1VHYA

Crystal structure of haemophilus influenzae protein hi0303, pfam duf558
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
245
structure length
241
Chain Sequence
IPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELADKESHLKIHLGQVIRMEFTIQKSVELGVNVITPLWSERCGVKLDAERMDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRVLRTETASLAAISALQICFGDLGEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein HI0303
total genus 73
structure length 241
sequence length 245
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 1vhyA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1vhyA02
4YQ4A 3IEFA 1P9PA 5GM8A 3O7BA 2V3KA 4YQKA 2QMMA 4YQ7A 4CNGA 4YQTA 1GZ0A 3GYQA 5D9FA 4YQNA 4IG6A 3AIAA 1Z85A 2NWAA 3OIJA 3IC6A 1ZJRA 4XBOA 3N4KA 4YPZA 2HA8A 3BBDA 4H3ZA 1UAKA 2CX8A 4YQ3A 4L69A 3ONPA 4KGNA 3E5YA 4YVKA 1X7PA 4YVGA 4YQLA 5CO4A 2EGWA 4YQGA 3KY7A 1VHYA 4MCBA 2V3JA 4JAKA 5GMBA 4CNFA 4MCDA 1X7OA 4YQIA 4YQJA 4YQRA 4YVIA 1UALA 3ILKA 4YQ2A 3OIIA 1TO0A 3BBHA 4X3MA 4RG1A 4YQCA 4YQBA 3NK7A 4CNDA 1NXZA 1NS5A 1O6DA 4YQ8A 4YQAA 2QWVA 4YQ1A 4PZKA 3AI9X 1UAMA 2Z0YA 1V2XA 1J85A 3N4JA 4FAKA 4X3LA 4YQ0A 5GMCA 3KW2A 4YQPA 2YY8A 4YVHA 4YQOA 3DCMX 2I6DA 4E8BA 5FAIA 1K3RA 4YVJA 1VHKA 4H3YA 4MCCA 2EGVA 4YPYA 3AXZA 3KNUA 4YQ6A 3KTYA 4YPWA 4YQDA 4YPXA 4J3CA 3L8UA 1V6ZA 1UAJA 4JALA 3OINA 3BBEA 1OY5A 4YQQA 4KDZA 4YQ5A 4CNEA 4YQSA 2O3AA 3QUVA 1MXIA 3NK6A 1VH0A 4YQ9A 1IPAA
chains in the Genus database with same CATH superfamily
5DM7S 2PI8A 4JXZA 4YQ4A 3IEFA 1P9PA 5GM8A 3O7BA 1O0CA 2V3KA 2ZJRS 4YQKA 4U67S 2QMMA 1O0BA 4YQ7A 4CNGA 3CZBA 4YQTA 1GZ0A 2RD2A 1QRUA 2AE0X 3GYQA 4H3SA 5GADW 2PNWA 5D9FA 4IG6A 4YQNA 3AIAA 1GTSA 1Z85A 1QTQA 2NWAA 4WFBS 3OIJA 3IC6A 1ZJRA 3N4KA 4XBOA 4YPZA 2HA8A 3BBDA 2G5DA 4H3ZA 1UAKA 2CX8A 4YQ3A 1FEUA 3AIIA 4L69A 3W2VB 3ONPA 2ZJPS 3E5YA 4IOCS 1X7PA 4KGNA 4YVKA 4YVGA 5DM6S 1GTRA 3CF5S 4YQLA 5CO4A 2EGWA 4JXXA 4YQGA 3KY7A 1VHYA 4MCBA 5BNZA 2V3JA 4JAKA 1QRTA 5GMBA 4CNFA 4MCDA 1X7OA 4FMWA 4YQIA 4YQJA 4JWGA 4YQRA 5HL7S 4YVIA 4IO9S 1UALA 3ILKA 4JWJA 2G6GA 4YQ2A 3OIIA 1QRSA 1TO0A 3BBHA 4P2BA 1ZJWA 4X3MA 4RG1A 4YQCA 5GAGW 4YQBA 3NK7A 4CNDA 1NXZA 1NS5A 4JWHA 1O6DA 4YQ8A 4YQAA 2QWVA 2ZJQS 4PZKA 3AI9X 1UAMA 4YQ1A 2Z0YA 1V2XA 1J85A 3N4JA 4FAKA 4X3LA 3DLLS 3J7ZV 5JVHS 4YQ0A 5IZNA 4V194 3KW2A 5GMCA 4UY88 4YQPA 2YY8A 4H4KA 1D6KA 3X1LB 4YVHA 3PIPS 4YQOA 4JWFA 5JVGS 3DCMX 2I6DA 4E8BA 5FAIA 1EXDA 5GAEW 1K3RA 4YVJA 1VHKA 5GAHW 4JYZA 4H3YA 4MCCA 1UDXA 2EGVA 4YPYA 1DFUP 2HZ7A 3AXZA 3KNUA 4YQ6A 2GAEA 3KTYA 4YPWA 4WFAS 4YQDA 4YPXA 4J3CA 3L8UA 1V6ZA 4IOAS 1UAJA 4JALA 3OINA 3BBEA 2PICA 1OY5A 4YQQA 4KDZA 4YQ5A 1NYLA 3W2WB 4WF9S 4CNEA 1EUYA 4YQSA 2O3AA 2PJJA 1B75A 3QUVA 3PIOS 1MXIA 4WCES 3NK6A 1VH0A 2RE8A 4YQ9A 1IPAA 1EUQA 4WFNS
chains in the Genus database with same CATH topology
4YQ4A 3IEFA 1P9PA 5GM8A 3O7BA 2V3KA 4YQKA 2QMMA 4YQ7A 4CNGA 4YQTA 1GZ0A 3GYQA 5D9FA 4YQNA 4IG6A 3AIAA 1Z85A 2NWAA 3OIJA 3IC6A 1ZJRA 4XBOA 3N4KA 4YPZA 2HA8A 3BBDA 4H3ZA 1UAKA 2CX8A 4YQ3A 4L69A 3ONPA 4KGNA 3E5YA 4YVKA 1X7PA 4YVGA 4YQLA 5CO4A 2EGWA 4YQGA 3KY7A 1VHYA 4MCBA 2V3JA 4JAKA 5GMBA 4CNFA 4MCDA 1X7OA 4FMWA 4YQIA 4YQJA 4JWGA 4YQRA 4YVIA 1UALA 3ILKA 4JWJA 4YQ2A 3OIIA 1TO0A 3BBHA 4X3MA 4RG1A 4YQCA 4YQBA 3NK7A 4CNDA 1NXZA 1NS5A 4JWHA 1O6DA 4YQ8A 4YQAA 2QWVA 4YQ1A 4PZKA 3AI9X 1UAMA 2Z0YA 1V2XA 1J85A 3N4JA 4FAKA 4X3LA 4YQ0A 5GMCA 3KW2A 4YQPA 2YY8A 4YVHA 4YQOA 4JWFA 3DCMX 2I6DA 4E8BA 5FAIA 1K3RA 4YVJA 1VHKA 4H3YA 4MCCA 2EGVA 4YPYA 3AXZA 3KNUA 4YQ6A 3KTYA 4YPWA 4YQDA 4YPXA 4J3CA 3L8UA 1V6ZA 1UAJA 4JALA 3OINA 3BBEA 1OY5A 4YQQA 4KDZA 4YQ5A 4CNEA 4YQSA 2O3AA 3QUVA 1MXIA 3NK6A 1VH0A 4YQ9A 1IPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQ4 A;  3IEF A;  1P9P A;  5GM8 A;  3O7B A;  2V3K A;  4YQK A;  2QMM A;  4YQ7 A;  4CNG A;  4YQT A;  1GZ0 A;  3GYQ A;  5D9F A;  4YQN A;  4IG6 A;  3AIA A;  1Z85 A;  2NWA A;  3OIJ A;  3IC6 A;  1ZJR A;  4XBO A;  3N4K A;  4YPZ A;  2HA8 A;  3BBD A;  4H3Z A;  1UAK A;  2CX8 A;  4YQ3 A;  4L69 A;  3ONP A;  4KGN A;  3E5Y A;  4YVK A;  1X7P A;  4YVG A;  4YQL A;  5CO4 A;  2EGW A;  4YQG A;  3KY7 A;  1VHY A;  4MCB A;  2V3J A;  4JAK A;  5GMB A;  4CNF A;  4MCD A;  1X7O A;  4YQI A;  4YQJ A;  4YQR A;  4YVI A;  1UAL A;  3ILK A;  4YQ2 A;  3OII A;  1TO0 A;  3BBH A;  4X3M A;  4RG1 A;  4YQC A;  4YQB A;  3NK7 A;  4CND A;  1NXZ A;  1NS5 A;  1O6D A;  4YQ8 A;  4YQA A;  2QWV A;  4YQ1 A;  4PZK A;  3AI9 X;  1UAM A;  2Z0Y A;  1V2X A;  1J85 A;  3N4J A;  4FAK A;  4X3L A;  4YQ0 A;  5GMC A;  3KW2 A;  4YQP A;  2YY8 A;  4YVH A;  4YQO A;  3DCM X;  2I6D A;  4E8B A;  5FAI A;  1K3R A;  4YVJ A;  1VHK A;  4H3Y A;  4MCC A;  2EGV A;  4YPY A;  3AXZ A;  3KNU A;  4YQ6 A;  3KTY A;  4YPW A;  4YQD A;  4YPX A;  4J3C A;  3L8U A;  1V6Z A;  1UAJ A;  4JAL A;  3OIN A;  3BBE A;  1OY5 A;  4YQQ A;  4KDZ A;  4YQ5 A;  4CNE A;  4YQS A;  2O3A A;  3QUV A;  1MXI A;  3NK6 A;  1VH0 A;  4YQ9 A;  1IPA A; 
#chains in the Genus database with same CATH topology
 5DM7 S;  2PI8 A;  4JXZ A;  4YQ4 A;  3IEF A;  1P9P A;  5GM8 A;  3O7B A;  1O0C A;  2V3K A;  2ZJR S;  4YQK A;  4U67 S;  2QMM A;  1O0B A;  4YQ7 A;  4CNG A;  3CZB A;  4YQT A;  1GZ0 A;  2RD2 A;  1QRU A;  2AE0 X;  3GYQ A;  4H3S A;  5GAD W;  2PNW A;  5D9F A;  4IG6 A;  4YQN A;  3AIA A;  1GTS A;  1Z85 A;  1QTQ A;  2NWA A;  4WFB S;  3OIJ A;  3IC6 A;  1ZJR A;  3N4K A;  4XBO A;  4YPZ A;  2HA8 A;  3BBD A;  2G5D A;  4H3Z A;  1UAK A;  2CX8 A;  4YQ3 A;  1FEU A;  3AII A;  4L69 A;  3W2V B;  3ONP A;  2ZJP S;  3E5Y A;  4IOC S;  1X7P A;  4KGN A;  4YVK A;  4YVG A;  5DM6 S;  1GTR A;  3CF5 S;  4YQL A;  5CO4 A;  2EGW A;  4JXX A;  4YQG A;  3KY7 A;  1VHY A;  4MCB A;  5BNZ A;  2V3J A;  4JAK A;  1QRT A;  5GMB A;  4CNF A;  4MCD A;  1X7O A;  4FMW A;  4YQI A;  4YQJ A;  4JWG A;  4YQR A;  5HL7 S;  4YVI A;  4IO9 S;  1UAL A;  3ILK A;  4JWJ A;  2G6G A;  4YQ2 A;  3OII A;  1QRS A;  1TO0 A;  3BBH A;  4P2B A;  1ZJW A;  4X3M A;  4RG1 A;  4YQC A;  5GAG W;  4YQB A;  3NK7 A;  4CND A;  1NXZ A;  1NS5 A;  4JWH A;  1O6D A;  4YQ8 A;  4YQA A;  2QWV A;  2ZJQ S;  4PZK A;  3AI9 X;  1UAM A;  4YQ1 A;  2Z0Y A;  1V2X A;  1J85 A;  3N4J A;  4FAK A;  4X3L A;  3DLL S;  3J7Z V;  5JVH S;  4YQ0 A;  5IZN A;  4V19 4;  3KW2 A;  5GMC A;  4UY8 8;  4YQP A;  2YY8 A;  4H4K A;  1D6K A;  3X1L B;  4YVH A;  3PIP S;  4YQO A;  4JWF A;  5JVG S;  3DCM X;  2I6D A;  4E8B A;  5FAI A;  1EXD A;  5GAE W;  1K3R A;  4YVJ A;  1VHK A;  5GAH W;  4JYZ A;  4H3Y A;  4MCC A;  1UDX A;  2EGV A;  4YPY A;  1DFU P;  2HZ7 A;  3AXZ A;  3KNU A;  4YQ6 A;  2GAE A;  3KTY A;  4YPW A;  4WFA S;  4YQD A;  4YPX A;  4J3C A;  3L8U A;  1V6Z A;  4IOA S;  1UAJ A;  4JAL A;  3OIN A;  3BBE A;  2PIC A;  1OY5 A;  4YQQ A;  4KDZ A;  4YQ5 A;  1NYL A;  3W2W B;  4WF9 S;  4CNE A;  1EUY A;  4YQS A;  2O3A A;  2PJJ A;  1B75 A;  3QUV A;  3PIO S;  1MXI A;  4WCE S;  3NK6 A;  1VH0 A;  2RE8 A;  4YQ9 A;  1IPA A;  1EUQ A;  4WFN S; 
#chains in the Genus database with same CATH homology
 4YQ4 A;  3IEF A;  1P9P A;  5GM8 A;  3O7B A;  2V3K A;  4YQK A;  2QMM A;  4YQ7 A;  4CNG A;  4YQT A;  1GZ0 A;  3GYQ A;  5D9F A;  4YQN A;  4IG6 A;  3AIA A;  1Z85 A;  2NWA A;  3OIJ A;  3IC6 A;  1ZJR A;  4XBO A;  3N4K A;  4YPZ A;  2HA8 A;  3BBD A;  4H3Z A;  1UAK A;  2CX8 A;  4YQ3 A;  4L69 A;  3ONP A;  4KGN A;  3E5Y A;  4YVK A;  1X7P A;  4YVG A;  4YQL A;  5CO4 A;  2EGW A;  4YQG A;  3KY7 A;  1VHY A;  4MCB A;  2V3J A;  4JAK A;  5GMB A;  4CNF A;  4MCD A;  1X7O A;  4FMW A;  4YQI A;  4YQJ A;  4JWG A;  4YQR A;  4YVI A;  1UAL A;  3ILK A;  4JWJ A;  4YQ2 A;  3OII A;  1TO0 A;  3BBH A;  4X3M A;  4RG1 A;  4YQC A;  4YQB A;  3NK7 A;  4CND A;  1NXZ A;  1NS5 A;  4JWH A;  1O6D A;  4YQ8 A;  4YQA A;  2QWV A;  4YQ1 A;  4PZK A;  3AI9 X;  1UAM A;  2Z0Y A;  1V2X A;  1J85 A;  3N4J A;  4FAK A;  4X3L A;  4YQ0 A;  5GMC A;  3KW2 A;  4YQP A;  2YY8 A;  4YVH A;  4YQO A;  4JWF A;  3DCM X;  2I6D A;  4E8B A;  5FAI A;  1K3R A;  4YVJ A;  1VHK A;  4H3Y A;  4MCC A;  2EGV A;  4YPY A;  3AXZ A;  3KNU A;  4YQ6 A;  3KTY A;  4YPW A;  4YQD A;  4YPX A;  4J3C A;  3L8U A;  1V6Z A;  1UAJ A;  4JAL A;  3OIN A;  3BBE A;  1OY5 A;  4YQQ A;  4KDZ A;  4YQ5 A;  4CNE A;  4YQS A;  2O3A A;  3QUV A;  1MXI A;  3NK6 A;  1VH0 A;  4YQ9 A;  1IPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...