1VHYA

Crystal structure of haemophilus influenzae protein hi0303, pfam duf558
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
245
structure length
241
Chain Sequence
IPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELADKESHLKIHLGQVIRMEFTIQKSVELGVNVITPLWSERCGVKLDAERMDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRVLRTETASLAAISALQICFGDLGEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein HI0303
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 73
structure length 241
sequence length 245
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 1vhyA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1vhyA02
2QWVA 4H3ZA 4YVGA 4YQQA 4YPZA 4YPWA 4E8BA 1GZ0A 4YQ8A 3QUVA 4KDZA 4X3LA 3BBDA 4XBOA 1VHKA 3DCMX 1VHYA 1UALA 5FAIA 3BBHA 3NK6A 1Z85A 4YVHA 2EGVA 3NK7A 2YY8A 4JAKA 3ILKA 3O7BA 4MCDA 4YQ6A 1MXIA 4CNDA 1IPAA 3IC6A 4YQKA 4JALA 4YVIA 1UAKA 4YQ1A 3GYQA 4YQ3A 4J3CA 3KW2A 4YQ0A 3AI9X 4RG1A 5D9FA 4YVKA 3E5YA 2NWAA 5GMCA 1ZJRA 4MCCA 3OIIA 4YPXA 4YQSA 3L8UA 2QMMA 4YQCA 4YQTA 4YQOA 4YQNA 4YQRA 4YQIA 3OIJA 4YQLA 4YQAA 4YQ2A 2HA8A 3N4JA 4YQBA 4YQ4A 4YQGA 4KGNA 4CNGA 1P9PA 4YQ9A 4H3YA 4YQPA 1NS5A 1VH0A 2V3KA 3IEFA 1UAMA 3AXZA 2EGWA 3KTYA 4PZKA 5GMBA 4YQ5A 4CNEA 3OINA 3KNUA 3AIAA 1X7OA 3BBEA 3ONPA 2O3AA 1X7PA 2CX8A 4MCBA 2I6DA 1K3RA 1V6ZA 4YQJA 1OY5A 3N4KA 4X3MA 5GM8A 4YQ7A 1J85A 4YQDA 3KY7A 4IG6A 5CO4A 4FAKA 2Z0YA 4YPYA 1O6DA 1V2XA 4L69A 2V3JA 4CNFA 4YVJA 1NXZA 1UAJA 1TO0A
chains in the Genus database with same CATH superfamily
3J7ZV 2QWVA 4H3ZA 4YVGA 4YQQA 4YPZA 4YPWA 4E8BA 1EXDA 1GZ0A 4YQ8A 3QUVA 4KDZA 4X3LA 5DM6S 4H4KA 3BBDA 4XBOA 1VHKA 4JYZA 3DCMX 1VHYA 5GAHW 2ZJQS 2RE8A 1UALA 5FAIA 3BBHA 3NK6A 1Z85A 4YVHA 2EGVA 3NK7A 2YY8A 4JAKA 2HZ7A 2PI8A 1QRUA 3ILKA 3O7BA 4MCDA 4YQ6A 1MXIA 4JXXA 4CNDA 1IPAA 2G6GA 3CF5S 3IC6A 5JVHS 4YQKA 4WF9S 4JALA 4YVIA 1UAKA 4YQ1A 3GYQA 5JVGS 4YQ3A 4J3CA 3KW2A 4YQ0A 1ZJWA 4JWFA 3AI9X 4RG1A 5D9FA 4WCES 4V194 4YVKA 3E5YA 2ZJPS 2NWAA 5GMCA 1ZJRA 4MCCA 3OIIA 1QTQA 4YPXA 4YQSA 3L8UA 1D6KA 4H3SA 2QMMA 4YQCA 4YQTA 4YQOA 4YQNA 4YQRA 4IOAS 4FMWA 4YQIA 3OIJA 4UY88 4JWGA 4YQLA 4YQAA 5DM7S 1EUQA 4YQ2A 2HA8A 3N4JA 4JWJA 4YQBA 4YQ4A 4YQGA 2GAEA 4KGNA 1FEUA 3CZBA 2ZJRS 4CNGA 1P9PA 4YQ9A 5GADW 5HL7S 4H3YA 4YQPA 1NS5A 1VH0A 5GAEW 2V3KA 2PNWA 3IEFA 1UAMA 1B75A 3AXZA 2EGWA 1QRSA 3KTYA 4PZKA 5GMBA 3W2VB 1GTSA 4YQ5A 4CNEA 3OINA 3KNUA 3AIAA 4WFNS 5IZNA 1X7OA 3BBEA 3ONPA 2O3AA 5GAGW 1X7PA 2CX8A 4MCBA 2I6DA 1K3RA 1V6ZA 1EUYA 1GTRA 1NYLA 4IOCS 3PIPS 1OY5A 4YQJA 2PICA 4WFBS 3W2WB 3N4KA 4X3MA 4IO9S 3X1LB 4U67S 3PIOS 4YQ7A 5GM8A 1J85A 4YQDA 4P2BA 1DFUP 3KY7A 4IG6A 5CO4A 4FAKA 2G5DA 1UDXA 2Z0YA 1O0BA 4YPYA 1O6DA 3AIIA 4JXZA 1V2XA 4L69A 2AE0X 2PJJA 2V3JA 4CNFA 1QRTA 2RD2A 5BNZA 1O0CA 4YVJA 1NXZA 4WFAS 1UAJA 1TO0A 3DLLS 4JWHA
chains in the Genus database with same CATH topology
2QWVA 4H3ZA 4YVGA 4YQQA 4YPZA 4YPWA 4E8BA 1GZ0A 4YQ8A 3QUVA 4KDZA 4X3LA 3BBDA 4XBOA 1VHKA 3DCMX 1VHYA 1UALA 5FAIA 3BBHA 3NK6A 1Z85A 4YVHA 2EGVA 3NK7A 2YY8A 4JAKA 3ILKA 3O7BA 4MCDA 4YQ6A 1MXIA 4CNDA 1IPAA 3IC6A 4YQKA 4JALA 4YVIA 1UAKA 4YQ1A 3GYQA 4YQ3A 4J3CA 3KW2A 4YQ0A 4JWFA 3AI9X 4RG1A 5D9FA 4YVKA 3E5YA 2NWAA 5GMCA 1ZJRA 4MCCA 3OIIA 4YPXA 4YQSA 3L8UA 2QMMA 4YQCA 4YQTA 4YQOA 4YQNA 4YQRA 4FMWA 4YQIA 3OIJA 4JWGA 4YQLA 4YQAA 4YQ2A 2HA8A 3N4JA 4JWJA 4YQBA 4YQ4A 4YQGA 4KGNA 4CNGA 1P9PA 4YQ9A 4H3YA 4YQPA 1NS5A 1VH0A 2V3KA 3IEFA 1UAMA 3AXZA 2EGWA 3KTYA 4PZKA 5GMBA 4YQ5A 4CNEA 3OINA 3KNUA 3AIAA 1X7OA 3BBEA 3ONPA 2O3AA 1X7PA 2CX8A 4MCBA 2I6DA 1K3RA 1V6ZA 4YQJA 1OY5A 3N4KA 4X3MA 5GM8A 4YQ7A 1J85A 4YQDA 3KY7A 4IG6A 5CO4A 4FAKA 2Z0YA 4YPYA 1O6DA 1V2XA 4L69A 2V3JA 4CNFA 4YVJA 1NXZA 1UAJA 1TO0A 4JWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWV A;  4H3Z A;  4YVG A;  4YQQ A;  4YPZ A;  4YPW A;  4E8B A;  1GZ0 A;  4YQ8 A;  3QUV A;  4KDZ A;  4X3L A;  3BBD A;  4XBO A;  1VHK A;  3DCM X;  1VHY A;  1UAL A;  5FAI A;  3BBH A;  3NK6 A;  1Z85 A;  4YVH A;  2EGV A;  3NK7 A;  2YY8 A;  4JAK A;  3ILK A;  3O7B A;  4MCD A;  4YQ6 A;  1MXI A;  4CND A;  1IPA A;  3IC6 A;  4YQK A;  4JAL A;  4YVI A;  1UAK A;  4YQ1 A;  3GYQ A;  4YQ3 A;  4J3C A;  3KW2 A;  4YQ0 A;  3AI9 X;  4RG1 A;  5D9F A;  4YVK A;  3E5Y A;  2NWA A;  5GMC A;  1ZJR A;  4MCC A;  3OII A;  4YPX A;  4YQS A;  3L8U A;  2QMM A;  4YQC A;  4YQT A;  4YQO A;  4YQN A;  4YQR A;  4YQI A;  3OIJ A;  4YQL A;  4YQA A;  4YQ2 A;  2HA8 A;  3N4J A;  4YQB A;  4YQ4 A;  4YQG A;  4KGN A;  4CNG A;  1P9P A;  4YQ9 A;  4H3Y A;  4YQP A;  1NS5 A;  1VH0 A;  2V3K A;  3IEF A;  1UAM A;  3AXZ A;  2EGW A;  3KTY A;  4PZK A;  5GMB A;  4YQ5 A;  4CNE A;  3OIN A;  3KNU A;  3AIA A;  1X7O A;  3BBE A;  3ONP A;  2O3A A;  1X7P A;  2CX8 A;  4MCB A;  2I6D A;  1K3R A;  1V6Z A;  4YQJ A;  1OY5 A;  3N4K A;  4X3M A;  5GM8 A;  4YQ7 A;  1J85 A;  4YQD A;  3KY7 A;  4IG6 A;  5CO4 A;  4FAK A;  2Z0Y A;  4YPY A;  1O6D A;  1V2X A;  4L69 A;  2V3J A;  4CNF A;  4YVJ A;  1NXZ A;  1UAJ A;  1TO0 A; 
#chains in the Genus database with same CATH topology
 3J7Z V;  2QWV A;  4H3Z A;  4YVG A;  4YQQ A;  4YPZ A;  4YPW A;  4E8B A;  1EXD A;  1GZ0 A;  4YQ8 A;  3QUV A;  4KDZ A;  4X3L A;  5DM6 S;  4H4K A;  3BBD A;  4XBO A;  1VHK A;  4JYZ A;  3DCM X;  1VHY A;  5GAH W;  2ZJQ S;  2RE8 A;  1UAL A;  5FAI A;  3BBH A;  3NK6 A;  1Z85 A;  4YVH A;  2EGV A;  3NK7 A;  2YY8 A;  4JAK A;  2HZ7 A;  2PI8 A;  1QRU A;  3ILK A;  3O7B A;  4MCD A;  4YQ6 A;  1MXI A;  4JXX A;  4CND A;  1IPA A;  2G6G A;  3CF5 S;  3IC6 A;  5JVH S;  4YQK A;  4WF9 S;  4JAL A;  4YVI A;  1UAK A;  4YQ1 A;  3GYQ A;  5JVG S;  4YQ3 A;  4J3C A;  3KW2 A;  4YQ0 A;  1ZJW A;  4JWF A;  3AI9 X;  4RG1 A;  5D9F A;  4WCE S;  4V19 4;  4YVK A;  3E5Y A;  2ZJP S;  2NWA A;  5GMC A;  1ZJR A;  4MCC A;  3OII A;  1QTQ A;  4YPX A;  4YQS A;  3L8U A;  1D6K A;  4H3S A;  2QMM A;  4YQC A;  4YQT A;  4YQO A;  4YQN A;  4YQR A;  4IOA S;  4FMW A;  4YQI A;  3OIJ A;  4UY8 8;  4JWG A;  4YQL A;  4YQA A;  5DM7 S;  1EUQ A;  4YQ2 A;  2HA8 A;  3N4J A;  4JWJ A;  4YQB A;  4YQ4 A;  4YQG A;  2GAE A;  4KGN A;  1FEU A;  3CZB A;  2ZJR S;  4CNG A;  1P9P A;  4YQ9 A;  5GAD W;  5HL7 S;  4H3Y A;  4YQP A;  1NS5 A;  1VH0 A;  5GAE W;  2V3K A;  2PNW A;  3IEF A;  1UAM A;  1B75 A;  3AXZ A;  2EGW A;  1QRS A;  3KTY A;  4PZK A;  5GMB A;  3W2V B;  1GTS A;  4YQ5 A;  4CNE A;  3OIN A;  3KNU A;  3AIA A;  4WFN S;  5IZN A;  1X7O A;  3BBE A;  3ONP A;  2O3A A;  5GAG W;  1X7P A;  2CX8 A;  4MCB A;  2I6D A;  1K3R A;  1V6Z A;  1EUY A;  1GTR A;  1NYL A;  4IOC S;  3PIP S;  1OY5 A;  4YQJ A;  2PIC A;  4WFB S;  3W2W B;  3N4K A;  4X3M A;  4IO9 S;  3X1L B;  4U67 S;  3PIO S;  4YQ7 A;  5GM8 A;  1J85 A;  4YQD A;  4P2B A;  1DFU P;  3KY7 A;  4IG6 A;  5CO4 A;  4FAK A;  2G5D A;  1UDX A;  2Z0Y A;  1O0B A;  4YPY A;  1O6D A;  3AII A;  4JXZ A;  1V2X A;  4L69 A;  2AE0 X;  2PJJ A;  2V3J A;  4CNF A;  1QRT A;  2RD2 A;  5BNZ A;  1O0C A;  4YVJ A;  1NXZ A;  4WFA S;  1UAJ A;  1TO0 A;  3DLL S;  4JWH A; 
#chains in the Genus database with same CATH homology
 2QWV A;  4H3Z A;  4YVG A;  4YQQ A;  4YPZ A;  4YPW A;  4E8B A;  1GZ0 A;  4YQ8 A;  3QUV A;  4KDZ A;  4X3L A;  3BBD A;  4XBO A;  1VHK A;  3DCM X;  1VHY A;  1UAL A;  5FAI A;  3BBH A;  3NK6 A;  1Z85 A;  4YVH A;  2EGV A;  3NK7 A;  2YY8 A;  4JAK A;  3ILK A;  3O7B A;  4MCD A;  4YQ6 A;  1MXI A;  4CND A;  1IPA A;  3IC6 A;  4YQK A;  4JAL A;  4YVI A;  1UAK A;  4YQ1 A;  3GYQ A;  4YQ3 A;  4J3C A;  3KW2 A;  4YQ0 A;  4JWF A;  3AI9 X;  4RG1 A;  5D9F A;  4YVK A;  3E5Y A;  2NWA A;  5GMC A;  1ZJR A;  4MCC A;  3OII A;  4YPX A;  4YQS A;  3L8U A;  2QMM A;  4YQC A;  4YQT A;  4YQO A;  4YQN A;  4YQR A;  4FMW A;  4YQI A;  3OIJ A;  4JWG A;  4YQL A;  4YQA A;  4YQ2 A;  2HA8 A;  3N4J A;  4JWJ A;  4YQB A;  4YQ4 A;  4YQG A;  4KGN A;  4CNG A;  1P9P A;  4YQ9 A;  4H3Y A;  4YQP A;  1NS5 A;  1VH0 A;  2V3K A;  3IEF A;  1UAM A;  3AXZ A;  2EGW A;  3KTY A;  4PZK A;  5GMB A;  4YQ5 A;  4CNE A;  3OIN A;  3KNU A;  3AIA A;  1X7O A;  3BBE A;  3ONP A;  2O3A A;  1X7P A;  2CX8 A;  4MCB A;  2I6D A;  1K3R A;  1V6Z A;  4YQJ A;  1OY5 A;  3N4K A;  4X3M A;  5GM8 A;  4YQ7 A;  1J85 A;  4YQD A;  3KY7 A;  4IG6 A;  5CO4 A;  4FAK A;  2Z0Y A;  4YPY A;  1O6D A;  1V2X A;  4L69 A;  2V3J A;  4CNF A;  4YVJ A;  1NXZ A;  1UAJ A;  1TO0 A;  4JWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...