1VHYA

Crystal structure of haemophilus influenzae protein hi0303, pfam duf558
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
245
structure length
241
Chain Sequence
IPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELADKESHLKIHLGQVIRMEFTIQKSVELGVNVITPLWSERCGVKLDAERMDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRVLRTETASLAAISALQICFGDLGEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein HI0303
total genus 73
structure length 241
sequence length 245
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 1vhyA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1vhyA02
2V3KA 2YY8A 4JALA 5GM8A 4J3CA 1UAKA 4YQ3A 3KW2A 3KTYA 1UAMA 4YPZA 4YQ4A 4YPYA 4YQNA 1UALA 1NS5A 4MCBA 2QMMA 3KNUA 4YQPA 3NK7A 4CNEA 4YQDA 4YQ0A 1UAJA 1K3RA 4CNDA 4CNFA 4X3LA 1X7PA 4YPXA 3BBEA 4YPWA 3IEFA 1VHYA 4IG6A 3OIJA 3O7BA 1J85A 5GMBA 4YQAA 4H3ZA 4RG1A 4YQ9A 4YQRA 4YQ2A 4L69A 4MCDA 1VH0A 3BBHA 4YQLA 2EGVA 1OY5A 2NWAA 4E8BA 3AIAA 1IPAA 1O6DA 1GZ0A 4YQOA 1Z85A 4YQ1A 4FAKA 4YVIA 4YQJA 4H3YA 3BBDA 4YVGA 4YQBA 4KGNA 1V6ZA 1MXIA 2Z0YA 3OIIA 3AXZA 5CO4A 4YQQA 3KY7A 4MCCA 3N4KA 2V3JA 4YQGA 4XBOA 1V2XA 1NXZA 4JAKA 4YVJA 4YQ5A 4X3MA 4YQKA 4YQ7A 1ZJRA 4YQ8A 3L8UA 3GYQA 4CNGA 5GMCA 2QWVA 4YQCA 4PZKA 2CX8A 3QUVA 1P9PA 2HA8A 3NK6A 3IC6A 2O3AA 5FAIA 3OINA 3N4JA 4YVHA 3ONPA 4YQ6A 3DCMX 5D9FA 4YQSA 3E5YA 1TO0A 2EGWA 1VHKA 2I6DA 1X7OA 3AI9X 4KDZA 4YQTA 4YVKA 4YQIA 3ILKA
chains in the Genus database with same CATH superfamily
2V3KA 2YY8A 4IOCS 4JALA 3CF5S 2PNWA 5GM8A 4J3CA 1UAKA 4YQ3A 2ZJPS 2RE8A 3KW2A 3KTYA 2HZ7A 1UAMA 4FMWA 4YPZA 4YQ4A 4YPYA 4YQNA 1FEUA 1UALA 1NS5A 2QMMA 4MCBA 3KNUA 4YQPA 3NK7A 1QTQA 3J7ZV 4WCES 1GTSA 4CNEA 2RD2A 1EUYA 3AIIA 4YQDA 4YQ0A 1UAJA 4JWJA 2ZJQS 1K3RA 4JWGA 4CNDA 4WF9S 4X3LA 4CNFA 1X7PA 4IOAS 4YPXA 2PI8A 3BBEA 4YPWA 1DFUP 1UDXA 3IEFA 1VHYA 4JXZA 2G6GA 3O7BA 4IG6A 3OIJA 1J85A 5GMBA 4YQAA 4H3ZA 4RG1A 4YQ9A 4YQRA 3PIPS 4YQ2A 4L69A 4MCDA 3W2VB 3CZBA 1QRUA 1VH0A 3BBHA 3X1LB 2EGVA 2PICA 4WFNS 5HL7S 4YQLA 1OY5A 2NWAA 4E8BA 3AIAA 1IPAA 1O6DA 1GZ0A 4YQOA 4P2BA 1Z85A 1QRTA 4YQ1A 4FAKA 1D6KA 2PJJA 4YVIA 4JWFA 4JYZA 4H3YA 4YQJA 4H4KA 2ZJRS 3BBDA 4YVGA 5IZNA 4YQBA 2AE0X 4KGNA 1V6ZA 3W2WB 1MXIA 2Z0YA 3OIIA 3DLLS 3AXZA 5CO4A 1O0CA 5GAGW 4YQQA 1NYLA 3KY7A 4MCCA 3N4KA 2V3JA 4V194 4YQGA 5GAHW 4XBOA 1V2XA 2G5DA 1NXZA 5JVHS 4JAKA 1O0BA 1B75A 5GAEW 4JWHA 5BNZA 1EXDA 4YVJA 4YQ5A 4IO9S 4X3MA 4U67S 4YQKA 4YQ7A 1ZJWA 1ZJRA 4WFBS 4YQ8A 3L8UA 3GYQA 4CNGA 5GMCA 2QWVA 4YQCA 4PZKA 2CX8A 3QUVA 1P9PA 1QRSA 2HA8A 4UY88 3NK6A 3PIOS 3IC6A 2O3AA 5FAIA 5DM7S 3OINA 3N4JA 4YVHA 3ONPA 2GAEA 1GTRA 3DCMX 4YQ6A 4JXXA 4YQSA 5D9FA 3E5YA 4WFAS 1EUQA 4H3SA 1TO0A 5GADW 2EGWA 1VHKA 2I6DA 5JVGS 5DM6S 1X7OA 3AI9X 4KDZA 4YQTA 4YVKA 4YQIA 3ILKA
chains in the Genus database with same CATH topology
2V3KA 2YY8A 4JALA 5GM8A 4J3CA 1UAKA 4YQ3A 3KW2A 3KTYA 1UAMA 4FMWA 4YPZA 4YQ4A 4YPYA 4YQNA 1UALA 1NS5A 4MCBA 2QMMA 3KNUA 4YQPA 3NK7A 4CNEA 4YQDA 4YQ0A 1UAJA 4JWJA 1K3RA 4CNDA 4JWGA 4CNFA 4X3LA 1X7PA 4YPXA 3BBEA 4YPWA 3IEFA 1VHYA 4IG6A 3OIJA 3O7BA 1J85A 5GMBA 4YQAA 4H3ZA 4RG1A 4YQ9A 4YQRA 4YQ2A 4L69A 4MCDA 1VH0A 3BBHA 4YQLA 2EGVA 1OY5A 2NWAA 4E8BA 3AIAA 1IPAA 1O6DA 1GZ0A 4YQOA 1Z85A 4YQ1A 4FAKA 4YVIA 4JWFA 4H3YA 4YQJA 3BBDA 4YVGA 4YQBA 4KGNA 1V6ZA 1MXIA 2Z0YA 3OIIA 3AXZA 5CO4A 4YQQA 3KY7A 4MCCA 3N4KA 2V3JA 4YQGA 4XBOA 1V2XA 1NXZA 4JAKA 4JWHA 4YVJA 4YQ5A 4X3MA 4YQKA 4YQ7A 1ZJRA 4YQ8A 3L8UA 3GYQA 4CNGA 5GMCA 2QWVA 4YQCA 4PZKA 2CX8A 3QUVA 1P9PA 2HA8A 3NK6A 3IC6A 2O3AA 5FAIA 3OINA 3N4JA 4YVHA 3ONPA 4YQ6A 3DCMX 5D9FA 4YQSA 3E5YA 1TO0A 2EGWA 1VHKA 2I6DA 1X7OA 3AI9X 4KDZA 4YQTA 4YVKA 4YQIA 3ILKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3K A;  2YY8 A;  4JAL A;  5GM8 A;  4J3C A;  1UAK A;  4YQ3 A;  3KW2 A;  3KTY A;  1UAM A;  4YPZ A;  4YQ4 A;  4YPY A;  4YQN A;  1UAL A;  1NS5 A;  4MCB A;  2QMM A;  3KNU A;  4YQP A;  3NK7 A;  4CNE A;  4YQD A;  4YQ0 A;  1UAJ A;  1K3R A;  4CND A;  4CNF A;  4X3L A;  1X7P A;  4YPX A;  3BBE A;  4YPW A;  3IEF A;  1VHY A;  4IG6 A;  3OIJ A;  3O7B A;  1J85 A;  5GMB A;  4YQA A;  4H3Z A;  4RG1 A;  4YQ9 A;  4YQR A;  4YQ2 A;  4L69 A;  4MCD A;  1VH0 A;  3BBH A;  4YQL A;  2EGV A;  1OY5 A;  2NWA A;  4E8B A;  3AIA A;  1IPA A;  1O6D A;  1GZ0 A;  4YQO A;  1Z85 A;  4YQ1 A;  4FAK A;  4YVI A;  4YQJ A;  4H3Y A;  3BBD A;  4YVG A;  4YQB A;  4KGN A;  1V6Z A;  1MXI A;  2Z0Y A;  3OII A;  3AXZ A;  5CO4 A;  4YQQ A;  3KY7 A;  4MCC A;  3N4K A;  2V3J A;  4YQG A;  4XBO A;  1V2X A;  1NXZ A;  4JAK A;  4YVJ A;  4YQ5 A;  4X3M A;  4YQK A;  4YQ7 A;  1ZJR A;  4YQ8 A;  3L8U A;  3GYQ A;  4CNG A;  5GMC A;  2QWV A;  4YQC A;  4PZK A;  2CX8 A;  3QUV A;  1P9P A;  2HA8 A;  3NK6 A;  3IC6 A;  2O3A A;  5FAI A;  3OIN A;  3N4J A;  4YVH A;  3ONP A;  4YQ6 A;  3DCM X;  5D9F A;  4YQS A;  3E5Y A;  1TO0 A;  2EGW A;  1VHK A;  2I6D A;  1X7O A;  3AI9 X;  4KDZ A;  4YQT A;  4YVK A;  4YQI A;  3ILK A; 
#chains in the Genus database with same CATH topology
 2V3K A;  2YY8 A;  4IOC S;  4JAL A;  3CF5 S;  2PNW A;  5GM8 A;  4J3C A;  1UAK A;  4YQ3 A;  2ZJP S;  2RE8 A;  3KW2 A;  3KTY A;  2HZ7 A;  1UAM A;  4FMW A;  4YPZ A;  4YQ4 A;  4YPY A;  4YQN A;  1FEU A;  1UAL A;  1NS5 A;  2QMM A;  4MCB A;  3KNU A;  4YQP A;  3NK7 A;  1QTQ A;  3J7Z V;  4WCE S;  1GTS A;  4CNE A;  2RD2 A;  1EUY A;  3AII A;  4YQD A;  4YQ0 A;  1UAJ A;  4JWJ A;  2ZJQ S;  1K3R A;  4JWG A;  4CND A;  4WF9 S;  4X3L A;  4CNF A;  1X7P A;  4IOA S;  4YPX A;  2PI8 A;  3BBE A;  4YPW A;  1DFU P;  1UDX A;  3IEF A;  1VHY A;  4JXZ A;  2G6G A;  3O7B A;  4IG6 A;  3OIJ A;  1J85 A;  5GMB A;  4YQA A;  4H3Z A;  4RG1 A;  4YQ9 A;  4YQR A;  3PIP S;  4YQ2 A;  4L69 A;  4MCD A;  3W2V B;  3CZB A;  1QRU A;  1VH0 A;  3BBH A;  3X1L B;  2EGV A;  2PIC A;  4WFN S;  5HL7 S;  4YQL A;  1OY5 A;  2NWA A;  4E8B A;  3AIA A;  1IPA A;  1O6D A;  1GZ0 A;  4YQO A;  4P2B A;  1Z85 A;  1QRT A;  4YQ1 A;  4FAK A;  1D6K A;  2PJJ A;  4YVI A;  4JWF A;  4JYZ A;  4H3Y A;  4YQJ A;  4H4K A;  2ZJR S;  3BBD A;  4YVG A;  5IZN A;  4YQB A;  2AE0 X;  4KGN A;  1V6Z A;  3W2W B;  1MXI A;  2Z0Y A;  3OII A;  3DLL S;  3AXZ A;  5CO4 A;  1O0C A;  5GAG W;  4YQQ A;  1NYL A;  3KY7 A;  4MCC A;  3N4K A;  2V3J A;  4V19 4;  4YQG A;  5GAH W;  4XBO A;  1V2X A;  2G5D A;  1NXZ A;  5JVH S;  4JAK A;  1O0B A;  1B75 A;  5GAE W;  4JWH A;  5BNZ A;  1EXD A;  4YVJ A;  4YQ5 A;  4IO9 S;  4X3M A;  4U67 S;  4YQK A;  4YQ7 A;  1ZJW A;  1ZJR A;  4WFB S;  4YQ8 A;  3L8U A;  3GYQ A;  4CNG A;  5GMC A;  2QWV A;  4YQC A;  4PZK A;  2CX8 A;  3QUV A;  1P9P A;  1QRS A;  2HA8 A;  4UY8 8;  3NK6 A;  3PIO S;  3IC6 A;  2O3A A;  5FAI A;  5DM7 S;  3OIN A;  3N4J A;  4YVH A;  3ONP A;  2GAE A;  1GTR A;  3DCM X;  4YQ6 A;  4JXX A;  4YQS A;  5D9F A;  3E5Y A;  4WFA S;  1EUQ A;  4H3S A;  1TO0 A;  5GAD W;  2EGW A;  1VHK A;  2I6D A;  5JVG S;  5DM6 S;  1X7O A;  3AI9 X;  4KDZ A;  4YQT A;  4YVK A;  4YQI A;  3ILK A; 
#chains in the Genus database with same CATH homology
 2V3K A;  2YY8 A;  4JAL A;  5GM8 A;  4J3C A;  1UAK A;  4YQ3 A;  3KW2 A;  3KTY A;  1UAM A;  4FMW A;  4YPZ A;  4YQ4 A;  4YPY A;  4YQN A;  1UAL A;  1NS5 A;  4MCB A;  2QMM A;  3KNU A;  4YQP A;  3NK7 A;  4CNE A;  4YQD A;  4YQ0 A;  1UAJ A;  4JWJ A;  1K3R A;  4CND A;  4JWG A;  4CNF A;  4X3L A;  1X7P A;  4YPX A;  3BBE A;  4YPW A;  3IEF A;  1VHY A;  4IG6 A;  3OIJ A;  3O7B A;  1J85 A;  5GMB A;  4YQA A;  4H3Z A;  4RG1 A;  4YQ9 A;  4YQR A;  4YQ2 A;  4L69 A;  4MCD A;  1VH0 A;  3BBH A;  4YQL A;  2EGV A;  1OY5 A;  2NWA A;  4E8B A;  3AIA A;  1IPA A;  1O6D A;  1GZ0 A;  4YQO A;  1Z85 A;  4YQ1 A;  4FAK A;  4YVI A;  4JWF A;  4H3Y A;  4YQJ A;  3BBD A;  4YVG A;  4YQB A;  4KGN A;  1V6Z A;  1MXI A;  2Z0Y A;  3OII A;  3AXZ A;  5CO4 A;  4YQQ A;  3KY7 A;  4MCC A;  3N4K A;  2V3J A;  4YQG A;  4XBO A;  1V2X A;  1NXZ A;  4JAK A;  4JWH A;  4YVJ A;  4YQ5 A;  4X3M A;  4YQK A;  4YQ7 A;  1ZJR A;  4YQ8 A;  3L8U A;  3GYQ A;  4CNG A;  5GMC A;  2QWV A;  4YQC A;  4PZK A;  2CX8 A;  3QUV A;  1P9P A;  2HA8 A;  3NK6 A;  3IC6 A;  2O3A A;  5FAI A;  3OIN A;  3N4J A;  4YVH A;  3ONP A;  4YQ6 A;  3DCM X;  5D9F A;  4YQS A;  3E5Y A;  1TO0 A;  2EGW A;  1VHK A;  2I6D A;  1X7O A;  3AI9 X;  4KDZ A;  4YQT A;  4YVK A;  4YQI A;  3ILK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...