1VHWA

Crystal structure of purine nucleoside phosphorylase with adenosine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
237
structure length
237
Chain Sequence
ATPHINAQMGDFADVVLMPGDPLRAKYIAENFLDNAVQVCDVRNMFGYTGTYKGRRISVMGHGMGIPSCSIYVTELIKDYGVKKIIRVGSCGAVNEGIKVRDVVIGMGACTDSKVNRIRFKDHDFAAIADYKMVKAAEEAAKARGIDVKVGNLFSAELFYTPDPSMFDVMDKYGIVGVEMEAAGIYGVAAEYGAKALAICTVSDHIKTGEQTTSEERQNTFNEMIEIALDSVLIGDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine nucleoside phosphorylase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transferase
total genus 84
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vhwA00
4YO8A 3NM4A 3K8OE 4WKNA 3OOEA 5CCEA 3DJFA 1Y6QA 4K6OA 4NSNA 3NM6B 1Z5OA 1RYZA 4OJTA 2OXFA 3TL6A 3C74A 1Z37A 5FAKA 1LVUA 4QFBA 4TXLA 4MCIA 5EFOA 4F1WA 4D8YA 4DABA 1Y1QA 2OC4A 1PR5A 5IFKA 4D8XA 1JDTA 2H8GA 3EMVA 3OPVA 4JP5A 4QASA 1ODLA 1K9SA 1U1EA 5CYFA 4DANA 4TTJA 1A9SA 5C80A 3BJEA 1RFGE 3T94A 2QSUA 1FXUA 5F7ZA 1Z33A 4JWTA 1XE3A 4QATA 2A0WA 1V2HE 3PNSA 4D9HA 3MMSA 3PHBE 3ONVA 4TXHA 4TTIA 5B7QA 4F3CA 4E1VA 4M1EA 3INYA 1A9TA 4TXJA 2HRDA 2QPLA 3IEXA 1C3XA 4DA0A 2P4SA 4BMZA 1VMKA 1A69A 1RXUA 4DA8A 1JDUA 1WTAA 2HN9A 4TTAA 3FB1A 4X24A 1TCUA 1N3IA 3KHSA 1Z38A 1PR0A 4F2PA 3DDOA 1PR2A 5F77A 1ULAA 4MARA 1PBNA 4OGKA 1YBFA 5DK6A 2A0YA 4TXMA 4LNHA 5F76A 3KVVA 1Z36A 3ODGA 1PW7A 3F8WA 3OZCA 1SD2A 4L0MA 3UAVA 1U1DA 1YQQA 2ON6A 1T8YA 1JDVA 3IOMA 1JE0A 4R31A 2OC9A 1RXCA 2AC7A 4YJKA 1YRYE 4DA7A 4BN0A 1Z5PA 1VHJA 3EEIA 3DPSA 3O6VA 1TCVA 1PR4A 3KUKA 1JDZA 5I3CA 4WKBA 3QPBA 4QAQA 1Z5NA 4OEHA 4BMYA 2I4TA 1Y1TA 2IQ5A 3PNPA 1ECPA 2QDKA 4BMXA 2HWUA 1T8WA 4H1TA 2AI1A 4NY1A 4G8JA 3OCCA 4YMLA 3EUFA 2Q7OE 4QARA 1JPVA 5CCDA 1JDSA 3K8QA 4MCHA 1JP7A 1TGVA 3E0QA 4LNAA 1LX7A 4P54A 3U40A 4PNPA 2BSXA 3OZDA 4F2WA 3E9RA 1RR6A 5F7JA 2RJ3A 2QTGA 4DAEA 1A9QA 4GKAA 1Y1SA 3MB8A 3OZBA 3GGSA 4L6IA 2ISCA 1U1CA 1K3FA 1OV6A 1Q1GA 5B7GA 1TD1A 3BSFA 4L5AA 1Z35A 1RT9A 2XRFA 4ECEA 4U2KA 1SJ9A 1U1FA 1I80A 5B7PA 4NS1A 1OUMA 2A0XA 3OZEA 3PHCA 4L5YA 3ENZA 1ODIA 4FFSA 5K1ZA 1K27A 5ETJA 3UAWA 3BL6A 2OECA 3E9ZA 4F3KA 2A8YA 3UAZA 1RXYA 1RXSA 2AI3A 1PK7A 3OF3A 4TXNA 1JYSA 4GLFA 2B94A 4M7WA 4IP0A 4KN5A 4GLJA 3NBQA 3FUCA 1NC3A 1ODKA 3GB9A 4G41A 3LGSA 5F73A 1PKEA 3UT6A 1VFNA 2PGAA 4OY3A 3BGSA 3P0EA 4EB8A 5EPUA 4G89A 2AI2A 1CG6A 1QE5A 4R2XA 1PF7E 4DAOA 1VHWA 4WKPA 1JE1A 4D8VA 1TGYA 1U1GA 1Y1RA 3DF9A 3SCZA 3KU4A 4RJ2A 1B8NA 2QTTA 3OOHA 1CB0A 3P0FA 3DP9A 1OTYA 3UAYA 1Z34A 3FAZA 1NW4A 1M73E 4D98A 5KB3A 2GUWA 3EUEA 4YNBA 4DA6A 1SD1A 1G2OA 1LV8A 3LA8A 1B8OA 1A9PA 4TYMA 1V48A 2HSWA 5F7OA 1T0UA 4GMHA 3UAXA 4PR3A 1PK9A 1ODJA 1T8RA 1Y6RA 3FNQA 1A9OA 1Z39A 1V3QE 4LZWA 1ULBA 4JOSA 5CXQA 3LBAA 1NC1A 3D1VA 4DARA 5B7NA 1RCTE 1V4NA 4L5CA 4LKRA 2I8AA 1SQ6A 1V45E 5JPCA 1V41E 4QEZA 3FWPA 1RSZA 3O4VA 3NM5A 3KVRA 4TS3A 4WKCA 4UC0A 1PWYE 4R2WA 3KVYA 5CXSA 1A9RA 1PR6A 4LDNA 5EUBA 4M3NA 1T8SA 5F7XA 1ZOSA 4WKOA 3FOWA 5IU6A 4OGLA 4OF4A 5F78A 1OVGA 4EARA 1OU4A 1OTXA 1ZL2A 4I2VA 1PR1A 1YQUA 1YR3A 4TS9A 5CYGA
chains in the Genus database with same CATH superfamily
3WK4A 3GG2A 1VG9B 3PFKA 2TECE 3FM9A 5HK8A 4COOA 5DIFA 2J32A 4KDRA 2IE8A 3B8HA 1LXCA 3FNEA 3T1VA 2VP0A 3CSSA 2VJNA 4AZ3B 1EQAA 1H2YA 5JWOA 4OLAA 4X1KB 4N5DA 4PYQA 3TOXA 3L6UA 3MWGA 3DKRA 1RHRA 2E87A 4LS3A 3FWYA 4URYR 3ACDA 3D31A 3W9UA 1N5RA 2AEEA 2NWQA 1J2YA 1DMRA 2AJLI 3ABZA 3H6KA 4Q0MA 3BX1A 5MGBA 1FF9A 5F2NA 2ZRCA 1P4HA 1QH8A 1N1GA 2JGIA 2PD4A 5B3JC 3C6KA 1V4VA 3IYLW 5DKFA 5BVGB 2V9CA 3PXUA 3WL3A 2Z9BA 4TV8B 4NMWA 4YCDA 5LLTA 3GLIA 3EHDA 1G3MA 3UWDA 4PYJA 3BF8A 5KKAA 4G4IA 4HZGA 5K51A 3AEKB 4ZVLA 2Q0HA 3OJFA 1TW2A 1C9NA 1UZNA 1WZUA 3GLQA 4KKVA 3I4FA 5IS2A 3F4KA 3S44A 4KR6A 5G0TA 1NP3A 4RTQA 3GN2A 5TMEA 1CUBA 1NMSA 2Z58A 4MQFB 3M4YA 4AJOA 4GPD1 5BN1A 4S04A 1UP4A 4YUXA 1XZGA 3I32A 3JAWA 2F1KA 3Q11A 2GEUA 4KWHA 4B82A 3F9CA 3M6MD 1VL8A 4DR6B 1VPVA 1D2NA 3WLSA 3AR7A 5CFQA 2VRBA 2ZDHA 4H1WA 4BN4A 2XITA 3N75A 4IHJB 3EVFA 4Q66C 4Y9SA 3DMHA 4O4LA 1FZTA 4YRGA 5KX5B 1Y4AE 3LUKA 5CNJA 2O8EA 3S4YA 2CXSA 1MJ5A 2OGSA 1IPEA 4OGGA 4R54A 2QSUA 3V7NA 2ECKA 1QGYA 3DMYA 1D1QA 3I1YA 4RDIA 1KU6A 5CFLA 3I92A 4RA9B 2NVBA 3E8SA 4WACA 2EGHA 3CNEA 1TAQA 2JG3A 1LS6A 2C2OA 3BHJA 1ZA1A 4B6OA 4IINA 4L28A 1IJBA 4NZMA 2X0RA 2HK9A 1KQPA 3P9SA 3CNBA 4CM4B 3TF5A 2QTMA 2VRCD 2W6ID 4C89A 3T7TA 1KYQA 3ESYA 3IAUA 1TUIA 1WZIA 2HV9A 4RK5A 3GUUA 3ND9A 3SXJA 4B47A 3FCCA 1VYUA 2W58A 4GD3Q 4OXNA 3I39X 4WNIA 1RJEA 3RYIA 3W77A 5CB4F 3ZDCA 4MRMB 3PITA 1E92A 1PLJA 3PGLA 2A0UA 3IT0A 4BLRA 2ODNA 5DI9A 3E82A 2GD6A 4PIPA 5ICGA 2MMGA 3I2FA 3FR8A 3MOGA 1YC2A 2X3YA 4N5MA 4JB0A 5FBWB 1E0AA 1VL2A 2K4MA 3WB9A 1IONA 2XQVA 1D0IA 3V1YA 4OI4A 4DA0A 3ANYB 4DCMA 1JR3D 2N75A 2PJZA 3WKAA 3H19A 1TKCA 4GLLA 3UGTA 2GBIA 4D9IA 4EUFA 2TMDA 3OJLA 4GX5A 4F96A 1RAGA 3AJAA 3LYAA 5JJCA 3PF9A 3WLRA 1EXNA 1QAQA 1IN7A 4FJ0A 2V7UA 2WYIA 2VXOA 1MABB 3NBUA 3OO1A 1ZK0A 4TTAA 3PRJA 1MV8A 3TLCA 1ZVVA 2FVXA 4LY9A 3LUAA 4JFAA 4QWWA 5BT8A 2EQ5A 4UMDA 4DSNA 3DDOA 3PRHA 3GPLA 5EJGA 2GSWA 2TMYA 3FOCA 4Q05A 5F77A 3E7FA 4DV2B 4JHXA 1OGJA 4LPKA 5CW1A 1KEWA 2IYLD 3LX5A 1AXEA 3CISA 3NWOA 3ZHYA 4ERXA 2ZIAA 4L72A 4WZAE 1E7WA 5BUZA 1Z29A 3TCXB 3ZV3A 1EFAA 1DBPA 3MWEA 4Y6OA 4ZI7B 4YCMA 1ZM2A 2ACEA 2JJ2A 4HWKA 5E1MA 5BMVB 4C87A 3K4QA 5MN5A 2BRUC 3OH8A 4NZ9A 1N1EA 3H5NA 5HXAA 1GZ6A 7ABPA 2B8JA 3F2IA 5ESDA 1KQGA 2WTUA 1J2JA 3L41A 4CQNA 1YUNA 4Z4FA 1N7HA 1L5SA 1EM6A 2E4XA 2ZR9A 2OY0A 3U4GA 2Q62A 3HMKA 2IUFA 2RGEA 2GX6A 4HGRA 5JNRA 5KYWA 3RASA 3LQ1A 3DE4X 4LTDA 3VZBA 3AW9A 2OCDA 4MQ4A 4JA2A 3PDCA 1TADA 3PSAA 4W1QA 1F38A 4JR0A 4RK6A 4CF6A 3GUVA 4MR8B 4PSUA 1TJYA 4HHEA 3K94A 3CEHA 1Y4ZA 4J4TA 1Z0KA 4Z3OA 1QTNA 1TAHA 4ISBA 1U0EA 4Y1RA 4YJKA 5DTMA 5L4NA 1EWTA 1TT7A 5EE5B 3A3KA 4DMHA 2P79A 3IERA 1NUHA 2NOAA 4ZMRA 3TFOA 1GGVA 2NYRA 3WLOA 4DCJA 4LWPA 4JXJA 3RPEA 1KO5A 1BEUB 4EY5A 3EEIA 1U0BB 2I1VB 2HSJA 1M6YA 3I8OA 4W63A 3QVWA 4LJ7A 4QQRA 4WT7A 4ZU1X 4ZU6X 4V1CB 4DLUA 5AW2A 5HA5A 3UBTA 1LBEA 1OXUA 4W1RA 5DW0A 1OBHA 1U7OA 3ORHA 2V6GA 2F8TA 2PJUA 3O1JC 1W581 3PLAE 2WMYA 2AB0A 3RLIA 3X43A 5I8WA 2ZM5A 2FR0A 2BONA 2X3FA 3DKKA 1BFUA 4C04A 4OQNA 4UAVA 4BFTA 1Z7YA 2YYYA 4P4TA 1ZX1A 1Z5NA 4HUJA 1TYCA 2DHEA 2MT9A 2PS3A 3W3ZB 5JJBA 5K8JB 1H2XA 1BFDA 4EIWA 3AY6A 1N6NA 1TPZA 3N2NA 1JJVA 4K9OA 1SBIA 2Y27A 3ZH2A 3ZY3A 4UULA 3JVEA 3GJZA 4ARZB 1E4VA 4R6WA 2H2DA 1HT3A 2RGNA 3OECA 4Y2SA 3IQGX 1P1FA 3W1WA 2QQGA 1TVKB 1XPJA 2OQ2A 3SFTA 4EHJA 4CKCB 1JEAA 3BE5A 4JB3A 4IIDA 3PIDA 4YUZA 3ZGVA 5B2FA 4A0QA 4S1OA 2C7PA 4G4JA 3TI9A 4WGGA 2QQ5A 3EIOA 4GYKA 3SU8A 4LA4A 4RHFA 1ILWA 4RKFA 4DFDA 4HSGA 4IO0A 2RKBA 4N18A 1OB5A 4TV8F 1A27A 2HEIA 3O03A 3AF6A 4UQLA 2JAHA 3UW3A 4Q37A 2IF2A 4D44A 1YR8A 2QV7A 2VDOB 1ZJWA 3MLEA 5DTQA 4BRSA 1NR5A 5KNBA 2WB2A 2BYTA 1JR6A 3PC8C 1ZK4A 1CR2A 1J2UA 4U2BA 1Y5RA 2OCBA 3K5HA 4P0PB 1LTHR 3D3WB 3I5XA 2Q1YA 4C6RA 1C0EA 3CLTC 5DRYA 1FE8A 1EIZA 1O87A 4JJ8A 4LBVA 4ZARA 1ZI9A 4TMVA 1U0HC 1TM2A 1OFTA 2XDYA 1E0DA 3OF5A 3UM9A 1BIFA 1DDOA 3WZLA 1N9KA 1O3YA 1A97A 3FBGA 1OYOA 4BNFA 5KAPA 3IA7A 2J6BA 2NTNA 5MHTA 3RS5A 3DEKA 5DNCA 2F7SA 2CXRA 2REOA 3PD7A 4Q4JB 1FFCA 4CFYA 4YCNA 2EIHA 1RP7A 5ESXA 1SKBA 2P67A 5FYDA 4CIDA 1AG9A 1J20A 4KXFB 3OLXA 1U2SA 4IHJF 4PYKA 5E1DA 3FLEA 3VU1A 3B9RA 3TAHA 5KYXA 1UC9A 3BYZA 3WLNA 4B34A 4AIRA 1QNFA 3PGXA 3STHA 2HO5A 5KX5F 1TKBA 1KMHB 1N6PA 3HGQA 5A06A 3O8CA 4S12A 4ETWA 5FUMA 1GV0A 3UFBA 4LDJA 4I50F 2AF4C 1QZXA 1EI9A 3CKLA 1ISRA 4J0QA 1TEXA 4G24A 4MJXA 1WNFA 4WN9A 3SGLA 2JJQA 5KC8A 2WOJA 1L9XA 3AKZA 1PJCA 1Z6XA 2OZLB 2OV4A 1CY0A 2B3TA 3I12A 1GZUA 2QE7A 2WNIA 2RGYA 2A1TS 1EGQA 1Q44A 2DBVO 3GEDA 2C99A 3TRJA 3OZEA 3K3PA 5E38A 5G0UA 5H9VA 4QO8A 1FS6A 1M2NA 2OB1A 2BUCA 3VKVA 2C4UA 4C6HA 4DXDA 3J81A 2XZLA 1S9HA 1Z8NA 1XDDA 2CXUA 3IMKA 4OMDA 4CR8A 1YS9A 3QPVA 2CD9A 3COYA 5EPOA 1XDWA 4QDUA 5CR9A 4FNOA 3EYAA 2JK1A 2Z5LA 1I32A 2A35A 2J5KA 2X9GA 4GR9A 4CMBA 1KEUA 3RTGA 4EW6A 1ID8A 4UZSA 4TT3A 1A7KA 3L7YA 4P58A 3U7JA 2Q8QA 5LM3A 3LCUA 4TZ6A 2XB6A 4EHNA 5AM5A 1L5ZA 2VPIA 3Q0TA 4L50A 3ZDRA 1MQ8B 1JYSA 1V16A 2HX1A 2PH7A 3K0AB 3QU7A 1P2VA 3HCCA 4FVTA 4RWEA 4DIFA 3GFVA 3EUWA 4M1YA 1ONOA 1ZVJA 3TJZA 3O4IA 3LBNA 1X1TA 3JASB 2RH9B 4IVPA 4CKEA 4B33A 1P80A 3TNYA 1E5QA 3KXKA 2RK4A 4GX2A 1I5OA 1X42A 1B2RA 3LGSA 4G85A 4MUGA 3OJEA 2OUIA 1N6HA 3MM4A 1QUFA 3ADPA 3IO5A 4B7CA 4IFBA 1ZD8A 1KJIA 4KWIA 2BL4A 1X1CA 3WNZA 4KN9S 4Y2JA 1T3GA 5F5LA 1E4EB 2GXQA 1CJMA 5DYTA 5FBVB 1XLTC 1HQCA 3MRTA 1EFKA 3T1YB 3ZPXA 2W2MA 3LFHA 3FPFA 5CHEA 1YZFA 4P7FA 4A0HA 4DPLA 1P2TA 4NCAA 3WV4A 2FR1A 5HJ7A 4NMXB 3PX2A 2OZVA 3EW9A 2NVUA 1CG6A 3H99A 4BXOA 4ZI7F 1AVTA 4CKYA 4P35A 5HBGA 2MR6A 4HNUA 4LYHA 4O2AB 3C7CB 2DKFA 5AICA 2Z83A 3BIXA 5K0NA 2CE2X 5E3HA 2DZDA 4ZTUB 1QGUB 5AKKA 2WVGA 4PVDA 1U1GA 1SU4A 1C3LA 2ENWA 4E5UA 1LDNA 2CVZA 4R2IA 3MCAA 4RQBA 4F1JA 2RAUA 4WOBA 5ENDA 4NMMA 4F38A 2WWIA 3V1TC 1LNZA 2W70A 1L5HB 2JKVA 3KUCA 4FFBA 3FSJX 4B3JA 3P0FA 1ZITA 1KVRA 1P7WA 4O4IA 2JFNA 4E09A 1Q74A 4HGOA 1IXKA 1PTJA 2WAMA 1TO6A 5EE9A 5FR2A 3U9LA 2XUIA 1P0MA 4DY4A 3HCDA 1CDZA 5CVEA 2QTVA 1HDCA 5JCJA 4CN8A 3A1FA 5KB3A 1OYVA 3JAMA 1J9ZA 1O94D 2CMDA 2I9PA 5JBNA 1ZGBA 3QF4A 1WSDA 3KQMA 4X0EA 1N2CA 3I23A 1LI5A 3E70C 4ENWA 5CA1A 1RM4A 1KO1A 1X1QA 3TUIC 3B13B 3TQHA 5E8RA 5IJ9B 4UU0A 2MSWA 3KQLA 1E1QA 1L8LA 5JC1A 3ZNNA 5MFZA 3V97A 3O84A 5AYVA 3IPLA 1JH8A 4LZZA 1YCDA 4L16A 1NBWB 1YNOA 2KLBA 3EC7A 1EXMA 5I7AA 3QKSB 1CRPA 1XALA 3EXHB 4OOFA 5C37A 1MOPA 4HBGA 3G8CA 4YMVA 3QBTA 3FFWA 5CG1A 5K0TA 2PH1A 3DW1X 2J87A 2MSDB 4IX9A 4AP9A 4PSKA 4ES6A 3KJNA 4LJ5A 5L3ZA 1JJIA 2GHRA 2VS1A 2WWGA 2HQOA 2LTAA 3QNWA 4B87A 2IS2A 1OI2A 4MUNA 2BGTA 4NWIA 3ZV6A 4YS6A 3SJZA 3MXTA 3URMA 1AV6A 3LPMA 1G0NA 3NHJA 5SYMA 1DKLA 1Y48E 3GDFA 2OP1A 3B1YA 1DUVG 4UKDA 1UPFA 3NIBA 1VLHA 5CMLA 1VRVA 4H1HA 2CUKA 1LTKA 4HB0A 3SN6A 4G5GA 4G0QA 3AI7A 1XL1A 2TYSB 4QDXA 3RB8A 4FB4A 5A3QA 2OVFA 4N65A 5BVHB 8MHTA 1N2BA 1DWUA 1YFKA 1E3SA 2XD9A 2VXBA 1U90A 3L1VA 4AZTA 3CLVA 2EKZA 3SYKA 2CMGA 4CW7A 3KB8A 3IVRA 3URKA 2CV0A 3AHFA 2I8CA 1KS2A 1M3SA 1KSHA 2J7PD 2EQAA 2KLHA 2VZ0A 2E6KA 1D2GA 3KWJA 3LYLA 2RARA 4L3OA 3ZR4B 4TTQA 4NVRA 3VX4A 4D9FA 3NT2A 1Z82A 3OZXA 1R64A 4I9FA 3R9XA 3AEQB 1AB6A 1MBZA 1T9HA 4HDOB 4M9UA 2FP4B 3GBVA 4M46A 3CKYA 1L4EA 2PLWA 3O8QB 5ECDA 5GOTA 4QPZA 1XTQA 3BZBA 1QF9A 3G0BA 3LSTA 1H4VB 2I54A 3L04A 1X6VA 4P81A 3QPUA 3SZUA 4BWVA 1T5HX 5JNWA 3PQ7A 2FN7A 4LPSA 3QA3E 5LIPA 5JYEA 2HREA 1KYYA 2P6OA 2IYNA 4CQMB 5A5EA 2BBTA 4UAJA 1NA5A 2QX6A 4A3SA 4B1FA 1TUGA 5DMHA 3SZLA 2GCNA 4MWOA 3GVXA 4ZRMA 3TE7A 2GJ9A 1O9HA 4W9NC 5TIIA 4W5TA 1PNTA 1SCKA 2DPMA 2D3WA 2CUNA 5IULC 3HUUA 4PFQA 5AKLA 1GSOA 3QVMA 5JZOA 2VTBB 3R6WA 4N39A 1IG0A 4DRZA 5DTRA 4NV1A 3OQVA 4NZPA 3AKCA 4BO3A 1SOVA 2Q6VA 4ZI3A 1IHDA 3BMOB 3GT7A 4D4JA 2ZW9A 1T2AA 1MNAA 1ZD2P 1WXWA 3MGAA 4RFSB 4UNPA 3UH1A 1ZICA 2W2XA 3AYXB 2GKGA 4FW8A 4UBJA 3UHPA 4O8ZA 2NYUA 3HRHA 1EXVA 3GEGA 5DI3A 1XMQB 2ZIXA 5EIHA 1M1UA 4MO9A 1RACA 2IHJA 3C85A 5EMMA 5F2OA 3RUPA 4E5DA 1N1DA 3RNOA 2W6MA 2O59A 3DL4A 4RSMA 1KFKB 2XQJA 4OQFA 2FOIA 4K81B 1QE0A 2V54A 3FYHA 4U7WA 2XGSA 1NTOA 4KQ2A 6PFKA 2VVTA 3OHPA 3RUEA 2JEYA 3TK1A 1I7DA 2AZXA 1VQ1A 2EAUA 3H6HA 4EA7A 5AVRA 3DAHA 5K6AA 1X1RA 3ZQUA 2B1RA 3L7LA 2YZ2A 2VHXA 1KY5A 1NJ8A 3UJAA 2XB9A 5CLGA 1MOZA 3G2HA 4JT9A 2CNOA 4FGWA 5ITZA 3LDUA 1SXGA 4KBFA 1CBUA 1SNYA 1LK5A 3KQOA 3FROA 4IMIB 5HKLA 1QANA 3JALA 3NALA 4R8SA 1TCBA 3TRDA 1K3TA 1RBQA 3PYXA 2Y92A 3R0IA 4S3MA 5IJAA 3O0DA 4X3OA 2A9QA 4P08A 4IO1A 5AVJA 5B57C 2FMTA 1ACMA 4ASUA 1THZA 2FRVA 2YMMA 3LHKA 4IRXA 4M53A 2J3HA 2VWPA 4WCFC 2J30A 1HLGA 1E5XA 3MRSA 4WZ6A 3DE2X 3K1AB 1OVMA 1TZCA 2RHTA 3JTMA 4LTNA 3P5SA 4X94A 3TXXA 4A8PA 3QA9A 2NUAA 4TKUA 4XH9B 1IK4A 1X1SA 4ZT2A 5HDBB 3SX2A 4F1KA 1PZXA 4ISCA 5AVUA 1TTTA 1XA3A 3I73A 4UBMA 2CJFA 3ZCXA 3GCGA 5FUQA 5K3OA 3GJYA 2W2KA 1HYQA 5FKJA 4HEA1 2FZGA 2CXXA 4X92A 5SYAA 1IWBB 2EHDA 4O2AF 3JSAA 1QXSA 4MDHA 2VUIB 4DR1B 1BCSA 1NVEA 5HPYB 3KTAB 4OTZA 4IV0A 4XCXA 3ROPA 2FMUA 1OGYA 3IMFA 3MCWA 1YZYA 1YZVA 2AEMA 3PK0A 4BNXA 1Z5WA 3LVRE 2HLPA 3VOBA 1DCKA 4HPXB 1BMQA 1GCIA 1ZCBA 2XTNA 1WTCA 3NTLA 4TZTA 1E62A 5B1EA 4DILA 1MW8X 1DAKA 3E84A 5TC4A 1P1IA 4NFHA 5BMOA 2IODA 1HURA 4AZSA 5A71A 5ICMA 1UC4B 1E4YA 1E2IA 1GIAA 4HAXA 1G20B 3D4OA 6GPBA 2V58A 1E2KA 1UM9A 3SC3A 4P31A 2GCGA 4BE4A 2YBDA 4IXMA 5BW6B 4RKEA 1G2QA 3DMNA 3MUEA 3IKTA 3B38A 3B3FA 5HF5A 2J0SA 4AVYA 1EMDA 5CVTA 1QV9A 4TXHA 2DVMA 5FEMA 1FFGA 2OSVA 3WB0A 2BM8A 2OORA 1QFSA 1ZPDA 1JTEA 2SECE 4NYJR 3GF4A 3ZI0A 5ADUS 5EP3A 1IBMB 4IH4A 1YHZA 2G1AA 4RETA 2FZ4A 4DNQA 2R0QC 1GDDA 1E2HA 1BVRA 1YDHA 3UJ8A 4RL4A 1PT7A 3W8RA 3R9KA 3MTJA 4Q6BA 2A5GA 2DHDA 3NHLA 1SCNE 2XEXA 3CLTD 1VB5A 5CNMA 4HWSA 1T9GR 1TKRA 3SD7A 3HL4A 3DL2A 2ZZMA 4WHMA 1MAHA 2H29A 2XKKA 4TV9F 3RYTC 2YZNA 1L1FA 1FOEB 1U2GA 2JA1A 1BXRA 2ZUUA 2O2EA 2P0AA 4CF7A 2Y1LA 3KJGA 3N86A 3K92A 5AVKA 2AC4A 2Z5GA 1TMYA 1WKBA 4REQA 3QE3A 2CFIA 1ZESA 1GNLA 4INPA 4OM8A 3SVTA 3O2QB 1K7FB 2Y0PA 2QZ4A 3DD5A 4EJSB 4XSHA 2VYNA 1J0XO 4ITVA 3MJVA 4IWYA 4LW8A 1MXHA 1XWWA 3LX4A 5EIWA 1DRKA 1PGJA 5JJLA 2I3DA 1L6RA 3R76A 2A9OA 3T3EA 3NHFA 1SRRA 5EUCA 3UJ7A 3ZE2B 2WWTA 1XG5A 4B3GA 1IFXA 3HXOA 1SOUA 2IS6A 1JDBC 4D81A 2VPTA 4FS8A 1E1CB 1JR3E 2WU1A 1FDUA 2IYQA 2H00A 3OJOA 5TGTA 4JBXA 5IM4F 4PCAA 5A6VA 3IEVA 2QDXA 3UATA 5JFTA 2QAJA 2XMSA 4PHTA 3TCKA 1WU8A 1HL7A 1MP0A 4A0SA 1EINA 3NONA 5TJHA 4TQGA 2UVDA 5D3KA 1NBEA 1YC5A 3JARB 1U1IA 2DKOA 5E4FA 1D9ZA 3PC2A 2C1ZA 4RVCA 2PT6A 4URFA 1XF9A 4C0SA 1ZOPA 4R7TA 2ECPA 3T35A 3UH0A 3WA6A 3DUFA 3F8TA 2QLLA 4MX8A 4Y9DA 5A3SA 1O6BA 3OFKA 3ZE9A 1PT9A 3GNLA 2X5KO 1X94A 3Q9LA 3REGA 3NHBA 2P3QA 2MYNA 2PSHA 3TLGA 4DKJA 4FDTA 2P9ZA 3QG5A 3DM5A 2PO5A 1WCWA 2YHUA 1KJZA 4FGJA 2E37A 1QUEA 3P9PA 4DLZA 5KWEA 3EF1A 5TT1A 3FDXA 3MJRA 3T06B 4Q1DA 4BNYA 5I9BA 5FPPA 1ESMA 4X7BA 1B73A 3F90A 2XW6A 1QNLA 2P2ZA 4XX0A 1CIPA 4NCNA 4MQMA 4AI6A 3ZGNA 4I55F 2D5BA 3D54D 1QYDA 1GZ3A 3IP5A 2L17A 3GW8A 3U2QA 2G3YA 5IF9A 3KLPX 1B6SA 1CUUA 2G5PA 2IZOA 2JCSA 4G4SP 4U00A 4YAJA 3V8EA 3WZ2A 3VBCA 2JL1A 4DLAA 6YASA 1CB7A 3LDFA 2XXAB 3KSAC 3QE9Y 3CLSD 1C8VB 4AB1A 4N47A 1N36B 3F5FA 4BMYA 4I6EA 1E94E 2A33A 2P0EA 4DLNA 2C88A 1VC2A 4Z4HA 5JALA 4B40A 3HZRA 5IKEA 1E4OA 2IQ5A 1W4ZA 4HATA 3ZDYB 1LSOA 2IL1A 2GXAA 1ZNQO 3I0NA 1W1WA 3KIPA 2E4UA 3NDRA 4QYIB 1G4HA 3OTGA 2O1EA 1NHWA 2D2FA 3AV0B 3D9QX 3GRVA 3L7BA 4WEOA 2HIMA 7ADHA 3ITEA 4DV4B 3CVWA 2FXVA 1I4WA 2QLNA 5B3JA 1SBCA 4HR7A 4JQZA 4NYMR 1U28A 3G2PA 5K20A 4AKIA 2AZDA 3RSLA 4CTJA 1AN0A 1IN1A 3DNFA 3KR9A 2IHUA 1YMQA 2A9JA 3AYZB 3C3WA 1OLSB 4ID9A 4JR2A 3AEZA 2O2ZA 1QHSA 1AZSC 4JD5A 4KQXA 2KQUA 4NECA 4W1SA 3QRWA 2JGDB 3RKRA 4GH5A 3S8MA 4EKDA 1FDOA 2IXEA 5H7XA 2ETVA 1Z63A 3SZOA 2PFGA 1JWLA 2JGMA 1AS3A 1REQA 5DM4A 4Z1MD 3F9RA 5CLQA 5ANRB 1QZUA 4N3CA 1F4LA 1Z88A 4YJDA 1Z83A 1FRZA 2FJ0A 4C4SA 1H4TA 3H84A 2B82A 2A67A 2XUAA 3VJLA 2I4NA 2Z4SA 4JBHA 1GG2A 4U2GA 5IMSA 2JHCA 3GI1A 2L18A 5ED4A 5F9FA 3LNTA 3RROA 4F7DA 5M2QA 2R6JA 4IRUB 1UKZA 2E89A 1QVZA 2V03A 3KC2A 4J75A 1JIXA 1G7RA 3I5AA 1RZVA 3IBTA 4BFCA 4C6TB 5KOJB 3GFSA 3Q2IA 2ID8A 1Z6GA 1ZQ1A 2XYRA 4GZ5A 4JIMA 1G21B 2PY6A 1W88B 4GOOD 2C7GA 3ZS9A 1E3DA 4M37A 2BZ1A 2XRFA 4XM0A 1Z6PA 1FPMA 1JA1A 2QGZA 4NDNE 4QLOA 3WXMA 2WSBA 3BDAA 4IJKA 5IDVA 4KTVE 2RGUA 5ILGA 4QG3A 4QVIA 4O5OA 1QRRA 4J2HA 4JEMA 4ARAA 1YGPA 3WIVA 1NVGA 3IQWA 3JYQA 4L75A 1QYXA 2BKEA 2GBLC 2QS9A 3IUMA 2XNSA 4KQIA 2BR4A 4RY2A 3NUGA 4CEIA 4QJ4A 4MYTA 3G88A 5JOQA 4HLCA 5ETJA 3W05A 3W7BA 3OICA 2ZJ2A 4ZHSA 3G0DA 4MKXA 2ROQA 1YL7A 2FZEA 5DNVA 4BO5A 3L7IA 2VDKB 4KMOA 1GXSB 1TM5E 1RXWA 1U3VA 4CG2A 5ALFA 1WDKA 1V0JA 3P9IA 5HVNA 1QIKA 1YVPA 4CEHB 2QPAA 5FUBA 2FZWA 1Y3CE 1YS4A 3CF4A 2HHLA 3SEFA 3NRBA 2HOQA 5AVSA 3OETA 4M7WA 4FYWA 4RXUA 1BQ3A 1GQRA 3CGWA 4LZAA 4PXAA 3RRFA 3FUCA 5JAQA 3RKSA 5FWXB 5JADA 3GUHA 1MZVA 3PUJA 2E5WA 3I6QA 2C29D 3K16A 1AKTA 3DYIA 4IDGA 4MRVA 5CLIA 5EQJB 5KQLA 4EI2A 4JI2B 2QVBA 2XYPA 3OKFA 5TE9A 4JLSA 1JFLA 4R8VA 1JG2A 1FDTA 2OM6A 3QLJA 3G5MA 4JJGA 2ESRA 4OH7A 3L7JA 3H1GA 4IDFA 3UT6A 1AKQA 2D2VA 4HKTA 1WJGA 4B3RB 2LWIA 3ASZA 3D4NA 3QU9A 5I6DA 1RQ7A 2VHVA 3O7WA 2CXTA 1GTVA 3PIIA 4EY4A 1KI7A 1LJ8A 4DN6A 2FLVA 1E2BA 1R9GA 2REQA 4KIGA 1H3NA 1HEUA 3C3CA 1YT5A 1Y3DE 2HCJB 3GLHB 1DRJA 2AC2A 2X2EA 3MD0A 5M5BA 1JMYA 4IDCA 2QG6A 2WFZA 1HE2A 1M2OB 1NI5A 2O05A 4WGFA 4RPHA 1I7PA 2RAVA 2ABWA 1W0JD 1GZSA 2PUTA 2PRIA 4LRTB 1PJBA 2LZ0A 2GN4A 4FFOA 4EEKA 2IRWA 1XGKA 2VO1A 4EJFA 1V1JA 5B5SA 1XB2A 2XB4A 5ALSA 4CR6A 1BJRE 1Z8HA 4AUMA 2ZLBA 3LFTA 4PZLA 5ALDA 1PFYA 4JL8A 1MFPA 1OTYA 4BFLA 4E88A 1IM2A 3P0HA 2I91A 2H31A 2BJWA 3HVJA 3BJRA 2VQFB 1R4MA 4A1FA 2EKBA 3A6GA 5F3DA 1F2UB 1IY9A 1DAMA 1UBRS 2R66A 1IATA 1VJCA 3RTDA 1RQGA 2JGFA 2GUWA 5DASA 1YQ9A 1BEEA 1GZ7A 3AL3A 5KOIA 2KBFA 2W93A 3EVTA 2IHZA 1HWYA 3IXMA 4LX0A 5DN9A 3LKZA 2YCLA 5BW8A 4JJ7A 2FSFA 3ZWCA 1S2DA 2WYWA 2P3OA 5LQJA 8AT1A 4IVQA 3NTVA 3TO5A 3W6PA 3IUQA 1U8YA 2Q3HA 3EOZA 4DIEA 8ADHA 1D0SA 2PUVA 3D43A 3CB4A 3DDWA 4EH1A 4M87A 3GFRA 5F7OA 4M88A 5T5QA 3U44B 1I3OA 1QCCA 2WDZA 1KI8A 3MVEA 4CHGA 1XLUA 3FYUC 3FWKA 1QOZA 4KE9A 3BE6A 4P22A 3UT5B 1PJZA 4JU9A 2WJVA 3V42A 5L3SA 4C2TA 1CVIA 5E6SA 2ZRKA 2QAIA 3JQEA 1B41A 3W2GA 4XCVA 2D6FA 2IYSA 3V1LA 4WBNB 5IYZF 1N5JA 4NPCA 2XUGA 4Z0NA 4P3PA 3OPYA 5C8XA 3Q4GA 2WY2D 4ZCMA 8GPBA 5JNUA 4FJ2A 3TRKA 2CBXA 2GO1A 4KQWA 4AKEA 1A4IA 2MINB 1G291 3GYBA 3D1VA 1Z22A 2PZMA 4FHZA 3DLPX 4ARSA 2WOOA 2VUUA 4C30A 4DNPA 1I13A 4JI8B 3D0QA 3AR2A 2XCUA 4ENSA 3B1FA 4L5CA 3NVMB 1XU9A 2DLNA 2I8AA 2EXXA 2OESA 1J8DA 1NYTA 4ONEA 4FWIB 5FPHA 3N0TA 2PAAA 3K0SA 4BKRA 5E9JA 2ZYWX 3HXPA 4OYHA 1MB4A 3GMIA 2QIOA 3DPIA 3BMNB 2X40A 4UTOA 5TQJA 2JANA 2AN9A 3W6NA 3WK8A 1AN9A 5BO5A 2Q6OA 2GD1O 2BDUA 1HE5A 3IE0A 5T57A 3MD9A 3H7IA 3KEFA 3BA1A 1NXSA 1R6VA 2GESA 4BQOA 4YRPA 3T61A 1JPNA 1BMDA 1OX4B 2RC5A 3OO0A 5KHLB 2QXTA 3RI3A 3QLVC 1D07A 2IBMA 1IE3A 2P62A 4UXIA 3CONA 3N2IA 1SCUA 3L8FA 4LI0A 3SVLA 3ND7A 2D1TA 2WIAA 4RZIA 4ZMBA 3A6DA 1B14A 4FGUA 3SZGA 4LYJA 2LDBA 1TA0A 1YDMA 3DWEX 4CKWA 3O21A 2BFPA 1S7CA 4WVLA 5J2UB 5FPKA 2OXIA 1EFTA 4LGCA 1U7TA 4E6PA 1B26A 1XELA 4MMZB 2HF7A 4YRNA 1T25A 3K73O 4DR4B 1U0RA 2XDAA 1L7DA 5KI6A 4RTRA 5EJ9A 1QS0A 4RK0A 2NU6B 1Y7IA 4BMCA 3CCCA 3B85A 1MA3A 4J9VA 3IMGA 1KBQA 5AK6A 2EFJA 4JKYA 2FZLA 4TTTS 5BWMA 3F8SA 1EGAA 2ZRNA 4OHCA 1SBNE 4IV5A 3C3BA 3T52A 3U3XA 4N4AA 1SUCA 1XQWA 1DNPA 1XMXA 2O2DA 3JYLA 4XWWA 1ZNZA 4H4EA 1PR1A 5AJYA 1FP7A 4ZALA 4JI5B 1ZR4A 1UPCA 3VU8A 4UUAA 5KNCH 2JHGA 3FBWA 2MSNA 1VG0B 1E2EA 4FFNA 2Z2ZA 2YYAA 3GARA 3QU2A 1V1RB 3L7KA 3N7TA 3U1TA 3KAPA 4B75A 4NZOA 1G5FA 4BX9A 5DVZA 4HQ0A 1R0SA 2PMBA 2M32A 2H5IA 4F4IA 4LBZA 2D0IA 4QYMA 8OHMA 3K70C 4RXMA 3AF3A 3HFJA 2ZUTA 4U2CA 2KPOA 3HKEB 5ALJA 2FWNA 2UUPA 5CCEA 4K6OA 1HC7A 4LRSB 2XDWA 1Z5OA 5JUWA 1SXJC 3GHHA 5K09A 1RYZA 2DRIA 3ZDXB 4KUGA 4DWOA 4J76A 5IHPA 1SCIA 3TQTA 3RRNA 1PFQA 1USUA 2ZWIA 4A03A 2Q3FA 2VHUA 1LVUA 4LHEA 3E7DA 2O8BB 3SEZA 1OW3B 1N25A 1DC3A 2YN0A 1WXEA 5F1PA 3VAZA 1YFJA 3F49S 4EVQA 3Q7PA 4XQGA 2ZRAA 1Y1QA 3DLTA 2VEDA 4LJLA 3SSMA 4M76B 1O95D 1ZRHA 2SCUB 3OY7A 5FI3A 5BSRA 1OKKA 4B73A 1TUBA 1XLTA 3JQGA 4KB5A 4UJ3A 3TIXB 5EZQA 5K3FB 5BWBA 3KKPA 1U0NA 4JQOA 1P1BA 1QV6A 1YI0A 4LRUA 5I01A 2BM0A 3WLAA 2B7CA 1K4MA 3EWIA 2B21A 1ZVMA 1TZKA 2XWPA 4WZAB 3V2HA 1L4FA 2IV2X 1L4MA 2HZ7A 2PBRA 1OCEA 2OCXA 3IAAA 1GL9B 3EPLA 5HW0A 3RODA 1L5FA 2BTQA 1IXZA 3NB0A 3ZEIA 2J6HA 1PLKA 2GPJA 2AFHE 3B9PA 2W6JA 4HAYA 4QJBA 5FNVB 3LV8A 4F84A 3RS9A 1QOPB 2FPXA 5BV1A 3PFIA 3ZVNA 1OT3A 4G6ZA 4HPWA 4PCUA 5DLYA 3VR2A 5BNTA 1O4VA 3ZHSA 3FJ1A 2A7XA 2C9BA 1DKRA 3A6HA 2OV3A 1FQKA 3LHDA 4AXBA 5IX8A 3R8FA 2M6SA 4HWGA 2IW3A 4HNQA 1QRTA 4UTPA 4Q9IA 2X8LA 4YP6A 3PIRA 1AU9A 3DAPA 3MJHA 2J41A 3TINA 3D8HA 3BMXA 3I52A 4J49A 4MTCA 1JSCA 3BCRA 3N58A 5J5VA 4URZR 4RJLA 1KJYA 4OYRA 4UBNA 2IV7A 3RWBA 1JILA 1A98A 3C14C 2R1TA 2HU8A 1OJLA 4GPTA 3INYA 3L3BA 4PWYA 1XROA 3HP4A 5IZ4A 1KMQA 2ATIA 1PAUA 2OV8A 3D6HA 3LUPA 1VG1A 3K8ZA 2VDWA 2VI5A 4L9AA 4KAFA 1S2NA 4CG3A 1R2QA 1YR6A 3HB9A 3WRYA 1CIJA 3H75A 4WA8A 3DWGA 1PFVA 1VP9A 1TF5A 2R5WA 3AESA 3CX4A 3R5HA 3WI7A 2OXRA 4GVPA 4BE9A 4OSEA 5ALKA 2UZ3A 1PX0A 4OQLA 4DGQA 721PA 5KJFA 2MTBA 1SB8A 2NU7A 3ZDAA 1TLLA 1WF3A 3ROXA 4ARBA 3OEHD 4OJQA 3KHSA 5HUQA 3U19A 1KTVA 4MRSA 4F2PA 3A58B 4MW4A 4BMSA 2H9YA 3NX4A 2YJ3A 5TLSA 1CYEA 1JU4A 1CR6A 3R7WA 5I7VA 2V1XA 4B3DA 4UDXX 1FW8A 2FPSA 3SQXA 1RXEA 2FN8A 4C7XA 1P77A 2VZEA 4MSUA 3NYIA 1QH8B 3KLMX 1A96A 3SKVA 2PAFA 3H87A 1YBFA 5TF4A 1NOKA 1E9EA 2FW7A 3JQAB 2X5NA 3NLLA 3PQ6A 1NOIA 5K7SA 5KQSA 1RPAA 4HL6A 4DMKA 2FRDC 2BTOA 4YRZA 2DPXA 2HYDA 1GPYA 2ZSEA 4E03A 1T3ZA 1NLZA 3HSYA 3ET5A 2I6TA 4ER7A 5JZMA 1R4AA 2XUQA 5PGMA 2W8ZA 2FPRA 1U6KA 3T38A 1ZBQA 2WLTA 1F8XA 3EZFA 1RZUA 4ND8B 4NTZA 5T6BA 4DTIA 4YRQA 3OFND 5L4SA 3RBZA 2GAJA 3WK9A 4AJ9A 3T7KA 2D5LA 1P17A 5P8WA 1HLPA 3TZQA 4IQFA 1J39A 2QR5A 5G4KA 5NLLA 1F7UA 3JAWB 2WIDA 4RK7A 5FQNA 3T95A 1RYDA 1L5RA 3F9IA 5J2UF 2IYFA 4JLMA 2EL7A 1P5ZB 1WWKA 4XWOA 1I1NA 2A4MA 2AC7A 2XA1A 3QQPA 2E1RA 2WG2A 5G1NA 2QMYA 1VPDA 3KZKA 4B8ZA 4HRYA 5AKIA 4JSYA 3DGFC 3F74A 2O8EB 4YECA 5DIZA 3KHKA 4FEYA 2WAOA 3C43A 2GO7A 3B60A 4GMKA 2DQYA 4HQNA 5IEJA 2DERA 3ZE6A 1XYYA 1VHLA 1CR4A 4DVJA 5A6SA 4G81A 2OCAA 5CYPA 1WHTA 3DDNA 3G2NA 2Y8EA 2HHCA 1KETA 3ZW7A 1H94A 1VJRA 1PJTA 2H7VA 4GI7A 3PC6A 4LE1A 2GPAA 2O5RA 2V4UA 2B4YA 2J6CA 5IAOA 4J1SA 3RYIB 3EAQA 1UDBA 3B6IA 3ZCQA 5IPFA 4OREX 1S3SA 1ZH8A 5EWMA 3E5RA 2EDCA 1NNLA 2GZ3A 3UC9A 3FCYA 1VZ3A 2QD1A 3BXOA 2CLEB 1FFHA 4YMWA 5CP8A 4W7SA 1ECPA 2QT0A 1QYCA 3J81k 1VHTA 1Z15A 1QZ3A 2J5BA 3I2JA 1ZRMA 3RTEA 3DBHA 3SMVA 2O7SA 3FPBA 2E0IA 2YTZA 3MJTA 3OCVA 1FQWA 4QOSA 4TL7A 4EENA 1G9XA 2I3ZA 2HXGA 4CI9A 3BGDA 2V98A 4QTTB 1XAHA 2OHHA 2ODBA 4HX9A 3VMMA 4K0RA 4WTOA 4EYKA 5CLFA 4HXGA 4PCLA 1JPVA 1XMOB 3UJPA 1ZMRA 3OZGA 3GLFA 3V8VA 5G02A 3OMXA 4KL8S 4YAFA 4ZAYA 2X9VA 4R0MA 1Q7EA 1AXRA 4GEKA 3E22A 4IDHA 4NABA 1OC2A 2ZTLA 5DBIA 3LCCA 1H2RS 1EP3B 3B6JA 2IHNA 1YJ5A 3QOWA 4OGWA 3STVA 1L4LA 4BVEA 3AVUA 4AKTA 4REOA 5EGNA 2JIRA 4BOYA 4FCTA 3KYBA 2X2OA 1W36C 4RLHA 1RM0A 2WPDA 4XPZA 5EERA 2WZBA 2JEOA 2R2AA 1ML3A 4QU8A 5TR9A 3TE6A 2BH2A 3MWEB 1B93A 4AKSA 2O57A 1I8TA 4DDUA 1WUJS 4WLVA 1JKXA 4L6AA 4P36A 2J3MA 5DHRA 2I6FA 4ZAGA 4K6MA 1T36B 1J2RA 1FS4A 5F64A 5FNVF 5H59A 3H1EA 3M6XA 3OCJA 2WJZB 4Q39A 1MG5A 2O20A 2JJMA 1SC9A 3LDAA 3M4JA 4D4LA 4YV2A 1NN5A 2B2XA 1SR8A 4YV0A 3QKWA 3VUEA 1FQJA 5KYWB 2FSHA 1NOJA 4PX2A 4TT3D 1KQ3A 5JR3A 3I2KA 3L79A 2EP8A 3ZUPA 2BF7A 3FTPA 4EPVA 3GAAA 4LKOA 3YASA 1KDYA 5CAEA 2A7QA 5CT9A 3L06A 1FLAA 1Y63A 2J67A 1BG6A 1T1IA 1V9CA 3C24A 3CJTA 2J3QA 1QIGA 2DPLA 2ODTX 5LBIA 4KPUA 1JV2B 2BMEA 1YDFA 5TX7A 4F4JA 5C2JB 1EIWA 4TKVA 4UM5A 3ENZA 4Y1RB 1P0FA 2B6HA 3C98A 3OFJA 3NAMA 4BX3A 1VJ0A 1PX2A 1WW8A 2CBGA 3HN2A 2XT0A 3L0CA 4K1XA 1YL6A 2WJIA 4RBNA 2CLMB 3C7TA 3ZLVA 4EFLA 1XVAA 3F5SA 3FOZA 2OTCA 3KP1A 1VIMA 1WW2A 2E55A 4ZT5A 1PLLA 3AGPA 3S8EA 5HRCA 4NCJA 1NW9B 4XVRA 3MUOA 1G60A 1TF2A 3BZUA 2GASA 3W2TA 1XN1A 5KSYA 4CEJA 2E6UX 2XUFA 4EY3A 5K8VA 3HR7A 3KTOA 3OF3A 4FUQA 1SZJG 1GOTA 5EQDA 4KN8A 3OP1A 3CPSA 4PZYA 1VP3A 3ZE7A 2FJUA 4O0MA 5IT5A 1PYOA 2ZIUB 5HQ3B 3PI7A 2HBZA 1N4DA 2O2SA 1EFUA 3H8JA 3E1SA 1U4OA 2YNMC 1E32A 3CZQA 4M9XA 1ISMA 4QGHA 2ZYIA 1ID1A 2W8BB 3SLRA 2GN2A 4KLNA 4Y2PA 2DQSA 4EG3A 2PZLA 3LS2A 1W4LA 3QMMA 1L5WA 4KXUA 4BP8A 1K5DA 4G4GA 4HUQB 2FZCA 4HVAA 1EK2A 3LWZA 1OSNA 5JXGA 1Y8ZA 3DOFA 4WBXC 3F46A 2DJ5A 3SS9X 1SKAA 3K4HA 4F5ZA 3HKBB 2WVJA 3DV0A 1T9BA 1UOEA 2LCQA 3LXUX 3O3NB 2P9YA 3K2BA 2ZJ7A 4R5HA 4A92A 2BKUA 3KQWA 4YCLA 2IYEA 1W30A 1AS2A 3B2QA 3NHUA 4PO3X 5EUQB 1DXYA 1H5QA 2DFVA 3DXFA 3A37A 4ZT7A 5HCNA 3ZH9B 3GZNA 5ALGA 2M1ZA 3OZVA 3EXFA 4WY8A 2N9UA 1FRFS 1J90A 4RVFA 4PBSA 3AL2A 3CNOA 3SLKA 1P91A 3LIPA 1QC5A 3R3VA 4LVCA 1LPMA 2R8XA 4Z99A 1DHRA 3RVRA 1XPOA 2RGWA 1GTZA 3T3IA 1DQZA 1EA7A 5C31A 2P9TA 2VJQA 1K4KA 3ZIDA 2RIPA 3NV7A 4IUYA 5AR1A 1BMTA 1R0KA 2ETXA 5CITA 4J16C 4IFIA 1ITZA 1FY2A 1TC2A 2ORWA 1JMKC 4OYLA 3FAZA 4TS1A 4ZT4A 2IUUA 2ZM6B 3MFQA 3QMPA 3QHPA 4NCHA 2IUYA 4EK9A 3RVPA 3K70D 4A2PA 3GMDA 5HQJA 2O2HA 3FNGA 4HQRA 5LKAA 1TM7E 2Q4BA 4FKMA 1RLMA 2HIHA 3P26A 5AVOA 3QBVA 1C7ZA 2HL6A 4OFBA 4O4LF 4B76A 5AW7A 3CKKA 3GCDA 3JQ7B 3E9YA 1FNSA 4KWEA 1TL7C 1SEVA 5FUYA 1WCV1 3AFHA 5REQA 2RGDA 1PNQA 2IEGA 4D74A 4EGQA 2F1OA 4EO9A 3GAZA 4LYEA 3S55A 5HS4A 1E0JA 5ALIA 5JBIA 3IOYA 1NF9A 1ZJ5A 4ZDIA 2NYVA 4WN9B 3WAGA 3C6XA 3VZSA 2RE8A 4P4LA 1XEXB 1MJFA 4L3WA 1CP2A 1DKOA 4UTZA 2HDHA 1JKFA 4BZZA 5L8VA 3RVLA 2WR8A 1DIOB 1KRHA 1A9OA 2XMDA 3NCHA 3KD2A 3O82A 3VR4D 5DE3A 2ZDQA 3GFQA 4ZOEA 5D5HA 1NUQA 4X41A 3P52A 1RWQA 3TOSA 1FUYB 1M72A 4DLPA 1RZRA 3AVVA 5DYWA 1B42A 2NZWA 1UXJA 3BK2A 2PQMA 1GQYA 2C0PA 4PGFA 1YQWA 2O5VA 2PMFA 2V3WA 1HBJA 3KL2A 2P4HX 2C83A 1NPYA 3K5PA 3VR3A 3G1UA 4FINA 3EVGA 3ACCA 4OQPA 4EL0A 1N7GA 3MPOA 1FJHA 4AG3A 3EVZA 3SYTA 4LKRA 1KI6B 2CCGA 1K5HA 1P8AA 1VIAA 1H5UA 2M6RA 2HADA 2XMQA 3KKKA 4G25A 4EB6A 4RH3A 1LBIA 4GL4A 1LBQA 3UO8B 2B0JA 3HADA 4XD7A 3ZU3A 5JPCA 1V6SA 1Z28A 3QMWA 4B4VA 4ZDKA 1GY8A 4G26A 1YA4A 3EZXA 3NTRA 4UZEA 2O0KA 1UWLA 3VNQA 1X70A 2VJMA 4IGIA 4JT2A 1KEVA 2ODPA 2C2BA 2D4AA 2ZB3A 3TVYA 4U2EA 5TNXA 5DOVA 3UQZA 4YJGA 2YJ6A 4WADA 1FP2A 5U4QA 3FOEC 1G3QA 2P78A 2JCVA 1PRYA 4GE3A 4QJIA 2IYXA 3AETB 4RV5A 4UVDA 5I7SA 2J6IA 5ARDA 5CDGA 1VLQA 3BTUA 3KQNA 4R2WA 3WP0A 3K6RA 4QTYA 2P1RA 1Z18A 4X6YA 1F5SA 1P6QA 1JZQA 1PG2A 2X7XA 5DCUA 2C4NA 2MSCB 4FQ5A 1STOA 4R1SA 5KO2A 1E89A 2ZULA 4Q03A 4NFSA 3JVDA 3CX8A 5BSUA 4JX8A 3MT7A 4O2BA 4G8DA 3TPCA 1LZKA 4YQEA 2IH4A 1WRBA 3IRVA 4S1NA 4Z4IA 5J43A 2GPTA 3CA8A 1M54A 1N0IA 3FNBA 4ENTA 1MB9A 1CHNA 1VBKA 3OUZA 1A1VA 4R2JA 5FWYB 5JMPA 4G0WA 2HH9A 4I8XA 4DYVA 1HTWA 2NUPB 3R7AA 2WLSA 1TLTA 4MV0A 2WTMA 1V4BA 4CM5A 3HK2A 1V7QA 4JVOA 2CL5A 2FK7A 3EF3A 5CLLA 3HTXA 2GZRA 4H3SA 4YI3A 1J8QA 3QI7A 4WFIA 3K6KA 3KDSE 2BUAA 4C0BA 4JUAA 3WGMA 1UBKS 1TW3A 4DIUA 2QTVB 1XXHE 2QAGB 1T2VA 4FFLA 1KY3A 4ZQHA 1XTPA 1QG2A 3ROGA 4EGJA 3G9TA 4D8WA 3QF4B 1EWQA 3AH8A 2G9ZA 3DLAA 2GBLA 3EIXA 4P8RA 3A1DA 5CA1B 2W43A 2PT5A 3KZMA 1YE5A 3I9MA 5LBTA 2IHKA 4BRUA 4WJLA 4AS1A 1TFUA 4OUKX 5EKDA 4EJ0A 2PT9A 1DKQA 1CQJA 1TEVA 3PC7A 1U2QA 4LYDA 2Q7XA 3VPAA 3ZC3A 1TEHA 1L7VC 4E2WA 5LQNA 2HTFA 1IPHA 4QDOA 3WIDA 4MUAA 3QUBA 4U8HA 4ZC1A 2QL5A 1DT5A 4IDQA 4MYCA 4P33A 1FFDA 3PJGA 2AIRA 3BRWD 3NXSA 3CPEA 4NBTA 5AK3A 5HS6A 3EGCA 3UENA 3VYSB 4B44A 3RS0A 3SEAA 1UOOA 2PR2A 4D3XA 2E7ZA 3VH4A 1R00A 3HVKA 1HFWA 1Z37A 2HT6A 2JIMA 2X77A 4ZGBA 3P0RA 2CFRA 4ZC8A 5FWNA 5DSTA 1GARA 3AEUA 5KKNB 5L7YA 1TT5B 5CGQB 2DAPA 4M0PA 4R0NA 4RIGA 1IN6A 1ESDA 1A7JA 1DX6A 5FBKA 2ZAOA 5FOUA 1QK3A 4UDOA 1ZGAA 3P2OA 3MINB 4WFQA 5I5EA 2CYAA 1I01A 4G8CA 2AR7A 3AP1A 4GM0A 1E1KA 4RO0A 4UBLA 2ZSJA 5IAEA 4ZO9A 2HJGA 3TLJA 1AGNA 1N2SA 4L8LA 4D57A 4C5AA 4Z0PA 2E1PA 5LDHA 4U6NA 2IOHA 3HC7A 1QRSA 4GG1A 3FUVA 3R9XB 1ISGA 4FMDB 4XB2A 4MS1A 1K9SA 3FCUB 1RE0A 4N49A 5A3JA 1RQLA 3I53A 4UBIA 5EWLA 4CCAA 3D6FA 3DV9A 2FDRA 3H5RA 3SQNA 4EGFA 2GEVA 2P77A 4KUEA 3T3HA 3S28A 4COKA 3S8YA 4DR3B 2P6RA 2NV2B 1YFZA 1D2EA 3FMIA 4I4TA 3D1JA 2XWJI 4O4HA 3ZBQA 1LTQA 4CIYA 3F2VA 2V6BA 1EVEA 3THOA 1JEDA 1RWOA 4G1EB 2CT8A 3GRYA 4W5WA 1USVA 2WUDA 3HY6A 3UMGA 1GU7A 4PPFA 5KNCD 1C4WA 5IUNC 1SZCA 3L1KA 2NXCA 2RHGB 2BHSA 1DBSA 2VBGA 2H4ZA 3H05A 3MAJA 4XYGA 1O97C 1XJWA 3FA2A 4HN9A 1Y8QB 2PLNA 3H2HA 4GSYA 1D2CA 1U2DA 1N77A 1C7QA 1FBNA 1G9SA 3K1YA 3RFTA 5FI5A 2W2VA 1KK2A 2UVQA 1GDHA 1GKIA 3TDNA 4G63A 3P9KA 2HLDA 1NSFA 4Q18A 2E21A 4H1VA 2HRQA 3UOAB 3C45A 2WJHA 3QTBA 3SOPA 1SCDA 2RHOA 1N32B 2ZIEA 2FOXA 1GZHB 1GSAA 1GSHA 1DX4A 1R1DA 2G8NA 4XQ9A 3OURA 2VYND 2ZE8A 3QF7A 2C9ZA 3QP9A 3VZPA 1A5TA 1SGWA 3LLUA 3A36A 2H65A 3QFTA 4RQAA 3N0RA 2Q3CA 4WY5A 4YJFA 1C3EA 2FQ1A 1QHNA 4DA8A 3RFUA 4PINA 4DLVA 4D9KA 3C8ZA 1FSPA 1W36D 1K1EA 1OFVA 2UV8A 4ZOLA 2XT9A 1Z38A 2XMPA 2P9JA 2ZPUA 2PXXA 4LXTA 4DSZA 4KR7A 3H5LA 4GAEA 1IMJA 3EPHA 4KLAA 3AG6A 4I14A 1U94A 4AJ4A 4G0NA 1I9GA 1W75A 5ITZB 1VHDA 3X1KA 4MVJM 4K28A 1MOSA 3RVMA 2BHLA 1QQTA 2WINI 4MXDA 4MW2A 5BW5A 1N2XA 2Y1WA 1HKHA 2N0SA 3EJ6A 3AO0B 2PWAA 3BWXA 1N8KA 1YCFA 2ZSKA 4XEHA 3VNAA 3ZJ5A 4H0FA 5CJJA 4CLXA 1L5YA 4PIVA 1YZUA 1KHTA 1L4GA 2P68A 2IEDA 4TXMA 1KL7A 2HY7A 3NRJA 2F3SA 3HUTA 2O8DA 2H51A 1KEKA 3FRHA 1NMYA 4M9RA 4RTSA 1L5LA 4B0PA 1AMUA 3S2FA 4LOIA 2H59A 2QTBA 3DDZX 3FKSD 2CDNA 3NT4A 1ATZA 3EAFA 4OHYA 4FYJA 1ORDA 3E3LA 1ZHOA 3ENNA 4LHVA 5ICFA 4FU0A 5BURA 3EEFA 2R3SA 2W2KB 1I0IA 4IF6A 4M55A 4P5EA 5AI4A 4TLLB 4LVOA 1ABFA 3COVA 4FK8A 3TD2A 4OHVA 3WWEA 2QTLA 2WAXA 4B74A 2OCGA 4B81A 3EWNA 4R31A 2QG9A 2O2JA 4JUDX 4K86A 3ELDA 3SJ7A 2IHTA 4OI0A 1EG7A 1TM4E 1USKA 3GD7A 4L08A 5L3QA 2PYIA 1QDEA 1BW9B 5EP4A 3ZBUA 1YRYE 2WT8A 1XRJA 2CNWD 2D13A 2H2AA 1JAYA 3BFVA 4LK3A 1GQSA 4ME6A 4OLJA 1QPGA 4NXNB 1DXQA 1Q6YA 1Y4SA 3PXBA 1ZINA 1GP2A 3AUKA 5C0OE 4AMZA 1WZNA 4DEYA 2O54A 1OAAA 2PWPA 2YNMD 3DC7A 5K0EA 4HP8A 3V6MA 5K4AA 5EXEA 3ZZ0A 4Z4QA 1D4OA 2XVZA 4RIHA 1VXRA 4J0CA 4POOA 3TZKA 1D1PA 2X8JA 4KJZA 5TEVA 1YIDA 4DBLC 2OBYA 3VOAA 4B3TB 1I6WA 5BR8B 1B3RA 3VNSA 5C1BA 2IYTA 2BR3A 1O57A 3QPCA 4JLAA 4QAQA 5E1OA 4BASA 3OM9A 5LNK1 2VHCA 4CDNA 2QM7A 5CA1F 3F7OA 4IDPA 4J07A 5MGNA 1XCOA 3UK2A 1JG7A 2QY6A 3VTAA 4AZ0A 3HEBA 3FF1A 2RGCA 1YQTA 1CUVA 4P4UA 5JECA 4PZ9A 3LBYA 4NEHB 1Q83A 1J1UA 1PQUA 2WQZA 3KOUA 4R1MA 5I7WA 1KWKA 4BBAA 2L82A 4UARA 3K0HA 2H4JA 1V7CA 5K8IA 3FNIA 4BUJA 3UAGA 1EXDA 2R6HA 4C88A 1G9TA 2C5HA 1OHHD 3ESAA 4C0AC 5AVWA 1G0OA 3SQDA 2CB9A 1UFQA 3HYLA 3COZA 3K31A 5G1OA 5BWLA 1XCGB 3A7EA 1SXJA 4X8LA 1ESEA 3BD9A 3ZNOA 3C97A 1XNJA 4DYDA 4QBKA 5JJ5A 2XVAA 2BGMA 1QFXA 1IBRA 1VG8A 2J4DA 3R3UA 1D9XA 3BMQA 2GH1A 2C5EA 4LNAA 4CGZA 5AW1A 2VDRB 3BCSA 1XTZA 3LFUA 4JYZA 1SXQA 2RCNA 2EFGA 3K35A 3COJA 1GL3A 4LOLA 1JXAA 1SIUA 2H48A 1YAHA 1P44A 1E2MA 2H1VA 4U9UA 4GWGA 2OCLA 5A4DA 1PNOA 4YP7A 4V0OA 2WTBA 3ROKA 5DBFA 3TQIA 2B36A 5AM2A 2IKQA 3W2FA 3HH8A 3JAKB 1G7SA 4MA5A 5EYPA 1U81A 1BWSA 1ZEMA 3M9XA 4GP7A 3V4FA 2WM8A 1HYBA 4RTPA 2NV6A 4ZEMA 3WWPA 2PL3A 2BDTA 5U1PA 3KUUA 1ZH4A 1ZSNA 1PQYA 1Y7PA 1LW6E 5M34A 2V6FA 3BIOA 5LLDA 4L9SA 4X8MA 4QPPA 2QRVB 2JI9A 4CV1A 5HZKA 4GE0A 1RWPA 4L3VA 2I29A 1Z35A 1VL5A 2C00A 1F2TA 1P3JA 2VJKA 1XMJA 3MBKA 2D5IA 3QVJA 4CDRA 1HFJA 4DEXA 3WSVA 1O03A 3K9BA 3SHTA 3W5BA 3DUFB 4IEFB 5B7PA 4F6LA 2CWWA 5DBEX 3L8GA 3MXOA 5BV2P 3GFFA 2QW8A 3PHCA 4L7VA 3DF7A 2AX4A 2JZNA 2VP9A 3O93A 3U5TA 3TLGB 2DFNA 3V9AA 2CFTA 2GQ0A 1X92A 3M6WA 5K1ZA 1JFTA 1ZGHA 4JH0A 4RF5A 2BAGA 1BH6A 1NMXA 2KM1A 4HTFA 4K5QA 4LXXA 4EW1A 2QPTA 2PLAA 4OV6B 3RQIA 4Z4CA 2A8YA 3UKDA 5DTEA 4LE2A 5KYGA 4BQEA 4LF5B 2HWWA 1RXSA 2HRBA 1WM1A 4KXYA 2ZJ8A 3DTTA 4J0IA 1N5LA 4UBOA 1FU4A 3UIEA 4QGAA 2BFNA 4WNYA 3TOCA 2OD2A 3GGDA 1OBOA 1V1MA 4GLJA 1PD1A 1YR9A 3ADOA 4HNTA 1RYNA 3GB9A 2CLDX 5A02A 4IH1A 4B83A 3OM8A 3A1UA 3GDGA 1NVDA 3T7EA 4Q6WA 1RRVA 1PR9A 3T3PB 5CX1A 3U5ZB 3K30A 4C5BA 5CM2Z 4D4GA 1S89A 5FWDA 3EGDB 3UPDA 1PKEA 1IOVA 1E3LA 3MTQA 2GLXA 3LTNC 1A9XB 1RI3A 2Z2KA 5D5QA 1E2LA 4QECA 2AD5A 4LSMA 5TPWA 3U60B 4MNTA 1TO1E 1Y9JA 2HFJA 2JGNA 4AJHA 1UANA 2R85A 3IDAA 4ZWNA 1C9EA 3CZAA 2O6HA 4PZAA 4G89A 4H6VA 4BNDB 4YQZA 4ZVUA 3U3DA 1JBKA 3IB3A 1KWGA 1QE5A 1ZVKA 2D62A 4DAOA 2C5FA 2G04A 2GYUA 2Y4NA 3GDHA 2IEZA 3O7MA 2ASVA 4RADA 1TYAE 3Q3EA 4UPEA 4JFRA 2P6PA 3GP5A 4JV5B 5LC1A 1M1YE 4HRVA 3ADBA 5EHGA 4FB5A 3X1MA 4RJ2A 5DNAA 3W7AA 1NXWA 1DS6A 3F1KA 4INOA 3TDKA 4OU4A 2EWMA 4IIHA 5DT2A 2H07A 4QNNA 2ZI3A 3WGIA 2WHRA 3R3JA 3INRA 4Y67A 1ISHA 4OI1A 3KJEA 1EDZA 1U9ZA 1A95A 4R16A 2JAUA 2O2YA 4F3YA 1T6XA 4WFJA 3LK7A 3UWSA 3ZIAA 2PKQP 3D8TA 3SC4A 4LNUB 1V96A 1V26A 3DTVD 4BIIA 3KR2A 3OLVA 3V55A 1E6KA 2Y4OA 2OG2A 3LA6A 1CUCA 4E5YA 3KOWA 4JJKA 3ZGXA 5F23A 4R9SA 1TJ4A 1W59A 4MGZR 5T4EA 3ON5A 5I9NA 1EM8A 4WXEA 3CRQA 3TSZA 1N5KA 2R87A 3WBKA 1I2AA 2Y1GA 3LC2O 1A3CA 3O8OB 5LXTB 3ZN2A 3CYFA 4YV7A 5AD1A 1GR0A 3LDHA 3O8BA 3WWZA 3TFWA 2XVMA 1XTKA 3GMSA 2BGGA 2IZ0A 3DAGA 4O4JB 3LRTA 3QEJA 2BMJA 1P45A 1YDGA 2LE0A 2ZSIA 3LJKA 1K6JA 3O3MB 3EDMA 4BB0A 4ENRA 4CEIB 3U37A 2QVXX 2CF5A 4ML3A 3CF0A 3ZYCA 3CRRA 4KQ1A 1POXA 3QBEA 2QBYA 1Z75A 3KYDA 5EQTA 3VOTA 3WIEA 1PTKA 1RWBA 2O8BA 3LG2A 1XVLA 2OGTA 3PFHA 5F9HA 5JRDS 5J4KA 5EINA 2J3LA 1ZO8A 2V0CA 3P2JA 3W2HA 1CQIA 4BBZA 2XKAA 4XYLA 2RHWA 2HBQA 1RXIA 1VDZA 3T41A 4EITA 1T8TA 5DLDA 3AFOA 1Y9DA 3KBOA 3WLMA 4ZI2A 4AP6A 3S29A 2O8NA 2DCUA 3WOVA 2PEZA 4JQYA 4I3GA 2ZRPA 4DY6A 1WQ3A 5JLJA 4EYEA 4J2OA 2ERCA 1SXJE 1VPEA 4K88A 3PXXA 5IABA 4Q4HB 3U4DA 1KEPA 3O8NA 5AW9A 1Y5LA 4CFSA 1A8UA 4HEQA 4JYAB 2AN3A 3HB5X 1OFUA 4ZYXA 2CHEA 3IEIA 5G40A 4BLUA 1AQJA 5JDCA 2ATCA 3H2KA 1TRKA 4F11A 2H1HA 4Q5IA 2JS7A 3C16C 3ZI4A 1U8ZA 4K26A 3MCVA 1H2AS 4N6GA 3VSBA 2F2TA 4W5RA 2EX4A 2P91A 3KQVA 2HK7A 1KIMA 2FUG1 4DMUB 1MKYA 2HGZA 4WERA 3I37X 2PUFA 4XWYA 3L4JA 1T0PA 1ZHFA 2HU7A 2Y1CA 4CODB 2QN1A 3NWJA 2VNSA 2REQB 4JI4B 1GYPA 2GCOA 2OLEA 4N9WA 1SG6A 1ZU5A 3R6GA 5EI5A 3L40A 2NSLA 4F5YA 1IDOA 3OHMA 4URWR 3TNFA 1FFSA 1DADA 5A9TA 5GTDA 2VHTA 3AUTA 5J3JA 1RYBA 1SD5A 2VH1A 2Q9AA 2XOKA 4KODA 5FHQA 1F2VA 3IPRA 4HDKA 1K6XA 1WXDA 1TZ2A 2AFHB 2OKGA 4LJYA 3FPEA 4C4ZA 2EP7A 1D2MA 1PQ4A 1CZKA 2FPIB 2ZZKA 2UUOA 3FSGA 2ZVQX 2ZSAA 4GHWA 4BO6A 2QGNA 3L8EA 1XFDA 4WQMA 4AP5A 2QU7A 2PJDA 4C0XA 2F00A 1XZIA 2RAPA 3CF2A 1R4MB 3AJRA 3VYTB 2PV7A 1O58A 3DBIA 4P92A 1ODSA 1SVNA 2IE0A 4RVGA 2YJ4A 3NNNA 3WGOA 2D54A 4BMOB 3PL5A 1LGYA 3KRTA 5B53A 3VO2A 1ZYUA 1JHDA 2YMQA 3S1SA 4PLVA 1NXTA 3FHTA 1VCNA 3V4PB 1O0SA 5IK2D 1V3TA 4JP1A 1Y3IA 5FPTA 1R37A 1DRWA 1KU0A 1ZM4A 4OSPA 4KWTA 1PK8A 2RI0A 3DOHA 4WDRA 2J4CA 3CX7A 4GRDA 2F8LA 5DFAA 1ZUNA 4EG1A 5B1DA 5MN6A 4GBMA 5HQTA 2AK3A 3MGGA 4FS3A 1M1NA 3OLQA 3PKIA 4JYCA 3OTHA 5AJHA 1WKVA 4G86A 3RRXA 4Z51A 4YK7A 4NV3A 2Q7DA 4QXAA 2CCKA 3VR5H 2D1SA 2DFLA 2W9XA 3W9YA 4BGUA 4QUBA 1XEWY 3MWDA 5E2IA 2P69A 5J1TB 3RC1A 4ZTBA 4QTXA 1NLMA 2YS7A 3KPWA 4P93A 3ANLA 2XYQA 4BCBA 4ALIA 4NARA 2UU9B 1KGDA 3VISA 2OGWA 3HHEA 1K5PA 2CZCA 3ECSA 3H4IA 3VAAA 2Q1WA 4QXMA 2PUAA 1DEAA 2A0FA 3BWEA 2YQ5A 1KC1A 4A5SA 5BSWA 1IBCA 4KTTE 2PLRA 1OWNA 4ZO8A 2W4QA 4X60A 4FP9A 3VDRA 3QKUA 4FD3A 1V8ZA 1K89A 2BEVB 2DY0A 2Z09A 3OZ7A 4QGBA 5CIQA 1ZNXA 1LF5A 3DZIA 1QTIA 2WIFA 4KIFA 2CLOB 1LPPA 3FE2A 3PNVA 3HCEA 4G0YA 4MA4A 4N1AA 3IHLA 3E53A 1IJKA 1H5NA 2QRNA 3HBAA 2X3UA 3O92A 2H8GA 3R0XA 2B9VA 3DB2A 1UPUA 2FSUA 3FDZA 3EBPA 3NJ8A 2IHBA 4U7PB 4XXHA 2P3LA 5BT9A 4MGEA 2OK7A 1B76A 1DC8A 3DFKA 3SVZA 4QVGA 4E5NA 3HL0A 3NC4A 4KIWA 1QVVA 3D5QA 3KU1A 1HH4A 1XK7A 3ESCA 4JGGA 1MIOB 3SQLA 1H6BA 2BSAA 4GZMA 2OFPA 4U7TB 2X41A 3PE6A 1CY8A 3WYAA 821PA 4EA8A 3I5YA 4WRRA 4H17A 5GZ1A 4D25A 2AJTA 4RCYA 5C46F 4K03A 2YN2A 3L0OA 3GCXA 1LNSA 2EZ8A 5KC9A 3QENA 2VTVA 3F6SA 3GA5A 3LP8A 1W8DA 1SCUB 3D7MA 2JPDA 2ICAA 3UWMA 4Q7QA 4FXOA 2XAAA 4PX9A 6ADHA 1MEJA 4JLWA 3PVCA 2YY7A 5IJWA 5LDDC 3IL2A 5ELXA 2RGBA 1UFRA 2DJIA 3ABOB 4Q9LA 5G0VA 4A27A 5AIBA 3ZX4A 4CKWB 3IBCA 5EWJB 2A0WA 3WK6A 3OMLA 5BRAA 3B1JA 3V1KA 1HE8B 1FX0B 5BNFA 4HC4A 3FSRA 4HO1X 1NBMD 1TU3A 4IXWA 1A76A 3ZNQA 4P4SA 3NFYA 1TZJA 3EASA 4M8NE 3U49A 4TTIA 2IXDA 3KEGA 3M3PA 3W5AA 3AHEA 1C14A 3GUCA 4M1EA 5LXTF 2BFBB 3CRZA 3JQ9C 4JB8A 4MP6A 2X1HA 4QYXA 5DNYB 1GQOA 2FWMX 4HK4A 3HM2A 3SDBA 4BO7A 3Q6NA 2QPLA 3DKVA 1OAOA 4LWZA 4O4JF 4OVKA 4PSAA 1D6MA 2FY8A 1DXOA 3P1JA 1B3BA 4DIBA 3A26A 3ZXUB 4C3VA 1Y7LA 1VMKA 4DZTA 3CUVA 2ZSFA 4GOMD 3DFFA 2FEWB 3H7AA 4JVNA 4RY0A 2WI8A 3U9SA 5CEJA 2G80A 1O4WA 4LDAA 4N0DA 5CA0B 4DG9A 4MVJI 1SOAA 3I76A 2OB2A 3PENA 4GU5A 5GM1A 4B6GA 4BKQA 1OWPA 3R41A 2Q5HA 3TSOA 1SUEA 1P0PA 1UINA 5JSYA 5FIUA 3EUAA 2A2ZA 3VPFA 5EJ4A 4B17A 4MWCA 2V96A 2EG5A 2P2LA 3LLMA 1H0KA 1OLUA 3PDUA 1T26A 2X0DA 1R6UA 4L5IA 2D1FA 3JVVA 4M22A 1I7QB 4HJXA 3KK0A 2I71A 3C5CA 4NDZA 4TWJA 1PBNA 2GNPA 2A5JA 3ADKA 2R96A 5HZGA 2ZR0A 5HNKA 2VK2A 1C9MA 2CK3D 2B8NA 3GY0A 4ESEA 1OQAA 4C2AA 2VNKA 3O74A 4PTZA 1SWVA 2CWDA 4OA5A 3I1JA 4HYYA 4DLRA 4URXR 2PZ8A 3BRSA 2O3JA 5F76A 3DG9A 1L5KA 4DSOA 3J7AC 1PT8A 3KVVA 1KH1A 2UAGA 4P7GA 4YCSA 2PMDA 1QGZA 1OREA 3W5DA 3OMWA 4F71A 1M2EA 2FEMA 3QFCA 2CMHA 3CW2A 3U3JA 1ELOA 3OA0A 1A2OA 1P9OA 3CE6A 5HGJA 4TYWA 2RGGA 3JQGB 4XPIA 4YMIA 5DNWA 3SC2A 2BFWA 3TLZA 3VSEA 3WO0A 4CPDA 3ZQ4A 3G82C 4IVNA 4H7KA 1CY6A 2ON6A 2VF4X 3BQ9A 3FGPA 5FTLA 2I4OA 5F5NA 1YTUA 2PO7A 2RGXA 2ZJOA 4FYVA 4NKRA 3GX1A 3ANTA 3AX6A 4FPXA 4J4HA 2PZBA 4RWZA 5JSFA 4KO8A 4M86A 1EK1A 2XKBA 1D09A 3P4YA 2I66A 3R5TA 2PQ0A 1G8JA 1O0CA 2JIZA 3WKBA 4RZ3A 4IUDS 5DBGA 3SS7X 2XT6A 5EGSA 1F1BA 3X2FA 4AZVA 3RS7A 5MFPA 1QHEA 5DN6A 1SH7A 4FOSA 1NVKA 3A3PA 4DDHA 2NG1A 1TVEA 5KAMA 4FZ3A 1Z0JA 3P45A 4BEWA 1EHIA 1H4SA 1Z4LA 3ZBTA 1WQ4A 2LIPA 1DBIA 3B2EA 3OEWA 1KNQA 4ZN6A 2GMWA 3FIUA 4MTLA 4KR2A 1U5BA 3A4NA 1ZCAA 2YCBA 3ILVA 3KAJA 4ILKA 2V7XA 3QLUA 2NACA 1GA4A 1ZXBA 3UB2A 4CLDA 1NG1A 1CJSA 1E69A 3CCFA 3SX0A 3TOZA 3KJIA 4Y2GA 3QEKA 1CJUC 2IYPA 1FQOA 4R7ZA 5FULA 5ILQA 3TZCA 2GN0A 1ONNA 4GXTA 2I4TA 3ABIA 3K72B 2NTYC 2Y67A 4JEIA 5TPZD 3WRXC 4DLKA 5GVSA 5T7BA 5ALTA 4LVUA 2PRJA 1JLHA 3PNPA 3WP1B 4HVLA 1Z6YA 2JI4A 1WG8A 4JS0A 5AVXA 2AE1A 2VDWB 2GM9A 5JD5A 3P94A 1UT8A 3DKIA 3VC3A 2AI1A 1BMFD 2O9JA 3DR3A 1KH3A 4JL6A 4G0PA 5AHXA 4MPDA 4HAVA 3VYUB 2BTEA 4B3FX 3NANA 4Y30A 1JQJC 3DVAA 4H7FA 1VYVA 3UTDA 1YZGA 2WQ6A 4E32A 4CT4B 3VQTA 4AZ3A 2NU7B 1ZD9A 2QEQA 4QKQA 2YQZA 5J9FA 2O0JA 3VI3B 2BGWA 2H7CA 2HWYA 2H1CA 2DUMA 3U0VA 2H1WA 2YUTA 3VVLA 4D9CA 2ZATA 4NK4A 5IVHA 1SBZA 3CZMA 1PFWA 3LMKA 4F2WA 3WICA 1I4EB 3IUEA 4NJMA 4RD6A 1WETA 1RWKA 5ECYA 5ESWA 3FMVA 5FHRA 5I9TA 1LDGA 4DTCA 3AW8A 4TPKA 4TV8A 4BO1A 1VFPA 3KEQA 3SEQA 2ZT6A 3L2OB 3BIFA 4XKJA 1FP6A 4ZYWA 1W5BA 3V4SA 1VMDA 2A78A 6LDHA 3E03A 3I9JA 4JUCA 2CUZA 3TG8A 3O1IC 1OBFO 4IY1A 1UXHA 4HBZA 1JNYA 3K9FC 4GC5A 4YREA 3LGAA 3T9CA 3UA3A 4MQFA 4S1TA 2TMGA 2OD9A 3Q98A 2KB0A 2PU5A 3BSFA 3BVPA 2DF8A 4OJNA 2OSBA 4CMCA 4F91B 5A62A 3CVUA 3NFRA 4ZJUA 3ZJ4A 1O08A 4BJ3A 1JSLA 1T0JB 2GWHA 2QA5A 3HVHA 3G23A 2B37A 3M5WA 3TW4A 3IIMA 4JL5A 3HYRA 1GAQA 2XPCA 2FFJA 3WLTA 4HUTA 4H60A 3VHLB 3MWKA 3FDJA 1RMQA 1UZMA 1XZDA 4OQDA 4EP1A 3AUSA 2OGZA 3FW1A 4YJ3A 1FCJA 3OQPA 5E7MA 4L1KA 2OVBA 5EIAA 3GO4A 3TZEA 1FLDA 3QLTA 3FUXA 1IVNA 4RHUA 4B6JA 3AP2A 3IHWA 1XA4A 2P9BA 1M2GA 3CNNA 4OMCA 1Z4MA 5FTWA 3SWWA 1W93A 1QJCA 1DELA 4KACA 3KOYA 4NU6A 4DCTA 1DGQA 1X1DA 3IFSA 1UDAA 4NG5A 4GXRA 3U1BA 1G8HA 3EQ9A 2PMEA 3AQIA 1IG3A 2IP2A 3N1UA 2B4AA 3OESA 4DQUA 1OFHA 5FADA 2H7XA 5A6SB 4IRMA 3LT0A 4I8IA 3AEYA 2C96A 2G40A 4XSGA 5AK0A 3I28A 5HF8A 3LLVA 1UPXA 2WM9B 3CJRA 4HAUA 4PGAA 1ORVA 1PSZA 2H2WA 2UZ1B 4GF5A 4MRMA 4QYSA 3SKYA 4AJNA 4EYOA 5KSZA 1AKNA 3WFJA 3BIWA 4DBZA 2ZRDA 4UVGA 1H6DA 3F7NA 4Y2UA 3UMCA 5CA0F 1U7DA 5TV2A 3USCS 1LS1A 1K6MA 3OEEA 1T2FA 4GZLA 4E07A 4A15A 3HYCA 4CMKA 3SQOA 3V7WA 2ODAA 5JD6A 1J00A 3TL2A 1QRAA 2IJGX 4B46A 5U9CA 1M2FA 1EFLA 4Q3KA 1YASA 2FW6A 3DE7X 4O2RA 4XARA 2HJVA 3LDGA 4Y6QA 3BGSA 3WJ1A 2WSMA 2R00A 3DBHB 1EVLA 2QIPA 3FFTA 3I0MA 1MABA 3QELA 1SHUX 3CHYA 2RBEA 2AI2A 4OIFA 1NZFA 1Q20A 3GEHA 4XIGS 1G7TA 1OPXA 3F3MA 4F5EA 3AJ9A 4KPYA 1VHWA 2YWBA 3ANMA 1W5SA 3BHNA 3TRHA 2H17A 4D8VA 1GPAA 3Q15C 4BVJA 5LQSA 2XSZD 2XWQA 4FCCA 5EJ7A 5KYNA 4UCWA 1H42A 4C2UA 1IB0A 4HGYA 1ATIA 4WJKB 1FDWA 5KNDA 5AW6A 1J23A 4KQJA 1MGPA 5DO9A 1J70A 5FL7A 4YT4A 4KPEC 3E23A 3ZKWA 5JTTA 3RK4A 3HACA 1KKLA 3IQIX 3TMAA 3WYBA 4DLTA 2Q50A 3KKQA 4ZI7A 3PZRA 5BMVA 1ADBA 1F3LA 1RRGA 3QW2A 1I3CA 3OIWA 5J5AA 1RQPA 4CV2A 2O7RA 1W85B 1N9ZA 4WK0B 4X90A 3IV9A 2R1ZA 4UVIA 3S1LA 5EHZA 3IODA 5DEIA 2FPGB 4PTYA 1T0IA 1ZIYA 1I0LA 3PUIA 2GPWA 1W4CA 4D46A 2Q2OA 1U6IA 2BGIA 1E9FA 2NAFA 4RD4A 2PFSA 3D4IA 4DM4A 1K9VF 1L7EA 4UHJA 2FAXA 3UVEA 2JLAA 1HQDA 3NASA 3NDBB 1BN6A 3ILYA 3VR3D 2K2WA 2Q6IA 4B3IA 1BDJA 5DXAA 3IOBA 4CLRA 1W6UA 3GGOA 4GUAA 1YRAA 5KYYA 4MR8A 2D2XA 3ES9A 4Y2YA 4FE4A 2CLCX 1CY1A 1QONA 3EFHA 3HJTA 3GVPA 1DPGA 3O94A 4R9RA 3JX9A 5AQEA 3EMBA 3JYNA 3U16A 4OFZA 1NBHA 2HRZA 4A2CA 3C5WP 1HYEA 1T2UA 4RJKA 1XXHB 1ADYA 1P4SA 4KPUB 2B5VA 2O7QA 4C0QC 5ALVA 3GEMA 5KNBD 1FP1D 4TKVB 1XTTA 3H0KA 4MGKR 4UNQA 3NTOA 2Q6KA 5LB2A 1DKUA 1PGOA 2CL6X 3NORA 2YX1A 4GWLA 4MIKA 2BHTA 2XGGA 4PG6A 2AN1A 3GZTB 4OQXA 3WYGA 3RFFA 1NVWQ 4U63A 2I3AA 3QZUA 2RK6A 3UCFA 2CV2A 4UASA 4I4IA 3OFVA 4D42A 5KQMA 4IDEA 1I33A 2DU8A 2RB4A 2VCHA 3HI4A 3INGA 3L4BA 5BQFA 4UMVA 4GQBA 4UATA 1P81A 1VBNA 1II9A 1W49A 1U2RA 2ZGVA 1KQNA 1NX6A 4QOJA 2XYVA 1BD3A 3GD5A 4YJHA 4D0SA 4ZVQA 4Q4CA 5JXWA 1Q12A 3KLBA 4KLZA 1B15A 1C8BA 3OQ6A 3UMBA 1BU5A 1YJ8A 1CFJA 1NQVA 1RCFA 2V97A 2QI9C 1E9AA 1Z6QA 3HU2A 3T7AA 1M6WA 1R66A 2AFRA 2ZJYA 4UM8B 2PS9A 1W9HA 1VXOA 1J42A 2YVAA 1IAQA 3LAWA 3NI2A 4ARZA 1SVUA 2CUTA 4L95C 4EGCB 1X7ZB 1B8UA 4CKCA 1TVKA 2OP0A 3RT7A 2X1VA 5H3LA 4RTLA 4PRKA 3B7WA 4UEQA 1VM6A 2R6CA 1YULA 2P6NA 2F3QA 1PW5A 1SIWA 1TTPB 1SUFA 2ZI5A 3CB2A 3TTVA 1ZGJA 3PQDA 3ZTYA 1AS0A 5HG0A 4E5KA 1WU7A 2VF8A 3AWIA 4W7IA 3TIGA 1IZZA 1PR6A 3KJFA 1MTOA 1KIFA 1WSWA 1FDRA 5CCBA 3SSAA 4RVOA 2FF7A 4RH1A 2XADA 4KVZA 4U6QA 2NZXA 1T8SA 1THGA 3R8CA 3HGTA 4HXYA 1T6NA 1ZOSA 2I67A 3GZNB 1R10A 1TJPB 1GUFA 3EXFB 1Q91A 1WV1A 3JU3A