1VHYA

Crystal structure of haemophilus influenzae protein hi0303, pfam duf558
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
245
structure length
241
Chain Sequence
b'IPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELADKESHLKIHLGQVIRMEFTIQKSVELGVNVITPLWSERCGVKLDAERMDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRVLRTETASLAAISALQICFGDLGEEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein HI0303
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 73
structure length 241
sequence length 245
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.193: 16S rRNA (uracil(1498)-N(3))-methyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04452 Methyltrans_RNA RNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.240.20 Mainly Beta Beta Barrel Ribosomal Protein L25; Chain P Hypothetical PUA domain-like; domain 1 1vhyA01
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 1vhyA02
3BBDA 5CO4A 1X7OA 4YQLA 4YPXA 1V6ZA 3DCMX 3QUVA 4YQBA 4YQCA 4PZKA 4YPZA 1P9PA 4YQAA 2NWAA 1UALA 1UAJA 5FAIA 3N4KA 4YPWA 2QWVA 1NXZA 1VHKA 3AI9X 4YQ8A 2QMMA 2Z0YA 3NK6A 3OIJA 4YVHA 1MXIA 1TO0A 4CNGA 4YQIA 4H3YA 4YQOA 4X3LA 4MCBA 4YPYA 3KTYA 1OY5A 3KY7A 4YQJA 2CX8A 1V2XA 3N4JA 4YQ4A 2EGVA 4YQ3A 2EGWA 4E8BA 1J85A 1UAKA 2V3JA 4JAKA 4MCCA 4YQDA 4H3ZA 3KW2A 4XBOA 3OINA 2V3KA 2I6DA 4YQ1A 3AXZA 4CNDA 4YQSA 4YVIA 3L8UA 4L69A 1UAMA 2O3AA 3IEFA 4YVGA 4YVJA 2HA8A 1VHYA 4YQRA 3BBEA 1NS5A 4KDZA 4YQKA 1VH0A 4RG1A 4CNEA 4YVKA 1K3RA 5GMBA 4YQNA 4MCDA 2YY8A 4J3CA 4YQGA 3E5YA 3O7BA 3NK7A 4YQ6A 4YQTA 3ONPA 4CNFA 4YQ0A 5GM8A 4YQ7A 4YQ5A 4YQ2A 3KNUA 4FAKA 4YQ9A 3BBHA 4JALA 5GMCA 5D9FA 3IC6A 1GZ0A 1ZJRA 1Z85A 1X7PA 4KGNA 3GYQA 1O6DA 4IG6A 3ILKA 4X3MA 4YQQA 1IPAA 3OIIA 4YQPA 3AIAA
chains in the Genus database with same CATH superfamily
4FMWA 3BBDA 5CO4A 1X7OA 4YQLA 4YPXA 4WFAS 1V6ZA 5DM7S 5GAHW 1QRTA 3DCMX 4JWHA 1EUQA 3J7ZV 3AIAA 3QUVA 1QRSA 4YQBA 4YQCA 5JVHS 4IOCS 4U67S 5GAGW 4WFNS 4PZKA 4YPZA 1P9PA 1O0BA 1NYLA 2RE8A 3OIIA 4YQAA 4WF9S 2NWAA 1UALA 1B75A 4JWGA 1UAJA 1UDXA 2ZJQS 5FAIA 3N4KA 4YPWA 2QWVA 4JXZA 1NXZA 1VHKA 3AI9X 4YQ8A 2QMMA 2Z0YA 3NK6A 1EXDA 3OIJA 4YVHA 1MXIA 1TO0A 4CNGA 4H4KA 4H3SA 5BNZA 4YQIA 4H3YA 4YQOA 4X3LA 4UY88 4MCBA 4V194 4YPYA 1ZJWA 3KTYA 1OY5A 3KY7A 4YQJA 2CX8A 1V2XA 3N4JA 4YQ4A 2EGVA 2PI8A 4YQ3A 2EGWA 4E8BA 1J85A 4WCES 1UAKA 2V3JA 4JAKA 4MCCA 4YQDA 4H3ZA 3KW2A 1QTQA 4IOAS 4XBOA 3OINA 2PICA 2V3KA 2I6DA 4YQ1A 4P2BA 3AXZA 4CNDA 3W2WB 4YQSA 4JXXA 3L8UA 4YVIA 2GAEA 4L69A 5HL7S 1UAMA 2O3AA 3PIOS 1GTSA 3IEFA 4YVGA 4YVJA 2HA8A 2HZ7A 1VHYA 4YQRA 3BBEA 3CF5S 2AE0X 1NS5A 1GTRA 4KDZA 4YQKA 4JWFA 1VH0A 1QRUA 5JVGS 5DM6S 4RG1A 4CNEA 3W2VB 5IZNA 4YVKA 3DLLS 1O0CA 1K3RA 5GMBA 2G5DA 4YQNA 1D6KA 2YY8A 4MCDA 2G6GA 4J3CA 5GAEW 4YQGA 3E5YA 3O7BA 3NK7A 4YQ6A 1DFUP 4IO9S 3ONPA 4YQTA 4CNFA 4YQ0A 5GM8A 4YQ7A 4YQ5A 4YQ2A 3KNUA 4FAKA 4YQ9A 3PIPS 3BBHA 4JALA 5GMCA 5D9FA 3IC6A 1EUYA 1GZ0A 1ZJRA 1Z85A 1X7PA 4JWJA 3AIIA 2ZJRS 4KGNA 2PNWA 3GYQA 4JYZA 1O6DA 2ZJPS 2PJJA 4IG6A 3CZBA 3ILKA 4X3MA 3X1LB 4YQQA 4WFBS 1IPAA 2RD2A 1FEUA 4YQPA 5GADW
chains in the Genus database with same CATH topology
4FMWA 3BBDA 5CO4A 1X7OA 4YQLA 4YPXA 1V6ZA 4JWHA 3DCMX 3QUVA 4YQBA 4YQCA 4PZKA 4YPZA 1P9PA 4YQAA 2NWAA 1UALA 4JWGA 1UAJA 5FAIA 3N4KA 4YPWA 2QWVA 1NXZA 1VHKA 3AI9X 4YQ8A 2QMMA 2Z0YA 3NK6A 3OIJA 4YVHA 1MXIA 1TO0A 4CNGA 4YQIA 4H3YA 4YQOA 4X3LA 4MCBA 4YPYA 3KTYA 1OY5A 3KY7A 4YQJA 2CX8A 1V2XA 3N4JA 4YQ4A 2EGVA 4YQ3A 2EGWA 4E8BA 1J85A 1UAKA 2V3JA 4JAKA 4MCCA 4YQDA 4H3ZA 3KW2A 4XBOA 3OINA 2V3KA 2I6DA 4YQ1A 3AXZA 4CNDA 4YQSA 4YVIA 3L8UA 4L69A 1UAMA 2O3AA 3IEFA 4YVGA 4YVJA 2HA8A 1VHYA 4YQRA 3BBEA 1NS5A 4KDZA 4YQKA 4JWFA 1VH0A 4RG1A 4CNEA 4YVKA 1K3RA 5GMBA 4YQNA 4MCDA 2YY8A 4J3CA 4YQGA 3E5YA 3O7BA 3NK7A 4YQ6A 4YQTA 3ONPA 4CNFA 4YQ0A 5GM8A 4YQ7A 4YQ5A 4YQ2A 3KNUA 4FAKA 4YQ9A 3BBHA 4JALA 5GMCA 5D9FA 3IC6A 1GZ0A 1ZJRA 1Z85A 1X7PA 4JWJA 4KGNA 3GYQA 1O6DA 4IG6A 3ILKA 4X3MA 4YQQA 1IPAA 3OIIA 4YQPA 3AIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBD A;  5CO4 A;  1X7O A;  4YQL A;  4YPX A;  1V6Z A;  3DCM X;  3QUV A;  4YQB A;  4YQC A;  4PZK A;  4YPZ A;  1P9P A;  4YQA A;  2NWA A;  1UAL A;  1UAJ A;  5FAI A;  3N4K A;  4YPW A;  2QWV A;  1NXZ A;  1VHK A;  3AI9 X;  4YQ8 A;  2QMM A;  2Z0Y A;  3NK6 A;  3OIJ A;  4YVH A;  1MXI A;  1TO0 A;  4CNG A;  4YQI A;  4H3Y A;  4YQO A;  4X3L A;  4MCB A;  4YPY A;  3KTY A;  1OY5 A;  3KY7 A;  4YQJ A;  2CX8 A;  1V2X A;  3N4J A;  4YQ4 A;  2EGV A;  4YQ3 A;  2EGW A;  4E8B A;  1J85 A;  1UAK A;  2V3J A;  4JAK A;  4MCC A;  4YQD A;  4H3Z A;  3KW2 A;  4XBO A;  3OIN A;  2V3K A;  2I6D A;  4YQ1 A;  3AXZ A;  4CND A;  4YQS A;  4YVI A;  3L8U A;  4L69 A;  1UAM A;  2O3A A;  3IEF A;  4YVG A;  4YVJ A;  2HA8 A;  1VHY A;  4YQR A;  3BBE A;  1NS5 A;  4KDZ A;  4YQK A;  1VH0 A;  4RG1 A;  4CNE A;  4YVK A;  1K3R A;  5GMB A;  4YQN A;  4MCD A;  2YY8 A;  4J3C A;  4YQG A;  3E5Y A;  3O7B A;  3NK7 A;  4YQ6 A;  4YQT A;  3ONP A;  4CNF A;  4YQ0 A;  5GM8 A;  4YQ7 A;  4YQ5 A;  4YQ2 A;  3KNU A;  4FAK A;  4YQ9 A;  3BBH A;  4JAL A;  5GMC A;  5D9F A;  3IC6 A;  1GZ0 A;  1ZJR A;  1Z85 A;  1X7P A;  4KGN A;  3GYQ A;  1O6D A;  4IG6 A;  3ILK A;  4X3M A;  4YQQ A;  1IPA A;  3OII A;  4YQP A;  3AIA A; 
#chains in the Genus database with same CATH topology
 4FMW A;  3BBD A;  5CO4 A;  1X7O A;  4YQL A;  4YPX A;  4WFA S;  1V6Z A;  5DM7 S;  5GAH W;  1QRT A;  3DCM X;  4JWH A;  1EUQ A;  3J7Z V;  3AIA A;  3QUV A;  1QRS A;  4YQB A;  4YQC A;  5JVH S;  4IOC S;  4U67 S;  5GAG W;  4WFN S;  4PZK A;  4YPZ A;  1P9P A;  1O0B A;  1NYL A;  2RE8 A;  3OII A;  4YQA A;  4WF9 S;  2NWA A;  1UAL A;  1B75 A;  4JWG A;  1UAJ A;  1UDX A;  2ZJQ S;  5FAI A;  3N4K A;  4YPW A;  2QWV A;  4JXZ A;  1NXZ A;  1VHK A;  3AI9 X;  4YQ8 A;  2QMM A;  2Z0Y A;  3NK6 A;  1EXD A;  3OIJ A;  4YVH A;  1MXI A;  1TO0 A;  4CNG A;  4H4K A;  4H3S A;  5BNZ A;  4YQI A;  4H3Y A;  4YQO A;  4X3L A;  4UY8 8;  4MCB A;  4V19 4;  4YPY A;  1ZJW A;  3KTY A;  1OY5 A;  3KY7 A;  4YQJ A;  2CX8 A;  1V2X A;  3N4J A;  4YQ4 A;  2EGV A;  2PI8 A;  4YQ3 A;  2EGW A;  4E8B A;  1J85 A;  4WCE S;  1UAK A;  2V3J A;  4JAK A;  4MCC A;  4YQD A;  4H3Z A;  3KW2 A;  1QTQ A;  4IOA S;  4XBO A;  3OIN A;  2PIC A;  2V3K A;  2I6D A;  4YQ1 A;  4P2B A;  3AXZ A;  4CND A;  3W2W B;  4YQS A;  4JXX A;  3L8U A;  4YVI A;  2GAE A;  4L69 A;  5HL7 S;  1UAM A;  2O3A A;  3PIO S;  1GTS A;  3IEF A;  4YVG A;  4YVJ A;  2HA8 A;  2HZ7 A;  1VHY A;  4YQR A;  3BBE A;  3CF5 S;  2AE0 X;  1NS5 A;  1GTR A;  4KDZ A;  4YQK A;  4JWF A;  1VH0 A;  1QRU A;  5JVG S;  5DM6 S;  4RG1 A;  4CNE A;  3W2V B;  5IZN A;  4YVK A;  3DLL S;  1O0C A;  1K3R A;  5GMB A;  2G5D A;  4YQN A;  1D6K A;  2YY8 A;  4MCD A;  2G6G A;  4J3C A;  5GAE W;  4YQG A;  3E5Y A;  3O7B A;  3NK7 A;  4YQ6 A;  1DFU P;  4IO9 S;  3ONP A;  4YQT A;  4CNF A;  4YQ0 A;  5GM8 A;  4YQ7 A;  4YQ5 A;  4YQ2 A;  3KNU A;  4FAK A;  4YQ9 A;  3PIP S;  3BBH A;  4JAL A;  5GMC A;  5D9F A;  3IC6 A;  1EUY A;  1GZ0 A;  1ZJR A;  1Z85 A;  1X7P A;  4JWJ A;  3AII A;  2ZJR S;  4KGN A;  2PNW A;  3GYQ A;  4JYZ A;  1O6D A;  2ZJP S;  2PJJ A;  4IG6 A;  3CZB A;  3ILK A;  4X3M A;  3X1L B;  4YQQ A;  4WFB S;  1IPA A;  2RD2 A;  1FEU A;  4YQP A;  5GAD W; 
#chains in the Genus database with same CATH homology
 4FMW A;  3BBD A;  5CO4 A;  1X7O A;  4YQL A;  4YPX A;  1V6Z A;  4JWH A;  3DCM X;  3QUV A;  4YQB A;  4YQC A;  4PZK A;  4YPZ A;  1P9P A;  4YQA A;  2NWA A;  1UAL A;  4JWG A;  1UAJ A;  5FAI A;  3N4K A;  4YPW A;  2QWV A;  1NXZ A;  1VHK A;  3AI9 X;  4YQ8 A;  2QMM A;  2Z0Y A;  3NK6 A;  3OIJ A;  4YVH A;  1MXI A;  1TO0 A;  4CNG A;  4YQI A;  4H3Y A;  4YQO A;  4X3L A;  4MCB A;  4YPY A;  3KTY A;  1OY5 A;  3KY7 A;  4YQJ A;  2CX8 A;  1V2X A;  3N4J A;  4YQ4 A;  2EGV A;  4YQ3 A;  2EGW A;  4E8B A;  1J85 A;  1UAK A;  2V3J A;  4JAK A;  4MCC A;  4YQD A;  4H3Z A;  3KW2 A;  4XBO A;  3OIN A;  2V3K A;  2I6D A;  4YQ1 A;  3AXZ A;  4CND A;  4YQS A;  4YVI A;  3L8U A;  4L69 A;  1UAM A;  2O3A A;  3IEF A;  4YVG A;  4YVJ A;  2HA8 A;  1VHY A;  4YQR A;  3BBE A;  1NS5 A;  4KDZ A;  4YQK A;  4JWF A;  1VH0 A;  4RG1 A;  4CNE A;  4YVK A;  1K3R A;  5GMB A;  4YQN A;  4MCD A;  2YY8 A;  4J3C A;  4YQG A;  3E5Y A;  3O7B A;  3NK7 A;  4YQ6 A;  4YQT A;  3ONP A;  4CNF A;  4YQ0 A;  5GM8 A;  4YQ7 A;  4YQ5 A;  4YQ2 A;  3KNU A;  4FAK A;  4YQ9 A;  3BBH A;  4JAL A;  5GMC A;  5D9F A;  3IC6 A;  1GZ0 A;  1ZJR A;  1Z85 A;  1X7P A;  4JWJ A;  4KGN A;  3GYQ A;  1O6D A;  4IG6 A;  3ILK A;  4X3M A;  4YQQ A;  1IPA A;  3OII A;  4YQP A;  3AIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...