 2PJZA 1MUUA 3I9JA 3SQMA 3BTUA 4Y1GA 1QP7A 1KA9H 3C5CA 3ESZA 1IN8A 1BOFA 2CWWA 4FUQA 2ONYA 3PX3A 4Q39A 4EECA 4P84A 5AIBA 1T2DA 1G60A 1J8VA 1IDOA 3MRVA 4HUQA 1NOJA 1CD5A 3P2MA 3QITA 2Z8YA 2WA1A 1M1YA 4UAGA 4DJ5X 4LYGA 1Z2PX 2XVMA 3PSHA 1B1AA 2FN3A 2H08A 4UUNA 4CT0A 3HP4A 5B4TA 5KX5B 4H4DA 5C1PA 2C2WA 1RYFA 3OZWA 3E9YA 2DBRA 4KRGA 4MRRA 3P0EA 2EJWA 4ECEA 5AVUA 1UOOA 3CLRC 4MZDA 1L7EA 1WOYA 2Q5EA 1JTFA 4HF7A 2C99A 4ZPXA 4IP0A 4XUGB 4HS4A 5A5GA 2EERA 1AKWA 5C8XA 5LP6A 3TO5A 4K2HA 1KZ7B 4TS4A 4DAEA 4GYJA 2F3QA 4NC9A 3W8FA 2FMXA 4FFOA 4IDFA 1NW8A 3VAZA 1XN1A 2QD4A 3NTRA 5F5LA 5C8ZA 3ZCPA 2D0OB 1YZ3A 4CYMA 4AY5A 3LBFA 16PKA 5FBVB 2NZVG 4LWOA 3A4YA 1HEIA 3U1TA 3J81A 5CLHA 1TNDA 2CE7A 2FWBA 2RGXA 2VJMB 3O9VA 2AJLI 4MA5A 4QYWA 2IDJA 4YMWA 4EA6A 2X5OA 1KIAA 2QNBA 5CH8A 4YGYA 2PRKA 5M7EA 2C0PA 3H5IA 2H4YA 3PIRA 4GLFA 2PUHA 5AHWA 3KTFA 5BN4B 1YE8A 4KQGA 2RHCA 4YCJA 3UB2A 2ZXEA 1HYQA 1R5NA 2VHJA 3GJRA 3KU4A 4G4SP 4E5SA 3G7SA 3HXTA 3PGMA 2JA2A 2HHHB 2YTZA 2Q4BA 4LOKA 1T5BA 2R1VB 3B6ZA 3OJCA 5ALLA 4CMIB 4Q9NA 2C3MA 4WWHA 3V7UA 2RG1A 3NV9A 4IWYA 2P68A 4H4EA 3VVLA 2O07A 4LVCA 4YRIA 2R7KA 4PO8A 3T7KA 4ME6A 4E21A 5LNK1 3F9IA 1E2GA 3IT3A 3FOEC 5CLQA 5CMLA 4BXOB 1L5KA 4YRRA 3UW3A 1IDN1 3VNQA 1P4SA 1QC5A 1WUKS 2ILTA 2JIBA 3VNBA 3AUUA 4FFLA 4A4DA 4HUTA 2I3DA 1F60A 3MWDA 4G85A 3W6UA 2LVBA 3PU6A 2DF8A 2EKLA 3ZHXA 2OC4A 1L8AA 1Z0IA 3COWA 3O95A 1A2BA 1UXIA 1XALA 3SMVA 1RM3A 5LLTA 2PUEA 3ULKA 1EJ0A 2GKOA 2GO7A 5EINA 4NNJA 4D41A 2Q9CA 4O6VA 5JCZA 4NCNA 1SIBE 2NZWA 1CJSA 3FNBA 3ITEA 2W2KB 4ZXFA 2ZUTA 1KK2A 4G8JA 1S8FA 4C0XA 2BGMA 3WZ2A 5C81A 2W71A 1NQOA 2YBDA 1RD4A 5AM3A 3RGGA 5J4LA 2Y66A 4Q7JB 1CYEA 2QTMA 4MJ7A 1QVZA 1EUZA 3L1JA 1OKKA 1I33A 3FMPB 5EAIA 5EFOA 3ZIUA 1PW5A 3E1KA 4FTWA 3FTDA 1PJZA 4U2EA 3AHHA 3PYMA 1O8CA 3N0RA 3Q85A 3CWQA 3PHIA 3QE3A 2VJYA 5D00A 2DEUA 1WZCA 4IZ6A 2NLOA 3GLFE 3BB3A 2OILA 2SKDA 3BYZA 3F8TA 1Q7BA 3OJWA 4IIDA 3D64A 1MOQA 3P26A 1RWXA 1MMFB 1JQJC 2WDZA 2XTAA 3PD1A 5J1TB 2I7DA 3FLMA 1JKJB 3IR7A 3RO7A 4FCCA 3WFIA 4AULA 1ONNA 2GBLA 3JARB 4HLDA 2GERA 1QUEA 2BM9A 2O5CA 2V54A 1GCIA 5FORA 2JCGA 2D1RA 5DX0A 3KSBC 1TKCA 3ETHA 4WDQA 4J7XA 5K03A 4IUYA 1NP6A 3AWDA 4FYVA 1U0BB 3IDQA 3VYTB 3AEZA 1LCIA 2G76A 3QLUC 1IY1A 1Y82A 3IP8A 5B55A 2G1UA 5CCXA 6ABPA 1QIMA 3Q7EA 1VI5A 2YASA 1TTPB 2VSQA 3U49A 3WLTA 5JNWA 3JQQA 4BMDA 5K4AA 5TV2A 4FP9A 3K0CC 3L1UA 5IM4F 4BAUA 3LA6A 4N8DA 2O1EA 4G1BA 5HKOA 3VPFA 4EBBA 4UCQA 5IAEA 3IA2A 4HQNA 4ZN6A 3I01A 2AZDA 1GM5A 3HJUA 3UHJA 3KS9A 1PRYA 4HVAA 3PWTA 1KSGA 5GGXA 3P2KA 2CXTA 4G0ZA 1CF2O 4N4AA 1IE3A 5FLXA 4ZAWA 2RK3A 3T4UA 2X8JA 4G4SO 1GEEA 2Y2VA 3KV1A 1Y63A 2IE0A 3IURA 4ZXPA 2YFQA 1IM8A 1P9RA 2AKEA 4WA7A 5A1JA 1NR7A 3CVVA 5CR9A 5DCUA 2WVJA 1HNZB 1Z08A 5HDBB 3OP4A 2VC2B 3RUCA 2ZAOA 4EUNA 2JJMA 4A8HA 4F3KA 1R6XA 2JL1A 4Q3DA 5EZ5A 4WA8A 2O50A 2RSLA 4AZWA 4B71A 2RIRA 3LPCA 2TMDA 2Z5VA 3P0FA 5CT8A 3KZVA 2ZBQA 3DEJA 3QOXA 1KYYA 1QGZA 1AK9A 2I55A 4H7DA 3P9QA 3OVMA 3OEHA 1QZUA 5LZ9A 3HWWA 3IPRA 4LAFA 1F9AA 3GLFA 2YS7A 3B3FA 1XYYA 4LK3A 3IV6A 4JBLA 3AEKB 2RKWA 3KCQA 1K6EA 3MC1A 4UBIA 2VK4A 2R0QC 3H7IA 2R5FA 3TZLA 2YDYA 4J1TA 2QUIA 5D6OA 1YZYA 3NWBA 3O8BA 1SC4A 4K6KA 4L1KA 2A9OA 2B1IA 5CH5A 3O2QB 5HM6A 1LDGA 2ZT5A 3LCJA 4MB6A 1MPTA 3D0KA 3QUQA 2QT0A 3ZWWA 5JXWA 4AYXA 3EMKA 5CA0A 3BL6A 4RIEA 2QF7A 5D01A 2BHNA 2FZ4A 2VPWA 1AUOA 1T29A 2KWIA 1FFWA 5AM4A 2EARA 5M3BA 5HOEA 1F8XA 3D3JA 3PNBA 4JI3B 5EKUA 2ALJA 5IARA 3D1JA 3I9NA 2EKPA 2JJ2A 4B84A 2V58A 2DUMA 2KJQA 4HDKA 1O7JA 1RI3A 3OPYB 4QBGB 2RKOA 3NOXA 5KCZA 3Q2KA 5KPDA 2FWIA 3QFHA 2GVDC 5E7MA 3Q40A 4LF9B 1EWTA 2BCJQ 3NHAA 4RPJA 2GBPA 2HAEA 7MHTA 4K03A 1GT91 1QK4A 1T6ZA 2ISCA 1ZK1A 3W5UA 2A1TS 1B8VA 2G5PA 1OVMA 3S2IA 1F3LA 4BJ1A 2KLHA 1SVUA 3CF4G 2OCBA 1RRMA 5COBA 1OT5A 1U4SA 4GC5A 1FFGA 3TXXA 3V9AA 2BDEA 4NMMA 4OHYA 4PX5A 4C4SA 1AQUA 3AEQB 3WGNA 5EIBD 3OEEA 2QJOA 1R0LA 4BO0A 1CZUA 5JROA 1T2FA 4LOIA 3OURA 3QXJA 4LTMA 4GE3A 3SZMA 3DLHA 3OQPA 1BOOA 1DZ3A 1C7EA 4PGGA 3IVAA 4IX1A 1U8TA 3A1FA 3Q7QA 4KTTE 4CKCB 1VLQA 4HR7A 5KYWA 1L8OA 1X8KA 3NT5A 3OIUA 4JSTA 3I83A 3NHZA 3WNCA 3GLTA 2JDID 4JWTA 3CX3A 4YBZA 1RZVA 4HDMB 1ZR2A 3M4JA 4PFKA 4L51A 1EDOA 2ZYGA 3AY6A 3JXEA 2Z6AA 3RYIA 1SCQA 1UOEA 1YULA 2AOTB 1IY0A 4BO8A 4ESHA 1WL8A 1TVKB 1TLLA 2XKBA 2G1PA 2XZPA 4FHZA 3BIWA 4RWEA 1P1FA 4ZRMA 5EIFA 5EWJA 1Q14A 4EJSC 1T13A 1OFGA 3EJWA 1FMTA 4FQ5A 2XUFA 4QQNA 5M04A 1VBFA 3OIGA 1UMBA 4RPHA 1K1EA 3TBHA 1WCXA 2RHJA 1OROA 1S2DA 1YZTA 1ADCA 1DUVG 1H2HA 1JQKA 2BMJA 3PFKA 5BWMA 4H3KB 3FIUA 3MAJA 4HZGA 3CMCO 2NO1A 1ZA2A 4RHCA 4MQUA 1A8HA 2PSHA 2VCYA 3H1GA 3HB5X 4RYDA 1G7CA 3L01A 1C50A 2CK3A 3N2GB 3CUYA 4FDTA 4J03A 5K3SA 4ZAXA 3WFZA 2TYSB 2BHSA 3DEIA 3ZXSA 4KLZA 1T5IA 4D43A 2VR1A 4F9TA 2WM3A 4U2FA 3OFSA 1RBQA 4J7AA 4DEVA 1Z25A 1K7EB 2G9VA 5TNXA 3EPHA 3G49A 1CDDA 1MA0A 1Y3IA 5K0NA 5SY6A 3L0IB 1Y9ZA 4JBHA 3TOXA 1ISFA 4Z53A 3VR1A 3UMYA 3OSZA 3CCFA 4M6WB 3KOWA 4HH1A 3THOA 3CYFA 3GRCA 2OZLB 5DGTA 3UKOA 3KQVA 3PC7A 2ZK7A 2PSSA 4O0MA 3RG8A 1FRZA 2IEDA 5A4MS 4NBLA 4W9NA 3MNFA 1MFPA 1XZLA 4C4OA 4FZ5A 4G25A 3IJRA 3M4ZA 2CLFB 1NULA 2J6BA 1XG5A 1F17A 2C2HA 2HL6A 3RC8A 1R5OA 5AIAA 4JX8A 4B75A 4RTRA 1H85A 4YT5A 5FBKA 4FSXA 3AY0A 3RRXA 2CV1A 4RJIA 4TLMB 3GFVA 1PT9A 3DL7A 4QYIA 1OBFO 5AOAA 4ZYTA 4B4UA 5FBQB 2JJ8A 2OXEA 2WPDA 3OQMA 3CLTC 3KQUA 1R6DA 3K4PA 2QU7A 3EXEB 3FKQA 5PNTA 1NOIA 3AUSA 4L0DA 2IODA 2QVYX 2BEUB 1EX7A 5KAPA 5B7QA 2UZ0A 5CJJA 5KNDA 4ETIA 2QQFA 4MRMA 4BVFA 5LQRA 3KYCB 1AQ6A 3CR7A 4PLCA 5BVGA 3DZDA 3H87A 4IEIA 2FPOA 2WZDA 2REQB 4FOPA 4XCVA 3M89A 5LZ5A 2XTNA 3RVLA 4AX4A 1GFZA 2CXQA 3I8SA 1NQTA 1X1TA 5HNKA 4GRDA 3WFJA 4LRWA 5JISA 2C3OA 2X9GA 1MXHA 2Y4NA 3RS2A 1DV2A 5HE8A 2EHJA 1Q7RA 4AFNA 5DSXA 1OZGA 5AI5A 4RH1A 1CDEA 1V4VA 1XX6A 3UANA 2EATA 2OORC 1MHTA 5D2CA 5L7YA 3VR6H 4KWHA 4XVHA 1ENZA 2FW1A 1BA2A 3OIFA 4EG5A 3B1JA 2KBEA 3O3OB 3TLJA 4Q9DA 1J24A 2QNRA 4YWHA 5IDYA 1NAIA 1XLUA 1BCSA 2ZCJA 4M7RA 3RU7A 2W93A 5LKAA 5DYTA 2HDNB 5I8WA 3F74A 5AW9A 2XD4A 4BYMA 4DGSA 1PSZA 3MWGA 2YMPA 2GMWA 1TK9A 3VPAA 2C2XA 4S3MA 1TKBA 3VKWA 4TYPA 2OHGA 2ZJOA 1V11B 2WIGA 4UJ3A 3IBSA 1ZOLA 2BONA 3OCCA 3QWHA 4GWGA 4MKIA 5KOYA 1A8QA 3RQSA 4M9CA 1CRPA 3QNUA 4YJFA 4ALNA 4XJTA 4ZOEA 1XK7A 3IT1A 4MITA 1OAOC 2ECKA 1CLUA 3CZQA 3OJXA 1WZ2A 4E32A 5B6JA 1T5DX 2F4NA 1VL1A 4K6FA 4UOZA 1SBNE 1XEAA 4M8LA 4IDBA 2IK8A 3C85A 3O4FA 5EEGA 4I4TB 2O06A 2ZT7A 4NYMR 4RD3A 3MHPA 5KNLA 3DQQA 4ZIRB 5JUWA 1VHLA 4YVFA 1XQXA 2VP9A 1NQXA 3WV5A 3STHA 2YWFA 1U8ZA 3H2GA 1EVZA 3O1JC 3PR2B 4I6JA 1A3CA 2J9XB 3ICPA 4WLOA 4OBBA 2J9ZB 2OR3A 2BFBA 3EIFA 3O4GA 4TTSA 3V8BA 4CM4B 2P90A 5MHTA 2BHTA 1K97A 2ZR8A 1T4DA 2DHCA 3TPCA 2ID8A 4OM8A 5HCUA 2Q7XA 3LHIA 3A3KA 3K7EA 3JQGB 1E6MA 1FDTA 2CHFA 3EISA 4YCBA 3ESXA 1GUDA 1DAKA 4A0RA 1KRWA 2NU6B 4Y2GA 1T24A 3ZCVA 4J1QA 2VHQA 1T5LA 2DUJA 4G86A 3QK7A 2DERA 2OHXA 5HMMA 5CX1B 5LXTB 3QLTA 2V8OA 1ZXBA 3G82C 4QO8A 1LK7A 4YFYA 2VDMB 3SXUA 1PBTA 2PBFA 1X6VA 3DLPX 3JS5A 2HHAA 1QVAA 4FDVA 2J67A 3PT9A 4LI3X 2ONJA 2GTHA 4D26A 3WGIA 1ZD4A 2L82A 2OXTA 1Q7CA 4BNMA 3OLYA 3ZJYA 1JI3A 5JC1A 1V9CA 5HX7A 3EVEA 1WF6A 4DANA 3OY2A 4WEOA 3NYQA 3PXUA 1WY5A 5AJXA 4OI4A 5DCWA 4ZAGA 1DJLA 3EQ6A 2ZIWB 3RS9A 2EVWX 3KTAA 3DUFB 2E5WA 1U81A 3NX4A 3QLJA 4OD0A 3GQBA 5CIYA 2HA2A 1UBUS 1ZVKA 3BL8A 3GT7A 3RFUA 5K20A 5K0JA 3S99A 3GROA 2PUAA 2IYRA 2G1AA 3CRQA 3LG2A 1QLWA 5A4DA 1EFCA 3TNDA 2PS3A 1SXJB 2DP4E 4KWTA 2VK1A 4HNTA 2AHRA 3W5DA 1A9RA 3OZBA 3BMNA 4B81A 3ENWA 3ER9A 3WK5A 1OVGA 4NESA 3Q5EA 3WY9A 1PEAA 2PLFA 3JD2A 4QTZA 2V9ZA 4L57A 3CWZA 3JVIA 4JC0A 4KR3A 1UP6A 4F3YA 3EGXA 3NTXA 4DIBA 1P1KA 4P7BA 4LJ5A 4J3JA 5BSTA 4Y6LA 5EPOA 3AIOA 1SJ9A 3DNPA 3ED5A 1ZW6A 3CISA 5DYYA 4MLZA 2VF8A 4GMFA 2WUWE 1HLGA 3PXXA 4PLWA 3K2IA 3KB2A 1YB5A 4K9DA 4MEAA 3GJQA 4F6RA 4JMPA 3LT4A 3R23A 3HFSA 1FDWA 4L8LA 1ZRMA 4J7CA 4EKIA 5C1IA 3RVMA 1VKRA 4GX2A 2IXBA 4OGFA 4QASA 3ZUGA 1JDNA 1ESZA 4NMHA 2CLCX 1GVHA 1A9SA 2VCHA 1Q0PA 2H1SA 1QU2A 3WWOA 2GZ3A 1ZI9A 3R3VA 2N0SA 3MTBA 1QR2A 3K73O 4ALIA 5JYDA 4U7PB 1NASA 4BMNA 3ZKWB 1XL1A 4W1SA 3CM0A 2EC5A 3R0QA 2DUUA 1NXWA 1KETA 1IC6A 2HHLA 4OUDA 4ES6A 1YE3A 3BFPA 3ETLA 4NMXB 3RYHA 2JH3A 3QWIA 4BLSA 4XOUA 2BCGY 3FM9A 4MR9A 5HBRA 3DBLB 2G70A 1UM9A 2O8CA 3VRHA 1GG2A 3NTQA 2CC2A 2Q5CA 2XMRA 3PSAA 5D1HA 1RQNA 2A78A 5DDIP 4LWQA 5ETJA 2QZPA 1UEXC 5I4BA 5JJIA 2R9VA 1U1DA 1JEJA 2XYVA 5KX5F 1XEXA 5BRJA 4G5YA 3IEXA 4PX9A 3F8WA 4KQKA 4CQJA 5AVXA 2J48A 8ABPA 4L8GA 2GUGA 2XNDA 2OZEA 1RKXA 3O0TA 3L8HA 3PFFA 3IVMA 2PD4A 4I08A 3W1WA 2JW5A 4XWYA 3RFCA 1M1UA 1ZHOA 1S9HA 5C34B 3SKXA 2OGZA 3V8RA 2PAFA 2XQKA 2OAP1 2ZGVA 2G63A 3M0EA 1ZGBA 1M2FA 1Y9EA 4RULA 3KD2A 2D0DA 2XUPA 5AXDA 3O26A 5FIUA 2BI4A 3DDWA 2BFEB 1MIOB 4TKUB 1BD4A 3A1SA 2MYUA 3GZ4A 1W4CA 4L9SA 1PFGA 3O91A 3SICE 1ADJA 1YZKA 3K9GA 1G6KA 3B1KA 1TM5E 1VHJA 2DR3A 1SVMA 3LTEA 1EFKA 3BDVA 3AR8A 5EKSA 4CUJA 4F72A 3VTZA 1N6HA 1TA4A 3I6MA 5JCJA 3S70A 4DYDA 5E4YA 3RVDA 2XNJA 1AT1A 1KMQA 3KR2A 1LSSA 3DNMA 5JAPA 4AM8A 1RMQA 1X7XB 1BVUA 2NZJA 2PA0A 2WF9A 1JKFA 1OW3B 1XQVA 1L7DA 1W5AA 2AC2A 3QIVA 4G26A 4N5MA 4GX1A 4MHTA 1Q11A 1X1BA 2UZIR 4I36A 4KO4S 2YMLA 5AJWA 3SKVA 5BNFA 4EGFA 2GOYA 1JAIA 1P0PA 1W5TA 3D8SA 1F0PA 2B5OA 4IZIA 1QTNA 5T3UA 1VECA 4IXMA 2PBZA 2WTUA 3VPGA 1B74A 1RHMA 1U2TA 3R0IA 4UC0A 1LLFA 3T1HB 5HCIA 4O2BA 5GGYA 3IV9A 4A6PA 2CKMA 2G04A 3DZBA 3TIVA 4EO7A 1E3WB 1EFLA 1XU7A 5CTAA 5IP5A 4CR6A 3F4LA 1W4LA 3BXOA 1AB6A 2I0FA 3HBAA 4HZIA 5C8YF 1QHHB 3IALA 2HNAA 4I5GA 4PIVA 4GR4A 5KJ6A 1RTTA 1ZUNB 1KZ6A 3KUUA 4BJHB 5KOHA 3U7QB 1XJCA 2GAIA 3FDIA 1PD1A 1LWOA 3TTUA 1GUZA 5DISB 5JI2E 1LS6A 1OBVA 2CV0A 2Q27A 1JA0A 1GZVA 3E18A 5LP1A 1XVLA 1RIIA 1XQ9A 2P41A 1SULA 2D7JA 4DMMA 3CIOA 3B85A 3F8SA 3A9SA 2JZNA 5J5CA 2P6MA 5TARA 2DTXA 5IHPA 4NABA 3L6CA 1OASA 3QVJA 1IJKA 3BHIA 2Q99A 4MR7B 4CLDA 3ZDFA 4Z1MD 1V16B 1GPH1 2FR1A 3GNQA 2Q7OE 3ASVA 4L73A 5DWQA 4F3CA 5DK6A 1GTJ1 2O8FA 5JCXA 1VC2A 3G8CA 3FHJA 1JXQA 3LQKA 4WW0A 3RRBA 3S2EA 4CQMD 4CLOB 3PGKA 4MAAA 3SR0A 5IXSA 3QUBA 2OV4A 2C8VA 3FOCA 3FTPA 5COQA 5ALHA 5SZKB 1B23P 1ZJ6A 4URXR 3W8DA 1XJ5A 1BRMA 2HOQA 3R4VA 4K2AA 3KJEA 2BFPA 4LSGA 3GEDA 4D8XA 1YA6A 4TLEA 2PLNA 1USVA 5GPBA 2HC9A 3ELDA 3PDHA 3A58B 4XKJA 1YHYA 1WCYA 1R9JA 4JYPA 3GJYA 1EG2A 2J3LA 1CR6A 3FPEA 4QXOA 5FTJA 2WKSA 4I2VA 4DW8A 4ZOQI 2PH3A 2C98A 4GUDA 4UZEA 5JEEA 3B53X 1ZGZA 3LKZA 3V4OA 3C14C 1R15A 4HWSA 3IRVA 1F4LA 3T94A 4HUQB 2OCIA 3OHSX 1ND5A 1XELA 1FPMA 1M6YA 3I04A 5CX4A 1ZL2A 1QH8A 3BK2A 1U65A 1M1YB 2JFGA 3WNBA 1USGA 3LY9A 1AZWA 3N58A 3N0VA 4JLUA 2CCJA 1L3BA 3C1OA 4YJHB 1A9OA 5K09A 3LO5A 2CWDA 4PAWA 3W3AH 3WNVA 4RTKA 2IZ6A 1WMBA 3MMSA 1SPBS 4HI0E 4I0WB 2PX2A 4XVQA 4UDNA 4EO9A 2Z1NA 4C0QC 2Q49A 5A4AA 2ZSAA 1KYTA 1D6NA 3PX7A 3HYLA 3EMBA 5FOQA 1ODFA 3C6YA 1U2DA 3B3JA 2PXHA 3DW3X 3H05A 3VC2A 1N6KA 5GAJA 2HREA 5FX2A 1DELA 3L8YA 3MCAA 1TZMA 4WESA 4BEVA 3R41A 3K4HA 3AERA 2GZAA 2YOGA 3HUEA 4BO1A 4ARBA 1Q57A 3PRHA 5EESA 1QFJA 2C1XA 2HU2A 1BEZA 2C31A 1VSQA 3Q0TA 1RHUA 2R2AA 3DGEC 1H8HA 2HBQA 3IKLA 4PZPA 4F7WA 2O2JA 3P9SA 3HKDB 2C4VA 3RU9A 1Q7TA 1IM5A 1L5VA 3THWA 1RZRD 5HFJA 2G7MC 4YAOA 3LD9A 4EVRA 1G3UA 5IFLA 1LGYA 3ETDA 4GLOA 2ZYRA 4HNAA 2ADFA 2IV3A 2GXUA 3SZOA 3SVZA 1XDSA 1CSEE 3P9RA 2HF9A 4TV9A 3WGTA 4JXXA 4A0SA 5HIIA 2HT1A 1EAMA 4JLAA 4RMGA 4YMUA 4ZV7A 3KEMA 2GBFA 2VPTA 2ZYVX 1UIRA 3H65A 1XHFA 3LO8A 4J2OA 3S2SA 3HZRA 1KO8A 1QHXA 4BUJA 4BAZA 4NG4A 3DFZA 1Y4DE 4R2LA 2EKZA 3OO0A 1OYYA 3PUVA 4TMWA 4KXLA 1PAUA 4ZALA 2XI4A 1QC5B 3MERA 2A6PA 3V4SA 2PIDA 4I5DA 3JCZA 3G5LA 3MWDB 3PQ7A 1I2MA 4WINA 4CV3A 2DKOA 2XMGA 1B8PA 4JLNA 2I7XA 2ZIXA 2IBSA 2WJYA 2QN8A 4R3UC 2XXBA 1JSZA 1BH2A 4G89A 4RH0A 2QJWA 1E2EA 1RM0A 5A9TA 2YWDA 3BH7A 3HB9A 3DVSX 1VBMA 2H16A 5KIAA 4BGEA 3HU2A 1L8XA 2HFKA 4S04A 1FTGA 4BEWA 3O3CA 3K5IA 1HSZA 5CB6A 2H9AA 2HCFA 1ONPA 4FYHA 3TQHA 1N36B 3AW8A 2D0IA 1LVHA 2QYHA 3R40A 3D5EA 3C41J 4DLPA 2WTAA 1M5UA 2QB5A 3WJAA 3EJ6A 1ANKA 1BE0A 1C7FA 2ZSIA 3E48A 4EW3A 3Q3HA 1O8BA 1IZ0A 3DP7A 1YVDA 4PSVA 1NWCA 1ULHA 2QRVA 3PXEA 3KQTA 1BWSA 1WKCA 3MGAA 1HURA 4JLOA 3SBDA 3ELUA 3SSAA 3U3OA 4ZEOA 1KI8A 2KS6A 4A6EA 4Q6BA 3ENZA 1YIDA 2A5JA 2EZTA 4EB3A 4N5LA 4D9IA 2RBKA 2ZSKA 4P33A 1FSSA 3LVFO 1IM2A 2EYUA 2J4CA 1WDLA 2AE1A 3CLSC 3PNMA 3RE1A 2Q3CA 4X3CA 1DOZA 1W94A 3GPCA 3AP1A 4RVGA 1DEHA 1E61A 2FEAA 5SYNA 3TJRA 2X3YA 3FYUA 1TKRA 5HPYB 2NZUG 4XASA 2FHPA 3IAS6 5IZCA 5D5QA 1JWLA 1E5LA 1WXXA 1K2WA 5BSGA 1WMAA 1YBFA 4PIPA 1MO3A 1PJ8A 2I03A 4MB0A 1UCFA 4PC3A 4UUPA 5JVDF 4HS9A 2GN2A 5IAKA 4C6SA 2VSNA 5BQXA 4OQQA 4H1WA 4P36A 3UPDA 3FWPA 4M1ZA 4MMYB 3IB3A 4RXMA 3LIIA 4AN4A 1M0EA 3LFUA 3WIDA 4C5BA 3A25A 2NO7A 4AROA 1Q7GA 4UNNA 1R37A 2LPMA 2X8JB 2Y0EA 4Y2YA 4MQEB 4MVJF 5LZ2A 3CQ9A 2PTGA 4X6XA 4YJGA 2EQBA 3K9NA 3G17A 1P17A 3NBAA 1O4WA 3QWBA 5CDGA 2BEKA 1IZ7A 3BSSA 4TYYA 5D87A 1WBBA 1CB0A 1NF3A 2Q1YA 1Q2UA 2ZBVA 1Z0JA 3EXG2 1GTL1 3B38A 3OD5A 9MHTA 4E51A 3LY5A 1RWWA 2DHRA 4Q82A 3G88A 1E2NA 3C1TA 4RVNA 1DL5A 3TLKA 1KZ9A 2QGFA 3NO4A 9LDTA 3L4JA 1F14A 1YVUA 1EZZA 4RK5A 5AKGA 1L1QA 3JQRA 4Z5XA 4MS1A 1L4HA 3GLFB 1YRAA 6NULA 3RPEA 1WB6A 2FQYA 3P97A 2C4TA 1VLMA 5HUJA 3FTEA 4NCKA 3UCEA 4QGHA 4Z99A 1ZI6A 2BI7A 2QLFA 1BU5A 4D7AA 4F06A 2AFIE 1LB1B 1CS0A 2GVZC 1GKKA 4I5FA 2POQX 3R0ZA 4JUDX 1UMCA 5M5BA 2H18A 2VPXA 3RLFA 5CA0B 1RBMA 3AXTA 2CE2X 1QYRA 4LDZA 2D2FA 4JJAA 3NPMA 4JFAA 1VMAA 4GKJB 1XZKA 2JFBA 4B31A 3N76A 4HTAA 4R1QA 2P0AA 2NTVA 3EDOA 3MBIA 5EXEA 2EIXA 4HDKB 1Z74A 2CW5A 5F78A 4ESVA 4RHYA 2JJ1A 3W5CA 1N32B 3PJEA 4UEQA 3SJCA 2E1PA 4MKGA 4F5YA 1AG9A 2RARA 3UXHA 4YRTA 4DLRA 4GOJA 4MOWA 4RFLA 3MLAA 1GL3A 5HG0A 3LNTA 4PRKA 5C18A 4M0PA 4QOHA 5FBLB 3SSOA 5DNEA 3T7JA 2E89A 4DPKA 3KXPA 1C7IA 2VXBA 1TFUA 2D1TA 5EJMA 3MQ2A 3WB2A 1NFFA 4EHJA 1LXCA 5FNVF 3T5GA 2YV1A 4JUAA 5K0FA 1SXJC 3O8RA 1PVOA 5KOIA 4CM9A 3GMDA 2I8CA 2YVAA 1UFRA 2NZYA 3AETA 1LWNA 3D4LA 3F6RA 3MJSA 4IOMA 1YZLA 1PNOA 4Q4JB 3DAFA 3U0BA 1V25A 3BD7A 3AF5A 4JC5A 1V5GA 1TW3A 3K8QA 2G08A 1HLDA 4DV1B 1EB8A 2D2EA 2HXGA 2ZJYA 2YXPX 1CUWA 4HK4A 3L4BA 1DP4A 5CFLA 3BWVA 3IQGX 4EA8A 2H1CA 5KYWB 2JZOA 4I4LA 3FRJA 1V1MA 3HNOA 4C4PA 2FX2A 1YZFA 4KXVA 1FTWA 2ERYA 5JNRA 5I7EA 4KR9A 2EU8A 3B52X 2YJGA 1NVVR 4A6XA 1Y4AE 4BNIA 4PLPA 4HDQB 3UAZA 3B13B 4XARA 3AM5A 4QSHA 3DZFA 3A04A 4R9SA 5IJAA 1Z17A 1VCIA 2B4AA 2P7HA 3EWAA 5HDQA 2VUSA 5BN3A 2YWEA 4PLZA 3DM5A 2ZR9A 4I4TF 5EWJB 4P7KA 1SKUA 3T4EA 5LMNB 13PKA 2DPMA 1UMBB 3KWJA 4JODA 2W0SA 3L6UA 2JGFA 5F2KA 2O3JA 3SFZA 4Z4GA 3SHVA 4BBJA 1XCOA 2TMKA 3EZ9A 2IYYA 4TMVA 1H2AS 1XZMA 1OIWA 4HDOB 2NXNA 4WLNA 3PE3A 4HRYA 5GOTA 5KQMA 4W5TA 3L6BA 3NZEA 4CF4A 4CFYA 1A5AB 1Z2CA 3F6CA 3KQQA 1DIOB 4G5HA 5E7IA 5DZSA 4ZCQA 3U48A 2Q9UA 2ZSJA 1H0KA 2H3EA 3W2HA 4ZT3A 3WBKA 5JQWA 5D3MA 1U1EA 4NBNA 5IUKC 2HZ7A 1TQ6A 1EQ2A 2WYWA 1FC0A 4M55A 2DQ4A 3KETA 5EJGA 4Q7KA 3AESA 3QKUA 2JB9A 3AZQA 2Q3BA 2WQZA 1Z5WA 2OPHA 3QNWA 2YJ5A 1CR1A 4K40A 4XR9A 4FBMA 1XZAA 3W2GA 1A50B 4PCAA 4GOMD 2BM8A 5DYGA 2BKVA 2JGKA 2Y4OA 1ORRA 1G16A 1EWQA 4TTPA 2QRNA 3EXFA 4AYTA 3D3EA 4HNSA 1W46A 1KQPA 4RS3A 3HADA 3PDCA 3VR3A 2YV5A 4CIBA 3D2AA 5B12A 4G2NA 2XRZA 2OFWA 4B3JA 2FFQA 3NBQA 2I5PO 4Q9JA 1I5OA 1A9YA 4GD3Q 4P3NA 5HJ5A 3FUTA 1TJYA 2CFIA 4A9AA 5LDDC 3EZXA 1TYZA 3KV3O 5FPQA 1TVCA 3ZU3A 1WMEA 1Z2NX 2H2HA 4QYIB 2E4WA 1K5GA 2XQJA 5JJ5A 5BR7A 2X6TA 1YHNA 1HBJA 2CXPA 5FPPA 4LG1A 2R8RA 5B3KA 1ZY2A 4PIMA 5A0TA 1TUIA 3AL2A 3AF4A 2R62A 1M6VA 4Q7MB 1RC0A 4QDZA 3MD0A 4HRXA 4QLAA 3OFND 1D2AA 5FR2A 5IPFA 2OAQ1 3BERA 3RHTA 5IEBA 1L5OA 1XQYA 3ZNNA 2JH9A 3I4LA 4EYEA 5HKLA 1MQ9A 2G5TA 4MRMB 5BVGB 1HK7A 2R6R1 2GHIA 2IVZA 3I2HA 3M6LA 2QRPA 2FETA 2CN1A 2Y1WA 4V0LA 1NXTA 2ZB4A 3S2ZA 4C0WA 4D98A 3EAQA 1JG7A 4PLHA 2J08A 3B1FA 3E7XA 5C46F 1XPUA 4PCVA 4V0KA 4RNDB 3TD2A 4BC1A 4IFBA 1SB9A 5E1BA 1TL7C 4WBNF 2F2TA 4HSGA 3VR6D 3CKKA 4KHPB 1CIJA 1CR2A 3JD1A 4AF8A 4MW6A 3H5OA 1P0MA 1JUDA 4U2CA 1YS6A 5CCDA 2YICA 3X44A 1XRPA 4QDTA 3H2BA 2ORVA 4FINA 3K9QO 1ZJWA 2JI8A 1UT8A 1XPRA 1D2NA 1SPXA 2WNHA 5IW8A 1HDZA 1UWLA 1UFVA 2H1HA 1DUIA 3LF1A 3NEYA 4W1PA 4UQLA 1B2LA 4HYEA 2H8KA 3HXQA 1ZH0A 4FGZA 3C24A 4ZWNA 2FXIA 1ZD5A 1SUBA 3GNTA 4K9KA 5JRZA 4PF1A 5H3LA 4GT1A 4HLCA 3RTGA 4RV4A 3SY8A 4EQZA 2YIVX 5TT1A 3UGJA 3K5WA 3FYDA 4TT8A 4TL6A 5H02A 3WADA 1ZIXA 4B4VA 4BVLA 2VTDA 4F1JA 4BATA 1G4AE 1ENYA 3OTHA 4YAFA 3ADBA 4YJFB 3DE3X 2GF0A 3GJSA 1LV7A 4X66B 4L16A 1H2RS 1QV7A 1QCCA 2H00A 2IY9A 2ZRLA 3P8ZA 1BRTA 1M1NA 1NDQA 3DLCA 4WOBA 3LY7A 3U3MA 2NUTA 3H0CA 4OGWA 2X0JA 4MXDA 1WSWA 4QQKA 1KI1A 4P98A 4CL0A 4CI9A 5FUQA 4R3WA 3WDSA 2QTHA 1MAAA 4FNGA 4G0WA 3SJZA 1NC1A 1HZZA 1T3SA 1XLTC 2R8YA 3TI9A 4DNXA 4LSZA 1ORTA 1UXGA 3GEPA 5KSWB 2NAFA 1RE0A 3QVWA 1GPBA 1P5RA 1CDOA 2D0PB 4N49A 1Z0SA 3W4JA 6Q21A 3NATA 3HSSA 3CLRD 4TKLA 1TUBA 4P5PA 4Y9UA 1N7GA 4YQEA 3T3IA 5CDFE 4BTVA 2QA5A 2O3TA 1GVNB 1XDDA 1N75A 2GGSA 2VZLA 3QA9A 3CZ5A 2WILA 2BT4A 1YCFA 1NPTO 3T3NA 3C3DA 5AJZA 2D8AA 4EUSA 2AKAB 2FQQA 2ZJFA 3KO8A 3VYRB 1DAHA 1VDMA 3DYIA 4J4HA 1V4NA 1MO6A 1NBMD 1H0SA 3D4PA 4N3GA 3GDFA 5F51A 4M83A 3OJOA 3T7AA 3PHCA 1NPYA 1UH5A 1YCHA 2RGCA 3LZDA 4HH3C 3UUEA 3SXUB 4E94A 4MVJH 3CRVA 5JAQA 1U0EA 4RKWA 5BW6B 4ERXA 5L51A 3EDYA 3FHTA 3AQ4A 5L4LA 1R6TA 3D5TA 1NNEA 3T0FA 4LYEA 1Y0BA 2D5CA 1HTBA 3EOBI 4IO1A 2CFRA 3SYKA 4Z4FA 3RC2A 4G65A 4YYEA 4NENA 4OX9Y 3OPNA 1GNSA 1TLTA 3IQIX 2PZKA 4PTYA 4F9FA 5A4KA 3WHKA 2H52A 3U4HA 3L9XA 2X4IA 4BNGA 3T3DA 4C22A 4KN8A 2RMKA 4ND8A 1X1SA 2HWXA 4N3NA 1SVIA 2H92A 1FP4A 4DA6A 4O4LA 5KWIA 3KTAB 2IUUA 3CLHA 4AJLA 2AJCA 4AZSA 5FDFA 1A9XA 4YCNA 4MWDA 4D1YA 1IBMB 1HMYA 2PBRA 3GQBB 2G36A 3NGLA 1J4AA 4NPCA 1H93A 3M83A 4II3A 4TVKA 2FP4A 4YI5A 4KAXA 4F2GA 3C3AA 5AOBA 4NCBA 2WABA 3HZOA 1E9EA 3QTTA 1LI4A 2OPBA 5DNAA 3NVDA 4C3UA 3VKGA 3BIOA 5ECWA 5IG2A 1E3EA 3BMNB 4J0HA 4HB2A 1W93A 5FPHA 4MUYA 2IXDA 3ZDEA 1YQWA 2XMSA 4NECA 1U7OA 1OFUX 1DCTA 1YZQA 3DDZX 2VNHA 5K8LA 3EGXB 1FMFA 2WHRA 2B4RO 3T3PB 1AHIA 1DDOA 4P82A 4XM0A 5TQ2A 3G9ZA 2QN7A 3T9AA 3TE6A 1SKBA 5CDFA 4YUWA 1Y81A 3U7RA 2FLWA 1YZVA 1FY2A 3MOGA 1M1XB 4BNUA 1JXAA 3X1JA 2OECA 4KE8A 2GZ1A 4G1MB 2JLYA 1G291 3SS8A 2RHBA 4AG6A 1PHRA 3T5TA 5JDCA 1AHNA 4WXPA 2E55A 1SUSA 1VPTA 4IJUA 3FNIA 4FDMA 1SHJA 4F6RB 4ALLA 1Y6GA 2JFNA 2GF9A 3IMKA 1YI8A 1KFBB 3U4GA 2P9FA 3GARA 5C5DA 5BYBA 3AI7A 1GWNA 1KSJA 2IIQA 3N39C 4MWGA 4TM7A 5IBCA 5DSZA 4BP3A 4I3FA 3RSGA 2FN7A 2GNOA 3TGWA 2Z58A 4EB0A 4QFDA 3S6JA 4IXTA 4O63O 4U3JB 1I1NA 5DBHX 2F1HA 1ZCJA 4N8SA 2ZTSA 2C9ZA 3WYCA 3L1IA 1K5PA 4OUDB 4JB3A 2OQVA 4D3ZA 4EPYA 6AT1A 4JGGA 5EVCA 3RYHB 4XIFA 4ABYA 4RGVA 4MR9B 2QE7A 1M2OB 1GILA 3DBRB 4L6AA 4M4SA 1R6UA 5FA8A 3N0TA 2GBLC 2OK7A 2XDYA 2O8CB 2M2IA 1V6SA 5KJEA 3STWA 3BWDD 3EWIA 4PWZA 1SOAA 4MJLA 2WYUA 2ZUCA 1OZAA 2CKDA 2ZAGA 1PDWA 1QF7A 4YJDA 1V7CA 2I6SA 4OLBA 1DEAA 2GXSA 4NICA 4EKNB 1XWWA 1JQ3A 1JR4A 3H11A 4P7FA 1XGKA 3AFIA 1OU0A 4BWGA 2V74B 3LXRA 1VPWA 4KGVA 2IU4A 2UYYA 3DEKA 3IOYA 4F1WA 3H5VA 1I2ZA 1J25A 1DOAA 1O54A 1YZNA 2HTFA 2QIOA 4C04A 2JJYA 4R84A 2H1FA 4Q4AA 3DLBA 2H9YA 2EWWA 1U6IA 1YKFA 3X1DA 3TQRA 3G0BA 1AA6A 1VCHA 5CW2A 1K2VN 2VT6A 1E0SA 4QD3A 5FTKA 1MX3A 3IVRA 4BVEA 1WNTA 1SH7A 1YTLA 1CP3A 2JCSA 4DREA 3DEFA 1Z2AA 1E64A 1E0AA 5KWSA 1I24A 1ITZA 1RKUA 3FR7A 1ZL0A 4G0NA 4PONA 2Q1UA 3T95A 3PWKA 2PEYA 1HE5A 2JKYA 5EIHA 3Q87B 3NC4A 2QTAA 2HMWA 1T1GA 4BNKA 1TC2A 3WLOA 1Q0SA 3F7OA 3GGDA 1XF9A 5EHNA 1EFUA 1JFLA 3WRYA 3RBAA 1Q0ZA 1IY2A 4OJQA 3KYBA 4XLZA 3RS5A 3IVXA 4AY6A 4E12A 2I33A 3NDBB 3QE2A 5H3CA 3LMKA 3K6SA 2J5KA 5LP6F 3ABIA 3NDRA 4NFYA 1KVRA 1N2IA 4FWBA 1WCWA 4J1TC 3D3KA 3EVNA 4K1XA 1VJGA 3TLZA 4DNFA 1RC8A 3W78A 4G84A 2CF5A 2J3IA 1RAEA 2BR3A 2BGTA 2GEUA 2XXJA 1N3YA 3LHKA 1P4JA 2WF8A 1ES9A 1QANA 4QGAA 4ZOLA 3DMPA 5L3RA 3VDNB 1KR5A 1XRQA 4B2LA 3E2IA 4OQLA 3UC9A 4ZC8A 4OMFG 3SXJA 3W79A 3QVLA 3DOJA 5T4HA 3TQTA 1Z3CA 4Z54A 2HQOA 4JLKA 4OUKX 3P32A 3D6FA 2OXIA 3UWDA 4EKDA 2I2AA 2ZYSA 3SBEA 4J4BA 5KOHB 1U4OA 1LBHA 4MDFA 1GTRA 1FLDA 1GCOA 3KHSA 1QBKC 3TNJA 4UBKA 1KO1A 2IDZA 2UZ1A 3F67A 3TX6A 3NKVA 4Q1BA 4YGXB 1HT2E 1OXKB 5T6MA 4RMJA 7MDHA 1Z5UA 2PZJA 1FX0B 1P1IA 4F4FA 2E4ZA 3FPHA 5I7OA 4RS4A 3A9WA 4A10A 2VA9A 3VO2A 4B45A 3DHNA 4QXAA 3V4RA 4QYMA 2WG0A 2Z1MA 1JDJA 3IO5A 2HIGA 2O8FB 1PJ4A 3FOFC 1BVHA 1IWBB 3A28A 3M6UA 4TV8A 4BDTA 1YNSA 5I7FA 1R0ZA 3TZKA 3BGIA 3IKJA 5EFZA 4HSEA 5E2IA 1V3QE 1Z3IX 3PXAA 3R6DA 3JAMA 3R5SA 4EMTA 1HM5A 1HL3A 2W5UA 1E89A 2GLUA 4RFSA 1NE7A 5HR5A 3DMFA 4R1MA 4CL2A 2F48A 1N9GA 1MO4A 3QBDA 4FKZA 1I3LA 3NOVA 1OFTA 2YDXA 4GBED 4Y1FA 1E6KA 3EGDA 1G4HA 2V98A 2YJZA 4F0JA 5K0CA 1UP7A 4HMPA 1A82A 1LDMA 1YDGA 1YI0A 3AUKA 3IDFA 5BNWA 4IJ5A 4Z0NA 1SCKA 4NJEA 3VR5A 9ATCA 1E3MA 2NNWB 1WO8A 1Y89A 2GZMA 1U8EA 2L69A 3DE7X 2Q7DA 4ACBA 2WBLC 1BVYF 1IXYA 1XTVA 4NEQA 3HUTA 4MO9A 4ARAA 1PZNA 1HX7A 1Y6FA 4BGUA 4JJIA 2RHLA 2O14A 4M1MA 3ROEA 1EFPA 4QFMA 2I7TA 121PA 4QDOA 1TE2A 4KO1S 1R0CA 2ACEA 4X7PA 1COWA 3V34A 3W3AD 4BZPA 4D5GA 3CVXA 3T1VA 2A9FA 3WLIA 4HWTA 1XTKA 3DDOA 1NYLA 5FWDA 3UHPA 3EG5A 3NAMA 1AKYA 1HYBA 1LBSA 3VUFA 1YR1A 5EUQB 1DADA 1EXDA 4GNKA 2DYKA 1J2EA 2XWPA 3B60A 5DNDA 5EXDA 3IHKA 2BUBA 1VJRA 2OHOA 1N8NA 4WXYB 4EEKA 1UMKA 5DBEX 3RFFA 3G9QA 4K9SA 3VYWA 3BL5A 3JD0A 4WESB 1YL7A 1QGUA 3GG9A 5PGMA 3UMGA 2UUAB 3VHXA 4PWYA 3GLUA 3HN7A 2CLSA 3INGA 3W9SA 2CZCA 1P91A 1US8B 4G8CA 4OAOA 2FN4A 5DF1A 4JUIA 1OOEA 4JJZA 3CT6A 4BRZA 1FU7A 3HB0A 1UPUA 5CBKA 3THWB 4BBAA 4YP1A 1NLMA 1OWPA 2KQUA 2XR1A 3EIOA 4F86A 3QFRA 2IS6A 4HNAB 3IUEA 4L74A 3TCKA 2G5GX 1D6SA 5FYDA 1BHJA 5KU1A 4R2HA 4BRSA 4TSFD 2W9XA 2XWBF 3ZQJA 4C03A 2BJHA 2VF4X 5CA0F 1ZD8A 2CVZA 4TV9B 4B1FA 4BQOA 5CGQB 1J49A 4FMCB 5GM1A 3X1KA 1XEWY 3HV0A 3LDGA 4LQCA 2VDVE 1WW8A 2OHHA 4M36A 2J31A 4QX6A 3W2EA 4IIXA 2X6RA 2WWVD 3EWSA 2P5TB 1BYUA 3A1VA 3C87A 3DXXA 2GETA 3LS2A 3OPYI 4Z51A 4WT7A 1JLSA 3CLTD 4D42A 3UGQA 1YR3A 4GEGA 1C9KA 1DNPA 1SAYA 1PFYA 2AD5A 3QKWA 3SOZA 3F3MA 4MIEA 4OYHA 3UM9A 4AP6A 9ABPA 2VTBA 2VP0A 4LRQA 1R0BA 3OZCA 3KL4A 3CXRA 1M8PA 3NBFA 3U7HB 2VFAA 2AI2A 2ZIXB 1R0SA 4F2DA 2Q2OA 2W6NA 5CAEA 3UK0A 1Y9JA 4X95A 3VKVA 4DIKA 1PZXA 1E4EA 2DH5A 2F9MA 4GOXA 1NVGA 1VMEA 1RJWA 2PLWA 1CZOA 1LC3A 4FYMA 4E70A 1M34E 3HJFA 3A31A 4HLUA 3A4NA 3RABA 1GL9B 3TAXA 4OQDA 1TZKA 2VL7A 3OI7A 3RVBA 3UTCA 2UVPA 3OLXA 3D8RA 3UK7A 2J9RA 4J2HA 1HE4A 2C4UA 3ZJUA 4FE4A 4D81A 1UT6A 3AVWA 4E4RA 4NZZA 2ZUUA 1QAMA 4PQFA 2J9YB 5B1DA 4UTRA 2NZXA 4LQDA 3UWOA 1MPXA 3UAOA 4INJA 1E6WA 1O9GA 4HYQA 4JVOA 2QRVB 2WUGA 3DMTC 4N39A 5I4CA 2EGGA 2G5CA 4XWOA 5A3RA 1T2NA 2OB1A 4FMDF 1JHZA 5I9TA 4C0SA 3L8ZA 4FC7A 4D3XA 3HV2A 3ZK7A 2QJFA 3L5OA 5HFAA 4BO5A 5K6AA 2XHZA 1P9LA 4DIOA 1QG6A 3G8YA 4OHBA 3Q8LA 1B41A 1YBHA 2MT9A 3PF9A 5AW8A 1IUOA 3AV0B 2AFRA 3R3JA 2F17A 4F4IA 5HOQA 1U3WA 3FYUB 1VPLA 2ODAA 3HWX1 4HB0A 1LPAB 1QPZA 1IL0A 2NYRA 1HA3A 1O96A 3G1UA 4G56A 4ND6A 4JB8A 3BFXA 2YS6A 3VNSA 4F71A 4A2PA 4YT8A 2Z8XA 3N74A 3EZYA 3CRMA 5BUCA 3VSCA 5KTTA 4R7ZA 3IAM6 1ZW1A 5FI3A 4JCCA 3SI7A 4WLEA 2B2NA 1NP7A 4GC9A 2XYQA 1LTQA 4CM8A 2AEJA 3DXFA 5GV7A 1DPFA 1GL7A 5K99A 3CVOA 3IRUA 4TWJA 1NZFA 1ST2A 1T5TA 4RL6A 4MVJI 2NTEA 4A0QA 4I55A 3NBUA 4ZMBA 2REBA 4PSAA 1IY8A 3GT3A 3GJ5A 4DOMA 4OA5A 3IDAA 3FOWA 4UHJA 2H0AA 4YJGB 2GM4A 1M34A 3G59A 1OC4A 4ATNA 2WSSD 1E1RA 1H6AA 2FG7C 4KNWA 4MI9A 4TSKA 3WLKX 1BD3A 3L7NA 5HEKA 2I2DA 4KQXA 1CEQA 1DFIA 5F7JA 3W06A 1NF9A 3BMCA 3EX7C 3MOSA 3AVQA 4DIFA 4X0EA 1HDOA 3OFJA 2GEBA 2UYOA 2PH7A 4OXYA 2IH2A 2PH5A 3UZUA 4G0QA 4YV0A 1XTRA 2W2PA 5DLQC 4MS1B 2A9PA 1Z6XA 1GARA 4G0MA 3UT5A 2GKGA 1HOTA 4C08A 1XTPA 3WL5A 4E5PA 1WULS 1KAQA 4BTLA 2V4MA 4GXNA 5CHYA 4WGGA 4F4CA 1QIJA 3NDJA 1CS0B 1E77A 1QKIA 1ZBDA 3L3BA 3GFGA 1GA6A 4RZHA 4EF4A 1TFRA 5K6TA 4YDSA 4FD2A 1UMCB 2QTNA 3RS4A 3L8EA 1P33A 2CLEB 3RKUA 1D6JA 4GGOA 1CY8A 4WY8A 2P2CA 3MB8A 1L4LA 1CLEA 1BN6A 5CVCA 5J47A 1O94A 1G8JA 5T4BA 4W9MC 4CUZA 1Z07A 6GPBA 4ZDJA 1Y80A 1GRNA 3H5NA 4P3OA 4BAGA 2ZRIA 3MS2A 3PXGA 2Z6QA 1RJGA 5ALZA 3PQDA 4YTEA 4TS9A 1LI7A 4DMHA 4E7PA 3EUEA 1E9RA 3O8DA 4FHEA 4BV8A 4HXYA 5LOVA 3HP7A 3F97A 1L5LA 2P4QA 2ZSDA 1DXQA 4LWPA 1YVRA 2ODBA 2OXCA 4P92A 4UREA 1YZHA 2O59A 3PQ8A 1VP9A 3A6ZA 1ZM9A 1ZO8A 4GZ6A 2QM0A 5EUBA 3VVCA 3ZGLA 4YPVA 5HZMA 1FPQA 1SBIA 4J0CA 3LQQA 4TWBA 5GOZA 3ZWXA 3FHOA 1SOMA 2VO1A 3LVRE 2AXQA 1AB5A 3IPAA 2HHJA 3L1KA 4JYBA 4F38A 4AXBA 3EARA 1BHQ1 4ZGGA 4JT2A 2OHFA 2CT8A 2Z09A 3AETB 4XDZA 4KUEA 3CURA 3FAZA 1L7AA 3H18A 3P2OA 4YREA 3SIPA 3EAFA 3D4NA 4NRDA 1RW4A 4GWLA 1T2EA 4XE5A 4GYKA 1HWYA 4UQOA 1D04A 1FSGA 4OO3A 4RVUA 3ZWVA 1V48A 1LD3A 4WJKB 5FL7D 4JEUA 8LDHA 3AF2A 2ZJBA 3RARA 4NBUA 5J59A 3R20A 2Y93A 2QX7A 5FQNA 1TTHA 2C94A 2QE6A 1S2OA 3UGKA 1XT6A 3ENVA 3QA3E 3ICWA 1MC1A 4A8PA 1EVKA 3C3PA 1VE5A 4B8WA 5DRYA 1V1MB 1Y5MA 1BHSA 1SB8A 3FE2A 3VZCA 3EZ7A 3R3SA 4PYRA 4EWLA 4U02A 5LU9A 3MMNA 4GPIB 4JV5B 2COEA 1H9BA 3MWEA 1C3OA 4Y6OA 3QE9Y 2Z3VA 1PT6A 5C5EA 1LEHA 4C87A 1HRKA 1N9KA 1RWQA 3BRQA 5BN3B 4XGRA 1Q95A 1W19A 3HEAA 1ZN8A 2DHQA 2ODNA 2Q6OA 1SBZA 3T7RA 3NBZC 3TS1A 4M7PA 3V00A 4PXSA 3VM6A 2I3GA 3EFBA 1TD9A 5K8VA 1CNFA 3B5IA 4AWBA 1TM4E 4HWRA 2HV8A 4LTNA 4A8TA 5I6DA 3D1LA 3CF4A 4OLAA 4OYLA 5ALXA 3RUIA 1THMA 5M34A 1M7GA 1Z4MA 1G9SA 2II6A 2X8AA 3G89A 3K2EA 5FBRB 4ESEA 2LKDA 2FYTA 2VK2A 5FP0A 2DFVA 2P9ZA 4ZO7A 2RGEA 3SBOA 5G3YA 2XE8A 3LCVB 721PA 2C77A 4HDSB 1NR1A 4IYRA 4PHFA 3AESB 4YP9A 2Y1OA 3G23A 4U1RA 2ZYIA 2XBMA 1VGRA 4RE6A 1RJ9A 2AR0A 1R12A 2ZDHA 3KKZA 1I7LA 3SEAA 4BVAA 4UHKA 3WMEA 5LA6A 4LXHA 1VLJA 1H94A 2D4AA 2ZBGA 1LA2A 3F78A 3IAEA 1KFKB 1L7BA 3CPHA 3F96A 4IGIA 3TB4A 3EXFB 5GZ3A 4BLRA 4DEXA 2AQIA 2V59A 3N2NA 1Q17A 3ZDDA 3H1FA 2B2CA 3OCXA 3Q72A 1ZCBA 4GX0A 1UDWA 1BU8A 3JQBA 1G8HA 4Q1DA 4IXDA 2I4OA 3L0DA 4NBRA 3G8DA 1S1CA 1RLJA 1WPQA 5LZ4A 3PRJA 1N7HA 2AZMA 1P7VA 1JJ7A 4OJNA 3TRJA 1CZKA 2QL5A 2RK6A 1Z8FA 2OO5A 3CX6A 4RE5A 1OLOA 2O3QA 4RGQA 1C3JA 1PQPA 3EW9A 1ORDA 3E84A 2B1QA 4OLFA 1JEAA 221PA 2H11A 1NRXA 2CB9A 2XNSA 3A7DA 1S7GA 4YQYA 5FA6A 1RYZA 3DE2X 1Y8RA 4DQVA 5A1TA 4N76A 1YASA 3U6KA 1J2UA 5E9AA 1HQYE 2CJWA 1JSCA 1A7UA 1MQSA 1LKZA 2ACWA 3KB8A 3MK31 3O93A 4IYJA 1PR6A 2OBLA 2A92A 3CW2A 3EVDA 2XKJE 4PE5B 1M6VB 3B12A 2B20A 4FJ1A 3A9UA 2FMHA 2OM6A 1MH9A 1W52X 1UJNA 3MGCA 1UBKS 2PLRA 4LXYA 2J9FB 1JIVA 2QW1A 2PFGA 1NKVA 4FWIB 3UBTA 1HL7A 5EVJA 2JFFA 4QJ5A 4RW0A 5EZYA 1PBNA 1N2SA 4EM6A 4EDFA 5CG2A 1DDGA 1MHPA 4CXMA 2YQ4A 1NVWQ 3PEVA 4R2MA 3TINA 3H2IA 3C4VA 5AW4A 1Z83A 1PDOA 1BDHA 3TIIA 3S2FA 1T6NA 2CEKA 4MHSA 1PLJA 3HB7A 3NXKA 5CFNA 4EH1A 1A96A 2AG5A 2EF0A 3A1CA 5AJYA 2FPIA 3TMKA 5ICCA 2O7RA 2QN3A 4HQRA 2AF4C 5ALKA 5DN6D 1DRVA 4ARVA 1GG8A 2XTMA 5A7GA 2EW2A 4MSUA 1CTQA 1QIGA 4CTJA 3F71A 3GAAA 4YMTA 1R6AA 1AQNA 4CGZA 1GKIA 1S3GA 3U4CA 3V3KA 1YKSA 4GSLA 4IRUB 4OMDA 5DGDA 3ZDAA 5AVZA 2XCIA 4P93A 5HM8A 3FUCA 3Q8XB 2VEOA 1R2QA 2D2VA 4GM0A 3AKDA 4FYIA 5M29A 1UP4A 4MV7A 4EL5A 4BNFA 1B0ZA 2NO4A 3T5MA 1YACA 1QYWA 4LV8B 4D4MA 1I80A 5CM2Z 2O2ZA 5L3VA 3PTLA 1DQRA 3E5RA 1J22A 2DCUA 5AVJA 2EBHX 4F12A 3GAZA 3MCWA 4CDRA 4D3DA 4ZT5A 4NE2A 3H6KA 1GR0A 3TSCA 2NP6A 2A0FA 1GRRA 2AB0A 4JJ4A 4OK3A 1T35A 3WHPA 4HWOA 3YASA 1M1NB 1E3TA 3QG5A 2NUTB 4C29A 1FVFA 1C2YA 2I66A 2MINA 2NXJA 4MW9A 3TMYA 4DDWA 2AD1A 2JIDA 3ZE0B 3WAKA 1VLLA 1VPDA 4DFDA 3FKSD 1IAQA 3UMCA 2QZJA 3ETGA 5ICEA 1FIUA 3RRNA 4AURA 3R8FA 2HKIA 4YMHA 1PKEA 4H1UA 4LFBB 4TKZA 5LMZA 1S9DA 1FA9A 2XIQA 4KDRA 4KGZA 5AOCA 1HUQA 1L4NA 3SMQA 4MLDA 3E22A 3W4KA 4ACAA 3VZSA 4OLHA 2PL5A 1AU9A 3WBFA 1HDIA 4EPRA 3UAGA 2E18A 4ZCPA 2W11A 4Z7OB 3LP6A 1X74A 3NUQA 4MPTA 1NG1A 1LRKA 1N0UA 1RC1A 3U5ZB 2JBAA 3WGKA 1W9HA 4KQEA 5JT1A 1TZJA 5JV5A 2E21A 3HZHA 2W00A 1GTZA 1H23A 3VKHA 4G9EA 2BZSA 5DN9A 3CT4A 3DE6X 1FP7A 1WR8A 2W6PA 4YRDA 4HXEB 3B82A 4QPZA 4AUMA 2HGSA 4WCFA 1U5BA 3M3PA 5HIAA 3FNGA 5KHLB 2MYPA 5C1BA 2XKKA 1GITA 3H5RA 1U2DC 4MVJD 1AMUA 1HE1C 2YYYA 5JSQA 1GQ2A 2DR2A 2IXGA 3R6LA 3LX4A 1R3UA 4PZZA 4TLLB 5HUHA 4DV2B 3OZXA 4IPTA 1RPZA 1D2CA 1QRAA 3BH0A 1PNQA 2I54A 2JLUA 3ITKA 2WWIA 3P9PA 2V0GA 2SECE 2WE8A 1SUIA 2IPNA 3OECA 4D3YA 1B8NA 2YV3A 4NENB 1AIPA 3EA0A 4XW2A 5JHGB 2VRNA 2XNHA 2JEOA 2ILVA 3QOFA 3DXZA 2JLBA 5DH9A 1JLMA 4GUAA 4L72A 4O2BF 3PHHA 4ND8B 1W76A 2A3NA 1IZ8A 3IUYA 3K1AA 2Z1DA 4OMCA 3ZI0A 1E5QA 1FP4B 4A2QA 1A9XB 4O4LB 2M6LA 2ZRQA 2FRDA 2FPKA 3GYBA 4ZREA 4BC0A 3THYA 1YK0A 2O2SA 2RHGB 3HA7A 1RYHA 1GZHB 1XZNA 1FMLA 2DPGA 1BQEA 1ZHHA 3FR8A 2FP4B 2K6GA 4TOIA 2P67A 3A3PA 1YSCA 2CHGA 2JFPA 1UBEA 3NAZA 1PR9A 2ZE7A 3WWEA 5JNLA 3D0QA 4N5HX 3F6BX 1EK1A 4FX5A 1JIXA 4HCJA 4U7WA 3ZN2A 3PRYA 4RY9A 3T6KA 4C4YA 1IK6A 1JDPA 3EWNA 4QDUA 3CUWA 2D7DA 4QDXA 4LHXA 2RGDA 1RZ3A 3FHCB 4UTVA 5JI3E 1JQ5A 3GOQA 4F84A 4ITVA 5TQ2B 1O97C 3QU7A 3QMWA 1ILWA 4PGHA 3OKPA 5KNDH 3FSRA 1EEHA 3OQVA 4B3BA