1VICA

Crystal structure of cmp-kdo synthetase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
255
structure length
255
Chain Sequence
b'SFTVIIPARFASSRLPGKPLADIKGKPMIQHVFEKALQSGASRVIIATDNENVADVAKSFGAEVCMTSVNHNSGTERLAEVVEKLAIPDNEIIVNIQGDEPLIPPVIVRQVADNLAKFNVNMASLAVKIHDAEELFNPNAVKVLTDKDGYVLYFSRSVIPYDRDQFMNLQDVQKVQLSDAYLRHIGIYAYRAGFIKQYVQWAPTQLENLEKLEQLRVLYNGERIHVELAKEVPAVGVDTAEDLEKVRAILAANGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
molecule keywords 3-deoxy-manno-octulosonate cytidylyltransferase
source organism Haemophilus influenzae
molecule tags Transferase
total genus 79
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.7.7.38: 3-deoxy-manno-octulosonate cytidylyltransferase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02348 CTP_transf_3 Cytidylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 1vicA00
2GGOA 4FRAA 4D11C 4G3QA 2YQSA 4CJ8A 1FXJA 2Y6PA 4KPZA 1EYRA 2FFVA 3TZTA 1H4DA 1YP3A 4EEAA 2X5ZA 1MP5A 4CJBA 5FU8A 4AYLA 1R7UA 5EIYA 5CQNX 2OI6A 1QWJA 1LZIA 3OH3A 4Y62A 1HJLA 1ZJ2A 5AJNA 3U2TA 4XWIA 2GGQA 4M28A 1JYLA 1ZJ0A 3ZLLA 4FROA 2Z87A 1MP4A 4B2XA 5JQQA 3I0DA 4DDZA 1ON8A 2AM5A 1H5RA 1VZUA 2PX7A 3V0LA 4HO0A 1H7GA 2Y4LA 3HL3A 4M2AA 1NQIB 2WVKA 4UEGA 1XZ6A 4Y7UA 5C4FA 4KNRA 1H7QA 1G2VA 1VGTA 3TQDA 4IRPA 2QKXA 1FGGA 1V83A 2RITA 3SXBA 2D0JA 4MNDA 1H7FA 3SPTA 2XMHA 2OI7A 3V0QA 4EEGA 1INJA 2WGZA 4ASYA 1ZI5A 1G0RA 2FFUA 3I0KA 3CKVA 1R81A 2RJ8A 4FRPA 1HJJA 4NALA 3U2VA 1VICA 3PNNA 5C3AA 2Y4KA 1FO9A 2BO6A 3BCVA 2I7BA 2V0IA 4KQLA 1H5SA 4AAWA 1H7HA 2RJ0A 3V0MA 5FU0A 1V84A 3RSBA 4KT7A 5J49A 2RIXA 1ZI1A 4KXOA 1INIA 2WE9A 3IOIA 3E26A 5CMIA 1MP3A 4ARWA 2WVMA 1H4CA 1FZWA 5I1FA 2VXLA 3IOJA 4FRQA 2UX8A 1QGQA 1FO8A 2O1HA 4D0ZA 1JVDA 4HG6A 4Y6NA 4B2WA 2V0HA 3OH4A 1O7OA 2V0JA 5FYEA 5AJOA 4LW3A 4FRMA 3ZLKA 1PZTA 1ZCYA 1V82A 1O23B 4G87A 2ICYA 1H7LA 4B3UA 2FY7A 4LW6A 1NMMB 1H7EA 4KNXA 3Q7UA 3QVBA 1G97A 3POLA 2Q4JA 4ASJA 2W0WA 2CU2A 4KRVA 1E5KA 1ZIZA 1GWVA 2VS3A 2RJ5A 4ZDQA 4FCUA 2RJ6A 5L6SA 2PA4A 3T7MA 3LW6A 4FREA 2YESA 3I0LA 3T7NA 1S4NA 3IOHA 4HOCA 1ZI3A 2OEFA 4EE3A 1GQCA 3U0XA 4HO3A 3U2XA 1I52A 1WT0A 3F1YA 2AESA 3EE5A 1GWWA 4Y63A 1JV1A 3FOQA 3I0EA 3V0PA 2P6WA 3RMWA 1Z90A 4EEMA 5CMGX 2JCJA 1W77A 3NGWA 1H5RB 5BXCA 1TVYA 3D98A 5EJ1A 1K4VA 1XHBA 1IINA 1ZJ3A 2P72A 4B42A 2D7IA 3ZGFA 4G3PA 2VS4A 5C49A 4DECA 2XWMA 4FQWA 1VM8A 4AYJA 4EVWA 5CMJA 5CQPA 2QH5A 4D48A 2I5KA 4B4MA 4Y7FA 1JV3A 4HO4A 5C1GA 5C48A 2AGDA 1G93A 1NF5B 1TZFA 3USRA 2AM3A 1HV9A 1ZHJA 3DUVA 3U0YA 1WVCA 1WT1A 4K6RA 1JYKA 3OH0A 2AE7A 4FRDA 4Y6UA 1YP4A 1H5TA 1VGZA 5C3DA 1FR8A 3V8YA 1ZDFA 2Y4JA 1FG5N 4EE5A 1VPAA 2JCKA 4FRBA 3D5NA 4FCEA 3DJ4A 1H4EA 3JTJA 1H5SB 4ECMA 2OI5A 4BMAA 3SXEA 3OGZA 1FOAA 1GA8A 1GX4A 3U2UA 3V0OA 1WSZA 1W57A 2BO8A 2WVLA 3CKJA 4E1KA 1OMXA 1VGUA 1R7VA 3RMVA 3T7OA 1NWGB 1QGSA 1TW1A 3SXGA 4MYBA 3DK5A 3Q80A 2QGIA 1H3MA 2ZU8A 2WAWA 4D11A 5IFYA 1R7TA 3USQA 5IDSA 3CU0A 2XWLA 1S4OA 2RIYA 3I0GA 2RJ1A 5C1LA 1ZDGA 1YROB 2W0VA 5C47A 3SXAA 4Y7TA 2APCA 1PZYB 1R82A 1TW5A 2YCMA 5EJZA 1H7TA 1G23A 3V8ZA 1VH3A 2O1FA 1MC3A 1G3LA 3R2WA 1G95A 1LZJA 1HM0A 1NKHB 4IRQA 4R7PA 3KIAA 4KC1A 4Y9XA 1FWYA 1ZI4A 2AECA 3K8EA 4JISA 2FYAA 4Y64A 1R7YA 4HO6A 3OH1A 2A8WA 2YC3A 1W55A 4DE7A 3ST8A 3PKPA 2PGVA 2X60A 4EE4A 3JUKA 4B4GA 2RIZA 3I0CA 1OMZA 1SS9A 2VD4A 3SX7A 4CJCA 3SXCA 3V91A 3JUJA 3CGXA 5C8RA 5DDVA 5CMHA 3CKNA 4NAKA 2E3DA 1VGWA 2Y7AA 2X5SA 1ZCUA 2WEEA 4AC3A 2MZBA 3GUEA 4B4BA 2YQCA 2O1GA 4Y7GA 5DDTA 2AH9A 3FWWA 5HS2A 2ZU9A 1ZCVA 3I0IX 4KC2A 2FYBA 5CQMX 5C4EA 2XMEA 5C4BA 1LL0A 4M4KA 3OH2A 2XWNA 4YS8A 3Q4SA 3V90A 4B5BA 2RJ9A 2Z86A 3SX5A 3OKRA 1NHEB 1O7QA 4L41C 1ZJ1A 2VS5A 2YQHA 5C3BA 1ON6A 4HO2A 1FR9A 3D8VA 4Y7VA 1JVGA 2VXMA 1H5TB 3K8DA 3SX3A 4FRLA 5L6VA 2E8BA 1FXOA 4EEOA 3PKQA 1HM8A 1LVWA 1VZXA 4HO5A 3SX8A 4GBPA 5FTSA 1LZ7A 5C36A 1ZJPA 5CQLX 2PGYA 1YP2A 4NAIA 3CKOA 1S4PA 5IDTA 4NANA 4P00A 5CQOA 1VH1A 2VSIA 1H5SD 1O0RA 1R80A 1G8OA 4JD0A 4HO8A 1R7XA 4KPXA 3V0NA 2FYCB 2JCOA 2JCLA 3SXDA 5C1HA 4HCQA 1IIMA 3F1CA 1EZIA 3E25A 5FTVA 1OQMB 3U2WA 1LL3A 3ZGGA 5FUHA 1WT2A 4G3SA 3ZF8A 4J18A 1VZTA 3R3IA 5C4DA 4HO9A 1GX0A 2X65A 1WT3A 3I0FA 5C4CA 4CVHA 1ZCTA 2P73A 3O3PA 3BRKX 2OEGA 1LZ0A 3OC9A 4P02A 2BO7A 2RJ4A 2YQJA 1GQ9A 2D7RA 4M2BA 4C2SA 2V0LA 3CKQA 2FYDB 5FV9A 2NXVA 2V0KA 2I5EA 2YC5A 2ICXA 2ZU7A 4FRHA 1FGXA 1H5SC 3I0JA 1G1LA 5AJPA 2VFZA 2DPWA 1ZJOA 1QG8A 2VSHA 1FRWA 2Y4MA 2A8UA 2AM4A 4KC4A 1LL2A 1G9RA 2RJ7A 3I0HA 3OAMA 2BO4A 3N9WA 5C38A 1KWSA 4D0TA 5CMFX 1HM9A 4BQHA
chains in the Genus database with same CATH superfamily
2GGOA 4FRAA 4D11C 4G3QA 2YQSA 4CJ8A 1FXJA 2Y6PA 4KPZA 1EYRA 2FFVA 3TZTA 1H4DA 1YP3A 4EEAA 2X5ZA 1MP5A 4CJBA 5FU8A 4AYLA 1R7UA 5EIYA 5CQNX 2OI6A 1QWJA 1LZIA 3OH3A 4Y62A 1HJLA 1ZJ2A 5AJNA 3U2TA 4XWIA 2GGQA 4M28A 1JYLA 4FIYA 1ZJ0A 3ZLLA 4FROA 2Z87A 1MP4A 4B2XA 5JQQA 3I0DA 4DDZA 1ON8A 2AM5A 1H5RA 1VZUA 2PX7A 3V0LA 4HO0A 1H7GA 2Y4LA 3HL3A 4M2AA 1NQIB 2WVKA 4MIXA 2J0AA 4UEGA 1XZ6A 4Y7UA 5C4FA 4KNRA 1H7QA 1G2VA 1VGTA 3TQDA 4IRPA 2QKXA 1FGGA 1V83A 2RITA 3SXBA 2D0JA 4MNDA 1H7FA 3SPTA 2XMHA 2OI7A 3V0QA 4EEGA 2C0NA 1INJA 2WGZA 4ASYA 1ZI5A 1G0RA 2FFUA 3I0KA 3CKVA 1R81A 2RJ8A 4FRPA 1HJJA 4NALA 3U2VA 1VICA 3PNNA 5C3AA 2Y4KA 1FO9A 2BO6A 3BCVA 2I7BA 2V0IA 4KQLA 1H5SA 4AAWA 1H7HA 2RJ0A 3V0MA 5FU0A 1V84A 3RSBA 4KT7A 5J49A 2RIXA 1ZI1A 4KXOA 1INIA 2WE9A 5D91A 3IOIA 3E26A 5CMIA 1MP3A 4ARWA 2WVMA 1H4CA 1FZWA 5I1FA 2VXLA 3IOJA 4FRQA 2UX8A 1QGQA 1FO8A 2O1HA 4D0ZA 1JVDA 4HG6A 4Y6NA 4B2WA 2V0HA 3OH4A 1O7OA 2V0JA 5FYEA 5AJOA 4LW3A 4FRMA 3ZLKA 1PZTA 1ZCYA 1V82A 1O23B 4G87A 2ICYA 1H7LA 4B3UA 2FY7A 4LW6A 1NMMB 1H7EA 4KNXA 3Q7UA 3QVBA 1G97A 3POLA 2Q4JA 4ASJA 2W0WA 2CU2A 4KRVA 1E5KA 1ZIZA 1GWVA 2VS3A 2RJ5A 4ZDQA 4FCUA 2RJ6A 5L6SA 2PA4A 3T7MA 3LW6A 4FREA 2YESA 3I0LA 3T7NA 1S4NA 3IOHA 4HOCA 1ZI3A 2OEFA 4Q7CA 4EE3A 1GQCA 3U0XA 4HO3A 3U2XA 1I52A 1WT0A 4FIXA 3F1YA 2AESA 3EE5A 1GWWA 4Y63A 1JV1A 3FOQA 3I0EA 3V0PA 2P6WA 3RMWA 1Z90A 4EEMA 5CMGX 2JCJA 1W77A 3NGWA 1H5RB 5BXCA 1TVYA 3D98A 5EJ1A 1K4VA 1XHBA 1IINA 1ZJ3A 2P72A 4B42A 2D7IA 3ZGFA 4G3PA 2VS4A 5C49A 4DECA 2XWMA 4FQWA 1VM8A 4AYJA 4EVWA 5CMJA 5CQPA 2QH5A 4D48A 2I5KA 4B4MA 4Y7FA 1JV3A 4HO4A 5C1GA 5C48A 2AGDA 1G93A 1NF5B 1TZFA 3USRA 2AM3A 1HV9A 1ZHJA 3DUVA 3U0YA 1WVCA 1WT1A 4K6RA 1JYKA 3OH0A 2AE7A 4FRDA 4Y6UA 1YP4A 2VK9A 1H5TA 1VGZA 5C3DA 1FR8A 3V8YA 1ZDFA 2Y4JA 1FG5N 4EE5A 1VPAA 2JCKA 4FRBA 3D5NA 4FCEA 1H4EA 3DJ4A 3JTJA 1H5SB 4O6NA 4ECMA 2OI5A 4BMAA 3SXEA 3OGZA 1FOAA 1GA8A 1GX4A 3U2UA 3V0OA 1WSZA 1W57A 2BO8A 2WVLA 3CKJA 4E1KA 1OMXA 1VGUA 1R7VA 3RMVA 3T7OA 1NWGB 1QGSA 1TW1A 3SXGA 4MYBA 3DK5A 3Q80A 2QGIA 1H3MA 2ZU8A 2WAWA 4D11A 5IFYA 1R7TA 3USQA 5IDSA 3CU0A 2XWLA 1S4OA 2RIYA 3I0GA 2RJ1A 5C1LA 1ZDGA 1YROB 2W0VA 5C47A 3SXAA 4Y7TA 2APCA 1PZYB 1R82A 1TW5A 2YCMA 5EJZA 1H7TA 1G23A 3V8ZA 1VH3A 2O1FA 1MC3A 1G3LA 3R2WA 1G95A 1LZJA 1HM0A 1NKHB 4IRQA 4R7PA 3KIAA 4KC1A 4Y9XA 1FWYA 1ZI4A 2AECA 3K8EA 4JISA 2FYAA 4Y64A 1R7YA 4HO6A 3OH1A 4O6MA 2A8WA 2YC3A 1W55A 4DE7A 3ST8A 3PKPA 2PGVA 2X60A 2J0BA 4EE4A 3JUKA 4B4GA 2RIZA 3I0CA 1OMZA 1SS9A 2VD4A 3SX7A 4CJCA 3SXCA 3V91A 3JUJA 3CGXA 5C8RA 5DDVA 5CMHA 3CKNA 4NAKA 2E3DA 1VGWA 2Y7AA 2X5SA 1ZCUA 2WEEA 4AC3A 2MZBA 3GUEA 4B4BA 2YQCA 2O1GA 4Y7GA 5DDTA 2AH9A 3FWWA 5HS2A 2ZU9A 1ZCVA 3I0IX 4KC2A 2FYBA 5CQMX 5C4EA 2XMEA 5C4BA 1LL0A 4M4KA 3OH2A 2XWNA 4YS8A 3Q4SA 3V90A 4B5BA 2RJ9A 2Z86A 3SX5A 3OKRA 1NHEB 1O7QA 4L41C 1ZJ1A 2VS5A 2YQHA 5C3BA 1ON6A 4HO2A 1FR9A 3D8VA 4Y7VA 1JVGA 2VXMA 1H5TB 3K8DA 3SX3A 4FRLA 5L6VA 2E8BA 1FXOA 4EEOA 3PKQA 1HM8A 1LVWA 1VZXA 4HO5A 3SX8A 4GBPA 5FTSA 1LZ7A 5C36A 1ZJPA 5CQLX 2PGYA 1YP2A 4NAIA 3CKOA 1S4PA 5IDTA 4NANA 4P00A 5CQOA 1VH1A 2VSIA 1H5SD 1O0RA 1R80A 1G8OA 5D92A 4JD0A 4HO8A 1R7XA 4KPXA 3V0NA 2FYCB 2JCOA 2JCLA 3SXDA 5C1HA 4HCQA 1IIMA 3F1CA 1EZIA 3E25A 5FTVA 1OQMB 3U2WA 1LL3A 3ZGGA 5FUHA 1WT2A 4G3SA 3ZF8A 4J18A 1VZTA 3R3IA 5C4DA 4HO9A 1GX0A 2X65A 1WT3A 3I0FA 5C4CA 4CVHA 1ZCTA 2P73A 3O3PA 3BRKX 2OEGA 1LZ0A 3OC9A 4P02A 2BO7A 2RJ4A 2YQJA 1GQ9A 2D7RA 4M2BA 4C2SA 2V0LA 3CKQA 2FYDB 5FV9A 2NXVA 2V0KA 2I5EA 2YC5A 2ICXA 2ZU7A 4FRHA 1FGXA 1H5SC 3I0JA 1G1LA 5AJPA 2VFZA 2DPWA 1ZJOA 1QG8A 2VSHA 1FRWA 2Y4MA 2A8UA 2AM4A 4KC4A 1LL2A 1G9RA 2RJ7A 3I0HA 3OAMA 2BO4A 3N9WA 5C38A 1KWSA 4D0TA 5CMFX 1HM9A 4BQHA
chains in the Genus database with same CATH topology
2GGOA 4FRAA 4D11C 4G3QA 2YQSA 4CJ8A 1FXJA 2Y6PA 4KPZA 1EYRA 2FFVA 3TZTA 1H4DA 1YP3A 4EEAA 2X5ZA 1MP5A 4CJBA 5FU8A 4AYLA 1R7UA 5EIYA 5CQNX 2OI6A 1QWJA 1LZIA 3OH3A 4Y62A 1HJLA 1ZJ2A 5AJNA 3U2TA 4XWIA 2GGQA 4M28A 1JYLA 4FIYA 1ZJ0A 3ZLLA 4FROA 2Z87A 1MP4A 4B2XA 5JQQA 3I0DA 4DDZA 1ON8A 2AM5A 1H5RA 1VZUA 2PX7A 3V0LA 4HO0A 1H7GA 2Y4LA 3HL3A 4M2AA 1NQIB 2WVKA 4MIXA 2J0AA 4UEGA 1XZ6A 4Y7UA 5C4FA 4KNRA 1H7QA 1G2VA 1VGTA 3TQDA 4IRPA 2QKXA 1FGGA 1V83A 2RITA 3SXBA 2D0JA 4MNDA 1H7FA 3SPTA 2XMHA 2OI7A 3V0QA 4EEGA 2C0NA 1INJA 2WGZA 4ASYA 1ZI5A 1G0RA 2FFUA 3I0KA 3CKVA 1R81A 2RJ8A 4FRPA 1HJJA 4NALA 3U2VA 1VICA 3PNNA 5C3AA 2Y4KA 1FO9A 2BO6A 3BCVA 2I7BA 2V0IA 4KQLA 1H5SA 4AAWA 1H7HA 2RJ0A 3V0MA 5FU0A 1V84A 3RSBA 4KT7A 5J49A 2RIXA 1ZI1A 4KXOA 1INIA 2WE9A 5D91A 3IOIA 3E26A 5CMIA 1MP3A 4ARWA 2WVMA 1H4CA 1FZWA 5I1FA 2VXLA 3IOJA 4FRQA 2UX8A 1QGQA 1FO8A 2O1HA 4D0ZA 1JVDA 4HG6A 4Y6NA 4B2WA 2V0HA 3OH4A 1O7OA 2V0JA 5FYEA 5AJOA 4LW3A 4FRMA 3ZLKA 1PZTA 1ZCYA 1V82A 1O23B 4G87A 2ICYA 1H7LA 4B3UA 2FY7A 4LW6A 1NMMB 1H7EA 4KNXA 3Q7UA 3QVBA 1G97A 3POLA 2Q4JA 4ASJA 2W0WA 2CU2A 4KRVA 1E5KA 1ZIZA 1GWVA 2VS3A 2RJ5A 4ZDQA 4FCUA 2RJ6A 5L6SA 2PA4A 3T7MA 3LW6A 4FREA 2YESA 3I0LA 3T7NA 1S4NA 3IOHA 4HOCA 1ZI3A 2OEFA 4Q7CA 4EE3A 1GQCA 3U0XA 4HO3A 3U2XA 1I52A 1WT0A 4FIXA 3F1YA 2AESA 3EE5A 1GWWA 4Y63A 1JV1A 3FOQA 3I0EA 3V0PA 2P6WA 3RMWA 1Z90A 4EEMA 5CMGX 2JCJA 1W77A 3NGWA 1H5RB 5BXCA 1TVYA 3D98A 5EJ1A 1K4VA 1XHBA 1IINA 1ZJ3A 2P72A 4B42A 2D7IA 3ZGFA 4G3PA 2VS4A 5C49A 4DECA 2XWMA 4FQWA 1VM8A 4AYJA 4EVWA 5CMJA 5CQPA 2QH5A 4D48A 2I5KA 4B4MA 4Y7FA 1JV3A 4HO4A 5C1GA 5C48A 2AGDA 1G93A 1NF5B 1TZFA 3USRA 2AM3A 1HV9A 1ZHJA 3DUVA 3U0YA 1WVCA 1WT1A 4K6RA 1JYKA 3OH0A 2AE7A 4FRDA 4Y6UA 1YP4A 2VK9A 1H5TA 1VGZA 5C3DA 1FR8A 3V8YA 1ZDFA 2Y4JA 1FG5N 4EE5A 1VPAA 2JCKA 4FRBA 3D5NA 4FCEA 1H4EA 3DJ4A 3JTJA 1H5SB 4O6NA 4ECMA 2OI5A 4BMAA 3SXEA 3OGZA 1FOAA 1GA8A 1GX4A 3U2UA 3V0OA 1WSZA 1W57A 2BO8A 2WVLA 3CKJA 4E1KA 1OMXA 1VGUA 1R7VA 3RMVA 3T7OA 1NWGB 1QGSA 1TW1A 3SXGA 4MYBA 3DK5A 3Q80A 2QGIA 1H3MA 2ZU8A 2WAWA 4D11A 5IFYA 1R7TA 3USQA 5IDSA 3CU0A 2XWLA 1S4OA 2RIYA 3I0GA 2RJ1A 5C1LA 1ZDGA 1YROB 2W0VA 5C47A 3SXAA 4Y7TA 2APCA 1PZYB 1R82A 1TW5A 2YCMA 5EJZA 1H7TA 1G23A 3V8ZA 1VH3A 2O1FA 1MC3A 1G3LA 3R2WA 1G95A 1LZJA 1HM0A 1NKHB 4IRQA 4R7PA 3KIAA 4KC1A 4Y9XA 1FWYA 1ZI4A 2AECA 3K8EA 4JISA 2FYAA 4Y64A 1R7YA 4HO6A 3OH1A 4O6MA 2A8WA 2YC3A 1W55A 4DE7A 3ST8A 3PKPA 2PGVA 2X60A 2J0BA 4EE4A 3JUKA 4B4GA 2RIZA 3I0CA 1OMZA 1SS9A 2VD4A 3SX7A 4CJCA 3SXCA 3V91A 3JUJA 3CGXA 5C8RA 5DDVA 5CMHA 3CKNA 4NAKA 2E3DA 1VGWA 2Y7AA 2X5SA 1ZCUA 2WEEA 4AC3A 2MZBA 3GUEA 4B4BA 2YQCA 2O1GA 4Y7GA 5DDTA 2AH9A 3FWWA 5HS2A 2ZU9A 1ZCVA 3I0IX 4KC2A 2FYBA 5CQMX 5C4EA 2XMEA 5C4BA 1LL0A 4M4KA 3OH2A 2XWNA 4YS8A 3Q4SA 3V90A 4B5BA 2RJ9A 2Z86A 3SX5A 3OKRA 1NHEB 1O7QA 4L41C 1ZJ1A 2VS5A 2YQHA 5C3BA 1ON6A 4HO2A 1FR9A 3D8VA 4Y7VA 1JVGA 2VXMA 1H5TB 3K8DA 3SX3A 4FRLA 5L6VA 2E8BA 1FXOA 4EEOA 3PKQA 1HM8A 1LVWA 1VZXA 4HO5A 3SX8A 4GBPA 5FTSA 1LZ7A 5C36A 1ZJPA 5CQLX 2PGYA 1YP2A 4NAIA 3CKOA 1S4PA 5IDTA 4NANA 4P00A 5CQOA 1VH1A 2VSIA 1H5SD 1O0RA 1R80A 1G8OA 5D92A 4JD0A 4HO8A 1R7XA 4KPXA 3V0NA 2FYCB 2JCOA 2JCLA 3SXDA 5C1HA 4HCQA 1IIMA 3F1CA 1EZIA 3E25A 5FTVA 1OQMB 3U2WA 1LL3A 3ZGGA 5FUHA 1WT2A 4G3SA 3ZF8A 4J18A 1VZTA 3R3IA 5C4DA 4HO9A 1GX0A 2X65A 1WT3A 3I0FA 5C4CA 4CVHA 1ZCTA 2P73A 3O3PA 3BRKX 2OEGA 1LZ0A 3OC9A 4P02A 2BO7A 2RJ4A 2YQJA 1GQ9A 2D7RA 4M2BA 4C2SA 2V0LA 3CKQA 2FYDB 5FV9A 2NXVA 2V0KA 2I5EA 2YC5A 2ICXA 2ZU7A 4FRHA 1FGXA 1H5SC 3I0JA 1G1LA 5AJPA 2VFZA 2DPWA 1ZJOA 1QG8A 2VSHA 1FRWA 2Y4MA 2A8UA 2AM4A 4KC4A 1LL2A 1G9RA 2RJ7A 3I0HA 3OAMA 2BO4A 3N9WA 5C38A 1KWSA 4D0TA 5CMFX 1HM9A 4BQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGO A;  4FRA A;  4D11 C;  4G3Q A;  2YQS A;  4CJ8 A;  1FXJ A;  2Y6P A;  4KPZ A;  1EYR A;  2FFV A;  3TZT A;  1H4D A;  1YP3 A;  4EEA A;  2X5Z A;  1MP5 A;  4CJB A;  5FU8 A;  4AYL A;  1R7U A;  5EIY A;  5CQN X;  2OI6 A;  1QWJ A;  1LZI A;  3OH3 A;  4Y62 A;  1HJL A;  1ZJ2 A;  5AJN A;  3U2T A;  4XWI A;  2GGQ A;  4M28 A;  1JYL A;  1ZJ0 A;  3ZLL A;  4FRO A;  2Z87 A;  1MP4 A;  4B2X A;  5JQQ A;  3I0D A;  4DDZ A;  1ON8 A;  2AM5 A;  1H5R A;  1VZU A;  2PX7 A;  3V0L A;  4HO0 A;  1H7G A;  2Y4L A;  3HL3 A;  4M2A A;  1NQI B;  2WVK A;  4UEG A;  1XZ6 A;  4Y7U A;  5C4F A;  4KNR A;  1H7Q A;  1G2V A;  1VGT A;  3TQD A;  4IRP A;  2QKX A;  1FGG A;  1V83 A;  2RIT A;  3SXB A;  2D0J A;  4MND A;  1H7F A;  3SPT A;  2XMH A;  2OI7 A;  3V0Q A;  4EEG A;  1INJ A;  2WGZ A;  4ASY A;  1ZI5 A;  1G0R A;  2FFU A;  3I0K A;  3CKV A;  1R81 A;  2RJ8 A;  4FRP A;  1HJJ A;  4NAL A;  3U2V A;  1VIC A;  3PNN A;  5C3A A;  2Y4K A;  1FO9 A;  2BO6 A;  3BCV A;  2I7B A;  2V0I A;  4KQL A;  1H5S A;  4AAW A;  1H7H A;  2RJ0 A;  3V0M A;  5FU0 A;  1V84 A;  3RSB A;  4KT7 A;  5J49 A;  2RIX A;  1ZI1 A;  4KXO A;  1INI A;  2WE9 A;  3IOI A;  3E26 A;  5CMI A;  1MP3 A;  4ARW A;  2WVM A;  1H4C A;  1FZW A;  5I1F A;  2VXL A;  3IOJ A;  4FRQ A;  2UX8 A;  1QGQ A;  1FO8 A;  2O1H A;  4D0Z A;  1JVD A;  4HG6 A;  4Y6N A;  4B2W A;  2V0H A;  3OH4 A;  1O7O A;  2V0J A;  5FYE A;  5AJO A;  4LW3 A;  4FRM A;  3ZLK A;  1PZT A;  1ZCY A;  1V82 A;  1O23 B;  4G87 A;  2ICY A;  1H7L A;  4B3U A;  2FY7 A;  4LW6 A;  1NMM B;  1H7E A;  4KNX A;  3Q7U A;  3QVB A;  1G97 A;  3POL A;  2Q4J A;  4ASJ A;  2W0W A;  2CU2 A;  4KRV A;  1E5K A;  1ZIZ A;  1GWV A;  2VS3 A;  2RJ5 A;  4ZDQ A;  4FCU A;  2RJ6 A;  5L6S A;  2PA4 A;  3T7M A;  3LW6 A;  4FRE A;  2YES A;  3I0L A;  3T7N A;  1S4N A;  3IOH A;  4HOC A;  1ZI3 A;  2OEF A;  4EE3 A;  1GQC A;  3U0X A;  4HO3 A;  3U2X A;  1I52 A;  1WT0 A;  3F1Y A;  2AES A;  3EE5 A;  1GWW A;  4Y63 A;  1JV1 A;  3FOQ A;  3I0E A;  3V0P A;  2P6W A;  3RMW A;  1Z90 A;  4EEM A;  5CMG X;  2JCJ A;  1W77 A;  3NGW A;  1H5R B;  5BXC A;  1TVY A;  3D98 A;  5EJ1 A;  1K4V A;  1XHB A;  1IIN A;  1ZJ3 A;  2P72 A;  4B42 A;  2D7I A;  3ZGF A;  4G3P A;  2VS4 A;  5C49 A;  4DEC A;  2XWM A;  4FQW A;  1VM8 A;  4AYJ A;  4EVW A;  5CMJ A;  5CQP A;  2QH5 A;  4D48 A;  2I5K A;  4B4M A;  4Y7F A;  1JV3 A;  4HO4 A;  5C1G A;  5C48 A;  2AGD A;  1G93 A;  1NF5 B;  1TZF A;  3USR A;  2AM3 A;  1HV9 A;  1ZHJ A;  3DUV A;  3U0Y A;  1WVC A;  1WT1 A;  4K6R A;  1JYK A;  3OH0 A;  2AE7 A;  4FRD A;  4Y6U A;  1YP4 A;  1H5T A;  1VGZ A;  5C3D A;  1FR8 A;  3V8Y A;  1ZDF A;  2Y4J A;  1FG5 N;  4EE5 A;  1VPA A;  2JCK A;  4FRB A;  3D5N A;  4FCE A;  3DJ4 A;  1H4E A;  3JTJ A;  1H5S B;  4ECM A;  2OI5 A;  4BMA A;  3SXE A;  3OGZ A;  1FOA A;  1GA8 A;  1GX4 A;  3U2U A;  3V0O A;  1WSZ A;  1W57 A;  2BO8 A;  2WVL A;  3CKJ A;  4E1K A;  1OMX A;  1VGU A;  1R7V A;  3RMV A;  3T7O A;  1NWG B;  1QGS A;  1TW1 A;  3SXG A;  4MYB A;  3DK5 A;  3Q80 A;  2QGI A;  1H3M A;  2ZU8 A;  2WAW A;  4D11 A;  5IFY A;  1R7T A;  3USQ A;  5IDS A;  3CU0 A;  2XWL A;  1S4O A;  2RIY A;  3I0G A;  2RJ1 A;  5C1L A;  1ZDG A;  1YRO B;  2W0V A;  5C47 A;  3SXA A;  4Y7T A;  2APC A;  1PZY B;  1R82 A;  1TW5 A;  2YCM A;  5EJZ A;  1H7T A;  1G23 A;  3V8Z A;  1VH3 A;  2O1F A;  1MC3 A;  1G3L A;  3R2W A;  1G95 A;  1LZJ A;  1HM0 A;  1NKH B;  4IRQ A;  4R7P A;  3KIA A;  4KC1 A;  4Y9X A;  1FWY A;  1ZI4 A;  2AEC A;  3K8E A;  4JIS A;  2FYA A;  4Y64 A;  1R7Y A;  4HO6 A;  3OH1 A;  2A8W A;  2YC3 A;  1W55 A;  4DE7 A;  3ST8 A;  3PKP A;  2PGV A;  2X60 A;  4EE4 A;  3JUK A;  4B4G A;  2RIZ A;  3I0C A;  1OMZ A;  1SS9 A;  2VD4 A;  3SX7 A;  4CJC A;  3SXC A;  3V91 A;  3JUJ A;  3CGX A;  5C8R A;  5DDV A;  5CMH A;  3CKN A;  4NAK A;  2E3D A;  1VGW A;  2Y7A A;  2X5S A;  1ZCU A;  2WEE A;  4AC3 A;  2MZB A;  3GUE A;  4B4B A;  2YQC A;  2O1G A;  4Y7G A;  5DDT A;  2AH9 A;  3FWW A;  5HS2 A;  2ZU9 A;  1ZCV A;  3I0I X;  4KC2 A;  2FYB A;  5CQM X;  5C4E A;  2XME A;  5C4B A;  1LL0 A;  4M4K A;  3OH2 A;  2XWN A;  4YS8 A;  3Q4S A;  3V90 A;  4B5B A;  2RJ9 A;  2Z86 A;  3SX5 A;  3OKR A;  1NHE B;  1O7Q A;  4L41 C;  1ZJ1 A;  2VS5 A;  2YQH A;  5C3B A;  1ON6 A;  4HO2 A;  1FR9 A;  3D8V A;  4Y7V A;  1JVG A;  2VXM A;  1H5T B;  3K8D A;  3SX3 A;  4FRL A;  5L6V A;  2E8B A;  1FXO A;  4EEO A;  3PKQ A;  1HM8 A;  1LVW A;  1VZX A;  4HO5 A;  3SX8 A;  4GBP A;  5FTS A;  1LZ7 A;  5C36 A;  1ZJP A;  5CQL X;  2PGY A;  1YP2 A;  4NAI A;  3CKO A;  1S4P A;  5IDT A;  4NAN A;  4P00 A;  5CQO A;  1VH1 A;  2VSI A;  1H5S D;  1O0R A;  1R80 A;  1G8O A;  4JD0 A;  4HO8 A;  1R7X A;  4KPX A;  3V0N A;  2FYC B;  2JCO A;  2JCL A;  3SXD A;  5C1H A;  4HCQ A;  1IIM A;  3F1C A;  1EZI A;  3E25 A;  5FTV A;  1OQM B;  3U2W A;  1LL3 A;  3ZGG A;  5FUH A;  1WT2 A;  4G3S A;  3ZF8 A;  4J18 A;  1VZT A;  3R3I A;  5C4D A;  4HO9 A;  1GX0 A;  2X65 A;  1WT3 A;  3I0F A;  5C4C A;  4CVH A;  1ZCT A;  2P73 A;  3O3P A;  3BRK X;  2OEG A;  1LZ0 A;  3OC9 A;  4P02 A;  2BO7 A;  2RJ4 A;  2YQJ A;  1GQ9 A;  2D7R A;  4M2B A;  4C2S A;  2V0L A;  3CKQ A;  2FYD B;  5FV9 A;  2NXV A;  2V0K A;  2I5E A;  2YC5 A;  2ICX A;  2ZU7 A;  4FRH A;  1FGX A;  1H5S C;  3I0J A;  1G1L A;  5AJP A;  2VFZ A;  2DPW A;  1ZJO A;  1QG8 A;  2VSH A;  1FRW A;  2Y4M A;  2A8U A;  2AM4 A;  4KC4 A;  1LL2 A;  1G9R A;  2RJ7 A;  3I0H A;  3OAM A;  2BO4 A;  3N9W A;  5C38 A;  1KWS A;  4D0T A;  5CMF X;  1HM9 A;  4BQH A; 
#chains in the Genus database with same CATH topology
 2GGO A;  4FRA A;  4D11 C;  4G3Q A;  2YQS A;  4CJ8 A;  1FXJ A;  2Y6P A;  4KPZ A;  1EYR A;  2FFV A;  3TZT A;  1H4D A;  1YP3 A;  4EEA A;  2X5Z A;  1MP5 A;  4CJB A;  5FU8 A;  4AYL A;  1R7U A;  5EIY A;  5CQN X;  2OI6 A;  1QWJ A;  1LZI A;  3OH3 A;  4Y62 A;  1HJL A;  1ZJ2 A;  5AJN A;  3U2T A;  4XWI A;  2GGQ A;  4M28 A;  1JYL A;  4FIY A;  1ZJ0 A;  3ZLL A;  4FRO A;  2Z87 A;  1MP4 A;  4B2X A;  5JQQ A;  3I0D A;  4DDZ A;  1ON8 A;  2AM5 A;  1H5R A;  1VZU A;  2PX7 A;  3V0L A;  4HO0 A;  1H7G A;  2Y4L A;  3HL3 A;  4M2A A;  1NQI B;  2WVK A;  4MIX A;  2J0A A;  4UEG A;  1XZ6 A;  4Y7U A;  5C4F A;  4KNR A;  1H7Q A;  1G2V A;  1VGT A;  3TQD A;  4IRP A;  2QKX A;  1FGG A;  1V83 A;  2RIT A;  3SXB A;  2D0J A;  4MND A;  1H7F A;  3SPT A;  2XMH A;  2OI7 A;  3V0Q A;  4EEG A;  2C0N A;  1INJ A;  2WGZ A;  4ASY A;  1ZI5 A;  1G0R A;  2FFU A;  3I0K A;  3CKV A;  1R81 A;  2RJ8 A;  4FRP A;  1HJJ A;  4NAL A;  3U2V A;  1VIC A;  3PNN A;  5C3A A;  2Y4K A;  1FO9 A;  2BO6 A;  3BCV A;  2I7B A;  2V0I A;  4KQL A;  1H5S A;  4AAW A;  1H7H A;  2RJ0 A;  3V0M A;  5FU0 A;  1V84 A;  3RSB A;  4KT7 A;  5J49 A;  2RIX A;  1ZI1 A;  4KXO A;  1INI A;  2WE9 A;  5D91 A;  3IOI A;  3E26 A;  5CMI A;  1MP3 A;  4ARW A;  2WVM A;  1H4C A;  1FZW A;  5I1F A;  2VXL A;  3IOJ A;  4FRQ A;  2UX8 A;  1QGQ A;  1FO8 A;  2O1H A;  4D0Z A;  1JVD A;  4HG6 A;  4Y6N A;  4B2W A;  2V0H A;  3OH4 A;  1O7O A;  2V0J A;  5FYE A;  5AJO A;  4LW3 A;  4FRM A;  3ZLK A;  1PZT A;  1ZCY A;  1V82 A;  1O23 B;  4G87 A;  2ICY A;  1H7L A;  4B3U A;  2FY7 A;  4LW6 A;  1NMM B;  1H7E A;  4KNX A;  3Q7U A;  3QVB A;  1G97 A;  3POL A;  2Q4J A;  4ASJ A;  2W0W A;  2CU2 A;  4KRV A;  1E5K A;  1ZIZ A;  1GWV A;  2VS3 A;  2RJ5 A;  4ZDQ A;  4FCU A;  2RJ6 A;  5L6S A;  2PA4 A;  3T7M A;  3LW6 A;  4FRE A;  2YES A;  3I0L A;  3T7N A;  1S4N A;  3IOH A;  4HOC A;  1ZI3 A;  2OEF A;  4Q7C A;  4EE3 A;  1GQC A;  3U0X A;  4HO3 A;  3U2X A;  1I52 A;  1WT0 A;  4FIX A;  3F1Y A;  2AES A;  3EE5 A;  1GWW A;  4Y63 A;  1JV1 A;  3FOQ A;  3I0E A;  3V0P A;  2P6W A;  3RMW A;  1Z90 A;  4EEM A;  5CMG X;  2JCJ A;  1W77 A;  3NGW A;  1H5R B;  5BXC A;  1TVY A;  3D98 A;  5EJ1 A;  1K4V A;  1XHB A;  1IIN A;  1ZJ3 A;  2P72 A;  4B42 A;  2D7I A;  3ZGF A;  4G3P A;  2VS4 A;  5C49 A;  4DEC A;  2XWM A;  4FQW A;  1VM8 A;  4AYJ A;  4EVW A;  5CMJ A;  5CQP A;  2QH5 A;  4D48 A;  2I5K A;  4B4M A;  4Y7F A;  1JV3 A;  4HO4 A;  5C1G A;  5C48 A;  2AGD A;  1G93 A;  1NF5 B;  1TZF A;  3USR A;  2AM3 A;  1HV9 A;  1ZHJ A;  3DUV A;  3U0Y A;  1WVC A;  1WT1 A;  4K6R A;  1JYK A;  3OH0 A;  2AE7 A;  4FRD A;  4Y6U A;  1YP4 A;  2VK9 A;  1H5T A;  1VGZ A;  5C3D A;  1FR8 A;  3V8Y A;  1ZDF A;  2Y4J A;  1FG5 N;  4EE5 A;  1VPA A;  2JCK A;  4FRB A;  3D5N A;  4FCE A;  1H4E A;  3DJ4 A;  3JTJ A;  1H5S B;  4O6N A;  4ECM A;  2OI5 A;  4BMA A;  3SXE A;  3OGZ A;  1FOA A;  1GA8 A;  1GX4 A;  3U2U A;  3V0O A;  1WSZ A;  1W57 A;  2BO8 A;  2WVL A;  3CKJ A;  4E1K A;  1OMX A;  1VGU A;  1R7V A;  3RMV A;  3T7O A;  1NWG B;  1QGS A;  1TW1 A;  3SXG A;  4MYB A;  3DK5 A;  3Q80 A;  2QGI A;  1H3M A;  2ZU8 A;  2WAW A;  4D11 A;  5IFY A;  1R7T A;  3USQ A;  5IDS A;  3CU0 A;  2XWL A;  1S4O A;  2RIY A;  3I0G A;  2RJ1 A;  5C1L A;  1ZDG A;  1YRO B;  2W0V A;  5C47 A;  3SXA A;  4Y7T A;  2APC A;  1PZY B;  1R82 A;  1TW5 A;  2YCM A;  5EJZ A;  1H7T A;  1G23 A;  3V8Z A;  1VH3 A;  2O1F A;  1MC3 A;  1G3L A;  3R2W A;  1G95 A;  1LZJ A;  1HM0 A;  1NKH B;  4IRQ A;  4R7P A;  3KIA A;  4KC1 A;  4Y9X A;  1FWY A;  1ZI4 A;  2AEC A;  3K8E A;  4JIS A;  2FYA A;  4Y64 A;  1R7Y A;  4HO6 A;  3OH1 A;  4O6M A;  2A8W A;  2YC3 A;  1W55 A;  4DE7 A;  3ST8 A;  3PKP A;  2PGV A;  2X60 A;  2J0B A;  4EE4 A;  3JUK A;  4B4G A;  2RIZ A;  3I0C A;  1OMZ A;  1SS9 A;  2VD4 A;  3SX7 A;  4CJC A;  3SXC A;  3V91 A;  3JUJ A;  3CGX A;  5C8R A;  5DDV A;  5CMH A;  3CKN A;  4NAK A;  2E3D A;  1VGW A;  2Y7A A;  2X5S A;  1ZCU A;  2WEE A;  4AC3 A;  2MZB A;  3GUE A;  4B4B A;  2YQC A;  2O1G A;  4Y7G A;  5DDT A;  2AH9 A;  3FWW A;  5HS2 A;  2ZU9 A;  1ZCV A;  3I0I X;  4KC2 A;  2FYB A;  5CQM X;  5C4E A;  2XME A;  5C4B A;  1LL0 A;  4M4K A;  3OH2 A;  2XWN A;  4YS8 A;  3Q4S A;  3V90 A;  4B5B A;  2RJ9 A;  2Z86 A;  3SX5 A;  3OKR A;  1NHE B;  1O7Q A;  4L41 C;  1ZJ1 A;  2VS5 A;  2YQH A;  5C3B A;  1ON6 A;  4HO2 A;  1FR9 A;  3D8V A;  4Y7V A;  1JVG A;  2VXM A;  1H5T B;  3K8D A;  3SX3 A;  4FRL A;  5L6V A;  2E8B A;  1FXO A;  4EEO A;  3PKQ A;  1HM8 A;  1LVW A;  1VZX A;  4HO5 A;  3SX8 A;  4GBP A;  5FTS A;  1LZ7 A;  5C36 A;  1ZJP A;  5CQL X;  2PGY A;  1YP2 A;  4NAI A;  3CKO A;  1S4P A;  5IDT A;  4NAN A;  4P00 A;  5CQO A;  1VH1 A;  2VSI A;  1H5S D;  1O0R A;  1R80 A;  1G8O A;  5D92 A;  4JD0 A;  4HO8 A;  1R7X A;  4KPX A;  3V0N A;  2FYC B;  2JCO A;  2JCL A;  3SXD A;  5C1H A;  4HCQ A;  1IIM A;  3F1C A;  1EZI A;  3E25 A;  5FTV A;  1OQM B;  3U2W A;  1LL3 A;  3ZGG A;  5FUH A;  1WT2 A;  4G3S A;  3ZF8 A;  4J18 A;  1VZT A;  3R3I A;  5C4D A;  4HO9 A;  1GX0 A;  2X65 A;  1WT3 A;  3I0F A;  5C4C A;  4CVH A;  1ZCT A;  2P73 A;  3O3P A;  3BRK X;  2OEG A;  1LZ0 A;  3OC9 A;  4P02 A;  2BO7 A;  2RJ4 A;  2YQJ A;  1GQ9 A;  2D7R A;  4M2B A;  4C2S A;  2V0L A;  3CKQ A;  2FYD B;  5FV9 A;  2NXV A;  2V0K A;  2I5E A;  2YC5 A;  2ICX A;  2ZU7 A;  4FRH A;  1FGX A;  1H5S C;  3I0J A;  1G1L A;  5AJP A;  2VFZ A;  2DPW A;  1ZJO A;  1QG8 A;  2VSH A;  1FRW A;  2Y4M A;  2A8U A;  2AM4 A;  4KC4 A;  1LL2 A;  1G9R A;  2RJ7 A;  3I0H A;  3OAM A;  2BO4 A;  3N9W A;  5C38 A;  1KWS A;  4D0T A;  5CMF X;  1HM9 A;  4BQH A; 
#chains in the Genus database with same CATH homology
 2GGO A;  4FRA A;  4D11 C;  4G3Q A;  2YQS A;  4CJ8 A;  1FXJ A;  2Y6P A;  4KPZ A;  1EYR A;  2FFV A;  3TZT A;  1H4D A;  1YP3 A;  4EEA A;  2X5Z A;  1MP5 A;  4CJB A;  5FU8 A;  4AYL A;  1R7U A;  5EIY A;  5CQN X;  2OI6 A;  1QWJ A;  1LZI A;  3OH3 A;  4Y62 A;  1HJL A;  1ZJ2 A;  5AJN A;  3U2T A;  4XWI A;  2GGQ A;  4M28 A;  1JYL A;  4FIY A;  1ZJ0 A;  3ZLL A;  4FRO A;  2Z87 A;  1MP4 A;  4B2X A;  5JQQ A;  3I0D A;  4DDZ A;  1ON8 A;  2AM5 A;  1H5R A;  1VZU A;  2PX7 A;  3V0L A;  4HO0 A;  1H7G A;  2Y4L A;  3HL3 A;  4M2A A;  1NQI B;  2WVK A;  4MIX A;  2J0A A;  4UEG A;  1XZ6 A;  4Y7U A;  5C4F A;  4KNR A;  1H7Q A;  1G2V A;  1VGT A;  3TQD A;  4IRP A;  2QKX A;  1FGG A;  1V83 A;  2RIT A;  3SXB A;  2D0J A;  4MND A;  1H7F A;  3SPT A;  2XMH A;  2OI7 A;  3V0Q A;  4EEG A;  2C0N A;  1INJ A;  2WGZ A;  4ASY A;  1ZI5 A;  1G0R A;  2FFU A;  3I0K A;  3CKV A;  1R81 A;  2RJ8 A;  4FRP A;  1HJJ A;  4NAL A;  3U2V A;  1VIC A;  3PNN A;  5C3A A;  2Y4K A;  1FO9 A;  2BO6 A;  3BCV A;  2I7B A;  2V0I A;  4KQL A;  1H5S A;  4AAW A;  1H7H A;  2RJ0 A;  3V0M A;  5FU0 A;  1V84 A;  3RSB A;  4KT7 A;  5J49 A;  2RIX A;  1ZI1 A;  4KXO A;  1INI A;  2WE9 A;  5D91 A;  3IOI A;  3E26 A;  5CMI A;  1MP3 A;  4ARW A;  2WVM A;  1H4C A;  1FZW A;  5I1F A;  2VXL A;  3IOJ A;  4FRQ A;  2UX8 A;  1QGQ A;  1FO8 A;  2O1H A;  4D0Z A;  1JVD A;  4HG6 A;  4Y6N A;  4B2W A;  2V0H A;  3OH4 A;  1O7O A;  2V0J A;  5FYE A;  5AJO A;  4LW3 A;  4FRM A;  3ZLK A;  1PZT A;  1ZCY A;  1V82 A;  1O23 B;  4G87 A;  2ICY A;  1H7L A;  4B3U A;  2FY7 A;  4LW6 A;  1NMM B;  1H7E A;  4KNX A;  3Q7U A;  3QVB A;  1G97 A;  3POL A;  2Q4J A;  4ASJ A;  2W0W A;  2CU2 A;  4KRV A;  1E5K A;  1ZIZ A;  1GWV A;  2VS3 A;  2RJ5 A;  4ZDQ A;  4FCU A;  2RJ6 A;  5L6S A;  2PA4 A;  3T7M A;  3LW6 A;  4FRE A;  2YES A;  3I0L A;  3T7N A;  1S4N A;  3IOH A;  4HOC A;  1ZI3 A;  2OEF A;  4Q7C A;  4EE3 A;  1GQC A;  3U0X A;  4HO3 A;  3U2X A;  1I52 A;  1WT0 A;  4FIX A;  3F1Y A;  2AES A;  3EE5 A;  1GWW A;  4Y63 A;  1JV1 A;  3FOQ A;  3I0E A;  3V0P A;  2P6W A;  3RMW A;  1Z90 A;  4EEM A;  5CMG X;  2JCJ A;  1W77 A;  3NGW A;  1H5R B;  5BXC A;  1TVY A;  3D98 A;  5EJ1 A;  1K4V A;  1XHB A;  1IIN A;  1ZJ3 A;  2P72 A;  4B42 A;  2D7I A;  3ZGF A;  4G3P A;  2VS4 A;  5C49 A;  4DEC A;  2XWM A;  4FQW A;  1VM8 A;  4AYJ A;  4EVW A;  5CMJ A;  5CQP A;  2QH5 A;  4D48 A;  2I5K A;  4B4M A;  4Y7F A;  1JV3 A;  4HO4 A;  5C1G A;  5C48 A;  2AGD A;  1G93 A;  1NF5 B;  1TZF A;  3USR A;  2AM3 A;  1HV9 A;  1ZHJ A;  3DUV A;  3U0Y A;  1WVC A;  1WT1 A;  4K6R A;  1JYK A;  3OH0 A;  2AE7 A;  4FRD A;  4Y6U A;  1YP4 A;  2VK9 A;  1H5T A;  1VGZ A;  5C3D A;  1FR8 A;  3V8Y A;  1ZDF A;  2Y4J A;  1FG5 N;  4EE5 A;  1VPA A;  2JCK A;  4FRB A;  3D5N A;  4FCE A;  1H4E A;  3DJ4 A;  3JTJ A;  1H5S B;  4O6N A;  4ECM A;  2OI5 A;  4BMA A;  3SXE A;  3OGZ A;  1FOA A;  1GA8 A;  1GX4 A;  3U2U A;  3V0O A;  1WSZ A;  1W57 A;  2BO8 A;  2WVL A;  3CKJ A;  4E1K A;  1OMX A;  1VGU A;  1R7V A;  3RMV A;  3T7O A;  1NWG B;  1QGS A;  1TW1 A;  3SXG A;  4MYB A;  3DK5 A;  3Q80 A;  2QGI A;  1H3M A;  2ZU8 A;  2WAW A;  4D11 A;  5IFY A;  1R7T A;  3USQ A;  5IDS A;  3CU0 A;  2XWL A;  1S4O A;  2RIY A;  3I0G A;  2RJ1 A;  5C1L A;  1ZDG A;  1YRO B;  2W0V A;  5C47 A;  3SXA A;  4Y7T A;  2APC A;  1PZY B;  1R82 A;  1TW5 A;  2YCM A;  5EJZ A;  1H7T A;  1G23 A;  3V8Z A;  1VH3 A;  2O1F A;  1MC3 A;  1G3L A;  3R2W A;  1G95 A;  1LZJ A;  1HM0 A;  1NKH B;  4IRQ A;  4R7P A;  3KIA A;  4KC1 A;  4Y9X A;  1FWY A;  1ZI4 A;  2AEC A;  3K8E A;  4JIS A;  2FYA A;  4Y64 A;  1R7Y A;  4HO6 A;  3OH1 A;  4O6M A;  2A8W A;  2YC3 A;  1W55 A;  4DE7 A;  3ST8 A;  3PKP A;  2PGV A;  2X60 A;  2J0B A;  4EE4 A;  3JUK A;  4B4G A;  2RIZ A;  3I0C A;  1OMZ A;  1SS9 A;  2VD4 A;  3SX7 A;  4CJC A;  3SXC A;  3V91 A;  3JUJ A;  3CGX A;  5C8R A;  5DDV A;  5CMH A;  3CKN A;  4NAK A;  2E3D A;  1VGW A;  2Y7A A;  2X5S A;  1ZCU A;  2WEE A;  4AC3 A;  2MZB A;  3GUE A;  4B4B A;  2YQC A;  2O1G A;  4Y7G A;  5DDT A;  2AH9 A;  3FWW A;  5HS2 A;  2ZU9 A;  1ZCV A;  3I0I X;  4KC2 A;  2FYB A;  5CQM X;  5C4E A;  2XME A;  5C4B A;  1LL0 A;  4M4K A;  3OH2 A;  2XWN A;  4YS8 A;  3Q4S A;  3V90 A;  4B5B A;  2RJ9 A;  2Z86 A;  3SX5 A;  3OKR A;  1NHE B;  1O7Q A;  4L41 C;  1ZJ1 A;  2VS5 A;  2YQH A;  5C3B A;  1ON6 A;  4HO2 A;  1FR9 A;  3D8V A;  4Y7V A;  1JVG A;  2VXM A;  1H5T B;  3K8D A;  3SX3 A;  4FRL A;  5L6V A;  2E8B A;  1FXO A;  4EEO A;  3PKQ A;  1HM8 A;  1LVW A;  1VZX A;  4HO5 A;  3SX8 A;  4GBP A;  5FTS A;  1LZ7 A;  5C36 A;  1ZJP A;  5CQL X;  2PGY A;  1YP2 A;  4NAI A;  3CKO A;  1S4P A;  5IDT A;  4NAN A;  4P00 A;  5CQO A;  1VH1 A;  2VSI A;  1H5S D;  1O0R A;  1R80 A;  1G8O A;  5D92 A;  4JD0 A;  4HO8 A;  1R7X A;  4KPX A;  3V0N A;  2FYC B;  2JCO A;  2JCL A;  3SXD A;  5C1H A;  4HCQ A;  1IIM A;  3F1C A;  1EZI A;  3E25 A;  5FTV A;  1OQM B;  3U2W A;  1LL3 A;  3ZGG A;  5FUH A;  1WT2 A;  4G3S A;  3ZF8 A;  4J18 A;  1VZT A;  3R3I A;  5C4D A;  4HO9 A;  1GX0 A;  2X65 A;  1WT3 A;  3I0F A;  5C4C A;  4CVH A;  1ZCT A;  2P73 A;  3O3P A;  3BRK X;  2OEG A;  1LZ0 A;  3OC9 A;  4P02 A;  2BO7 A;  2RJ4 A;  2YQJ A;  1GQ9 A;  2D7R A;  4M2B A;  4C2S A;  2V0L A;  3CKQ A;  2FYD B;  5FV9 A;  2NXV A;  2V0K A;  2I5E A;  2YC5 A;  2ICX A;  2ZU7 A;  4FRH A;  1FGX A;  1H5S C;  3I0J A;  1G1L A;  5AJP A;  2VFZ A;  2DPW A;  1ZJO A;  1QG8 A;  2VSH A;  1FRW A;  2Y4M A;  2A8U A;  2AM4 A;  4KC4 A;  1LL2 A;  1G9R A;  2RJ7 A;  3I0H A;  3OAM A;  2BO4 A;  3N9W A;  5C38 A;  1KWS A;  4D0T A;  5CMF X;  1HM9 A;  4BQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...