1VIAA

Crystal structure of shikimate kinase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
161
structure length
161
Chain Sequence
KNIVFIGFMGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQKVSEIFEQKRENFFREQEQKMADFFSSCEKACIATGGGFVNVSNLEKAGFCIYLKADFEYLKKRLDKDEISKRPLFYDEIKAKKLYNERLSKYEQKANFILNIENKNIDELLSEIKKVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
molecule keywords shikimate kinase
total genus 63
structure length 161
sequence length 161
chains with identical sequence B
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1viaA00
1L4UA 1QHYA 5K8LA 4MRPA 4LBYA 1NN0A 1BOFA 2ZQ5A 1S3GA 3OZXA 2P3SA 1AGPA 5LD2C 1E9DA 5JRJA 1UKVY 1TQ4A 2FSGA 5BQ5A 4E22A 4FWTA 5JLJA 2FFHA 5J40A 2GA8A 4Q03A 2YC2C 1WCV1 3L8YA 4N0EA 3SN6A 5FL7D 2XZOA 3GJ0A 4BLRA 3U61B 1OIXA 3TW8B 1D6JA 1I4DD 2C95A 3REGA 1W0KA 3KFVA 2BCGY 3MMPA 2EFDB 2QI9C 4B3GA 1XTIA 4MRSA 1W44A 2GCOB 4K81B 3VR2A 4IOJA 1TNDA 4PC6A 4Q02A 1EFRD 1D2EA 3EIQA 4RZUA 3LBIA 5C4GB 4BRWA 5FPYA 4TYYA 1ZJ6A 2NZJA 5JHGB 3R9WA 1JAHA 4WA7A 1IONA 4QGFA 3AF1A 4Q9KA 4XWOA 1XBTA 4BLQA 5ANRB 3IHWA 2JLSA 4TQAA 1Q3HA 3BFXA 3A1WA 3W6NA 4D0GA 4EUNA 2RGAA 3AKYA 1NF3A 2HF9A 2IWRA 2IF2A 1WDTA 1WP9A 4AKHA 1XTJA 3NHAA 4KXFB 1P4SA 2O8EB 2WWGA 1RRPA 2D7DA 2F9MA 1J99A 5JECA 4PX9A 5SZJA 2OT3B 1W0KD 3RANA 4RKEA 2OCBA 1ZNXA 3KKOA 4LC1A 4ASUD 1TEVA 3VU9A 1ZUIA 1OXXK 4U02A 4B74A 1W0JD 1VKJA 4EKDA 2O0HA 1KSFX 1FTSA 4JL6A 3T06B 2JA1A 2ZRDA 4MGZR 3MJHA 3H2YA 4Q1DA 5CLQA 3N5CA 4OI0A 4HYYA 2NZ8A 1ZBDA 1GWNA 4RKFA 3PEVA 4NTZA 2PX3A 1T0HB 1TF7A 2GTPA 3LXXA 3B1XA 1G64A 4GDFA 1MOZA 2OBLA 2DPXA 2V6JA 4MKIA 2QP4A 3KTAB 4F91B 4IEEA 3CR7A 1W4RA 3VNUA 3FMPB 4IHQA 4PHFA 2A5YB 2A5JA 5CIWA 1GL7A 3NVAA 2OE2A 4M1TA 4Q4AB 4XTCS 3QPWA 4FWIB 2FSFA 2FNAA 4ON9A 1J2JA 1IAQA 1OFHA 2BOVA 5AUPB 2FFBA 1II8B 5E7MA 1SVKA 2I1VB 5C4MA 4MKGA 1RRCA 3CWQA 3GEIA 2VA8A 3IPYA 3U3RA 4M4SA 5J4KA 4PPGA 1V43A 4JLNA 1E1QA 1BH2A 2NPFA 1TX4B 2UKDA 3J81k 4C0QC 4IVPA 2ODBA 4PHHA 4QJ5A 3Q5EA 3ZVLA 3W3ZB 4YDHB 1JXMA 4CF7A 1F6BA 3W5JA 2FX3A 2NO7A 3C4JA 1ZIPA 4RSGA 3X1YA 4KHZA 721PA 4LC0A 1TUEA 4TMXA 2WSSA 4AK9A 4UJ5A 1CJKC 5KU1A 4RD1A 2OG2A 3SEAA 4YMTA 1N6NA 5B58C 1I4TD 2W00A 1COWD 3Q7PA 1G8PA 2DY1A 5J4YA 4QM6A 3GJ5A 4V02A 1KI1A 5FPKA 4LBWA 1KZGB 2FJUA 2NO6A 1Q0UA 2BIFA 1QHSA 3SE0A 2WHXA 3DM9B 4ZCIA 4ILEA 4RD0A 4JMPA 1HUQA 3A1VA 221PA 5F9HA 3GFPA 5FOSA 1VDZA 2X2FA 2QM8A 1LTQA 1ZM3A 3FHCB 3K70C 3PV0A 2VTKA 1TF5A 2ZVPX 1AS3A 4JLDA 5EQTA 2OM2A 3RRZA 3FHOA 1VYUA 5BYKA 1E1QD 5GJWC 2DFNA 2I4IA 2Q3MA 2FA9A 4PSKA 4U5XA 3CPEA 4M1YA 1Z0JA 2FEMA 4LV5B 3PQCA 5FH9A 2VLIA 4URYR 4NKRA 2W2XA 1VG1A 3W34A 2EQBA 3OIVA 1Y63A 4B2IA 2F43B 2J87A 5EXPA 3B2EA 4KITB 1NL3A 1DAHA 4KJZA 2IUSA 4KODA 3RC8A 3GJ8A 2EFEB 4M2LA 4Q4JB 4JSYA 5CM8B 5L3QA 2V6IA 1JB1A 1IN4A 1GL9B 3H1TA 1WMSA 4IDHA 3DDCA 2QN6A 5B2ZA 3T1VA 5DI3A 3CM0A 1RYFA 1NSFA 2XB2A 5J4VA 4HZIA 4OI4A 2FGJA 4PZZA 2QAGB 3TKLA 4PAMA 5CDFE 4MKFA 2GCNA 2AD5A 2ZU6A 2F1IA 4DSUA 4IEIA 4C0BA 4Y0AA 5KDLA 2J45A 1FOEB 2ZJAA 3FTQA 4QL3A 3GLGB 1BYIA 3H4MA 2YYZA 2P67A 1KMHA 2JEOA 4F93B 1WF3A 3KZ1E 3EZ7A 4GZMA 3ADCA 2DBYA 2OCAA 2ZRGA 2A30A 2AKYA 2F43A 2IS1A 2LCFA 3K8YA 2WOOA 1K5DA 1RRGA 3OFNA 2CHGA 2O0KA 1KSJA 2HDNB 1NKTA 4ZI3A 3R7WB 2FPLA 5E95A 1G8FA 1UKEA 1YZNA 1GNQA 1J8MF 1X3SA 1LV7A 4YXWA 1N6OA 2JLZA 4CGZA 4DB2A 3GJ7A 1UKYA 5AUNB 4Q47A 1CJTC 2J59A 2OHFA 3IBGA 5KSOA 1EX7A 3K0SA 4D4MA 1A7JA 3B82A 5H68A 3CNNA 2IXEA 3QKRA 4KYIB 1YR7A 2O52A 2FSHA 1HY3A 5DLQC 2ASEA 2EWWA 3RABA 1OYYA 3CBQA 1KAGA 2OBMA 3BXZA 1OXUA 3M0EA 2BMEA 1E98A 2CJWB 3BB1A 5EP2A 2D7CA 3AVQA 3WNBA 4C0SA 4HDQB 1JR3A 2JLRA 4AKGA 2ZM5A 1JQLB 3BS4A 3TR0A 1I2DA 4FIDA 2ZRMA 2GCOA 4E09A 5FBLB 3TUJC 1G3MA 2IL1A 2Q6TA 4TL7A 2JAQA 4RD4A 4L4UA 5KO2A 2IYXA 1IY2A 2OV2A 4DUGA 3QBVA 2PEYA 3SYKA 4D4KA 2BKEA 4NDZA 4UNNA 3PUVA 2Q9AA 3EZ2A 2AD1A 3B1ZA 3IQWA 4G0NA 4GOXA 2XB4A 4BE7B 3PUXA 3H86A 5TDHA 3GLFB 1E9AA 2HCBA 1NBMD 4DCNA 2IX3A 3NH6A 4DEYA 2OFXA 1P61B 3Q8XB 4G5QA 2BEJA 3BD9A 5FL3A 1W36B 5KYKA 1KIMA 4LJ6A 1FQKA 2XZLA 1W2HA 3NBZC 4JBYA 1LVGA 3WNCA 1G7RA 1J8YF 4HB3A 3OEHD 1GFIA 5DGXA 3FKQA 2GEUA 4LHXA 2V1UA 3GJ6A 1WRBA 1VMAA 3B78A 3JZAA 1XCMA 2QTHA 1U2RA 1Z6AA 4PO8A 2VP5A 3Q7QA 1E2NA 4HAWA 4URVR 4URXR 2H92A 3V9PA 2IHYA 3VR4A 1IY1A 2QGZA 1GDDA 1KY3A 3HU3A 4DCUA 2RCNA 4V0OA 4CEJB 5H1YA 4HAVA 3TK1A 1MR3F 2WV9A 4NYMR 2IYLD 4MYHA 4UNQA 4YDSA 1KO1A 2CVHA 2VBCA 5UKDA 1X8KA 2O8FA 3FFBA 4BGDA 1IJFA 1N6PA 5CB6A 2BHRA 2QSYA 1NVUQ 1JEDA 3C8UA 4JLVA 4A2PA 5HR5A 5BYJA 1R0WA 1YKSA 4P0TA 3AP1A 2FZLA 3P20A 5IF9A 1R6BX 1PUJA 4HEJA 3UWOA 5A4JA 2CCKA 5HKKA 1YR6A 2XTNA 3THXB 2IYWA 4PQFA 4B3CA 3FKSD 4C0JA 2IF0A 2QZ4A 1HE8B 4EPVA 1XXHB 4URUR 1PJRA 3G82C 4B43A 4D4LA 5HZHA 2WIAA 4LWZA 1QHIA 2QMUA 1UDXA 1Z28A 2ANBA 4H1VA 3ZZUA 4IOLA 5D3MA 2JDIA 4FI3C 3AP3A 2FE4A 1Z07A 4C2TA 4R98A 4WZ6A 1NMXA 2C5LA 3AF4A 3B7GA 1E2KA 2WBLC 1YZQA 1DELA 3T5GA 1U98A 2QMHA 1N2CE 1RVDA 3UIEA 3OIYA 2Q3HA 4L15A 4MGIR 2ZETA 1M8PA 2W0SA 4Q4HB 5F9FA 1NN3A 1SKQA 5JCPA 4AI6A 5J4HA 2GRJA 2PT7A 1R0ZA 1N25A 2ZJ8A 2J5XA 1S1CA 4ACAA 2C78A 2ERYA 3CRMA 4LHZA 3SDZA 4L5BA 4C0KA 1P2TA 4CVNA 1NNEA 3PENA 2D2EA 2ZRAA 2JJ1D 4OJQA 4V03A 4DEXA 4GMXA 2ZE5A 3EAQA 4RCYA 5AJZA 1LNZA 1HTWA 2ZJYA 1F2UB 4MRRA 3P4XA 2WIBA 4DLZA 2CL6X 2GJAA 4PANA 1P9RA 4I81A 1GSIA 2YNMA 3GLHA 3KJHA 4HLCA 5CYOA 3UANA 2GVDC 2SHKA 1G4UR 1JEEA 4PAOA 1IXRC 1RJ9B 1N5IA 2MSCB 2BC9A 3ND8A 4TSFD 5EXSA 1U90A 4M53A 4JBWA 1M1YE 2PZEA 4OL0A 1KSHA 1L4YA 1M74A 4CDGA 1NLFA 2CLDX 3EXAA 1G3QA 2H18A 4HUQB 4XSHA 3IDQA 1QHHB 3AF3A 3CWZA 3NHBA 3RC3A 3GLFA 5JJKA 3TJZA 4DIEA 2CNWD 2JJ8A 5JWHA 4FMCF 3FMIA 3BB3A 2Z83A 3ADBA 2PT5A 2IXGA 5LB4A 3TVTA 3I5YA 1M2OB 2J0UB 3R9XA 1DE0A 2A3RA 2WPDD 4OHWA 1A1VA 3CIOA 2PCJA 3ND9A 1NKSA 2CMKA 3K0AA 5EP1A 2ZVQX 4QBFA 2GZHA 1L7VC 4IW3B 1ZUNB 4LY6A 3A4NA 3RRNA 4Q1FA 2XNSA 2ZSBA 4ERNA 1XPUA 3AGQA 1KAOA 3VKGA 3MFYA 4RZ2A 2A2ZA 121PA 4XWKA 4BZPA 3ETLA 1W5SA 4PC7A 3DEFA 1GKIA 2QMOA 2ZIAA 4Z8XA 1SVLA 4OYHA 5A5GA 3CUEF 3SR0A 4FW9A 4QGGA 4CYMA 4TWZA 4ZDJA 2YV5A 4P4SA 1Q1QA 2F6RA 1UDWA 2WJIA 4M1MA 1DEKA 4LHWA 3U3JA 1KGDA 4CT4B 4V0MA 3A36A 4X8HA 5AUQA 1E69A 1VHTA 3LRPA 5KSPA 3THWA 2IS2A 1DOAA 4L9WA 2ZRJA 2UZIR 4YC7A 3QXHA 1ETUA 4IKEA 3SU8A 3VR6A 1J90A 2ZI4A 5B30A 2IK8A 3LLMA 1KI4A 2K5UA 2LKCA 3EWAA 5DIFA 3OE7A 3L43A 4NYJR 1Y3AA 3AUXA 3TR5A 5FBWB 2JLUA 5KHOC 4A8JB 2RGGA 2RGNC 3Q72A 2EVWX 2JDID 1Q20A 2XOKD 5DYGA 3N2EA 3RRYA 2AL7A 3WYGA 3U7EB 1KMQA 5C46F 5F2EA 2XSZD 1KO8A 4DRZA 2QENA 1R5BA 5JS8A 3AVXA 3HR7A 4GFDA 2WWIA 2V7QD 5LPNA 4UXJA 1G20E 1X1SA 3B9QA 3KQUA 1OE0A 1CJVC 3FFAA 4JKYA 1G8HA 5A0FA 3WP0A 2GBLA 3B1YA 2R8RA 5K8UA 2V55B 3SHWA 1E9EA 2GZAA 1A5TA 3RWMB 4DDTA 3RYTC 1AN0A 2XNDA 1QHGA 1EX6A 2HEIA 4HSEA 3SC3A 4MGYR 3IIJA 1XEXA 4KLZA 5L3VA 3U4QB 3JVUA 3K53A 4TMTA 2REOA 4X8OA 4EPWA 4TYQA 1XRJA 2IUTA 1XJ0A 2AWNA 3X1ZA 1F48A 2X8AA 4JVSB 1G41A 1UBEA 3KUCA 5AWFC 1CLUA 4HAUA 5EP4A 3GLHE 2V3CC 4G01B 1NIPA 3AVTA 3B5JA 3LQQA 5E7JA 3EZ6A 4MH0R 1TTTA 1JNYA 4DKXA 4DLWA 5KOYA 1Q21A 1GKUB 1Q22A 2ECKA 1ZC3A 3NBYC 1KDOA 1N5LA 4GRAA 2EFHB 2VP2A 4OQFA 5KPJA 1GIAA 5G41A 1Z6GA 2G77B 3U6KA 3HJNA 3KQNA 2XJ4A 2KJQA 3TBKA 4CT5A 3GJXC 1E99A 4I99A 5FBRB 5KTYA 3QSYA 1QHHA 1H8HD 1J7KA 4EJSB 4JKIA 1R2QA 2BCJQ 1ZM9A 1Z0DA 5JHHB 4V0LA 2ZTSA 4YMWA 1VHLA 2G88A 1TPZA 1M34E 4B2LA 5FPSA 2IW3A 4CW7A 2ZSAA 2GZDA 3LLUA 3REFA 3NWJA 4BFSA 2A7QA 1KNXA 1G9XA 1N0WA 2V8OA 3LBHA 2KB0A 4EPTA 2GKSA 1EG7A 3R20A 2FOLA 4HLUA 1E0AA 4D80A 1WXQA 5B64A 2YWHA 2BDTA 4JSTA 4QJ4A 5HCNA 2BMJA 4TT3A 3DZ8A 4Q7MB 4BUJA 1KK2A 1CS4C 4HDCA 3TE6A 3I4LA 3HR8A 3PUZA 3U7HB 1XMVA 2WJYA 1GUAA 1XPOA 2F3RA 2PMKA 4NCJA 1S4QA 4TLCA 4B6FA 4QGAA 4A9AA 2P2LA 4G1UC 1X8JA 2V1XA 5E3HA 5FL7A 3VR3A 2FMXA 3GEHA 5L3QB 2EU8A 2QY9A 1GOTA 3CF2A 2ZI9A 3QOFA 2HXYA 3QIAA 3ASYA 5GADl 3QEOA 3RLFA 2CJWA 2ZR9A 3CZQA 4A92A 3DVLA 1P60A 4B3XA 3PVSA 3TAHA 2ZSEA 1HT2E 2KE5A 1K8RA 2O8DA 3L8ZA 1P2SA 3H0KA 3T35A 1KDTA 1ODFA 1SVOA 1ZC4A 2YWFA 2R65A 2I3BA 4XD7D 4Z1MA 3CPJB 1II0A 4M1OA 1JBKA 1N6KA 4QG7A 5JI2E 2XGJA 1YR8A 2Z5FA 1YJ5A 1SXJE 3AH8A 1W2GA 1G17A 1OIVA 4DLTA 3U44B 2NPIA 4DWJA 4RFVA 1NVVR 1D9XA 3ICEA 3IHLA 3LO5A 2QSZA 2OFWA 2ZAMA 4GP7A 4RZ3A 4HAYA 2XNDD 3KXKA 3DZDA 1O87A 1W4CA 2ZJBA 2J0UA 4JLBA 1X8LA 2PZGA 2ODEA 1VCOA 2J46A 4QKQA 1FFHA 3CNOA 3HPQA 5DI9A 3Q5DA 1OYWA 2Q9CA 2JLXA 1FMLA 3B85A 3QNUA 2GWHA 2GBLC 4B33A 3AVVA 5P21A 2WOJA 3CRVA 2ZUBA 5BN5A 1NIJA 1ZNYA 2VP9A 4V0NA 5FTKA 4D2IA 1ZINA 4JLPA 2QM7A 3TUIC 1QVAA 3NEYA 1RJ9A 4NONA 3EASA 1UADA 1GNRA 2ODWA 1U8AA 1KI2A 4PAQA 2RGNA 4RVCA 2PX0A 3FWYA 2VO1A 3A4MA 3UKDA 2ZRNA 2IYUA 2XXAA 4XVQA 4DXAA 1Z6XA 2OSBA 3PEYA 5HZKA 4IRUB 2C99A 3TUZC 1W47A 2AHOA 4MDFA 2OCPA 2HXSA 3WHLA 2BVNA 4JBXA 4I1UA 3N70A 4OJKA 1E96A 2D62A 4EPYA 3GJ3A 1I4LD 1EWRA 4PQYA 1G16A 1YR9A 2WICA 4IXMA 4QNRA 5EXTA 1UBCA 4WXPA 1RPZA 8OHMA 3VNVA 3CRRA 3EA0A 2D3WA 4B48A 1VECA 3AKDA 1SQ5A 1Z0FA 2QBYA 1KI8A 3PFIA 3KKNA 1G8YA 1LW7A 4WZBE 1A2KC 1XP8A 1ZU5A 3OEHA 3QXCA 2NO0A 3CX7A 5IDVA 4TTQA 2HYDA 3QVVA 4NH0A 5FUYA 2NGRA 1DAKA 4URZR 3O8DA 3DOEA 1YZLA 3WP1B 4IOMA 2CHQA 1NVXQ 3LX8A 3IILA 3MWKA 1VYVA 4PSVA 5AJXA 2AXNA 2F1HA 1NJFA 1G5TA 3K0CC 5EZ5A 5DN6D 1IXZA 1FX0A 4TLDA 3DMNA 3BJIC 4D81A 4DT1A 1UEJA 1CRQA 3CONA 1XXHE 4X8LA 2IYTA 1KI6B 4KFUA 1N0UA 3FOZA 4ITRC 5F3WB 1OFTA 1KO5A 5CITA 2JATA 1XD9A 4JL5A 4P33A 1IJEA 4D25A 3IEVA 3P4YA 2PZFA 4MUAA 4NMMA 3MUFA 2GEVA 1D8TA 2A9KA 3BBPA 5EE0A 5FTJA 3NBXX 4RFSB 3QY0A 4KU4A 4BFTA 4B34A 1MO6A 1R0XA 2FN4A 1Z6TA 4GOJA 4CZ2A 2ZRBA 3IO5A 2ZYTX 4JT2A 1XEWY 3TH5A 2X1VA 1H65A 1Q12A 1BMFA 5IK2A 2DYKA 1LF5A 2E9SA 4LJ4A 3RWOA 3AVPA 1OB2A 4UXIA 5GJCA 2ZYUX 4TL6A 2V9PA 5KPDA 2RGEA 3LXRA 4QHSA 1VCMA 4HLUC 4M1SA 1CR4A 1SKYB 2QMEA 2QTFA 3G0HA 1VYTA 4LJ9A 1S2MA 2YINC 2EWVA 4G5GA 4GNKA 3D7MA 4MITA 2C2HA 1OHHA 5JRZA 3ADKA 2X2EA 1Z0KA 2RGBA 4LV8B 3CR8A 1XTKA 2ZI6A 4KYUA 1F60A 2O8BA 5BN4A 3AVUA 3M6AA 2P5SA 4LK2A 5FUVA 1ZD1A 3K09C 4OQMA 1JXOA 3NC0C 3WBJA 4A0GA 2JJ1A 1KDRA 4NPHA 4DJTA 4TQUS 4A36A 1A82A 1OH5A 2HLDA 2AK2A 1XF9A 2B6HA 1LY1A 2LWIA 1U0LA 1W4BA 2ANCA 4O2LA 2IS6A 2VSXA 5HE8A 1XDBA 1YZTA 4NYJQ 2ZJZA 2R6DA 2Y8EA 1CJUC 5M04A 3PUYA 1A4RA 1CULC 1G18A 2CDNA 3OFND 2WVJA 4MGKR 3OEED 1JALA 1KO4A 2QAJA 2W6JA 1T91A 1XFAA 4M22A 5KSYA 4R71A 1N6LA 1S9HA 5HTKA 1XMIA 4TSFA 2QUZA 1QF9A 3ZLJA 1KK3A 3WMGA 1YZKA 1OHHD 2W2TA 1W1WA 5DHFA 4C7OA 1Z2AA 2C04A 1ONBA 2G6BA 3UMFA 2O8DB 1SXJC 3UWKA 4DSTA 5G40A 3EX7C 1M7BA 3FPAA 3WY9A 2PLFA 4ZKDA 1VG0B 2TMKA 2ZRPA 3LX5A 1Z5ZA 4FN5A 4Q1BA 4F4IA 4JJKA 2JJ2D 4LUCA 1CEEA 3K9LA 1YHNA 2WMNB 2C96A 4Q4LA 1Z22A 3QKSA 3LWNA 1E9RA 4PSAA 2OO7A 4AIIA 4GMDA 1ZCAA 3W6PA 1R0YA 3WXMA 5TARA 4PHGA 1W4AA 2HV8A 2B92A 4F4CA 2JLQA 3A1SA 4QHYA 2WSSD 3LH5A 2QNRA 1JECA 2J0VA 2XZPA 1CIPA 2YVUA 3OEEA 4HB4A 4Q19A 1DAIA 3MWYW 3W3AA 4ZI2A 3FHTA 3K0CA 3CH4B 1XZPA 2CE7A 2YJTD 2R6CA 2C03A 4QHTA 3M4YA 1SVSA 4DCVA 2JCSA 1E2JA 3THWB 2CNWA 2OILA 1TAGA 2QAGC 2YZ2A 3QBTA 5KUTA 3SQXA 3ZQ6A 4P4SB 2FGKA 4JYCA 2VHUA 3I32A 1HH4A 1SZPA 3U3OA 4NYIR 3T34A 2H8KA 1O3YA 2J3EA 3LFUA 5EP3A 1EFHA 1VG8A 1XTRA 3CKLA 1GM5A 4LGMA 3TMKA 3KJEA 3M1IA 3MWJA 3TIFA 2REXB 4PO9A 1DARA 1ZNZA 5G3YA 2WKPA 3RVBA 3AKEA 3OE7D 4AG6A 1TQ6A 1DAEA 3EARA 1E1RA 1SKYE 5E7IA 3I8SA 4ZCMA 1E32A 2BMDA 3BOSA 3D6TB 2GILA 3TRFA 4H1UA 4J0QA 3A6PC 1Q57A 3B9PA 1GRNA 4OQLA 5JI3E 2JIZA 3B13B 5JEEA 1OB5A 1MRSA 4IXNA 4KCGA 1NY6A 4FMDB 1D9ZA 1S9DA 3AP2A 3RHFA 3K0EA 2C9CA 1G3UA 2QRZA 2V7QA 4M9SA 4C7OB 2QE7A 4ACBA 3AF2A 4Q48A 4LSGA 4BZQA 1N6HA 2N46A 2YWEA 3LVRE 4OK3A 2ZRLA 4NCKA 4TYPA 3TVDA 4AC9A 4PZLA 1X86B 4JJZA 5CLLA 1XXHA 4YLGA 1G7TA 2G1KA 1SHKA 3CZPA 1AQUA 2BBTA 1OXVA 3W9YA 3KB2A 5DE3A 1EFRA 3CLVA 4NP6A 2AXPA 5GVSA 4D82A 2ZXUA 4HATA 2EYQA 3N2IA 3ECCA 1VTKA 1QRAA 3EIEA 3VFDA 3X1DA 1R5NA 3EPJA 4BFZA 3EPLA 1BYUA 2OAP1 4JLAA 3QKTA 1NN5A 4ZDWA 3IQXA 4TZ0A 3P1JA 5C18A 3THOA 2WAYA 3B1WA 2ZI5A 4D6PA 1L8QA 1UF9A 4DVGA 1AZSC 2BJVA 3NDPA 4DCTA 2CHVA 4AKIA 4S2EA 2BEKA 4M0LA 4MA4A 3UATA 4PR0A 2QE7D 5FPHA 3KX2A 2WWYA 3O8CA 4LCBA 1MV5A 2NO1A 4GSYA 1G5PA 3HYTA 2IYZA 1F2TB 4JVMA 3QI2A 4LHVA 4P3YA 2ZPTX 4EJSA 4MYTA 3OESA 2WAXA 3I5XA 4ARZA 4DZZA 4OI1A 3A1UA 4GP6A 3HDTA 4KSBA 2W83A 4RY2A 3WBKA 1FP7A 4Q4AA 2RB4A 5FUWA 3UMSA 3VKWA 4LX0A 5C1BA 4WZAE 4S35A 1K6MA 3L0SA 2XAUA 2GXAA 4Q1EA 3NEJA 2G0TA 4EQ6A 3QJYA 5JCZA 4Q01A 3PUWA 2ZI3A 2J1LA 4D0LB 2KSQA 1EFTA 1E4VA 2W0MA 1XMSA 4E03A 4DLVA 2B7CA 4U7DA 4OKSA 4K46A 4DUGD 1CJMA 2QORA 4AYXA 1EFUA 2Q21A 4KBFA 4UNRA 4JT4A 1KSGA 4XWAA 4QBGB 2B7BA 2EW1A 1JJ7A 2JLVA 1G7CA 4EPXA 3I73A 3LNCA 1FNNA 1GZSA 2AFHE 3FDIA 3D31A 4LI0A 4PO1A 1NBMA 1G5RA 4A4DA 1WB9A 2J7KA 4HAZA 1QG4A 2WSMA 1RKBA 2VP6A 4URWR 3P32A 5JSZA 3ZVMA 1V5WA 1CXZA 2Q0HA 1ZD8A 3WNDA 1ESMA 3K9HA 4UNSA 5CDFA 3GLHB 4B47A 3AM1A 1JPNA 4G3XA 2O8FB 3SBDA 1FW6A 3ZVNA 4Q66C 3P26A 1HYQA 2EFGA 4JLOA 3TSZA 5JMTA 1CKEA 1S3SA 2IHBA 1SXJA 4CEJA 4TZ6A 4JL8A 1OH8A 4W9MC 3BAFA 2QAGA 2R9VA 4LV6A 2KBEA 4LJAA 4XVRA 3DM5A 2HUPA 4QFMA 4EAQA 5JJIA 2Z4SA 5EUQB 1RW4A 3TSOA 1XEXB 4E07A 2R44A 1G291 4Q9LA 1CR2A 3CX6A 4TN1A 4Q18A 2HF8A 3WHKA 2WKQA 1US8A 4PTLA 1XX6A 1DBSA 4NCHA 2A78A 3ZYCA 2QPTA 1NMZA 5IHPA 1E9SA 4M21A 1S8FA 2D2FA 4Y0VA 4A82A 4FMCB 1KO7A 3AVOA 2G83A 2ZRKA 1SULA 3CNLA 1Z0AA 1WA5A 2AX4A 2C8VA 4LJ8A 1S96A 5KNDA 3WRXC 3AB3A 3X2SA 4A2WA 2FSIA 1D5CA 2W6ID 4KFSA 3K1JA 1T5IA 4M9XA 3SNHA 2BWJA 1NLZA 2VPPA 4LJ7A 2ZSDA 4W5HA 4DDWA 4XIGS 2F1RA 1OLOA 3QF4B 1GL6A 2NTYC 1M7HA 4QBIA 1LS6A 1MO5A 2BBOA 1BS1A 1C4OA 4KVGA 1E2MA 1AM4D 4DT1B 1GITA 2VQSA 3TW4A 2QRNA 2JLYA 2CVFA 1P6XA 1XZQA 1T3SA 1ZRHA 3EPHA 1Q44A 1NSTA 1SVMA 5JFGA 4KLNA 4YONB 4TYWA 4QRHA 1F5NA 1YVDA 2OFOA 2HYIC 5TXGA 4BFYA 1GRQA 2XJ9A 1QVRA 3SS8A 1S1MA 5SZKB 1ZMXA 1DAMA 3U44A 2BBSA 2QA5A 5H70A 3ZZTA 4B76A 3FE2A 2HJVA 4OQNA 3A58B 1EFCA 3QEJA 5CK5A 2N42A 4BLOA 1P7CA 3GJ4A 2RH5A 1VIAA 2YWGA 3SBEA 1G3IA 3MSXA 4B35A 3U4QA 5BWMA 4PHTA 4CEIA 2QU8A 3T15A 3BRWD 4GI7A 4RJLA 1P5ZB 1WBBA 1QG2A 5HCIA 2IYQA 1IBRA 4MUBA 4NE2A 3LAWA 2DWQA 4BASA 3OIWA 3PG5A 4JLMA 4EFNA 2ORWA 3KB1A 3GLIB 3KDSE 2DHRA 1TQDA 1ZCBA 5FOTA 3VAAA 3IGFA 2GF0A 2VHCA 2ZRFA 5EJEA 1TF2A 1QHXA 4R7ZA 1COWA 3E70C 3TGPA 1OXSC 2O8BB 2ZUCA 5AJYA 4EPRA 421PA 1FZQA 3D3QA 3I61A 1RFLA 1KK0A 2ZROA 4ZV4A 3QE0A 2QT1A 3KTAA 3L2OB 4LOAA 3B6EA 3O47A 3CPHA 1XTQA 3HP1A 4C30A 1ELOA 2QGNA 4DC9A 4Q9IA 4AG5A 3QPUA 1GAJA 3RRMA 3H84A 3WMFA 1XCGB 4FMDF 3GLIE 2VYFA 3LY5A 1II9A 3AQ4A 4PXAA 4ZDKA 5SZHB 1XD2A 5DSZA 4W7SA 5AK0A 5FTMA 2YOFA 2CE2X 4B71A 1T4GA 3I72A 3LBNA 4MRNA 2YC4C 1DTSA 2UVQA 2YOGA 2ZITA 2R6FA 3BH6A 2IXFA 3CB4A 1Z08A 2GNOA 1B23P 1UBGA 5FTNA 4B6EA 2P6UA 2W2VA 2G3YA 2WWXA 4TMWA 1WBDA 3Q85A 3VHXA 3ZH9B 2BV3A 1E2IA 2FWRA 3HWSA 1NJGA 2XTMA 4WAUA 2B21A 1XPRA 1KK1A 1SXJB 2Z4RA 2D4HA 1QBKC 1E6CA 2NOAA 1E2EA 1UPTA 3AUYA 3V4RA 1DO0A 4AYTA 3EPKA 1KHTA 4XOIA 3L0OA 1OH6A 5FBQB 2BM1A 2CLCX 1PZNA 1NP6A 2ERXA 2VP0A 2O8CB 4BWYA 1IN6A 1XU4A 1KKMA 3FMOB 1FUUA 1R10A 3GLGA 4NYIQ 3GFTA 2RGCA 2GDJA 2HT1A 1T8TA 3I3SR 2A5DA 2GXSA 2ZE8A 3MAAC 3UMRA 1P2VA 5IK2D 1P9WA 1TADA 2EYUA 2ZANA 1OPXA 4M1KA 4R9UC 2IYSA 1NRJB 1OH7A 4XJXA 3ZD6A 1X6VA 2BMFA 5HE9A 2FFQA 4DDUA 2GF9A 5CJPA 4B32A 3SYNA 1W49A 4YMUA 1HV8A 4LBVA 3T12A 1EWQA 5LB2A 4PPNA 4A1FA 5JWRA 3T5DA 2IBMA 4IDOA 5HPYB 2OXCA 5AJWA 2GESA 5KDDA 1XD2B 2OCYC 4I1VA 3MWLA 4ESHA 4V0ME 4CIDA 4WBSA 4ARZB 4BRUA 4HI0E 4AKEA 5L3SB 4C2UA 3FKSA 3HPRA 1FMJA 5BN3A 1VIYA 4BLSA 3KKPA 4PPQA 3E1SA 4F7WA 1DO2A 1G19A 3O8BA 2ZU0C 4HDOB 4XH9B 3OAAA 4HLDA 3W8RA 3V4FA 621PA 3A37A 2IYRA 3E2IA 3OHMA 2GJ8A 2G0NA 2GAOA 5AUOB 5JZVA 5FR1A 3L0PA 3X1XA 3GPLA 2W6JD 4GL2A 2DWOA 4DLRA 5IT5A 4N3NA 1OF1A 4TLBA 3PXGA 1M6NA 5G3ZA 1YRAA 1S0UA 3DPUA 1P2UA 3KFXA 5DH9A 4NU0A 2IEZA 4NL4H 2F1JA 2C9YA 1N3BA 2DFTA 4RFSA 3FVQA 3GD7A 1HQCA 1UKZA 3NC1C 4TLEA 3DHWC 2WWWA 5H8WA 4ZIRA 1TL7C 1Z2CA 1D2NA 2UZ3A 3FB4A 3MG9A 4Q1CA 2PH1A 4OK6A 2ZRCA 2CCJA 3X1WA 4O25A 2JJ2A 4WXRA 4Q9JA 3SJCA 3BERA 2CLSA 2FFAA 3MD0A 2OEPA 5JBQA 2QT0A 1PLJA 2NO9A 5TB5A 3MCAA 3U7FB 1NN1A 3ZQJA 1NG1A 1T6NA 4L9SA 1VCNA 4Q00A 2HCJB 1LS1A 2RGXA 3GCGA 3PR1A 4II7A 1AJEA 1F3OA 1Z0IA 3NXSA 4TMKA 2J0SA 1OV4A 4KAXA 1PVOA 4FCWA 4A8JC 1PUIA 2EFCB 4PQRA 1II8A 5FUXA 1JJVA 4WIAA 3ZDQA 3T61A 2ZRIA 1J70A 4DSNA 4LYJA 4JYBA 5AJVB 1G4AE 4OK5A 4N1AA 2F3TA 4A15A 2VSFA 2IA5A 2IS4A 1R4AA 3ADDA 1F2TA 2P5TB 4DBLC 3NDBB 3VR1A 3QQ5A 3PEUA 4P4UA 4QGHA 2VF7A 4D4JA 3MRSA 4AURA 3SI7A 1U0JA 2R6AA 1T9HA 2J7PA 2IYYA 1GILA 4IFBA 5GJVC 1P3JA 3FMFA 4FCTA 4F4JA 3QKUA 3EZFA 4N0DA 4OHXA 1MO3A 4W5WA 3CH5A 5EZ6B 1GTVA 1W0JA 2PCLA 4RZXA 3I8XA 4P32A 3BE4A 1UEIA 2G9NA 4DCSA 3O8RA 4C4PA 2QQEA 2XITA 1U9IC 4B3FX 1LB1B 2BM0A 1KY2A 1E9FA 1RYHA 1E94E 1ZUHA 3BB4A 3NIBA 4G5RA 4UXHA 3GLFE 1DPFA 4I1SA 3R8CA 1AS0A 1JR6A 2C98A 2P6RA 1BMFD 4R2IA 1KI9A 1N0VC 4EFLA 3C41J 3RS0A 1DADA 3DKVA 1XJQA 3EIHA 4QOSA 2JASA 2QROA 1KI6A 2ZR7A 4RCZA 5D3QA 4PC1A 4ESVA 2ZAOA 4YMSA 3K70D 4PC2A 1HQYE 3BK7A 3C7KA 4B3DA 4OHVA 2PMDA 3F5FA 2GJSA 1N6IA 1OW3B 2B8WA 1MO4A 1FX0B 3HYRA 1Z63A 1A2BA 4O0MA 3ZS8A 2FU5C 3RSLA 3QXXA 4Z54A 5E4FA 1YU9A 2AWOA 4A2QA 3FYHA 4MYUA 1ZM7A 4PC3A 4QM7A 3ZD7A 1TEXA 3BC1A 3I1FA 2IUUA 2MMCA 1IXSB 3LVQE 2VF8A 3NTUA 1AK2A 2OBNA 3AGPA 4JLJA 4LYAA 3MGCA 2VL7A 4CEHB 2BBWA 3RAPR 3CRQA 2VEDA 3BFVA 3SQWA 1H8EA 1OKKA 3U3KA 5KNBA 3IBYA 4FINA 1KI3A 1E9CA 5JS7A 3TSWA 3B1VA 1OJLA 1FQJA 1LFDB 4H9GA 3U7GA 2JLWA 4BZXA 2ZJ5A 4B75A 4EIWA 4B2PA 2H1LA 3F0TA 2RAPA 3KKMA 3EZ9A 3PCRB 2FPKA 5BW8A 1ZVQA 2WWFA 2CK3A 1TU3A 4HAXA 3AV0B 5TV2A 5LBIA 4US0R 1MABB 4FMBB 1AS2A 3AEZA 3NG1A 5FTLA 3LDAA 2AR7A 4G5SA 3T1TA 1KJZA 5DNYB 1ZW6A 1EGAA 1E4YA 1CR0A 1ESNA 1NLYA 4QBHA 2DWPA 2E87A 4AYWA 4MDEA 2VSOA 4RD6A 4JS0A 2ZSFA 2NG1A 2Z0MA 3CRW1 4US1R 5J47A 1U99A 1ZM2A 2ATVA 3BWDD 1YZUA 1IHUA 4JLKA 1UJ2A 2MMGA 2VIIA 2GK6A 1Z29A 3GP8A 1KJYA 2RHDA 3BIFA 4IVRA 4UKDA 4A8JA 3P27A 4HZUA 5J4LA 5CK4A 4DSOA 4IVQA 3B8HA 3PITA 2P65A 3Q9LA 2QPAA 4LYHA 1G8GA 1TMKA 1TUIA 4F92B 1EK0A 3UXMA 4TLAA 2CK3D 2RGDA 4Q7KA 1U81A 3MLEA 4TL9A 5FOXA 2QG6A 1DS6A 2ZYWX 3GQBA 3K0AB 1XWIA 4EJSC 2LKDA 1H8HA 4A6XA 4LJ5A 1JI0A 4PZYA 4BEJA 5JSZB 1W36D 1US8B 4MRVA 1XD8A 2WJHA 1R8SA 4BPBA 1Z06A 2Z43A 1DVRA 3AKCA 4K8OA 1DAFA 1E0SA 4QXAA 3W8NA 3THYB 1YE8A 2J7PD 4NHOA 3KQLA 2O0JA 4I4LA 3A8TA 4CEIB 4DLYA 4DB4A 3SOPA 4Z51A 3G5UA 4DLUA 2WMOB 4KFTA 1BO6A 1OSNA 2V54A 4M9QA 1CR1A 3PIRA 5FI0B 2J9RA 1IM2A 1VG9B 2FH5B 1C9KA 5DHAA 4AWXA 1U9IA 3IEUA 5F98A 1GNPA 2AFIE 2B8TA 1P75A 4NCIA 3CF6R 4TMZA 1E1RD 1Q1EA 4Q1AA 3WRYC 1KNQA 1N5JA 3EC2A 2OAQ1 1Z47A 4QC2A 4BLTA 1E0KA 2Z6VA 1E79D 3I62A 3QPVA 1R5OA 4NBSA 3W6OA 3KJGA 4KV9A 4BFVA 5TMPA 1ZIOA 3W90A 2ATXA 2O8EA 2ZYVX 2GAAA 1PLLA 3JVVA 1IN7A 2JGNA 4YXWD 5HKKD 1BIFA 4LJYA 2CBZA 2W6IA 2WWHA 2RMKA 3QF7A 2YOHA 2F9LA 4P4TA 3CO5A 5KDOA 5DYIA 1N5KA 3ZIAA 4D0NA 4EQ6B 2CXXA 2WM9B 4Q4JA 2A5GA 1W48A 1W5TA 5SZIA 3QKSB 5B57C 2N1BA 5EE3A 2PEZA 2NMVA 1YZGA 2VRWA 2ZR0A 2VHTA 1UM8A 2NQ2C 4UNPA 2H17A 4YMVA 1Z83A 5EE9A 4A6PA 4GT1A 1XB2A 4TTRA 1E0JA 1ZNWA 1HEIA 4AY2A 2GVZC 1SGWA 3HU1A 4IFEA 3VKHA 2HJGA 1E79A 4POAA 1T8UA 3E5HA 4O3MA 4HZUB 5L3RA 4JVLA 4ZDIA 4DHEA 2GEDA 3B60A 4LHYA 4BECA 4WOPA 3EWSA 3TNFA 1N6RA 4BFWA 2VH5R 3WYAA 2G1JA 1KTVA 1NBME 4GZLA 1Z3IX 1QHNA 3C16C 2ZE6A 2PJZA 3ZIAD 1T5LA 3QXSA 4MQBA 4I1OA 2IWHA 1Q1ZA 2AKAB 4HLQB 1JR3D 1AKEA 3QVUA 3C5CA 5EXXA 2PJRA 5D3MB 1L2TA 4TQ9A 2E1RA 4WVFA 3VR5A 821PA 6Q21A 5AR1A 1NG9A 3DKPA 4DLSA 1GG2A 2ZRHA 1ZAKA 2GJ9A 4BLPA 4XTRA 1OFIA 2MSDB 1NI3A 3AVWA 3SJBA 2ORIA 3ZGXA 2ZREA 5EUMA 3IIKA 5FI1B 1VCIA 1TQ2A 4V0KA 3THXA 2GXUA 2GJKA 4US2R 5G53C 3I92A 2I1QA 3QUSA 3QF4A 4AD8A 1GKYA 3VTKA 4KBGA 4YQFA 4ZCLA 4A0RA 4KFRA 1E2DA 1E9BA 4Z8YA 4FD2A 2J41A 3Q3JB 4UJ3A 2OESA 3IPXA 5EE5B 3ONWA 1U8ZA 4OBEA 5CYPA 3T1QA 1FTNA 4X8MA 5DISB 4LPSA 3L0IB 1IN5A 1DG1G 5FOUA 5CB8A 1AQYA 2IYVA 1T3LA 2R2AA 3NBFA 3D8BA 2NIPA 1WQ1R 3DMDA 1E2LA 4FCVA 1G6OA 4DIDA 3K0FA 4OQXA 1HA3A 1SXJD 1P73A 3ZVRA 2H7VA 1JPJA 3BORA 3GLGE 2QP9X 3LD9A 2FEOA 3GFOA 1FPMA 4TL8A 5JEDA 3RS5A 3SFVA 4DDVA 1AGRA 2IEYA 4LZZA 2MSEB 1GRRA 4HB2A 3TQFA 4XVUA 2KBFA 1Q1BA 5K8IA 2HT6A 2F7SA 1E3MA 4KVAA 1XEFA 1YQTA 1R7RA 4IDPA 2AN9A 1RZ3A 3ZS9A 3NH9A 3K70B 1KDPA 1G1MA 4ZO4A 1HURA 3KQKA 5ELXA 2AK3A 3UG7A 4M8NE 4M9ZA 4OHYA 3ICQB 5TVKA 1CBUA 2DFKB 4JIMA 1XNJA 2BJWA 3KXLA 1FUKA 3RSOA 1SVWA 1WE2A 2XOKA 3MJRA 5FFMA 2DCUA 2P6NA 4Q7JB 3R7WA 4MKHA 3GEEA 2QEQA 2XEXA 2KI5A 4BFUA 3K9NA 3IO3A 3SJAA 2FV8A 4P31A 1XTSA 1DAGA 4Q5IA 1EXMA 3SFZA 4D26A 1G3RA 5FBVB 3PEWA 3KJIA 4Q7LA 2ZS7A 5FOWA 1AIPA 2PLRA 1Q3TA 4C3ZA 2VHJA 1OT3A 3RNLA 1QDEA 3F8TA 2A5FA 1GVNB 1UFQA 3DL0A 4TYNA 3S1AA 3EW9A 4LYFA 2QQ0A 1E2HA 5EE1A 2CL0X 1U8YA 4ABYA 1OIWA 2ZS8A 3RS3A 1T0JB 4BQSA 2QTVB 1XCPA 4NCNA 1HE1C 4A0HA 2J0QA 2FF7A 5FR2A 4W5JA 2P0EA 1SVIA 4EDHA 1NVWQ 3V00A 1U94A 2L0XA 2REBA 2OLJA 1D2MA 2HLDD 3IIMA 3TLXA 5L3SA 4R2HA 4IDQA 1IOZA 4HB0A 3IUYA 3SHFA 4QJ3A 4XSGA 3WYFA 2QP3A 4PFSA 2VHQA 3CW2A 4WW0A 1ZP6A 1C1YA 5L8VA 1F2UA 1JQJC 1E2QA 2W58A 3IKJA 1OFUX 3KUDA 3QENA 4LPKA 4A0FA 4C0AC 3GLIA 1MRNA 3L82B 1G6HA 1MT0A 1W36C 3C5HA 3EA5A 5JJLA 2WZQA 2WJVA 5IRCD 5FOVA 3KQHA 3AF0A 3VQTA 5DN6A 4B44A 2CL7X 1CU1A 1HT1E 3UG6A 1X1RA 5KSZA 1NMYA 1AA9A 3K09A 3ZZ0A 2YKGA 3WMEA 4PPFA 3KXIA 1KOFA 2PBRA 4Q4HA 4IJMA 1U0HC 2VP4A 3LW7A 1IQPA 2ONJA 2X19A 4JVNA 1B0UA 1JR3E 2GHIA 1KJWA 3CF0A 3QXJA 3A4LA 4U00A 1P72A 1G21E 3U3MA 2H5EA 4C0HA 5K8TA 1W7AA 4L8GA 1MABA 2GCPA 1M7GA 5DO9A 2R6GA 5LDDC 4EFMA 4KO8A 1CTQA 4TT3D 2D74A 4ZKEA 1Z8FA 2WJJA 4NZYA 3LA6A 3U60B 3RS2A 4DLXA 4O2RA 1IN8A 4GPTA 5J5CA 3R9IA 2H57A 2QBYB 3R8FA 4RD3A 3KL4A 3BH0A 3TAUA 2C77A 3FGNA 3ZJYA 1ANKA 4BEBA 3A1TA 3BH7A 3LQRA 3S1AB 2R62A 1IY0A 3RS4A 4MYCA 5C2JB 2FPMA 2XTZA 3SZRA 4B3BA 3SJZA 3C15C 3VMFA 2QPOA 2XX3A 1TU4A 4M1WA 4C9BA 1ZM4A 1E2FA 4OHZA 3HU2A 1QZXA 3GMTA 2ZEJA 2ZUDA 2V4ZA 2WKRA 4RD2A 3RS7A 3DOFA 2H16A 1PV4A 4C0LA 1FL9A 1R8QA 2X77A 4HUQA 3U2QA 3OIUA 4TMVA 4Q9HA 4TTPA 1MH1A 4XD7A 5DI3B 1GP2A 3BGWA 3VX4A 1MKYA 2XSZA 3VHLB 4Z1MD 5LD2B 2KWIA 4Q21A 4ZPXA 1XEWX 2ZE7A 4E5UA 1ZD9A 2CEAA 1FP6A 2OXRA 1CRPA 3LW8A 3RDPA 1ZYUA 3NKVA 1FNMA 2CCGA 2IT1A 2JIZD 4FXPA 2FZ4A 1OXTA 521PA 2DFLA 4LDJA 5KNCA 1KMHB 2XXAB 1EESA 1JAIA 4HUTA 3LV8A 1RC8A 1P9NA 1KI7A 5GVRA 2WTUA 2ZI7A 2Q9BA 5BXQC 3OF5A 3EG5A 2ONKA 3C14C 4G5OA 4QNMA 2Q3FA 4IOKA 4B73A 4GOKA 4KSCA 4ASUA 4LRWA 2F55A 2PL3A 2RKOA 1KYIA 1YRBA 1NY5A 1RE0A 1RRFA 2C9OA 2OZEA 2FG5A 3K9GA 2DB3A 1ZU4A 3PJRA 1KKLA 1I2MA 1E2PA 2DR3A 1KZ7B 1AKYA 3K0FB 2GXQA 4KI0A 2GETA 3BFKA 1H8ED 1OKKD 3ASZA 2GK7A 3KKQA 3OAAD 3QG5A 4JZKA 5CM9C 5TY0A 3U6BA 2OLKA 5JWOA 3W5IA 3DO6A 2RHMA 1UBFA 2ZJOA 3AVYA 5CIQA 3UPUA 1PLKA 3VX3A 4CEHA 1E2GA 4F38A 1W46A 2O8CA 4ZIRB 1VPLA 4BFXA 2O5VA 1NVVQ 3QG1A 3VU9B 3T1OA 3SYLA 4IDNA 1G7SA 3QKRB 5FPTA 2QL6A 2BKUA 2ORVA 1XMJA 5GJBA 1K5GA 5CJ2A 1UAAA 1SHZA 3JZMA 1Z6YA 1LF0A 4GBMA 4L16A 1DG3A 3TQCA 1RIFA 4CRWB 2YHSA 2D06A 4LBZA 1XJCA 1CP2A 3F3YA 3U5ZB 4UQOA 2FDCA 1CF4A 1P62B 2OUKA 3THYA 2IC5A 2WPDA 3CX8A 2ZJ2A 1BKDR 2ZS9A 2ODNA 1T3HA 3UK6A 1AZTA 2WJGA 3EC1A 4OI2A 4NYMQ
chains in the Genus database with same CATH superfamily
1EFVB 4D9IA 4EY3A 1B41A 1QHYA 1C3EA 4I6EA 4FKBA 2Z2IA 2ZQ5A 4MW5A 3MBOA 4B3MB 5ESWA 3S2GA 4P86A 3CXUA 5LD2C 5E6SA 3RKSA 3QE9Y 2PWBA 5IBCA 1TVKA 3H42B 2HNBA 3H9CA 4UCFA 4D3XA 4KQ2A 2FSGA 3VJRA 1E2BA 1GQQA 1T5OA 1QIDA 5JLJA 2VUHB 3OWXA 3AOEA 5J40A 1BD4A 2BL4A 4Q03A 4GEKA 3A6JA 2J3JA 3WXBA 4HPXB 4JI0B 2R2GA 4LNUB 4ZU3A 1D6JA 2C95A 2AN5A 4LXUA 1W0KA 5EQDA 1RWWA 5ED0A 2HQOA 4QSHA 3BQNB 3I2HA 2GT1A 3ISTA 4XDHA 3MMPA 4D9CA 2NU8A 3ZUPA 4M0CA 4BN5A 3ZGYA 1MENA 1XTBA 5JNWA 3R6LA 2PNJA 1U9YA 3T3NA 4X7PA 2NYRA 1W25A 3PQDA 3FROA 3WV4A 1EFRD 5C4GB 3LBIA 1N3IA 2JFOA 2VJYA 4OH7A 1ZLYA 5EL0A 3COWA 2YASA 5GM2A 3ANXA 1CFZA 4ZXFA 3FI9A 2PL1A 2PS1A 1V4BA 2C2GA 3QYPA 4B4UA 5JHGB 5DK6A 4WA7A 3RAFC 3PT9A 4XWOA 1H9AA 4BLQA 5ANRB 1H6CA 1A0OA 4PV7A 1U3GA 2WWYA 4D0GA 2ZTVA 1OI3A 2K4MA 1N8SA 1UC4B 3OWHA 4D8YA 5ADWA 4BXOB 4W63A 3U4GA 4DQLA 2QRVA 1WP9A 1XZNA 3PFHA 4K26A 3NHAA 4MS4B 5CGQB 3U0VA 3ZV6A 2FXVA 1X2BA 1FC0A 3RB8A 2OYSA 4IDGA 4NIMA 2E21A 2EEZA 1EJ2A 4N12A 5SZJA 3ZE1B 2OT3B 4U5QA 3DEAA 3AESB 4RKEA 3H2ZA 4EB8A 1L7MA 2CDAA 2BTQB 2AOWA 1Y3BE 3BMNA 2HM7A 1IUNA 5B6IA 2XF2A 3V7FA 3L8GA 4ZOLA 3HJTA 1OXXK 2HGZA 2CFCA 5I48A 3QYJA 4KR3A 4B74A 1W0JD 1VKJA 1W1UA 2O0HA 2PRIA 2Q07A 2RGUA 1U9CA 2BRUC 4H59A 5CW1A 1B8NA 4WCVA 1GFSA 1AMUA 2QRMA 2NZUG 3TEMA 4OMDA 5FV7A 5GONF 3ZJ5A 2NZ8A 1ILEA 1JHYA 2IJGX 2PX2A 3OM1A 3M4JA 2PX3A 3NT5A 1T0HB 4RPKA 3TOXA 4EO7A 4NF2A 3JQAD 1T2VA 1EM8B 1U3UA 1DUSA 4ZVSA 2ID8A 3WGOA 3FFXA 1EQUA 2XUQA 3LLCA 4OGGA 5EGSA 2ZYGA 4DLKA 2OHIA 1RPNA 4PGHA 3CR7A 1O5OA 3FNBA 2G4LA 3VNUA 2ZXFA 4IHQA 1I5RA 1SM4A 1SCUB 2E0IA 1XEAA 3BMXA 3L1JA 3NVAA 1J0DA 1DC4A 4KL8S 2OE2A 4XTCS 1BVHA 4I3GA 2Y0PA 3PGA1 1IAQA 4LISA 1CUEA 1P7ZA 2RC5A 1J8QA 4KXNA 5C4MA 2L82A 1GFZA 4QJBA 3UCFA 3ZY4A 2RGWA 3HBNA 3E9RA 4DCPA 3GEIA 4GPD1 5EJGA 3IPYA 5J4KA 3U3RA 4M4SA 1QLHA 4JLNA 3C5VA 1JH9A 3LUPA 4K9LA 5K3FA 4E15A 1QS0B 3LQ2A 4G4SO 4IVPA 2I7TA 2IYNA 4PHHA 2G08A 4QJ5A 6REQB 2WD8A 1JXMA 2IODA 4R40A 1ZSYA 1PJAA 2NO7A 3LPMA 3UXEA 3GBPA 2PQ2A 4A0QA 1R4MA 1BJRE 3S8EA 5KU1A 3N28A 4RD1A 5KAMA 2AGVA 1I4TD 2W00A 3MIIA 4U6QA 3EXHC 1U2DA 4NBWA 1UQUA 2HQRA 3F6BX 1OX6A 1RWXA 2O1XA 1KZGB 1EK6A 1E77A 2R5NA 5BNFA 1KFEB 5TT0A 4C7VA 2WHXA 2CXRA 1NE2A 2L69A 3QLUC 3HXOA 3X2EA 1DJMA 3A1VA 3JARB 221PA 3UJ9A 3SYRA 4GI5A 3T9AA 3TM5A 2Y68A 3ST7A 1Y7PA 5BURA 3PNYA 3PF9A 8MHTA 4ECAA 1SQ0A 3EDMA 4DJ5X 1TF5A 2AOTA 2ZVPX 3KWLA 5EQTA 1WXEA 4ED9A 3NX4A 3FHOA 5LWQA 1S2NA 1WU8A 5GJWC 1LH0A 5LLDA 5AXCA 2FA9A 4RQTA 2QUKA 5MFPA 1BXGB 1V5GA 2GZ2A 3O94A 1L9XA 1G2IA 1MJ5A 1I1OA 2X8WA 4LV5B 3PQCA 4WH0A 2VLIA 1CJBA 3I2GA 4ISBA 4ZEWA 2W2XA 3F4BA 5CA1A 4D45A 5HIIA 3W34A 4DF3A 4IZ6A 4YRRA 2RHHA 2DH5A 4WOBA 5EXPA 4FKZA 3J81A 1Y5RA 3IUBA 5A4MS 1A8PA 2C4KA 1CRZA 5JYDA 1NL3A 3RU2A 1DAHA 1JAXA 1KMNA 3H2JA 3MT8A 3NTQA 1B73A 4L2IA 4WN9A 4ZN6A 1J20A 1WCIA 1THZA 4W5RA 2EFEB 4OQ4A 1EMDA 5L6MB 4M2LA 4ESEA 3E3OA 4TUYF 5JY6A 2AE1A 3STTA 1XZIA 1JB1A 2AQHA 4YT4A 2JVJA 5INTA 5JAMA 1FP2A 2C4TA 1CQZA 3AIMA 4K5QA 4LDAA 4HNSA 4IDHA 2JGDB 1PZGA 4ESOA 3VRHA 5B2ZA 3TXXA 1RYFA 1KS2A 3PL1A 3IOCA 1T1EA 1VL1A 3EXG2 4HZIA 4MICA 4HN2A 1TJ4A 1IBLB 5F5NA 2NTEA 3QEMB 1MJFA 4Y0AA 1SQ6A 1EZZA 1QORA 1Y9JA 2ICAA 2R11A 4GR4A 1P31A 4QL3A 4NV3A 5EIWA 4CM7A 3EK2A 2FXIA 1BYIA 1QH0A 5IVKA 1KMHA 2JEOA 4F93B 1L5MA 1VRCA 3ZGZA 1JNXX 4Y2QA 3SLRA 1AHPA 1K6IA 3KOZA 4NU5A 2A30A 4CGYA 5CT4A 4REQA 3R7DA 2ZZKA 2HHAA 4KP7A 3UJDA 3ZH2A 1MB4A 1GSOA 4G5FA 1RSZA 3QU7A 1OC2A 2CHGA 1WO8A 5CAEA 2HDNB 3UO8B 1CY8A 4ZI3A 3R7WB 3L4KA 2VK4A 3ICPA 3C7TA 4KUHA 3RVJA 3ZDXB 4RZSA 2WQ7A 2FPLA 3ZDAA 2RD2A 1O6BA 3PEFA 4RF5A 1A8QA 4PHCA 3VPCA 2R7MA 3QXGA 4F12A 4O02B 4HC4A 4CGZA 5A7GA 4WGFA 4X00A 1KY5A 1NT2A 5AVKA 1M8JA 1D07A 1WKBA 3MT9A 3W8EA 1YRLA 2J59A 3RSHA 5IANA 4HGRA 1QVVA 3K8OE 3B82A 1K7EB 2BM8A 3CNNA 2IXEA 3E9EA 3QKRA 4XJSA 1SU6A 4MR7B 1FYXA 4N0PA 2C2MA 5DP1A 1AKUA 1PL7A 5KTKA 5LQMA 2EWWA 2HNKA 4LOIA 3WX0A 3L8DA 1Y9AA 4FGKA 2VJBA 3LUKA 3HL0A 2C7GA 1XTVA 2EW2A 1WABA 3N8DA 4WGGA 4HQKA 1R64A 2RHLA 5EP2A 3AVQA 4CR6A 1NUSA 1U7HA 1ORTA 4HDQB 3T4XA 4CLEA 5HKAA 5TS2A 3TS1A 2X9QA 1V35A 3U7IA 2KYRA 4PYNA 4FIDA 4E09A 5FBLB 3TUJC 2JGLA 3GG9A 2IL1A 4GMKA 2G6TA 2PNFA 3K72B 1NVTA 2VT7A 4LVUA 2WUDA 4LZOA 4RSMA 4KK4A 1J2YA 3ENVA 4TWIA 4Y2SA 1O95C 1IY2A 2OV2A 2O3RA 4TV8F 4BNJA 5ICCA 1MIOB 1T1IA 4FQ5A 4JEMA 1YL6A 2BKEA 2YWDA 4OKNA 3NGMA 4NDZA 1JV2B 3PUVA 5COBA 3WGKA 3EZ2A 4DR3B 2AD1A 4EW6A 3M9WA 3CEAA 1QUFA 3P9SA 4JEUA 4PG6A 4UE6A 1K2WA 3H86A 5B1HA 3E18A 3CGWA 4ARUA 1Z4MA 4DCNA 2IX3A 3NHFA 4EHFA 4YACA 2I34A 3Q8XB 4OXXA 2EW8A 6AT1A 2ZB4A 3DO8A 1Z4IA 4EELA 1W5AA 3BD9A 1KQGA 1KIMA 3C3WA 2H2DA 2JC3A 1YASA 5CA0A 1FQKA 1RQ2A 3OZRA 3MUOA 4R1NA 3A4VA 4ZV7A 3SF8B 3SLKA 4AO6A 4WXEA 3WNCA 2DLCX 1G7RA 1Y34E 1ZOLA 5DGXA 3FKQA 1GR0A 4P84A 3KKEA 4LHXA 3P9NA 1B43A 4MVWA 3QJ5A 1ADBA 1FXWF 4B4KA 2SECE 5ADVA 2QTHA 3T9BA 4B7ZA 3PTAA 4Y9UA 2VP5A 5ALSA 2JCBA 2I33A 4H18A 4HAWA 5JFOA 2H92A 1IY1A 1LX7A 1TA0A 1Z5NA 1YRQA 4HAVA 2O2XA 1Z82A 1MR3F 2WV9A 3CG4A 2IYLD 1N2EA 3E6AA 3VH1A 4R0MA 2C7QA 2AQIA 4PYKA 2VHXA 4EY7A 4IIDA 2O8FA 2VN8A 3FFBA 3PNVA 1DDOA 2RAUA 5ESXA 1DB3A 4ETWA 1IXKA 1MXFA 2G63A 1JEDA 4PN7A 4JLVA 1QQ6A 1R0WA 2RKBA 3MTGA 5IAAA 2AF3C 1UQRA 2ZJ1A 3AP1A 4G4IA 1JRLA 5DYWA 2FZLA 2XUFA 4A8TA 3LY9A 5KVAA 4QEZA 1Q0PA 3UWOA 1JA1A 5HKKA 4YAIA 2ON6A 3O3CA 4JZYA 3THXB 3FZQA 2VDRB 3D5QA 5EJ8A 2G5TA 3FKSD 3S5JA 2NACA 2QZ4A 4J1QA 2OBBA 1OVGA 3EXHB 1C8KA 1XXHB 3GEBA 3CVOA 4IIYA 4URUR 6REQA 1RAAA 1K92A 4D4LA 1PQPA 1OGJA 1K7SN 4M88A 2WIAA 1ZH0A 4I5IA 4C7MA 3W1WA 1Z28A 1GXSA 1UKAA 1C3OA 4ISCA 4FI3C 3TXYA 2PQ0A 3FD8A 3HADA 1Z2NX 1Z07A 4D8XA 4C2TA 4R98A 2J6BA 1NMXA 5LU9A 4TS4A 5M5BA 4EW2A 2QN7A 5KC9A 4GHWA 4LRXA 4R9NA 2B2XA 4WK6A 4CG2A 1R6XA 1JIXA 1N2CE 1RVDA 1URPA 4J6FA 4K6MA 2GDZA 1SHJA 1XKXA 4L15A 1JDUA 1CRLA 1M2EA 1NXVA 3FLMA 4AY3A 2O5CA 5ELLA 2ZDGA 2II6A 2QQGA 5J2UA 1NN3A 2A0UA 3KV3O 3U1TA 3COPA 1H2HA 2VT6A 1UINA 2GRJA 3C3YA 3WG9A 1FDIA 2WF9A 4N48A 3NWBA 3A0UA 1S1CA 4IR7A 1YBHA 3B6ZA 4Z0NA 4CQJA 1SPBS 2IVZA 3IP5A 1T26A 3C3BA 3IPLA 1P2TA 4RBNA 5G2OA 2FUNB 4C0KA 1A7KA 4UUPA 3UJBA 3T0FA 1Z6QA 2RCYA 4GMXA 1XI2A 2PFSA 3EQ7A 1HDZA 1HTWA 3TZKA 4JR0A 4IJKA 4CMIA 5CNMA 2E4WA 1U0GA 3P4XA 2CFSA 3PDWA 3OH8A 2ZIXA 2WIBA 3IL2A 4BQFA 3STYA 3DKKA 3H8SA 3ENKA 2ZYIA 3KJHA 4Z7OB 2H29A 1U8XX 3D8SA 1YQGA 3UOGA 1HE2A 2A92A 2X0KA 5KYYA 1Z62A 3HJCA 3N75A 1Y89A 1Z7GA 3OPQA 4OXYA 4NZMA 3LC7O 2FQWA 3AFGA 4L02A 2HMSA 3P7MA 1N5IA 1V7CA 1U1FA 4GXNA 4D9JA 1EM8A 4GQAA 1C0KA 1OWLA 2XCTB 2HJSA 2P0YA 3AU9A 1CT9A 3E7XA 4DZRA 2CLDX 1SBYA 4HUQB 1IZ7A 1VB5A 3OFSA 1E4OA 5JJKA 2D0OB 5LYYA 3QOYA 4UVDA 3TJZA 4D9FA 4DIEA 3LDHA 1JHQA 1COZA 2IZ7A 5JWHA 2H1FA 1KGSA 2JFQA 5DGCA 3RT7A 3PFNA 1DWQA 2B0JA 2IXGA 3TVTA 3PNPA 3OF2A 1M2OB 4OBBA 2J0UB 4XYBA 4P7GA 5K0LA 1DE0A 4U7TB 2WPDD 2XOXA 4OHWA 3VV3A 1A1VA 4MA5A 2IIBA 3EDOA 4UHKA 1UODA 1MF7A 2VQ3A 4UU1A 1HG1A 4UAJA 4G1VA 3TEJA 2NTNA 3W7VA 5BVHA 2P8JA 1M33A 1FSSA 1H93A 3H2HA 4IW3B 3UWSA 4JJEA 1W2WB 4D46A 2I6XA 4GI3A 1U3TA 2XNSA 5ALGA 4ERNA 3CTPA 1WDLA 1T9GR 3ONFA 3VKGA 2CZGA 4IIEA 4EMSA 1HT3A 5LQRA 1GUYA 1EQAA 3KDPA 4M0PA 4XWKA 2QN8A 1W5SA 3ETLA 4KBYA 3M5WA 3OZCA 5CNJA 1GKIA 1U8UA 2E49A 1ECPA 3PL5A 4MTCA 3PDUA 3RVNA 2MR6A 1FXUA 4Z8XA 3GH1A 4L3OA 4AVYA 2O7RA 1CJSA 3CUEF 2IXAA 4UOQA 3SIPA 1JAZA 1JH8A 3KPWA 5T5QA 1N57A 2B1QA 5ALQA 1YAJA 2FPIB 1XZ8A 4QTUB 1OLXB 2PUHA 5CU7A 5GP1A 3WFIA 8AT1A 2YV5A 1GPWB 2F6RA 4N8EA 3QVTA 1HZZA 3A6EA 1N2BA 1L5KA 5KSPA 4EF5A 4LYGA 1RCUA 4I1IA 4N3AA 1OA0A 2Z3VA 2Q5QA 2VNIA 2ECOA 1ETUA 4IKEA 3VR6A 4EUHA 1YZYA 5ALPA 2IK8A 5FLKA 2R7AA 2LKCA 1GT6A 1GPYA 2V7PA 3LLMA 4MKRA 3RV4A 3D3WA 5A6SA 4UNIA 1Y3AA 5C80A 5ITZB 3OZBA 4QPCA 3TR5A 5LP6F 3IT1A 2SBTA 3CEMA 2CLFB 4JUDX 3DJFA 4FW8A 3Q72A 4YQYA 4C2BA 2JDID 4C3VA 5AW0A 5DYGA 1YC5A 3PE6A 3NIGB 2W2LA 5C8YA 3SD7A 5C46F 2H2IA 5F2EA 1G0NA 1RCFA 2YVAA 4B9EA 4QARA 1L5HB 3BGOS 5L7YA 5SY6A 5JSQA 4M8IA 2F8LA 1U3DA 2V7QD 1VLHA 3VSAA 1G20E 1VM6A 4QDXA 2JGFA 4TXJA 1EEHA 3I6QA 1CJVC 1P1KA 5HQTA 2FP4A 2X2PA 5K8UA 2V55B 1J8VA 2A1UA 4KH0A 3TX6A 3IVMA 4YBZA 2XNDA 4JA2A 1EX6A 1PKXA 4HSEA 4I4IA 2NUAB 1YI8A 3STWA 2QKYA 4TKUB 2C4UA 3IIJA 3EMKA 2HF2A 1EVIA 4WZBA 3U4QB 3K53A 3ILXA 4LZNA 2UVPB 4W8GA 3R8XA 1F4LA 1QFZA 4EPWA 4TYQA 1XRJA 2EATA 1XJ0A 3FZYA 1EINA 2X8AA 1O0BA 1D2RA 4GKJB 4LE0A 1AF4A 2XMPA 3WQRA 1ODJA 3H17A 4DC0A 2Z5GA 3HUFA 4G9EA 3N7TA 4PIPA 5HRCA 2W2OA 1YB5A 1NIPA 3AFMA 4GX2A 5ERYA 3UQYS 4KR2A 3JQGA 1Q21A 2QDKA 1Q22A 1VA5A 3OZFA 1KDOA 2B8EA 4J90A 4OQFA 4CKBA 2CV1A 2VG8A 5KPJA 3ROGA 1I1NA 5G41A 3IP7A 4Z9YA 5BVGA 1FDWA 4V1CA 2G77B 2Q28A 3I34X 2QN9A 3ETJA 3PQ6A 1TA9A 4QXPA 2HO5A 2XYQA 3KYBA 1I36A 2G17A 3GEGA 5FBRB 2HMWA 4I99A 4O4LB 1T0BA 3L6CA 1QHHA 4NBTA 1QAOA 2G07A 4MMZB 4E51A 4JKIA 4ZJPA 1M6WA 2BCJQ 1Z0DA 1O94C 1VHLA 5EA2A 5KYWA 2WLSA 2M9MA 3ED1A 4KN5A 1EA5A 1KYXA 4B2LA 1T9KA 3PJDA 4D8UA 5FPSA 1VBNA 1MW8X 2EL9A 2JGRA 3WTCA 1M8KA 4AULA 1K08A 2F3UA 4BFSA 1G9XA 2NUPA 1N0WA 4JI2B 3LBHA 4I4NA 2AW3A 4KGZA 2GKSA 1EG7A 3D3JA 1IRXA 1VI6A 5T41A 4W99A 1E0AA 1P2GA 4ARBA 1EHIA 1A2OA 3EEBA 2RDMA 2W8BB 2BMJA 3WL6A 1ZQ1A 4BUJA 1L3CA 1CUWA 1KK2A 1R0KA 1BHSA 4KIJA 4YJFA 1PJCA 5JANA 1T2EA 1T4CA 3HR8A 4BQRA 4F97A 4YX9A 1GXSB 1SHTX 4L27A 4L28A 2O9JA 1YS6A 2QX8A 3DLHA 3EMVA 2H7CA 2B9VA 4QRDA 4ZAYA 3SYTA 1S4QA 3H83A 2EIHA 4E11A 4G1UC 1X8JA 5E3HA 4E5VA 2HF7A 1PZFA 4ZEOA 4G89A 3GEHA 5DU2A 3OMWA 1JHPA 1OZHA 2O20A 4BUCA 3IBTA 5KVCA 1BOOA 1YDMA 2JFNA 4QDOA 3QOFA 4ZZ2A 2HXYA 3QIAA 3ASYA 5C8XA 1RNLA 2DQZA 1NFFA 1T43A 2CJWA 3CZQA 4NJMA 4A92A 3DVLA 3ELBA 4B3XA 1YZVA 4G2NA 4IHJF 3A9SA 1EBUA 2X6TA 3LUAA 3TZLA 4X41A 5HA5A 2O8DA 3T35A 1KDTA 3TOVA 3OHSX 4YR9A 2J6CA 3QPBA 1RXUA 1ZC4A 4RJTA 1BD3A 5BSEA 4NY1A 5FBHA 5JU6A 3IJPA 3PA6A 3JQDA 3EQ6A 2IKQA 3A2LA 3E53A 3TRDA 1O9HA 1JHDA 3SZOA 1Y5MA 1RM4A 2OPBA 3N8GA 4EG1A 1AMNA 2XGJA 1YJ5A 4IXDA 4DMHA 2NPOA 1G17A 1OIVA 4K6OA 4Q6WA 4ZZ0A 2YXPX 3TZEA 3GVPA 5ERXA 4PLVA 1SCAA 5ALKA 1PZHA 1XDDA 2L2QA 4J7XA 4MW0A 1D9XA 3VZSA 3ICEA 1YL7A 2QSZA 4RZ3A 3W5AA 3KAKA 3RCBA 4BLUA 1LA2A 3DZDA 5ESRA 4JJAA 5ALEA 1FDUA 1W4CA 2VTDA 2J0UA 1EUCA 3OCYA 4JLBA 3F5DA 5LOVB 4EG3A 1U11A 3NBKA 1A9OA 2G9QA 3TVYA 2HCRA 2H5JA 1FFHA 1A8SA 3CNOA 3QTLA 4RPCA 3TQIA 5EJ9A 3DOJA 3A70A 1SURA 2FOXA 3Q5DA 1C8BA 1QCCA 3B85A 3QNUA 4INZA 5AM0A 2I03A 3FYTA 1RZVA 5BSUA 3ZVKA 3CVUA 2GBLC 4B33A 2WE8A 2PWZA 3PPYA 5P21A 5JAPA 3DZFA 3QUTA 2BGGA 1KEUA 3SSAA 5CYGA 1YQQA 4LYYA 3EBLA 4ZGBA 4G8JA 3GP3A 2DHQA 4C4AA 1RJ9A 2AG6A 2IP1A 4E3ZA 1E92A 2CSXA 3EASA 4TS3A 1GG9A 1KZ4A 1H9BA 2GAJA 4IRMA 4UTNA 4RMGA 3DAHA 2HK8A 4UBIA 4UDXX 3DFMA 3FWYA 1T2UA 2VO1A 4WNCA 5CUQA 4ZWNA 4MVJG 2DMRA 3A4MA 3MIZA 1V3UA 3BXFA 4XVQA 2RIPA 3DNFA 2OSBA 2VFAA 3FYCA 4LVOA 4UUQA 1VLZA 4IRUB 3TUZC 2QN3A 3FVWA 3H2IA 3NVMB 2OCPA 5DB4A 3JATB 1NBOA 5BW5A 5HQ3B 2BVNA 4JBXA 3RC1A 2VF2A 3AT1A 4AX4A 1WPXA 1N2JA 2X14A 3KG2A 2NT3A 3LFHA 1UJBA 5EESA 3FOCA 1UWLA 3IVXA 1GD1O 1YIOA 4Q9NA 4IXMA 4QG3A 1O6CA 2GWRA 3VOAA 1G8AA 2I55A 1UBCA 4WXPA 2G8LA 1Y42X 2UXCB 3E1KA 5DZSA 3EA0A 1ZX1A 2D3WA 1BW9B 4X9XA 4FNOA 2GMWA 4KR7A 2XWQA 4IJWA 1V6CA 4AZWA 2CL5A 5CLJA 5JZOA 1KI8A 1K7FB 3PFIA 1A5SB 4CDMA 3O93A 4N3BA 4C1NA 3CX7A 3WJ1A 2FRDA 4F60A 3MA0A 2ABWA 4E1AA 3SS9X 1TJ3A 3H7IA 2HADA 2P9EA 3LRTA 4V0RA 4AF7A 3DOEA 3IVRA 4QJIA 2CLMB 3WP1B 5AVYA 4BO8A 5JSFA 2XYRA 3FPFA 3G2NA 4PSVA 5AW4A 5JNTA 4LA4A 2F1HA 1K0UA 3RRBA 3D7KA 2EBFX 5DN6D 4UU8A 1Y4ZA 2BM9A 4ZCRA 3L8EA 2QU7A 3O8QB 1XYYA 4D81A 3WMRA 1CRQA 4R8RA 5HGJA 4MVJH 2Y05A 3KTOA 4X8LA 1U1CA 4KFUA 2UUBB 3KHKA 1BROA 4XWWA 1OLUB 2MSNA 1OFTA 2P30A 1KO5A 1E5TA 1T6YA 1O97D 1UDRA 2JATA 3NUGA 3S2IA 3VC3A 4EI7A 4JL5A 2BI7A 1UP4A 3E5RA 1IJEA 3AR8A 3IEVA 1G42A 2BFBB 2IIPA 3P4YA 3DCJA 2YMPA 2IOFK 2YXDA 3R3VA 5FD8A 4AL4A 2R8EA 2A9KA 2A1IA 5LMZA 3D3KA 1GQ2A 5DCYA 2DG2A 1C30B 1F4PA 2WYWA 3GQVA 4G84A 1E8MA 2G5CA 2WHQA 3G5LA 4BFTA 3S27A 1MO6A 2XCRB 1FFYA 3AHCA 3FSGD 3VO8A 2FUEA 2CXHA 3DBRA 4PLFA 1XEWY 3BREA 5JDIA 1MA0A 3DP9A 3EY9A 5IK2A 4XRRA 4CLOB 4LJ4A 3UJHA 4LKOA 1HDCA 3WADA 1VE9A 4NDAA 1OB2A 1D04A 3GW8A 2F90A 4ZMRA 3KZNA 3HM2A 5C8YB 3W1EA 1CR4A 2QTFA 1OXKB 3ESCA 2AR0A 1VYTA 3GP5A 4DIBA 2G7MC 2G9ZA 2EWVA 4M7OA 4G5GA 5SYMA 4BQPA 3D7MA 1EA7A 1OHHA 3F5SA 2CVZA 1DZ3A 1TO1E 4LWPA 1V2GA 3DTYA 3ZNQA 1Z0KA 4OP3A 2IPXA 2RGBA 4H0FA 4TMFA 1L7OA 1XTKA 4BTVA 1PFKA 3QFRA 1FNBA 1LBQA 1UCFA 4DJAA 5JZMA 2WD7B 5BN4A 5FUMA 1IWPB 2QWXA 2VJKA 4M36A 3O2JA 3DC2A 1LNQA 1NM5C 5AOVA 4OQMA 1JXOA 1P19A 3ZQ4A 4NPHA 3D6FA 3B48A 5FQNA 1PNQA 2HD4A 2VQDA 2HLDA 4AIRA 1HOXA 1T2AA 2VXCA 2B6HA 2JIRA 4GS5A 1LY1A 4K6HA 4P3NA 4YRLA 3I05A 5AD1A 1NFQA 1MOPA 2XRFA 2VSXA 4F3KA 4XQGA 2ZIFA 2X1LA 3UWDA 4QBTA 4G0WA 1YJQA 2BSAA 3IXQA 3LGAA 4LE2A 5LYJA 2QZZA 1ENYA 1XFDA 3OFND 3ZGOA 1JLLA 1FIUA 1WX1A 1T91A 3ABZA 4CDRA 1XFAA 1VJ1A 3CCBA 1NKVA 1N6LA 4C6SA 1EU1A 1GA4A 3OM0A 3O7MA 4P7BA 1U7TA 4O4JF 1KK3A 5AKLA 4HDNB 5C1DA 1W0CA 1PTKA 3CZAA 4OMUA 1L5YA 3UGTA 4C7OA 1ONBA 2G6BA 4BMXA 4MJ3A 2DTEA 3GCXA 4FHEA 2MCFA 4DSTA 5G40A 3EX7C 5CCDA 3WY9A 1P2DA 3M2TA 2FP4B 1ZMRA 4MS1A 1VG0B 2ZRPA 2PRKA 1JG6A 2J4CA 4F4IA 5IWCA 5AKYA 4Q4LA 2C96A 2PSSA 2AOVA 2WMDA 4X0EA 4Y2PA 1YBFA 3X2FA 1V95A 1TIBA 4C22A 2OO7A 3CO0S 3WMXA 4AIIA 3W2GA 4DBZA 3WXMA 3FDXA 4EUEA 3LKZA 5A03A 5TARA 3W2EA 3P8ZA 4I0WB 1OYOA 3EG9A 4PHGA 4QLOA 1VKRA 5BSRA 2OQIA 2HV8A 4GUDA 4KWTA 4Y1GA 4ZT6A 1FFAA 3N3AC 5EJIA 4BNYA 1M54A 2PHZA 2XA1A 4RZIA 4S2UA 4FBMA 3KYCB 2XZPA 2J0VA 4W7IA 3OEEA 2Q7XA 5HXAA 1XLTA 1DAIA 2HK6A 3HYCA 1SZJG 4E46A 1EG2A 4KIGA 5HOEA 3K0CA 4KO2S 1ZN9A 4RE5A 2CE7A 4FBGA 4ND6A 3S2YA 5D1NA 1N9GB 3FAKA 1A9PA 2IUYA 3PP8A 4UU0A 4YJ2B 5EJ2A 2AFRA 2J07A 2Q5JA 3WA7A 3QQPA 1XHEA 2NP7A 1TAGA 4ZI5A 2Y4OA 2ENUA 3HN6A 4RHUA 2YZ2A 3QBTA 4FYVA 3PU6A 5CT5A 3C8ZA 3VUEA 4AAYA 4P4SB 2FGKA 3RTAA 3A1FA 3I32A 5JW6A 1SZPA 1U2TA 2CXOA 2X0JA 4UULA 4YPOA 1XTRA 3CKLA 1SWVA 2QLJA 3DQQA 4QREA 3ZUGA 2O3JA 2XGSA 4L0MA 1QK5A 1Y5IA 4LGMA 3KJEA 3QY9A 4RKQA 4CM8A 5HJ7A 5EEHA 4KQIA 5ALYA 3TIFA 2REXB 3NETA 3KR9A 4MLZA 3MTIA 5C9ZA 3M8KA 3RVBA 5JNVA 5KKCA 4PTYA 4PBSA 2DHDA 1C50A 1EE2A 2E7ZA 5DNCA 3F78A 1MNAA 1JA0A 5E7IA 4FP9A 4RMJA 2WUFA 3DAGA 3BOSA 2P7HA 1RHQA 3AI7A 1G20A 1JEYA 4MI3A 3HCFA 4H1UA 2W2QA 3TRFA 3DEZA 1TVCA 1BEEA 4J0QA 3PB3A 2WUVA 2ZW9A 1ARZA 3N0TA 4YDQA 3B13B 2OC9A 4K9DA 1MRSA 1NY6A 1A9TA 1F14A 3ZW9A 1QIGA 3RHFA 4CLRA 5DHRA 3DQPA 1G3UA 3IV9A 2PVPA 4M9SA 2CNOA 4ACBA 4AN1A 2O5EA 2FI1A 3ZLUA 3IV6A 1KBOA 1N6HA 3JZIA 3UICA 4OK3A 2ZRLA 3CLKA 2JNWA 3G8CA 4J9VA 1YQUA 4PCAA 4GPZA 4ZT5A 4AC9A 1X86B 3WNZA 5T8KA 3WVNA 3GGSA 5CDHA 3X1JA 1D4ZA 3F49S 1OUMA 4F2PA 4WBNB 5F77A 1SHKA 3NJ8A 3RTGA 3KZVA 3F46A 1DQZA 2E5FA 3CZPA 1RAFA 5EYPA 1CDEA 1ODTC 3SFTA 2BBTA 2AVDA 5AW9A 4ZCQA 4ZFNA 4G0XA 4RDHA 1ICIA 2I71A 3BE8A 2BMWA 3H3JA 1KJNA 1J23A 4HATA 1SN7A 3PPXA 1P8JA 4R6WA 1VTKA 5MHTA 4R41A 2V6FA 1CSEE 3KXDA 4KQ6A 1W59A 3WSTA 3EPLA 1Z7BA 4WJLA 1C9MA 2V7WA 4JLAA 3QLEA 2IIVA 4GXTA 2D00A 2A6PA 3NPMA 1TUBB 1M2KA 3B1WA 4D6PA 4Q3CA 4TZTA 2JLBA 2YICA 3TI7A 3VYRB 2RJ3A 3NDPA 4S24A 5HS6A 4RNCA 1X14A 4CL2A 2QTZA 2BEKA 3UAWA 4M1EA 4RVSA 3J7AC 4YFYA 3UATA 3EOZA 2V5UA 4Y0NA 2DBRA 4Y6OA 3KX2A 3PE4A 5FPHA 4D74A 2WVHA 2V03A 4LCBA 4JBIA 4XPIA 1MV5A 3GLRA 4CTKA 3CVVA 3A9UA 4GSYA 1AUVA 3DLPX 4JOSA 1FMTA 2IYZA 3UJAA 4ENUA 1RLUA 3DOHA 4P3YA 4HRVA 4MYTA 1C7FA 4RTOA 1AV6A 2IXTA 2IDJA 4Q12A 3A1EA 3A1UA 3KQVA 4JYZA 2D5AA 1KEVA 2J33A 3Q7SA 3WLJA 1KRWA 1PEDA 4OF4A 3JYPA 1A9RA 3UMSA 4WZAE 2IPAB 3LHFA 1K6MA 2X13A 2G0TA 4K6GA 4EQ6A 3JQGB 5HMLA 1CZHA 5JCZA 5ECDA 4RPJA 1MEEA 4D0LB 3DZCA 1EFTA 4P5EA 5DULA 2OV8A 1N2XA 2PZKA 1T2CA 2VYND 3EYWA 2N0SA 3HYLA 1T4BA 4K46A 1AKQA 1L5OA 2BZ0A 5G1NA 1K75A 3U4HA 4WI1A 4UNRA 2BI8A 4ETIA 3K96A 4XWAA 4MPJA 1PGNA 2FFJA 5LBUA 1PV2A 4QBGB 4CIWA 4Z86A 4DA0A 3JQFA 1J09A 1SB9A 4GO1A 3RFCA 3A1NA 1SCIA 3IMKA 3LNCA 5LA6A 3FDIA 3Q1KA 3D31A 4BO3A 4IINA 1DWOA 3MWEB 5F1OA 3INTA 1RKBA 4LX8A 1RJDA 3OJXA 5JSZA 3ZVMA 3CYFA 1V5WA 3K35A 1K4KA 1CXZA 3VNBA 3ZZ1A 3C3DA 1A5AB 1BA3A 1M2JA 2R47A 3K9HA 4UNSA 3GLHB 2YYSA 2K7ZA 2OQVA 5ENDA 4OQZA 3ZG6A 4B47A 4J7CA 4KFCA 1CNMA 1ML4A 1Z13A 2EFGA 5A2QA 3TSZA 3ESBA 1S3SA 2BGIA 4N6NA 3MJTA 3DMPA 4W9MC 1FVFA 3M6XA 4G56A 2IH5A 4N41A 1Y1SA 3DBVO 2YW9A 2Q1XA 1AU9A 1UXOA 3DM5A 1JHXA 2C3PA 2QD1A 3DOIA 3O9MA 4G26A 5ITVA 5EUQB 1RW4A 4WESB 3ND5A 3RFXA 2NV6A 3LUFA 2VJLA 2R44A 5EG5A 3CX6A 2PANA 2QJWA 2YMLA 2HF8A 4U2CA 1SXPA 3P0IA 2OECA 2WKQA 3ANSA 1Y82A 2J31A 2A78A 3OY7A 2QPTA 2R00A 3KKLA 1A5ZA 3QVLA 1ZFNA 3VPFA 2H9YA 3H1EA 4QQKA 3UAGA 1D09A 3A6GA 2QXUA 2BHTA 1HLPA 2G83A 2FZKA 3CZ4A 5JDCA 1Q11A 4LJ8A 5KNDA 3BXEA 5LUBA 2EJUA 3O8NA 3X2SA 4A2WA 5K45A 2W6ID 2DBVO 1KJIA 1NHGA 2OCXA 3WZMA 3FNFA 2ZSDA 4UTOA 2F1RA 2OXTA 2NTYC 1M7HA 4K9MA 4DTCA 1PQUA 4NAUA 2LP4Y 1E2MA 2ADFA 3AZPA 3IAAA 1X1EA 2BTOA 5E8RA 4UPDA 4EW1A 2H08A 2FQYA 1H69A 1XIVA 2QJRA 2NSYA 1CUGA 1GITA 2OMKA 2ST1A 2VAWA 2V98A 2J3MA 3CV3A 1VBFA 2ZK7A 1Q44A 3V7UA 2AC7A 1N2OA 2MIIA 4PU0A 4TYWA 4GSLA 1YVDA 2OFOA 1Q7EA 5BUZA 4BFYA 4Y2GA 3V33A 1GRQA 4F71A 3E5MA 4H7IA 4J75A 5HG0A 3UMBA 3SS8A 5L4NA 1S1MA 4RK1A 4QUIA 3E4DA 4TXNA 3K1AB 4HWTA 4MI6A 4DG9A 4D79A 3TDKA 3U44A 2BBSA 3CUUA 3ZZTA 5EJ6A 1WKVA 1Z39A 4G8BA 4DCJA 1GLVA 4YUYA 2IGBA 1EFCA 2G76A 3KT0A 3V42A 3GMIA 1P7CA 2XIJA 4AJHA 2RH5A 4E4YA 4P34A 3SBEA 1BKSB 2HJRA 1G3IA 2B78A 3SDBA 2EX4A 3MSXA 4BCCA 5C3MA 4WZAA 5EIEA 3T15A 4GI7A 3SF0A 4RJLA 3MVEA 4DA6A 4E5MA 1YVRA 1IBRA 2QTAA 1G6Q1 1XRMA 1Z8NA 5LOVF 1VJTA 2JVIA 1PU2A 3OOEA 3TTYA 2X40A 3D6VA 2VRCD 4JLMA 4KXMA 5SY9A 4BNTA 4CETA 4MV5A 4Z49A 4I46A 1RWNA 1V6AA 2AE2A 1TKBA 3GLKA 4NQRA 1JDVA 1UAYA 2MYTA 2M1ZA 4KQ9A 4P54A 1QX4A 3TN7A 2CXPA 1TF2A 1BS2A 4MVJE 4R7ZA 5C34B 2XF8A 3E70C 1EDZA 2ZUCA 4BLWA 3WHPA 5AJYA 1XAGA 5H3HA 4LZAA 4AN0A 3OUZA 3VO1A 3CUYA 3I61A 1LWNA 3RSQA 3NWEA 1JB9A 1T5DX 1WB6A 1C0PA 2R7NA 4DA7A 3QE0A 2QRLA 4ZEVA 2QT1A 3C8DA