1VIDA

Catechol o-methyltransferase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
TKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of catechol O-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase (methyltransferase)
molecule keywords CATECHOL O-METHYLTRANSFERASE
total genus 80
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 1996-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vidA00
4PYQA 1MJFA 3FUTA 5K8VA 5EGSA 4PGHA 3C3YA 3UJ7A 3UBTA 2FK8A 2NNWB 1U2ZA 3IEIA 5E1OA 5F2OA 3ERCA 2XYRA 1VP3A 4QDKA 5LSAA 2G71A 1ORIA 3G2PA 2AN3A 3P97A 3G88A 3LKZA 4HTFB 4OQEA 5FHRA 5D1NA 1YZHA 5T64A 2EJUA 3BKWA 4FGZA 2UYHA 4ER3A 5HIJA 2Z6AA 2FHPA 2I9KA 5DM4A 2P1DA 2AN4A 5E9QA 4AZVA 4FSXA 4CKCA 2DULA 4RSRA 4YUYA 2PVCA 5EIFA 4C03A 3PFHA 4XUEA 2ERCA 4PONA 1X1DA 1JTFA 3UFBA 1SKMA 3PX3A 1XJ5A 5C0OE 1YFJA 1O9HA 5DTQA 2NXCA 2ZBPA 2B25A 2VDWA 5K0CA 1YUBA 4EQZA 1AQJA 3I58A 4RTRA 1NW7A 1NW8A 3ANXA 4QPPA 3G2QA 5K0LA 2AN5A 1YZ3A 5K09A 2CMHA 3JWHA 4A6EA 1RJEA 4P7GA 2HMYB 3BUSA 4IKPA 5KS2A 1KPHA 3HCCA 4U7PB 3AXSA 5DTRA 4GC9A 2IIPA 3M70A 2ZSUA 4GC5A 4PYNA 3VC2A 5K0EA 1JQDA 3NDIA 1X1AA 2IBSA 3IYLW 4PYIA 2H00A 4DCMA 2G1PA 2P3LA 2Z6QA 5K03A 5HILA 4RTPA 2YQZA 5ICCA 1R8XA 5E1BA 5FTWA 4E2WA 1N7IA 4QVGA 2Z6UA 1RJFA 1SUIA 2IBTA 1PJZA 4RTJA 4MWZA 5FQNA 3KQOA 3P2KA 3FRHA 5K05A 3HEMA 3UWPA 3FTDA 1XCLA 3CVOA 3HNRA 3L8DA 2I7CA 3Q87B 1R74A 5FA5A 5B1SA 3SSMA 1RI1A 2BZGA 3QV2A 3VYWA 1VE3A 2XVMA 5CCBA 1WZNA 2AOUA 3LECA 3PVCA 4IV8A 1D2HA 4AZSA 3PTAA 5KQRA 4EKGA 2IH5A 2FPOA 4OBXA 2QY6A 4BLWA 1JQEA 3HP7A 1BOOA 3HA3A 5EMJA 3GJYA 5K0BA 2Y1XA 1AF7A 3E05A 5E1MA 3FUWA 3T7RA 4RVFA 2PXCA 1KPIA 1O9GA 4KRGA 3UJBA 2AOWA 1G8AA 3P9KA 1VLMA 3SSOA 3MGGA 1L9KA 3KQMA 3A25A 3BKXA 5DM2A 3UA4A 3CJRA 3I9FA 4HTFA 1WS6A 4EKIA 4BY9E 3LKDA 5MHTA 1EQAA 3B7PA 1INLA 3BWBA 5IH3A 3REOA 1TW2A 4E31A 4GOMD 2HTEA 4KWCA 3UJAA 3VSEA 3FPEA 2IH4A 2AVNA 3KPYA 4C07A 3GXOA 3D2LA 3PT9A 5FHQA 4PWYA 2XVAA 1WY7A 2ZBQA 3GU3A 4P7KA 1JSXA 4V0RA 5GIPE 3LGAA 4L7VA 3SVZA 2IPXA 3M6XA 2B2CA 3QOXA 5HIMA 4E33A 1EG2A 3G7UA 3HA7A 5GWXA 1XCJA 1VIDA 2C7RA 3B5IA 3UJ6A 2HR1A 3CKKA 5DM0A 1Z3CA 2IDJA 2AR0A 3GRZA 3LDGA 4HGYA 3TKAA 3ELWA 4FR0A 3K6RA 3C3PA 3EVGA 3G8AA 2FRXA 5E2AA 1F38A 2WK1A 4E2XA 3TRKA 3T0IA 2XYQA 3DOUA 3G89A 2YVLA 5EMKA 3EVBA 4BLUA 3M4XA 4PCAA 3NMUF 3FUVA 5HEKA 3DXXA 1VPTA 3P2EA 2P40A 2E5WA 5E2BA 4Z2YA 3UA3A 5BW4A 1BC5A 5IKMA 5M5BA 4PINA 5CCXA 2UYQA 1ZQ9A 2OB2A 3V97A 4OA5A 1JSZA 3DP7A 4GUAA 5LQUA 3BWMA 1AV6A 1G8SA 5EVJA 1H1DA 3WSTA 3HTXA 3PX2A 5LQRA 1SQGA 1NBHA 3LDFA 2ZZNA 2YR0A 1XDSA 4RTNA 3A4TA 3LHDA 5JR3A 2K4MA 4GOLD 3DXZA 2CWWA 2AOTA 3NJRA 4PYKA 4QQKA 4BLVA 1NV9A 3T7SA 4E30A 2JG3A 2ZWVA 3I53A 2PX2A 3MTIA 2LD4A 4GBED 5EMLA 3UJDA 4YV2A 5LQAA 2V74B 4DMGA 1XDUA 1YFLA 5EC8A 3CC8A 5GM1A 4GQBA 5K0NA 1Q0TA 1QAMA 3SM3A 3M33A 2OZVA 4FSDA 4YV1A 2ZULA 3TR6A 1HNNA 2Y1WA 3FYDA 4DZRA 5CVUA 2P3QA 3M6WA 3NDJA 4IV0A 5DX8A 1RI2A 3OZTA 2JJQA 4DF3A 2OKCA 2PSSA 3S68A 3B3GA 3TMAA 4YUXA 4R6WA 1NW6A 2ZTHA 4AUKA 1RI4A 2YXLA 3HCEA 3A7EA 2H11A 3DMFA 5ICFA 4DA4A 1FBNA 1MHTA 4RTMA 2PXXA 5ICGA 3E8SA 5GIOE 5EOVA 4QDJA 3TLJA 4HH4A 5EKXA 2AOVA 3ELDA 3Q7EA 4C06A 3MQ2A 3C0KA 4PNEA 4UOEA 3EVAA 2VZ9A 4KIGA 1KR5A 1PRYA 2ZIGA 5EHIA 4YV0A 1JG1A 4R6XA 5KYGA 2A14A 2YTZA 3GDHA 1L3BA 3BT7A 2AOTB 3TM4A 5K0JA 5FWDA 2NP7A 3V8VA 2PBFA 3A27A 3GRUA 1V39A 3JWIA 3QOWA 5FCDA 3GRVA 4F85A 2C7PA 8MHTA 4HRAA 1L3CA 1WG8A 5DT2A 4YUZA 2QYOA 4WVLA 3DTNA 1QYRA 3KR9A 1EJ0A 2F8LA 1UFKA 3MERA 4CXMA 2OY0A 2GS9A 3SR4A 1R18A 4GEKA 3KHKA 4B17A 3B3JA 5E1DA 1QAQA 3EVDA 5EMMA 3OU6A 3LBFA 5CM2Z 2BH2A 3MCTA 2ZW9A 5E8RA 3IV6A 4PYOA 2AOXA 3EVCA 4XUCA 2P8JA 4C04A 4PGGA 2I6GA 2O05A 2JHCA 2VDUE 3IHTA 3HA5A 3OZSA 3EVZA 4FP9A 3EEOA 3U81A 5DXAA 1IM8A 4MQ4A 4RX1A 3A26A 4WXHA 4H0NA 3EMBA 3ER9A 5HIIA 2GPYA 4E2YA 2NXEA 3NTVA 1N2XA 3HVHA 5E9WA 3FPGA 3LDUA 4PIPA 4OQDA 2PV0A 3GO4A 1RJGA 2JHAA 3BXOA 1O54A 2AS0A 1ZGJA 3KPUA 4QTUB 3X0DA 1NW5A 3FPJA 3GIWA 4GF5A 5BXYA 4M7RA 3LL7A 5DX0A 2IP2A 3G2MA 2PT9A 3CGGA 2JH8A 5E8JA 5FQOA 4LECA 2EFJA 1FJXA 1EJ6A 3O7WA 5DTMA 1SUSA 1VBFA 4AX8A 1JG3A 5DRTA 1UWVA 3AWIA 2FCAA 3FRIA 3MHTA 3HCDA 2CMGA 3GCZA 2ADMA 3KQSA 2GH1A 4YMHA 5C9ZA 1G38A 4E2ZA 4EMSA 5CVDA 3LBYA 4RVHA 3EMDA 3VC1A 4RVDA 3EGIA 4ISCA 3F4KA 4DQ0A 2WA2A 5JUWA 2C7QA 4POOA 5EQJB 4CWAA 5FWAA 3LCUA 3NW9A 3G8BA 5EEGA 3JWJA 2ONZA 5GINE 3PS9A 4FZVA 4FT4A 5K0FA 2G70A 3R24A 4RV9A 5HOQA 5F2KA 3OU7A 4RVGA 4ZTBA 1KHHA 3O31A 2IDKA 2ZIFA 3FUUA 4ER7A 5KQSA 1M6EX 3BGVA 3GRYA 4HG2A 4M36A 5FULA 3EVEA 3KR2A 2IGTA 2GA9A 5EG5A 4YMGA 5F2NA 1F3LA 5EIWA 5C1IA 4ER5A 3P71T 4X1OA 1FPQA 1JR4A 2XYVA 1L1EA 2PGXA 3AXTA 3DH0A 3FTCA 3GWZA 3LX6A 4X41A 2OYRA 2VS1A 3OE4A 1X1CA 3LCCA 2QE6A 1VP9A 4AZWA 1L3IA 5FA8A 3THSA 4OA8A 5LQJA 2PWYA 3K0BA 1IY9A 2N47A 4PYMA 3DR5A 3UJ8A 2ONYA 4YUVA 1DCTA 4F84A 4RTLA 5HFJA 4QQNA 3CCFA 4YUWA 2P3OA 5DM1A 2ZIEA 1NBIA 1EIZA 3EVFA 5EZSA 3SSNA 4FT2A 5E9JA 4RTKA 1NKVA 1XDZA 3HVIA 4E32A 4U7TB 3P9CA 4E70A 3GRRA 4QPNA 1XVAA 3P2IA 3OCJA 4XUDA 2V7EA 3I64A 1R6AA 4CKEA 2PXAA 2ZBRA 3CJQA 3FPFA 2HNKA 3KPWA 4KDCA 1JQ3A 3C6MA 2NP6A 1RI3A 1KPGA 2GAFA 1NT2A 2HWKA 3FPHA 1JTEA 3BGIA 2YXEA 5DLYA 4AZTA 2PX8A 2KW5A 3RODA 2QRVB 2XBMA 3BWYA 3ER8A 4OX9Y 4KVZA 4P7FA 4OBWA 4F86A 1TW3A 5K01A 2BR3A 4A6DA 2PKWA 4CKBA 3LCVB 5DX1A 3RW9A 3TQSA 2FK7A 1M0EA 2B3TA 3BWCA 3LSTA 1XXLA 1JG4A 2AZTA 2G8NA 4M38A 2P7IA 1QZZA 3R0QA 2OXTA 3OE5A 1ZHFA 2OPBA 3I5UA 5CVVA 1B42A 1G6Q1 2EJTA 2PX5A 1FP2A 1T43A 2VP3A 3DLCA 1ZGAA 4HC4A 3OPNA 5D1HA 3GNLA 3UJ9A 5K0GA 3P8ZA 2JHPA 3TOSA 4MTLA 1X1BA 2O0LA 2ZLBA 2ZZMA 3FTEA 5DSXA 2AVDA 3ELYA 4O29A 2DPMA 4Y2HA 5EPEA 2BR5A 2GLUA 2IFTA 3CJTA 3HVKA 3M6VA 3KQTA 3EGVA 2BM9A 3O4FA 3TM5A 2G72A 3ID6C 4P7JA 2VDVE 5EZQA 5LQCA 4ER6A 2H1RA 2O06A 3NWBA 4R05A 4RTSA 1DL5A 1KYWA 1QANA 1ZG3A 2BR4A 2NXNA 1KYZA 3SXJA 1QAOA 4G56A 2HV9A 4R8SA 2FYTA 4DCGA 4KIFA 3EEYA 3KR1A 3NVKI 1BKYA 5HZMA 4PYLA 3G2OA 1DUSA 5DWQA 3UJCA 3JWGA 5EHGA 3OZRA 3FUXA 1EAMA 2P35A 1OR8A 2PT6A 1HMYA 3RIEA 2JH9A 3NWEA 3FTFA 2PX4A 2R3SA 5FUBA 1YF3A 3R3HA 1KP9A 3H2BA 3E23A 1WXWA 4LWOA 5CD1A 3KQQA 5FADA 4QVKA 4V0QA 5U4XA 4K6MA 5LR6A 3ORHA 3AJDA 3SMQA 2OBFA 3HCFA 5T67A 3KQPA 4CTJA 5EEHA 2PWPA 3KR0A 2O07A 1P91A 4PIMA 4Y30A 5H02A 4EK9A 5CIYA 3KQVA 3HCBA 1XTPA 3P9IA 1ORHA 1VL5A 3EPPA 4GOND 1AQIA 4C08A 1I1NA 3G5TA 3NVMB 2GB4A 1Y8CA 1UIRA 3SGLA 3FZGA 2UZ4A 1P39A 1R8YA 3DMGA 2I62A 3P9NA 5DPMA 5EKUA 3MB5A 2B9EA 1FP1D 4X63A 5DXJA 3DLIA 5G02A 2ZZKA 2PJDA 3A7DA 4M37A 4NECA 3TFWA 1ZKDA 3M6UA 3ELUA 3ME5A 2B78A 2CL5A 4BP3A 2YX1A 4PCLA 1R00A 2QRVA 1NE2A 1NV8A 1P1BA 4P58A 4KW7A 4RTOA 5GM2A 2ORED 1TPYA 3KKZA 3UZUA 2UYCA 4QTTB 3C6KA 5ICEA 1VQ1A 4DM3A 2ZCJA 1KXZA 4CTKA 2NYUA 4R8RA 2OB1A 4JXJA 2YUIA 5T6BA 4IWNA 1WXXA 5GOZA 4ER0A 2O57A 1G60A 1SG9A 3HM2A 3SX0A 4PYJA 5ERGB 5DRYA 4RTQA 2Q41A 4FS8A 2IH2A 4RWZA 5CUQA 2ZWAA 1RJDA 3TKYA 2EG5A 2P7HA 5P8WA 3HCAA 10MHA 4HGZA 4C4AA 3PLAE 3LPMA 3OFJA 3TPZA 5LQNA 4LG1A 2ZFUA 5BP7A 3AY0A 1M6YA 4MHTA 4MIKA 3DMHA 5KVAA 2PLWA 4XCXA 1BHJA 4X60A 4GOOD 5BW5A 1P1CA 1G55A 2YXDA 3OU2A 4HSGA 2C7OA 3T7TA 2WA1A 3E7PA 1IXKA 1D2GA 2CKDA 1YB2A 3HVJA 4KDRA 5CVJA 3CBGA 4X61A 1X19A 1Q0SA 3MCZA 4EVIA 3BGDA 4DKJA 2OO3A 1D2CA 2BM8A 5LQKA 3KPJA 3B89A 9MHTA 3EGEA 4RYLA 3DUWA 4C05A 2NXJA 2ESRA 1N7JA 2P41A 3FYCA 3MTEA 3KU1A 3R6TA 4BP1A 3MAGA 3R9XB 1RI5A 1KIAA 3OFKA 2PY6A 1SVUA 3PB3A 3THRA 3GGDA 5HIKA 5DSTA 1NW3A 3KQWA 2AOUB 3KPVA 5CVEA 1JG2A 3PFGA 3DXYA 4LWPA 2R6ZA 2QM3A 2UYOA 3B3FA 3KQYA 7MHTA 3BZBA 5GP1A 1SQFA 1I4WA 3DULA 4ATNA 2EX4A 2ZVJA 1I9GA 3G5LA
chains in the Genus database with same CATH superfamily
5HDBB 2H4YA 1XEWY 3SR0A 2JLUA 1HV8A 4MVXA 5A9SA 5EGSA 2WY2D 3JD2A 3UJ7A 1I7LA 4C0SA 3MWEB 3RVJA 3NEJA 3ITNA 2ACWA 4C43A 3LYLA 5C46F 5F98A 3SXUB 1YJ8A 4OHYA 2E4AA 5C8ZA 3TW8B 3VM6A 3BDIA 2B94A 2WQ7A 4FGZA 5KVSA 4KCGA 3EG5A 3UWOA 3TSZA 3AFGA 1AKMA 2I71A 1I30A 1OZFA 2HWYA 2O2CA 2ZTMA 3MBKA 3JZIA 4PPGA 4Y0VA 2NPIA 2P68A 4IDCA 4NVRA 2HUPA 4RS3A 3ER6A 1JWLA 1YB7A 2JJ2D 4FGLA 1SKMA 4TRMA 4XYMA 1Z75A 3LCJA 4OM7A 4A8HA 4BZQA 2EYUA 2NXCA 1Z5WA 2GI4A 9ABPA 3P0RA 5JH7B 5TY0A 4KR3A 4ESHA 1I10A 2AV6A 3MMPA 5DYWA 5K09A 1XF1A 4KMOA 1GAWA 2V3VA 1ULBA 2YNMD 1ENPA 3PQCA 2O8BA 2H1OA 2GCEA 3FWYA 3Q3JB 4QATA 5DBGA 1T5BA 3T4PA 3RYIA 1WMSA 1KZ7B 1FNNA 2IOFK 2XMBA 4GC9A 1T36B 2ZSUA 3ZBPA 2WVJA 1AXEA 1OX6A 2Q8NA 3T8YA 4NK5A 1GSIA 2J9GA 1XMQB 1HEUA 2GN9A 1ZD2P 5KVCA 5FTMA 3AYZB 1MJHA 1YT5A 2H7VA 1R9GA 3H2KA 4K1XA 4RGQA 3KXIA 1LLCA 5CDSA 1AS0A 2P6NA 4UNPA 5BNZA 1KVTA 1SKUA 3AMVA 8ATCA 1E5DA 1FLDA 4A26A 1JDUA 2FN7A 4K03A 4WLEA 2XNCA 2ZDHA 2EFEB 3H17A 3EZLA 3WHPA 2FPWA 2ICAA 1UBNA 4J07A 2CNKA 4MW6A 3U61B 1ZPDA 2VJYA 2RGCA 2R25B 4M6WB 1NVXQ 3TVYA 3V7UA 1DT3A 1QGUA 4N39A 2GLTA 4EVRA 3M81A 3EDQA 3V1TC 4Z53A 3HBFA 3OLXA 4ZAVA 1JQBA 4PIVA 1WEKA 2CEKA 3LVRE 3OMLA 3OX1A 4BQRA 5A3RA 1BOOA 3OM0A 3PA6A 4U3JA 1P18A 4M0PA 4WEQA 5DHPA 1B8PA 2HD4A 2G4CA 2VWGA 4OYHA 5H59A 2BTEA 3WHLA 4UAUA 3NB0A 4YXFA 1VLMA 5ITZB 5JTUA 1Y3BE 2CFRA 1Z7BA 3L0BA 3KQMA 2WG2A 5IJ0B 2JEOA 4BUCA 3AUAA 3DQPA 3RSLA 1MRZA 1K3UB 1TYEB 3A6FA 2J7KA 1EE2A 2YRWA 1KAGA 3A2LA 3JXEA 3KAPA 1RNLA 5AJZA 4U6SA 4CV3A 4CF7A 5I7WA 2V7BA 4Y3UA 4MV9A 3D8UA 2MSWA 1HE2A 1HI9A 1DRVA 3SQMA 4DJEC 3OLZA 3RASA 2C5LA 3F96A 1XV5A 2BFCA 2JB9A 2O1SA 3EGOA 3MRSA 4PLHA 1K9SA 1MOPA 4IQ4A 1ZMTA 3FNGA 3ZXSA 4DBVO 3ZCUA 1P17A 3MGCA 1IE3A 2XLBA 1N5DA 3OQMA 4IIGA 3C1OA 4NBTA 3T1OA 3OCUA 3TN7A 1YNSA 1WEHA 2D4HA 3DVLA 5F4BA 5BW6B 1QFYA 1NSFA 1P0FA 2NV0A 3VJMA 4EB8A 4WK6A 5LA6F 2O8CB 1MHPA 2BISA 3E15A 3MFQA 2IT1A 4AY6A 1H8HD 1JDJA 1R0XA 5F1KA 4V1CB 1UBKS 5LFAA 2NQTA 3KSRA 1A69A 1QIEA 1W0CA 1T8PA 2I1VB 2IPOA 2N3ZA 3PC6A 2HCBA 4L07A 1VGRA 4A8PA 1NXWA 3H1AA 1RAEA 1P62B 1YIOA 4WAUA 5F9MA 2BFOA 2FZGA 3WSTA 2FZCA 4D9FA 4JBHA 2GEUA 3GJXC 5JDCA 1SQGA 4GRAA 1YH3A 1BZYA 1EMDA 2NO5A 4CCYB 1R12A 5EJAA 1O58A 1Y42X 3LD9A 2FP3A 3UWKA 2BUCA 2XR1A 3QTTA 5I9IA 1DEAA 1K5HA 4R84A 1MVNA 5JMTA 1C0EA 4CF6A 2ZR7A 4EHBA 3FMVA 3OBIA 4H3HB 1FSGA 4I9UA 4QQ8A 4DMGA 5IBRA 4C7OA 3R6DA 2LE0A 2QRQA 2E89A 3O5AA 5IM4A 5IDVA 1ZJ6A 2IODA 2NYAA 2LIVA 3H6GA 4MPJA 1RQ2A 2AYXA 2W2LA 3CLVA 1UANA 1WSDA 2EHJA 1K27A 4YV1A 4DJAA 4DZRA 1AKEA 2LDXA 3GH3A 3G59A 2PD3A 2BBOA 3NDJA 4LV8B 3WISA 4AWAA 4L9RA 1LZKA 2E1RA 5FL7A 3V1LA 5GAJA 2AZMA 2X8LA 3W2TA 4CL3A 3WO1A 2O23A 4DQXA 4U9IS 4XEHA 3TQFA 5ICGA 4JP3A 2WHRA 4PZDA 2OK8A 2BGGA 5KSZA 3H7IA 1XKTA 1XPJA 5J40A 4PNEA 4C06A 1NMYA 4ZTZB 1P31A 1KR5A 2F43B 4WCDA 5EHIA 1R50A 2W22A 3RK1A 3IKVA 5CFLA 1FL9A 3UIEA 1HZZA 4D4JA 4Z4CA 4ENQA 3A9CA 3I83A 1A7AA 3V4FA 5FCDA 1SVIA 3R8XA 3IHWA 4EAAA 5TS3A 3E9NA 3FCSB 4GMHA 1NVTA 4XB6B 3OOYA 3UQZA 4FCCA 4YUZA 1FFEA 2IUYA 2QYOA 2Y1EA 2ZRGA 2MJLA 5J47A 1UXHA 1YAHA 3U5ZB 3WLMA 1WMBA 1BN7A 5JALA 3GQBB 4AJLA 3PJEA 2V65A 5FFNA 3SJBA 5FPSA 2VT3A 4MGYR 3DMTC 4DDTA 5FNZA 1JPVA 5KTNA 2J3HA 3C70A 1EIWA 1MABB 2YJ4A 1KI6B 3AB3A 4F4JA 2C4HA 4MWOA 3ISVA 5BSWA 4HWRA 4XUCA 2O05A 2YDXA 4G0YA 2CZGA 1RXCA 1VKHA 2QTBA 2YHIA 4UJ5A 4Z3DA 1P7PA 2HWXA 2PKEA 2QT1A 4F8EA 4CEIB 1GPYA 3T3PB 3FSRA 4NMHA 4IVNA 1NL3A 5THKA 4HUQA 3IAAA 4PLVA 5JQGB 3I45A 5COBA 4N5LA 2PH5A 5FPKA 3DZJA 2WD7B 3HVHA 1ZXBA 4IIXA 2QVZX 2YVKA 2CYCA 2OXFA 2R1VA 4PIPA 4R1SA 4K9OA 1H66A 2YY6A 3MPOA 1TUBB 3A6JA 4PZ0A 1DHRA 2VKTA 2O1XA 2H18A 3RUIA 1P77A 3BPSA 4TTQA 3FPKA 4PC2A 2FG7C 3VR2D 1KYVA 1EJ6A 3FPSA 3O7WA 2XUAA 1KS2A 2Y27A 4N0DA 1N77A 4HY3A 5CH3A 2O4UX 1HC7A 1II8A 1M1YB 4IDAA 3LW8A 2RG7A 1B6SA 4RIGA 2QD1A 2HA4A 4DARA 5CVDA 1UPFA 4ENRA 1ZISA 2VDNB 4MV6A 4MQUA 5DLQC 1A8IA 4TL8A 2K6GA 1NQVA 4FFMA 5KSPA 1PLLA 4YRCA 3LSYA 4DQ0A 2MINA 3VAZA 3L1HA 3A05A 3IO3A 3VHLB 4CZ2A 1KJ8A 3A9TA 4E7PA 4G09A 4RW0A 4DY6A 1JSCA 3ZYCA 1ST2A 3EXIB 5C3UA 4C0XA 5KQGA 4RVGA 4GU5A 5KJEA 1FZTA 4AI6A 2A0FA 5JC8A 1G42A 3OCWA 1HNWB 2P5YA 3BREA 3DE5X 2VQSA 4TV8A 3GDGA 3KU4A 3SHVA 1Z2PX 2VXBA 4YCLA 2I8CA 2YHAA 2PL5A 3GQVA 4QBGB 3N1UA 4PNPA 3FDJA 1QH1A 5F3DA 2PUBA 1T2EA 3ZV5A 4QJBA 4NBKA 4X1YB 3JARB 1GPJA 4M1MA 2Y71A 4XSVA 1SHUX 3LHIA 5JSKA 3RFFA 1NVAA 4A16A 2Z04A 4ALKA 4MR7A 4QBTA 3K0BA 3L6RA 4NC9A 2YZKA 5H82A 3V9AA 3WBKA 1TEXA 2O1EA 3E7WA 4DLXA 4PZLA 3CCFA 5MFZA 4IR7A 3WNQA 3ZIAA 4H7FA 4KR2A 3BIXA 2C8VA 1NBIA 1Z4OA 3E4DA 5JDIC 4IIVA 3UANA 5KEIA 4QDXA 3BL5A 4O1MA 4JV5B 1UMDA 2RHLA 1Q1BA 1UUFA 1XDZA 2REBA 4E70A 1TD9A 2V1UA 1F2TA 2OP0A 1ZICA 5L9AA 4OLFA 5FUXA 4I5FA 3RIMA 1GEGA 1PL8A 1U3TA 3UCEA 4CKEA 1DBWA 4ZIRB 3V7FA 2G7ZA 3V4OA 1RI3A 2QX8A 5DOZA 4DCSA 3V2HA 4XYLA 1Y1KE 1N2IA 3SZOA 5EJ8A 1O1YA 4ABYA 4BRZA 1XQWA 2KW5A 2JDIA 2LXNA 1BXGB 4YQFA 3EPKA 3BMOA 5DBEX 4A36A 3HCNA 2FEKA 3IB6A 4U9UA 1M72A 1IULA 4OBWA 4PG4A 3GOHA 3Q6NA 4TX1A 5ENDA 4A6DA 4TLMB 5DBFA 4OHXA 2F55A 5HP4A 2YC4C 3LCVB 1QMPA 4C7OB 3E84A 2WAMA 2B3TA 3H6HA 1UFQA 1P74A 4V0KA 3WWYA 1P0PA 3UOWA 2C2YA 3ZR4B 4FFDA 2YVAA 1USKA 5CDUA 3DFMA 3NP9A 3S7TA 1WCXA 3CRNA 2WPDA 4A1FA 4YMHA 3DOIA 3FIUA 3LYHA 5BN4B 3IS3A 3UHOA 1ZEMA 5AKEA 1X1BA 1RAIA 3HFSA 7ABPA 4G9EA 2TECE 2BE9A 4PG7A 4M9XA 1N33B 3VJLA 2DPMA 1Y48E 3C6YA 2B21A 3SZ3A 4YR7A 3K0EA 1RD4A 1IHPA 1BG6A 4DC0A 3EGXB 4FZ3A 5HM6A 1R4AA 1EEXB 3KJQA 3VZBA 4EYQA 4TYYA 3ZGNA 1YMUA 4ER6A 3AVVA 1N9ZA 2P0EA 3NHMA 2GQ0A 1NQTA 4P32A 1HWYA 1VI2A 2QS9A 2VSQA 3K30A 1U8CB 4Z4EA 1PZGA 1VKJA 5HZMA 1M34B 2HMTA 4N5IX 1XA4A 1CRQA 4TMTA 4FE3A 2ACVA 3GG9A 3R7WA 4AL4A 2DBZA 3B9RA 5DZSA 4DCNA 3EPJA 1AZSC 3PEVA 4V3CA 5FNVB 1Z4QA 5AR1A 2LCFA 1ZHOA 2F3QA 1N6IA 4OHMA 3ZVNA 3OC0A 4ZT6A 2VJOA 3HI6A 1ZL0A 5DLPA 5I51A 3DTYA 3CE6A 4PAOA 1A9XA 1CR1A 2ZAIA 4X91A 4CM9D 1T3ZA 3HCFA 4C0JA 3KFLA 2DUWA 3DZCA 2XKBA 4CCWA 1QP4A 1EVIA 2Z56A 4GOJA 4QEDA 3LMKA 3HBJA 3QI7A 1JJ7A 4O25A 4F2WA 2HZ7A 1DXYA 4I36A 3C98A 3I9KA 1QS0B 3NVMB 5B7GA 1KWGA 3MJTA 4URWR 1Y8CA 2FW0A 3ZIUA 4BLRA 3RTAA 3VKGA 3KB6A 4FWTA 4TKUA 4JNKA 3NHYA 1X7XA 5IMBA 5LMUB 4YJKA 4CR8A 5I7VA 3ORFA 1L4EA 1Z7WA 2NU7B 5FUYA 1FSPA 2Z5GA 4QDTA 1W4ZA 4BGUA 1Y4DE 4Y6OA 4P58A 2OCAA 2ORED 1FE8A 2VBFA 3R0JA 4QTTB 5KJCA 3PFBA 2OCBA 2XIQA 2H4FA 1GQOA 3FMGA 4E0BA 4J8PA 1CB0A 2ZYRA 1XJQA 5JSYA 3RHSA 5AW9A 4F7WA 3ROTA 2XUOA 3LG2A 1SU8A 2C0QA 3TTTA 2CJPA 3PFIA 3ZW8A 4E5DA 5ARBA 2C98A 1UP4A 4P84A 5FI1B 1RBZA 4I1SA 4X3PA 4B7ZA 2WAYA 3TS1A 3DB2A 4KNVA 1T2CA 4FJ2A 2V0GA 2P67A 2YMQA 3PLAE 5JOQA 3G0DA 2F3RA 3QMMA 4RESA 2W90A 2ZFUA 3EZ7A 3TQRA 1GFZA 2D74A 2OHOA 2Q1XA 4DCPA 1QVVA 5AK4A 1FYVA 2HY7A 5JJLA 2JGJA 2W0MA 1CEXA 2XOEA 1TYBE 3DM5A 4R71A 2KX7A 3SS7X 1CNEA 1L4NA 1P1CA 2XEXA 3AERA 3HS3A 4Y2JA 5HKKD 1K75A 1U5BA 5B5SA 3I6ZA 1YB2A 5FOTA 1YGPA 1RZUA 1X19A 2IHKA 1P7CA 4HEA1 4LI0A 4NOLA 5F4ZA 2XD4A 3V4LA 4EVIA 5K6AC 1C1XB 4XI9A 1FVOA 3K9WA 1M0SA 1X9GA 2NZYA 2EP5A 1NXOA 3GAMA 4G1VA 4RSHA 2AG8A 3EIOA 1XU9A 5AXAA 5JZOA 2AFIB 4Y0AA 2GPJA 4J0DA 1K7FB 3SS9X 5CBPA 5C32A 3LF2A 4NDAA 1U65A 4L75A 4ZGGA 5DHAA 2ILVA 2ZVQX 5EIOA 4G5SA 4RF5A 2RH8A 3HVRA 1OU4A 2WWYA 2BTQA 2IHNA 1CD5A 4OUDA 1MAVA 4R3NA 3N3BC 5AM3A 3N2GA 2ODAA 4L9WA 1D1PA 1L8QA 4RXUA 4ZALA 1CLEA 2QM3A 1VHDA 3LQ2A 1CPYA 4HNQA 4WXRA 4E4YA 5AUNB 5GZ1A 2FSUA 1MD9A 2JFXA 4ECEA 4FB4A 1AG9A 1FDVA 2OFWA 3AIKA 2A4MA 5K3FA 4BLOA 2Y6VA 5F2OA 2QUHA 1BGVA 1G20B 1YDGA 2JJ1A 2AN3A 2PVPA 1EK5A 4MI6A 4RDXA 1WETA 4DJJA 3FB4A 4P80A 3LUJA 1RWOA 5FOQA 5JAQA 1T5LA 5EFZA 2OXIA 3U40A 1TT7A 3FPLA 3EXHC 3HUFA 3JTEA 4GMGA 2JBAB 5TT1A 1O3YA 3ZI7A 3BRQA 5DNAA 5SY4A 4D5EA 1TZ2A 2UDPA 4WL0A 2C2HA 4DW8A 1QX3A 4OAQA 2P77A 1MIOB 5AXBA 5A1TA 1QGAA 3W5CA 1MLDA 1CY0A 1JPNA 4OQNA 2C4WA 1E3SA 2HJRA 3IEXA 3PHCA 2Z5LA 3LOQA 3LP8A 4KODA 4NE7A 5DTQA 5C0OE 2R0QC 1ONSA 2WJJA 4HWKA 3BTOA 1MZPA 2XWBF 3V4ZA 4LXQA 2ZT8A 4OXIA 2WWHA 4CUKA 2OV6A 1T8SA 2C58A 3A1NA 2AN5A 3ZY3A 3QENA 4A6EA 1HDGO 2AL7A 2ZIUB 3K5WA 1CY4A 3IRUA 3FCYA 1U7OA 4A0GA 5HM8A 3KDPA 3LUGA 4LJ7A 1LRJA 2JCYA 1MDFA 2IIPA 2REOA 3ADBA 1NZFA 1ADYA 5D3ZA 5C4MA 3BF7A 5K0EA 2W2OA 1GV0A 1U2EA 2EZUA 5IT0A 2CLMB 3ZEIA 3N59A 2IOHA 1JDVA 1G98A 1TRKA 2ZB7A 1Z07A 4UPVA 3FR7A 4Z2AA 3QE4A 4LYAA 1K88A 4IIEA 2DFKB 2IC5A 2P69A 2P9EA 2ZU0C 4XYBA 1PV4A 1L5FA 1DRJA 3EQZA 1V8ZA 1TM5E 3FYTA 3OF2A 2JAUA 1G8YA 1ZLXA 1HG0A 3ABSB 4RZIA 3FRHA 4ZYWA 2GD2A 1BVHA 4G0QA 4PQFA 4BTVA 3H2HA 1MF7A 3IDOA 1NAIA 1PR4A 1U8ZA 3NATA 5BSUA 3HY6A 4B1FA 4CUJA 1F0PA 1HDIA 3BICA 3OQBA 1OAKA 1DNPA 1VE3A 1WXGA 3F6SA 3P52A 4PZZA 4U2GA 4DLZA 5CCBA 4F04A 3B9BA 4BKRA 5B12A 4PPNA 4ZVQA 2V3CC 2V9ZA 5A5VA 1H65A 1ZJ4A 3TWOA 6REQA 2IUFA 5F5NA 4KIUA 3TYXA 3QMVA 4Q93A 3UG6A 3UMCA 1KKLA 1PFKA 1T9ZA 1ZUNB 3CTPA 4K9SA 3WP1B 2AFRA 4RVFA 2ORIA 4KMRA 2QLNA 3NV7A 4G4GA 3U48A 4P83A 3ZGXA 3H1GA 2AOWA 2HADA 1QQ6A 5CTJA 2BW0A 3B2QA 1S1CA 1PK7A 3H87A 2Q5CA 3PHGA 1PL0A 4IOJA 5DM2A 4ZXFA 3V1MA 5MHTA 1E94E 1E18A 3W9YA 1N2EA 2IYUA 4WXYB 2ODEA 1OXUA 2I22A 4GKAA 4DILA 3A9WA 2FP4A 4NJEA 1ID1A 4OH1A 1ACJA 2PUFA 2JEYA 2AVNA 4L5IA 2PZGA 4W9RA 3U9TA 1T3GA 1NRIA 2OGUA 4HN4B 1LC3A 4MULA 3KE8A 3UUFA 4PWYA 4TMXA 5CLIA 2FCRA 3QV1A 4Q3LA 4UTXA 1ISGA 3S2SA 4GZ6A 3ZOKA 2RJOA 3M6XA 5EP1A 3VTKA 3R7BA 3VV3A 3TE7A 3CR8A 3NYWA 3T4XA 3C1TA 4JLSA 3SJUA 1K9VF 4BX3A 2OE2A 4E88A 5ES3A 3B7WA 1HE5A 3UB2A 2Z08A 5FAKA 4JOQA 3ETCA 2ADFA 4X64B 1S89A 5B58C 1BE6A 1I0IA 5KOIA 1CTQA 2HPVA 1RBYA 1XZQA 3O2SB 5DHUA 4KQFA 4B2YA 2NLOA 4B8YA 2BLLA 4O1HA 3TR0A 3S5JA 1ND5A 3PWKA 1LQUA 1SG6A 3S44A 5LMNB 3UFXA 4NXMB 2O2DA 4J6EA 1G8GA 2VK1A 3ZTWA 3GHYA 3C1UA 2FOLA 2C61A 2FZLA 3H2IA 5HEKA 5KHAA 3VXKA 3UPTA 3HB7A 3L49A 4C3ZA 4BVEA 3BFJA 1O95C 2A9RA 1UEIA 1U6KA 1FQKA 1RWVA 1U1GA 2D5IA 2FXVA 3BIOA 2OFPA 3FWHA 5T4BA 3NU1A 4JROA 2GZDA 3DZHA 3COWA 2CVHA 2B0JA 3UMSA 5KQPA 2GEJA 2Q29A 3UEOA 3WA7A 3A37A 4CIWA 1IZ8A 3GEBA 5JCZA 3LKVA 3LHDA 1C4KA 4PEVA 4OEHA 4P3NA 1J0XO 4HR7A 2IPNA 1DAOA 1Z0IA 1BW9A 1MVOA 2HK7A 4E30A 1A7UA 3VPCA 5HS6A 3U7EB 4CHTA 1MJGA 2UVDA 4ON9A 4QQRA 3ZGOA 3PXUA 2BKXA 4K9DA 3NPMA 5GM1A 1HRKA 1KU6A 3CRVA 2VIIA 4OFWA 5E9AA 4HWOA 4L4SA 4UTRA 4XB2A 2CFIA 2NO4A 4N65A 4XIYA 3B9QA 4G5YA 5AKKA 1FS5A 5EXDA 3S0JA 3EUEA 1DAPA 1ZINA 1ENYA 2NTEA 3DOHA 4TTVA 3F8TA 3PL5A 1BX3A 1F14A 1Q0RA 2C83A 2YYAA 4XGRA 4ZANA 1SZJG 1T13A 1V5GA 5ALUA 5BT8A 4Y98A 2AEEA 3PXDA 1U80A 2VH1A 5FUWA 1MP0A 1YQQA 2F3PA 4H3KB 3S1LA 3T34A 3ZCVA 3WLRA 1I3OA 5HKBA 3AKCA 4HH4A 4MROA 5JRZA 1R8QA 1E3WB 3MQ2A 3VDNB 5JD3A 5JARA 1EAYA 2QNBA 2PKXA 2R5WA 4OJTA 4RIIA 3B85A 1QLHA 3JQ8A 3M5WA 3OZXA 3IUSA 4IL5A 2DY0A 4EARA 2Y0EA 5JVDF 2NP7A 5KNBH 3TUJC 3UN1A 4XD7A 1WG8A 2GPSA 4UMFA 1PBNA 3PEEA 1WULS 3GLQA 4LQDA 4LTMA 1WIWA 4S1VA 3S40A 1LFDB 2QTZA 3KR9A 3TLXA 4YCNA 2ZRQA 2FFBA 3F1LA 4N5MA 4DJTA 5CB4A 3QP9A 2GS9A 3MOGA 1FNDA 4C4ZA 3PC3A 3HPQA 3ZXXA 4TYQA 2GERA 3N7AA 3RAEC 1LV7A 1QRDA 1TU0A 2XVYA 2ZRLA 1VGQA 1GR1A 3L7MA 4PYOA 1U3FA 3KTDA 4YJGA 4YYZA 2DUNA 1MKYA 1O94A 4BMZA 4EITA 2I6QA 1PJLA 1S8NA 2OXRA 3EVZA 3ROKA 4HGOA 4O8CA 2A88A 2VF5X 4YAGA 2G76A 1O5OA 4IQ0A 1J9GA 3WP0A 4WOCA 2BP7B 1EVYA 3EAQA 2G82A 3O4IA 4PV7A 4XQCA 2GEBA 1KMIY 3T9BA 3ZU5A 4TMYA 4DMKA 3OJ0A 2AS0A 1WUHS 4GF5A 3GIWA 4MLZA 1GPLA 3IO5A 3LL7A 3GFRA 4UXJA 3S3TA 5E8JA 1U7TA 1Y3IA 2EFJA 3CZQA 2W6JA 3A1VA 5HF9A 4WFQA 1O87A 2WVAA 1KE1A 2YVQA 2QTFA 4NCKA 4F71A 2FNAA 2XQIA 4LHVA 2XCTB 1SHTX 4RUKA 1M0WA 2GPTA 2GZRA 2IEIA 2J0UA 1C0PA 2ZB3A 3A9UA 4G97A 4HPJB 4NRDA 2A7XA 4DR1B 3HWWA 4HKTA 1E4EA 5LYYA 2CLCX 1BDBA 4D7AA 9LDBA 5BXQC 2RGEA 2WA2A 1H2RS 1FFSA 5DTJA 4FDAA 1BE0A 3WL5A 4L2IA 1X92A 2ONZA 1KEPA 1EFRD 3NBFA 3G9UA 4RV9A 4X65B 1BHO1 1GTL1 2VYQA 2ZWMA 4AMUA 3FPCA 4UNIA 3GRYA 2J41A 3L01A 3NHJA 3NG1A 1A9XB 5TX7A 1FVXA 4ERXA 4RKWA 1N6NA 2VDPB 1PNVA 3OF3A 5C1IA 2ZCUA 2XWQA 4GI2A 4LPKA 3SEZA 4RANA 4B6PA 4CBVA 1XHLA 2MOKA 3L7BA 2SKDA 3F98A 3LX6A 2VS1A 3ED1A 1A8HA 3DB1A 3OE4A 2PWAA 4QNNA 3TFOA 4WXMA 4QBHA 4P2GA 5TF0A 3A6DA 3ZS9A 5JEDA 4ARVA 5H8WA 3DR5A 3QXJA 4DSAA 3VU9A 1U9IA 8GPBA 1PJSA 3L6CA 5D3KA 5THQA 1I0LA 1YMVA 3VH2A 4KVFA 2ZIEA 3FHCB 4NNPA 4LPSA 1LDNA 1P5JA 3EARA 3K4HA 1N5MA 3T9EA 4WK2B 4K0RA 3KSBC 4IF4A 4BTEA 5J2TF 4FHZA 1BGWA 4WCFA 3PX7A 4LI3X 1XVAA 4P86A 2QUKA 4HXFB 3VISA 1XMJA 1TX4B 1C2YA 1Y9JA 1XC7A 4MR8B 1JP7A 2VSNA 3ONDA 3TOXA 4AECA 4HAZA 2HM7A 1S2MA 3ZE1B 2BELA 2AX3A 3M3PA 4W7SA 1PLKA 1D8AA 2YXEA 3E3OA 5JNSA 2AMVA 4E4RA 1AS3A 3SVTA 4B73A 1RCFA 3BMCA 4LDRA 4RK5A 1TL7C 1IVNA 2FX3A 3OIFA 4AS2A 4F86A 4QT4A 5BUQA 1CS0B 2WV7A 4WY5A 1ZRHA 3K71B 1SRRA 4QU5A 3QKRB 1DIRA 3D6JA 4N5DA 3VZRA 3E9RA 2A9OA 4M49A 5AM4A 1IEWA 4EUFA 5B3KA 4OYYA 3D6TB 1FUUA 2QRJA 2JCVA 3OC6A 5E7MA 3OE5A 4DE5A 4F5ZA 3REQA 1P2DA 4PFQA 4FYKA 3RRBA 2PX5A 4A8TA 5CVCA 4NHEA 1Z6GA 4RU1A 2HJWA 5D1HA 2TMGA 3GNLA 3U9LA 4CLRA 5A3SA 5KNDH 1HDOA 4ZO9A 3FTEA 3QVTA 3Q41A 2R7NA 3M9WA 3NRCA 5DK4A 5EPEA 1IY8A 1J49A 1SURA 4TMWA 1GPNA 2QRKA 3LX4A 2EP8A 5GOTA 4F06A 1HDCA 1U1DA 3MWKA 4KQCA 4MVJM 1Q16A 3O7MA 4PRZA 4RFLA 4WBSA 4X1IB 1OILA 1NMZA 2I4IA 3QHAA 4BKOA 2AFHA 4AJOA 3CW2A 1A9SA 3NVAA 3TRJA 5FD8A 4RSGA 3IOCA 1ZA1A 1RJ9B 3OZUA 4DSZA 4QAQA 3SPXA 1GU1A 1KI7A 3I8SA 3GJZA 2GRJA 2GDJA 3DAGA 2EJVA 5CDGA 3D3NA 2CWDA 4ZVMA 4GXTA 2I8AA 3BH7A 5ANRB 5LVAA 2WSSD 5DWQA 1LW7A 2BSAA 5EHGA 4RULA 3GAFA 4YLGA 2PKQP 4ZVPA 3VVMA 4A3SA 1HT0A 1K97A 2I0FA 4FMCB 4TQUS 2CDNA 1QDUA 2HA6A 1E0DA 1Q92A 1YIDA 2FW1A 4XM0A 5KNBD 4BNYA 1UZAA 1ESNA 3A1WA 3LHKA 4QTZA 1R0SA 4W9NC 1MOQA 2VFAA 3VHQA 5KVVA 3FJYA 2GK3A 4JJGA 1FC0A 4O33A 5U4XA 2ZJ3A 3GUYA 5A4DA 4DR7B 3LIPA 5LR6A 3SMQA 4ZAGA 2NO7A 1DWPA 2QZ9A 3DOJA 3L8ZA 1EGMB 4G1EB 4BQEA 3CCCA 4JIMA 4LWZA 3AF0A 3DC7A 1MJ5A 3WL8A 5IXJA 1KEKA 1PG2A 4E2FA 4GOND 1WVIA 3BK2A 4AJ4A 1W9MA 3A3YA 1VSVA 4KR0A 4YK7A 1G21A 3K3PA 1H2BA 2NQ8A 3EZFA 3F3MA 2NUTA 3N9IA 2A0YA 2ZE5A 2I62A 2AGVA 2B9EA 3IIMA 4DFDA 4YI3A 3SQNA 2O8EB 3M8KA 4FX2A 2WWIA 1X74A 2FMFA 2FJUA 3GRPA 3ZJTA 4RD0A 1BU8A 2GTPA 1XDGA 2NIPA 1CUVA 1X8KA 4JLOA 2R9VA 1P1BA 2XT6A 1V41E 1Q95A 1EXNA 2F1IA 5BQ5A 5L45A 3MCUA 3DFIA 2GHIA 1BKDR 4ETMA 3FLEA 2CLLB 1TYDE 4Y2UA 2XE6A 3IP1A 2ZB8A 1P6XA 4EUKA 2VT2A 5T6BA 1XSEA 3QUTA 3PCRB 3NASA 5A05A 2V7TA 4B4KA 4DY4A 2QD4A 1EUDA 1EXDA 5HX7A 3VRHA 4QGGA 4D9BA 5IM4F 3K9HA 1UKCA 3KKQA 1XEXA 4UUNA 3ZWXA 3OHMA 4R1PA 4CG2A 3Q7PA 3DDCA 4PPFA 1UDXA 1A7KA 3FNIA 3OFJA 3TPZA 3PU6A 1K6XA 1J2UA 2XCRB 4EG0A 2QENA 1ITZA 3KDAA 2C9YA 2UZ1B 4AJ2A 4WZBA 1BHJA 2VHJA 1PDOA 4R2HA 3UPDA 1F9AA 3A70A 4OQ4A 1EFUA 5BVHA 2YXDA 1I7DA 1CCWA 2PUGA 4JI7B 4O0MA 2VHQA 2W4MA 3AIIA 1A2QA 3CT6A 5EJGA 4C2AA 3K92A 4P3PA 5B3JC 2CJWA 2ZQYA 4TWRA 3VU0A 1OYVA 1BXGA 1SUWA 1LDGA 4G4SP 3GLKA 1OPRA 2VHEA 3NGMA 2OD7A 3O2QB 2Q9AA 2OO3A 2ZDQA 5DN9A 3SM9A 5EAIA 3I04M 3O9MA 5BYAA 1QIIA 4V2UA 1V2GA 2V96A 3JWEA 1J97A 3JRWA 4LRUA 4U1RA 2M6KA 1R37A 3SI7A 4E5NA 5FO1A 4DEYA 1ZRNA 1AGNA 2EGHA 2VJPA 2BFCB 3W2HA 4JIGA 2PY6A 4LDQA 3PB3A 5BSKA 3THRA 2F3SA 3QWBA 1JWBB 1PR5A 1YFZA 3KQWA 3CX3A 3IAEA 2R8XA 4TS3A 2I65A 4HSEA 3NT5A 4L08A 4H31A 4RELA 1QUFA 4NE9A 4JUFA 1N6OA 3HMKA 5G53C 1L7XA 5C8YB 3SYTA 2C20A 3IMEA 4HBGA 2DPYA 4W1QA 4UCFA 1Q3TA 1TA9A 1EE1A 2FEWB 3EMVA 1H2HA 3HN2A 3ND7A 4K81B 4LCBA 4YHBA 3WR5A 1Z73A 1TUBA 3DE7X 4NOMA 1DARA 1YBVA 3OCVA 2XYRA 4I5IA 1IBRA 3JQQA 4GKBA 4O6VA 4OQEA 1XLUA 3BFKA 2RMKA 4ZD6A 4CN8A 2VJLA 2Q0SA 4PVCA 3HLKA 4GO1A 4UU7A 3KZMA 2OAP1 3C3DA 5SY9A 2VQFB 1FFXB 1ZN9A 1IRXA 3N39C 3PR1A 3D3WB 2VQ6A 5AKZA 4FUQA 4M0MA 3TH5A 4J2OA 4O2LA 4OKNA 1G17A 4K9KA 4O1IA 4XPIA 2I9KA 4XYGA 5E6RB 2NTNA 2VWQA 2F1OA 2HRZA 1WSBA 3D5EA 1ZH8A 3FDZB 3HB4X 4ZYXA 3U4QB 3PFHA 1QH8B 4PLCA 2WE7A 2OCDA 1CHDA 4QWWA 4HDOB 1PYGA 5J4LA 1XJ5A 2FJPA 3SEAA 4FNGA 5BN3A 4XGQA 2Q1SA 2J33A 3K9FC 3RNLA 1GTZA 3C3XA 1ODTC 3JWHA 1X1SA 4PZPA 2PA0A 1WZUA 1DQNA 4YQYA 1WWKA 2WJ4A 4Y2QA 3EDOA 4JWTA 4QO8A 2W2KA 2PGJA 3D1JA 4QM6A 2ZXEA 4RCYA 1WY5A 3WZLA 3FR8A 4IO0A 2O8CA 4UULA 1BNCA 1DZ3A 4M0DA 4YJ3A 3SIPA 1K86A 1SUPA 3UWDA 4YRSA 1NF8A 1T2AA 3JQBA 4JN6B 3QLUC 4KQKA 3WFJA 3L5KA 4MP8A 3Q7QA 4IX9A 4NESA 5JSUA 2QMHA 2YQZA 1GG8A 4M38A 2CV1A 2CLHB 3KKKA 4HEJA 5TDHA 5AD1A 1A5BB 3SYMA 2ADOA 3VKFA 2VKQA 2A7QA 4NV0A 1NI5A 4DCTA 5FQNA 3OOJA 2I6TA 2X5XA 3L18A 1KDRA 2VUIB 2DT8A 4M83A 1USWA 1NHWA 2H07A 3FSJX 1IY0A 1CQPA 2YQ5A 2BE7A 3PJGA 2QYTA 1ABEA 3CV3A 4IFIA 4JR2A 3OWXA 4ZDWA 3MMXA 1AMUA 2A3NA 3ABRB 5A4FS 3ICQB 1JA9A 1VECA 3D3KA 4DA0A 4P4NA 5FWXB 1KFCB 2CDRA 2R6CA 1N0IA 2PBLA 1JQEA 3FTPA 4A91A 4OK6A 1P19A 4NCAA 5E1MA 1ZD5A 3N2EA 4I08A 1CJKC 2GKSA 3QGMA 3RK0A 421PA 1J06A 2VF2A 4OSEA 4JXXA 1ECPA 3F6RA 3C4QA 2AJTA 5AKIA 3W5SA 5I48A 5JAOA 2CXRA 4OXYA 5ALFA 4D25A 1FXWF 3CJRA 3CWZA 3JYQA 4YJ2A 1TJPB 1NW4A 4XASA 5CG1A 1AQYA 2LKCA 4Q12A 5L6LB 2FA9A 5K4AA 4E31A 3K9CA 4Z1OA 5BV1A 4QEKA 5C8YA 4XFKA 3KOOA 3VYUB 2BZ1A 4QRDA 4GPEA 1UKYA 5ALDA 4ZVOA 1NDQA 5JG7A 3TJZA 3QEMB 1BJRE 3USZA 5C7LO 4XWOA 5DBHX 4L7VA 1TZMA 5CW1A 2QAJA 5EJ2A 5LB4A 2RAPA 3CSSA 4QGFA 3FVTA 4FCVA 1PFVA 1XCJA 4L4ZA 5GWXA 4WKCA 4CMJA 3B1KA 1AHPA 3TVDA 1J0BA 3VHXA 2VP5A 4MIEA 1W59A 3GP3A 3HDQA 1GZ5A 3DL7A 1O96B 2ZXFA 4HGYA 4WCFB 3ELWA 1ESZA 2P1ZA 3GEGA 4FR0A 4WY8A 3R7FA 3VMMA 4ZJYA 1BDIA 1G3IA 1XLTA 2BI4A 4H0CA 4OP3A 5ESRA 3G9XA 1QIHA 3I0NA 5I9LA 3W3AA 1AHIA 3DOUA 2B8TA 3ZJVA 5IBPA 3QJ5A 1DC7A 1GAEO 4KUGA 1JDSA 5EZYB 1A95A 5E2BA 1V71A 3ZC3A 1K6IA 1ZMBA 2UYQA 3NGXA 1ISPA 3OM1A 2DBVO 3LT0A 5KZMB 4LE2A 5G4KB 5ALXA 2HJSA 1TJ4A 2JKYA 4TT3A 5AI0A 3RAFC 5EVJA 2NSLA 4UHJA 1WCYA 5E4TA 1DEXA 3SICE 1O0CA 1UPCA 2JJ1D 1YACA 4GG1A 1Q0LA 4NH0A 1TO6A 4Q9JA 1CU1A 3EVNA 4O4JF 1E59A 4EMUA 5I7HA 4IH9A 1DUVG 3O8RA 1MJGM 3A4MA 3I53A 5ESDA 5JS8A 1J0AA 1ZNYA 3NPAA 4EI9A 1M2NA 1FOEB 1N57A 1W2HA 2HEIA 3ZZTA 3LHFA 1VL8A 4YIKA 1NMEA 1YL6A 2R5NA 4TUYF 5FBWB 5A7HA 4JJ6A 5AW7A 2WJGA 3EDCA 2EERA 3EULA 3U0BA 4MGKR 3OQJA 3ESXA 2GJ8A 4GYJA 1ZI8A 4FMBB 3CLUC 3FOFC 5JQWA 4X7PA 1F7UA 4YQZA 4WKPA 3ZIDA 4EYSA 2D00A 2G06A 3QYAA 4MNTA 2C04A 3JQAB 4WRRA 3M1IA 3WTCA 1UZLA 4D5GA 2IF0A 4F11A 4M54A 5TQ2A 3ZJUA 1X6VA 2GZHA 1NTOA 2EXXA 3CN9A 3OWHA 2PXXA 4ITUA 4RTMA 1XTIA 1AC5A 4MQ6A 5GIOE 2QMZA 5ED0A 1IHOA 1O03A 3HE3A 2BLNA 5ERXA 1GAQA 2AOVA 5J2UB 5H9WA 3T5PA 3H9UA 5AMXA 1AQ6A 1R4MA 1OFUA 4UOEA 3ULKA 5LU8A 1DPFA 1QHFA 1AB5A 5BOSB 4J4TA 4RL4A 3TLCA 1I2BA 2WTEA 1CJMA 2A9KA 3TKLA 2X8JB 1V16B 3S2GA 1FDWA 5LZ4A 2RK4A 3PTZA 4ISBA 4TXHA 1ZVVA 1BH2A 3UCFA 1RWNA 1VCNA 4ESEA 4BEBA 4MVJE 2C0CA 4IHJA 1IAVA 1RYEA 1HOTA 2HIGA 4KXWA 3DW3X 2EDCA 3N8NA 3PA8A 1OXMA 1PHPA 2VJBA 3F78A 4YT2A 1F8YA 5KIAA 1CQJA 1JLKA 5ALNA 3SEFA 2O2SA 4C9BA 4OH7A 3KHKA 1WUTA 2FEOA 3K1AA 2OMEA 4Z4IA 4L0DA 1XWIA 4TWBA 1Q7RA 3B6EA 2KB0A 1Y6ZA 2YL2A 5K6RA 1C9MA 4EF4A 3TSYA 1VG9B 1IN1A 3UG7A 5I9TA 5B2EA 2PGAA 3QVSA 5CFQA 1U3VA 3QVJA 2DQSA 2M1ZA 2YV5A 4RMJA 1S7GA 4Y18A 4XYEA 3N0TA 4AMZA 1UQUA 2VH5R 4GRIA 1R0RE 1A04A 3LU1A 1NSTA 2L82A 3MW8A 3PICA 3SXUA 1AIPA 4K26A 3AM5A 5FLYA 2W4QA 3CR7A 4G23A 4I4TF 5ECYA 1H8ED 2I3DA 4I5DA 1W34A 3SC2A 3FYUA 4JP2A 2JRLA 3FI9A 4BVKA 1C9DB 1XDWA 4LHXA 4U4AA 3V00A 2JI9A 5BXYA 3DV0B 3GGCA 1QTIA 4JP1A 4NE2A 5ALIA 1OC2A 3GVIA 4AN0A 2BP7A 1ZXXA 2ZEJA 1JBKA 2XUKA 3NCHA 4S05A 1N75A 1LEHA 4IDEA 5EA2A 3ANLA 4IGKA 3STUA 1KO7A 1TLTA 2FCAA 3NCTA 1DVRA 3HCDA 3UWSA 4G0UA 1M34E 1LW6E 3I2IA 3RS7A 4QBIA 4JZKA 5JH7A 1UBUS 2PSHA 4V2IA 2HCJB 4TWZA 2Y1GA 9GPBA 1YS4A 1GZDA 1VLQA 4MYHA 1FJHA 5DWDA 1YE5A 1YJBA 4K9PA 2J3IA 2O7NA 3IHKA 1SQ5A 3E9ZA 3N58A 5A4AA 4ALIA 1I7QB 3WIOA 3IFSA 1DC8A 1VRVA 5JYCA 1BEUB 2Q6KA 2QJRA 4RJLA 2GN0A 3FDFA 2A9QA 3R24A 4CEJA 1U3WA 2Y1DA 4NMMA 1JKJB 2W2TA 3FNBA 1PD0A 1KJYA 4QASA 4LGYA 3GVPA 1VHLA 3L9WA 3PHIA 4M36A 3ICOA 5FULA 2YV1A 3QSYA 4B4WA 4UOZA 1Y3DE 1DV2A 3OKCA 2QZ4A 4UMEA 5DHFA 4Q1BA 1IUKA 5JANA 2GDZA 3TK1A 2ZRCA 1H1LA 1L1EA 1X8JA 1Y6QA 4EECA 1LK5A 1LD3A 2QRHA 2NWQA 3I30X 3ZCPA 1RC8A 2VZ0A 2YRXA 1D09A 2Y2UA 2Z09A 3E5RA 4XUGB 2ZB4A 3JR3A 4MVJG 3TD6A 3P5BA 3INYA 5FTLA 1QCYA 2BJHA 3R8CA 3DBVO 4PQGA 1KJJA 2P3OA 2X19A 3K7EA 4M1TA 4EG4A 1DQZA 5CDHA 5D6NA 1UFOA 3PQ5A 2WICA 4Z86A 3WKAA 2R6AA 1JKIA 3TZQA 1NKVA 1GZ3A 3Q5EA 3JQPA 2QMYA 5FR1A 3ZV7A 4D3YA 3N8GA 3RAPR 2PUHA 1BMFD 5G0WA 1YJAA 4Y2RA 2O5RA 1E6EA 1Q7EA 3H5NA 1YA6A 1DBPA 1ZKMA 3CG0A 1LBQA 3IQDB 3BK1A 3QWAA 1KJWA 3B6IA 3ZU4A 2YWFA 1GCOA 1JB1A 2XWSA 4IRMA 4D0NA 1EFHA 1GA1A 1FTGA 1F8XA 4PCUA 3RYFA 1NFRA 1WOYA 2IEBA 3B9PA 4BE9A 5B1YA 5JZBA 4G5XA 5JNRA 3WVNA 2A4KA 4FFRA 5JMWA 4TQ9A 1JL3A 1ZH6A 3VYRB 3CEPB 4OL9A 3DLHA 2H48A 2HK8A 2J0VA 3U3ZA 1W49A 3QIAA 2WQZA 4G1FA 4TLBA 5CX1B 3WL7A 2V5VA 2CF6A 4QSMA 1JA0A 3TRIA 3FOWA 4MUKA 1JH9A 3DMPA 2G1UA 1B00A 4MW7A 1ODSA 5JY1A 4DLLA 2C82A 2EC5A 1FP2A 4ZVNA 3OPNA 1SG0A 2IOFA 5TQJA 2OESA 1EFPA 2XHEA 4ILEA 5KX5B 2ZBDA 2OCPA 4OMUA 4NPAA 4DQDA 4X45A 2FPRA 4L74A 3SK0A 4X20A 5MGNA 4D43A 2AFIE 3T1VA 1HE4A 1HFEL 1UR5A 1OPXA 1YQXA 2XX3A 4AY4A 3F9IA 2H0RA 4BNDB 1CY1A 1ZK4A 3I6IA 1QTQA 1E7SA 1PQPA 2PMCA 1ORWA 3M5DA 1JFFA 1H5UA 4PS1A 1FDRA 4TRJA 3E70C 4GGOA 5KC8A 2ZUUA 3ZDAA 3VKHA 1E0JA 3K1YA 5GONF 1TMYA 3RUEA 5JBQA 1NC1A 3C5WP 1MB3A 4J29A 4F3KA 4J49A 2RHDA 3HABA 5F7XA 3EEYA 2JIQA 3F6EX 3LQKA 1E0SA 3BQMB 2A8YA 3R5HA 3VYVA 2HQOA 1DT5A 1PUJA 5LOVA 4NX2A 4I5GA 5CB4F 2NZWA 2WG1A 4IEEA 4P3XA 1Z0ZA 3T7CA 4DADA 3OHSX 2AC7A 3A6EA 4BB6A 3DVQX 3IVGA 1T1JA 2CUKA 2PFSA 1ZAKA 2P62A 5H7XA 1Y1RA 5A4IS 4OXKA 3PQ2A 1FXUA 3MAJA 1XZJA 1T0PA 3DYIA 4UTVA 1OT3A 1TM1E 4HMOA 3WLOA 4ZDKA 1WDKA 2QAGB 3IP6A 2HDWA 4MV4A 1OKKA 2IELA 2UVQA 3B53X 1GL6A 3IVXA 3K9GA 3U4AA 4RGYA 4BJ5A 1NKSA 4HZUA 3D3WA 2FPIA 1J5EB 1AKNA 3H9BA 3RKUA 3RS2A 4HDRB 4KFRA 1GG5A 3SJAA 4DEVA 1VL5A 1Z3IX 5CM9C 2FX2A 2R8YA 1O77A 5BQ3A 1I1NA 3R76A 5E3HA 4B3BA 4AJ9A 1UXOA 2EX0A 2X0IA 1PNOA 2X6TA 5MDHA 2CV0A 3EIWA 1NLMA 5CFOA 1ZC4A 4XDHA 3PIIA 5DXJA 3DLIA 5JPIA 3AB7A 3DEFA 4NECA 2I4NA 1PEKE 4RORA 1YS7A 1XTQA 4F9TA 3G7NA 5B1DA 4U39A 1PKXA 5J63A 4HAUA 1KGDA 1KQPA 2NZ2A 5JWHA 2VHWA 3PUHA 3MELA 2J07A 2BHTA 2G5TA 3RU7A 3WB0A 4GQAA 2NPOA 2WJVA 3IA7A 3C24A 2IP1A 2YIVX 3UK7A 4LF8B 1WXXA 3WFZA 1UP6A 2VHVA 1IZ0A 2G3YA 1DC6A 3C7CB 1B6GA 3WA6A 2B8EA 2BBSA 2YN4A 3NDPA 1XDBA 1RYHA 2DFDA 2R2AA 3Q8MA 4HMQA 1JU3A 1KQOA 4XJXA 4C7JA 1EHYA 2O7SA 2P7HA 4URXR 2JCXA 2GBGA 3K2IA 4EPTA 2QTLA 2I2FA 4MPTA 1XD2A 4NYMQ 2PEYA 3PWZA 1M6YA 2PZMA 1UL1X 1G2OA 1Y82A 3THXA 4DZZA 3IJEB 1JEYB 4DOMA 4EYOA 2Z8ZA 3CO0S 3RF7A 1XELA 2WUVA 3OQIA 3SD7A 3OKFA 1DOAA 4E46A 4G65A 3W5BA 1R4NA 5EJFA 2CKDA 1T34A 3FGNA 1BYUA 3GD5A 3WLLA 2EL7A 1ORRA 2YJGA 3KZXA 3C8ZA 3EQ9A 4JBIA 2H2AA 3T3IA 3FIJA 4JYBA 1FVHA 3GRCA 1JQLB 4PX3A 1AK9A 4AS3A 1IEXA 2OR3A 1NVGA 6PFKA 7ADHA 5LQKA 3M7IA 4O2AA 1VL2A 4WLVA 3H9JA 2CVPA 3TIGA 5TJ9A 5HFNA 1E2EA 1VJ0A 2PG3A 2JJ2A 1XZFA 3PQFA 1NURA 3LPNA 4ZCMA 2ZETA 2ZXUA 3I6MA 3AFMA 2ZTLA 5BR7A 3MB8A 4F96A 3TRFA 2C54A 2QMEA 2PYZA 4CQMB 1X7GA 3KYIB 5CT8A 2Z6VA 4H3SA 4JLDA 2C7BA 1JHUA 1JKMA 1HYBA 3FOBA 4NEGA 4ZI7B 1XXHA 2YY5A 4ATNA 1IWBB 4JCCA 1VL0A 4ND8B 2ZJZA 5JEEA 1A77A 1YZUA 1MJFA 3CURA 5EL0A 1L5HA 1L1QA 1ID8A 2SCUB 1DPGA 5ENZA 4I4TB 3QMPA 1RZ3A 1W5EA 3O3MB 5AW0A 2Q4EA 5T7BA 4P9NA 3QLEA 1KYXA 1TQ2A 2ECFA 3R3SA 4PQEA 2QX4A 3DPSA 3PEFA 4UVIA 3ASYA 2PUTA 2OZKA 4Y1GA 1GPAA 2OGZA 1XQ6A 3GRAA 1VLHA 3KLBA 3UTCA 2IYRA 1E6MA 4OLJA 1JAYA 2AN4A 1VJGA 2BFPA 2FPKA 3DAPA 4RACA 5ALEA 3NBAA 3TLAA 5AVOA 3ETEA 1WUIS 4KFSA 3N70A 4LDZA 2ERCA 6GPBA 4EZBA 2QBYA 3RK4A 6YASA 1W581 4FHDA 2ZPUA 1JS1X 1KOFA 3HGTA 5TF4A 2WKPA 1QDEA 3K5PA 2WYOA 3P0HA 1B0UA 3I58A 3UV6A 3WLIA 3QMWA 1RXWA 2NUPA 5EJ6A 3P27A 3P2YA 2F48A 3JY6A 4URZR 1WXQA 2E2WA 3OJXA 2EFCB 2Q5JA 4WMLA 1L5SA 5AW4A 5JC1A 5LXTF 2DFLA 3IQXA 1YHZA 3PFKA 2HNAA 3M4JA 4NH4A 4FC6A 3NJ8A 2I55A 1K0FA 2I4OA 4W8GA 2E9SA 3WYFA 4KR6A 2TMKA 3FYUC 2HBZA 4JOSA 1MNAA 2QDKA 4I1UA 4ARUA 4S24A 1QH0A 3KV3O 2KSQA 1FB5A 3NJ4A 2P5TB 3GPIA 3T5BA 3ZWCA 1IQ0A 5K03A 1GL9B 1NT4A 4C6HA 2JEZA 3CPEA 1TUEA 4RKEA 4Z6KA 1SUIA 2QSYA 3G13A 3PQ8A 4M1QA 4ZZ3A 2XB8A 4QU0A 5HSGA 5DNEA 3ZUGA 3KQOA 1NXPA 4OXXA 3ZQJA 1KI6A 2EOAA 3NAMA 4MZDA 1HQDA 5ALRA 3Q87B 4G25A 3B51X 5K5EA 1RI1A 3DKIA 8AT1A 1YS1X 2C2KA 3BHIA 5FWYB 2XVMA 4JT2A 1J09A 4Y6RA 4RADA 4AX4A 4TKVB 4WZBE 3C4JA 4G0WA 4F3TA 1A9TA 4B32A 2WHYA 2XUGA 2BCJQ 4L6CA 1SM4A 1WLYA 1PT9A 2R00A 4X8LA 4XIFA 5JWRA 4OI2A 4REQA 1ZYUA 4QOSA 4YREA 4ZDIA 4RKQA 4ZVRA 3VNUA 2AMLA 2VC2B 3AONB 1BD3A 3A0RB 1DP4A 2ES4A 3PFFA 4X0EA 5C5EA 5CYOA 3CUVA 3CX8A 2PE5A 1C3EA 1S2LA 4L5AA 1DX6A 2Q4RA 5ALHA 1K7CA 1WS6A 5FWXA 1X8XA 3S8MA 5KNCA 4DJ5X 3B7PA 1D0SA 3GROA 2D2EA 3BWBA 3HSSA 1TK2A 3UAVA 4MUNA 4H1VA 1QK4A 3G2JA 1OIXA 2HTEA 4BNWA 1K2VN 1CQXA 5IAJA 4F3NA 5HTOA 2ZRFA 4E14A 3PT9A 1SIBE 1QHNA 5FHQA 4BV8A 2NTVA 3G0BA 3KXLA 4AY3A 1PW7A 1UWKA 3AL2A 4M6WA 4QUBA 4YHHB 1J00A 5EHZA 3SFZA 1V0JA 2QP3A 3OEED 4D9JA 3HYSA 1NP6A 3GBPA 2GCOB 1U0NA 3NC1C 4KQ2A 4MV1A 5E6UB 5DF1A 1VIDA 1YZQA 1CR2A 4R2IA 2PAFA 3O6VA 2EZ4A 1VB3A 1W25A 2HCFA 3DOOA 2O6LA 2O8NA 3R9WA 1K6MA 3GP5A 1LX7A 3EVGA 5K0TA 1TA4A 5KWSA 4UM8B 1IJKA 3UAXA 3L6EA 1K8RA 1W5FA 2YWDA 1RJWA 2ZTSA 1MGOA 3PNPA 1M33A 3G89A 3HXLA 3Q85A 5FL7D 2DYKA 2QY9A 5BSFA 1AURA 4MDHA 3NMUF 3M4ZA 4MDFA 5ALZA 1B7GO 1MV5A 3CWQA 3GARA 4QGBA 2B7CA 1O97D 4GP9A 4JJAA 3HKBA 4PINA 3ZPXA 2YV4A 1DJOA 5M04A 3S6JA 3CVUA 3LI2A 3GDFA 4BATA 4HVLA 3GLVA 1Q7BA 2OA0A 5I9BA 1AV6A 3CLRC 1GCUA 3PC4A 3N2KB 4OOEA 1IJBA 2YWRA 1MC1A 4TTAA 4XPIB 3GEMA 2DPXA 2Z2YA 4RTNA 3OCXA 1KI3A 4DKXA 5GVSA 5J23A 2AZ4A 4P0PB 5ELMA 1IZ7A 5JR3A 2OXEA 2CWWA 1HQKA 4ZOCA 3RU9A 1XL0A 2CCJA 1SOVA 3T7SA 1ZWLA 2CZCA 5BSRA 2H65A 3KYDB 4FEAA 4D0LB 2PMFA 2OG2A 4JA0A 4O0LA 1DRWA 2XB9A 1H6DA 3CISA 5KYYA 2FUG1 1THMA 2BMJA 4EF5A 2WM3A 3HB9A 1M1ZA 3LXMA 1R27A 1CT9A 4OQPA 1KI8A 4X9XA 4ACBA 1VRCA 1G1MA 2VP4A 2FGKA 3AHEA 5MN6A 4ZN6A 5DX8A 1V26A 2AF3C 4MCIA 3KYJB 3S68A 1N8NA 4DLRA 1OB2A 1KZGB 4H15A 4RXMA 4D2IA 3V1UA 1XD8A 4EI8A 1W5SA 3KB2A 1ESMA 1KAQA 2RH9B 1TJ5A 4DWWA 5IU6A 3ON5A 1YASA 4P4LA 5T8KA 4CFYA 2VZ9A 2IL1A 4G6ZA 1KOLA 2AZXA 4P82A 3R3YA 4A1OA 1SB9A 1V8PA 5CDYA 2K7ZA 3PR3A 5LZ8A 1F0YA 1SVLA 4M88A 3T5AA 3BT7A 4KPUB 3FOZA 3JWIA 1JHOA 4N5HX 4WLFA 3O95A 4BLTA 4EG7A 1XU4A 4G5GA 4NDNE 5I45A 5JD5A 1NMXA 1AHNA 3AIOA 2WMYA 3HADA 4GL4A 2WVGA 2HA7A 1QYRA 2PS3A 1GZSA 1JKJA 2ST1A 3E9EA 1VSUA 4MS1A 1O97C 3SR4A 2I3BA 2B34A 4D4GA 4GEKA 4TL7A 3JQGB 2YJ5A 1M1YE 4R2JA 1QAQA 1OWMA 1WRBA 5L3ZA 3TGPA 2F6RA 4YT8A 1FMTA 3BXEA 4N82A 3VYSB 4NQZA 4GS5A 2X2FA 3FF1A 1ZRMA 4YRKA 2PRJA 1GSHA 3FOEC 1ZGGA 3E82A 4B7XA 4PN7A 2FSVC 3FDZA 4B3GA 3RUDA 1T8TA 4K1LA 3AFIA 1EVEA 1QQ5A 3A26A 4H0NA 4LS3A 1JDPA 1T5IA 2GPYA 3D6MA 3ORYA 2H51A 4JMPA 3DE0X 3RTBA 4YASA 4ZEOA 3LYAA 5F51A 3L3BA 3OUTA 3WAJA 5E9WA 5D2CA 4BV9A 2H2GA 4ZVVA 2GD1O 2Z1DA 3PENA 2HI0A 2RHWA 4NR0A 1ZGJA 4DB2A 2BZ0A 3BCUA 2F1HA 2GHQA 3H18A 3QM1A 3IE0A 1TKAA 4FK8A 2G25A 4M7RA 2VYNA 2Q6TA 2ZJBA 4UD6A 3CGGA 4YWJA 3SF0A 2D62A 3I37X 4FFOA 4FLMA 4J9UE 2GZ2A 4ZGWA 4MTCA 1B4DA 3O73A 2GCIA 3DCNA 3S1AA 3ZIAD 2FOIA 2UZAA 3AWIA 3OT5A 3G8YA 3I5XA 1Y8QB 2C92A 1E92A 1SBQA 4E2ZA 3OIVA 3MS7A 4BGEA 4C5BA 5FTKA 3WWZA 4ZCRA 2FQYA 2HFKA 4EFKA 2AC4A 3LA8A 4E1BA 3ZK9A 3IQEA 5LIPA 4EZIA 2IYTA 4POOA 2F62A 4YJ3F 5EQJB 5GINE 4H16A 2IXBA 2J6HA 3JWJA 2Q5EA 2FUEA 4YAJA 2P2LA 5A4JA 4MS3B 2PGOA 4ER7A 1I1OA 1M6EX 3M6LA 3HRKA 5A5FA 3GGSA 3EEQA 4AIRA 2XEDA 2C3UA 1VJDA 2NO9A 3AR8A 1U3UA 4FBGA 4IEFB 3PDIB 1WDTA 1ZITA 5KCZA 4NMWA 2OYRA 2W2MA 1RM4A 1IZZA 1J8YF 1VJ5A 3TAXA 1A1VA 4ZPXA 2IV7A 4RQUA 4ALMA 3IH5A 3NR2A 1T1SA 3ROPA 4KH0A 4GPZA 4QPJC 4PAQA 2WJWA 3ENVA 4L4RA 3ZV6A 1L5VA 1OASA 3L4BC 5EE5B 4PVDA 4CG0A 3UV7A 1A82A 1BRMA 2FPLA 5EZSA 1AUQA 3EN0A 1C9YA 1E5VA 4RK7A 4FW8A 2ZI4A 1E9SA 3UWMA 4K88A 3P9CA 4R7TA 4CDRA 5C18A 4RGBA 2ZBVA 1ENOA 3MVEA 2V7EA 3LS2A 4BJHB 1GKIA 1MW8X 4R3WA 2FPPA 2X8AA 2XY4A 2NGRA 4BKMA 1XWWA 3P94A 2G28A 3UGTA 4OSPA 4BO3A 1NQAO 3BB3A 4F91B 2AZDA 3WL4A 4HDQB 1P2UA 4FNMA 4M98A 1G64A 4MCAA 4ONEA 4AZTA 2VCHA 5GGYA 3VPDA 4HJRA 3WDKA 1SO8A 4ICIA 4WBNA 1VG0B 3RJTA 1RWBA 2CLIB 2PAAA 2PKWA 4NZNA 4OYLA 2A3RA 4CMKA 4DGSA 1BFKA 1WD7A 1O89A 5B37A 5BPHA 1XJ0A 2GN1A 3KWMA 3QWHA 2EIXA 1USVA 1GFWA 2B7LA 3LOPA 2H1HA 3VU1A 1D03A 1BSVA 1QC5A 1FSFA 2IP4A 3MT9A 1EZ1A 4CIXA 3NX4A 4HC4A 3R7AA 3AF5A 4D8WA 1EWKA 1DTWA 2ZR8A 1PEDA 2WJYA 3C8HA 3CUEF 3QYJA 4QJ4A 4YJHB 2NX2A 4AN1A 4MTLA 3CZ4A 3PNSA 1E3IA 3O9ZA 3EPHA 1W85A 2VBIA 1U0OC 3CZRA 1EU1A 1XVVA 2WHXA 4FKBA 4KDEA 3RTCA 4X24A 4LTNA 1EG7A 3HBMA 4JQZA 5I4CA 4UVGA 1TKRA 3KT0A 1YJCA 2SKCA 1II9A 2XH8A 3QEMA 1QBKC 4PLYA 4D9CA 3D8HA 5JECA 3KJNA 1Z0UA 4YN3A 1U0EA 5DP2A 7REQB 2BKLA 4MYTA 3T9CA 3I4CA 3H86A 1YCFA 2NT3A 3VX4A 4NAVA 1E64A 3D4LA 1G4AE 4DCUA 4O4HF 4N7JA 3UW3A 4CEHA 2Z98A 4IXWA 3RARA 1Z68A 2VNHA 3GZTB 4Y2VA 4BVBA 1EK2A 4LF4B 5AVZA 4JYMA 3HBAA 1IOZA 2BZSA 2WG0A 2PT6A 3WLSA 1L4FA 3W3ZB 1S7CA 3Q2IA 4ZFNA 1AKUA 5T8KC 1IN4A 1PTJC 1XQVA 1S2DA 4QXPA 3RYHA 1DIAA 2XW6A 3O1JC 5HCNA 1I7PA 3ESBA 1HT3A 3F97A 4ZAWA 5SYMA 3WIBA 3A2NA 3P5SA 3KQQA 3QEAZ 5FADA 2HF2A 4KNWA 4EPRA 3SXPA 5K0ZA 3N87A 4LAFA 3UF0A 2Z83A 3ZU3A 3F3SA 1ST3A 2OORA 3DNPA 4UAGA 4TZ6A 3LRPA 3OX2A 3P9IA 4B80A 2PGIA 3EXEA 5DVZA 3HR4A 1KORA 2V7PA 1L7QA 3G5TA 3IODA 3M9XA 4NV1A 4MEAA 3U6BA 1P39A 1Z5PA 3RRJA 5JS1A 1FP1D 3O93A 4L85A 4R2MA 4RK4A 2IK8A 1CEEA 5JWOA 1H69A 3UJHA 1CKEA 2QG9A 2CF5A 4MW5A 1VDZA 2F90A 4HFJA 4L9SA 4YNBA 2B78A 4NY1A 5JAZA 3GX1A 3MN1A 1H2ZA 1NE2A 4MR9B 2DSNA 1N1MA 3Q5DA 4KN9S 1U02A 5GM2A 3SLGA 3I05A 1YCDA 5ILOA 2GR9A 1QV7A 2BDUA 2X1VA 1ND6A 4HQ0A 4AROA 2CXPA 3S4YA 3KKMA 5A5EA 4BPRA 2L18A 4MITA 4TSKA 1JEOA 1WBJB 5DEIA 3B3AA 3W7AA 2YUIA 3LBAA 5B7PA 1N6HA 3UCXA 4W5RA 1L4HA 2H2IA 2PUDA 4IV5A 5H80A 3J80A 2C2ZA 1N1EA 1TIKA 1Z4KA 2YZ2A 3AZQA 3CE9A 1PFWA 3N07A 4H17A 2EG5A 2EWWA 1DAFA 1XN1A 2BEUA 3H9QA 3LLMA 1L4YA 4GHWA 1YVEI 5A9RA 4HQRA 1IVSA 1SC3A 1G2IA 1M10A 1ZCAA 4E11A 2WPDD 5K2OA 1VE5A 2VYND 4MQLA 4NS1A 3ZDYB 4X60A 1LBSA 3Q3EA 4I99A 3V4PB 1OAAA 4ENUA 4EG3A 1WU8A 3OU2A 2XDYA 3AW9A 3HKBB 3LQYA 4OBEA 5LQSA 3T7TA 4NF2A 1D0VA 4RPHA 1D2GA 3KE9A 3QQ5A 3FFXA 4P0QB 5JLAA 3F47A 3WLTA 3RYFB 5CLHA 4WECA 1O5IA 2B98A 1D2CA 1SCBA 3QFCA 4I19A 2BFDB 2IUUA 5KJ6A 1I4EB 4YRJA 5HGXA 4KPGA 5FRDA 4D79A 1Q22A 2PZEA 1FK8A 4ZYLA 4PSVA 5MFPA 4TTIA 4ZMRA 1EINA 4P36A 1YR7A 1L5ZA 5BNTA 2AG0A 1GA4A 1A9PA 1G8MA 1JMVA 3FCEA 5BUSA 5HTKA 3MUEA 4KOEC 1PVVA 1WA5A 2NADA 2XT9A 2ZK7A 1ICEA 2FR0A 4B74A 3NHPA 1G5RA 3OEEA 2J6CA 4Q1VA 1UBEA 3GFFA 1PJTA 4QOJA 3RRMA 4FVTA 1Q57A 2BGIA 3EHEA 4HN2A 1QIGA 3WXMA 4AK9A 4HDCA 3C3YA 1U8EA 1MENA 2FK8A 4AAYA 3ERCA 2SECE 1G2PA 4BVAA 3QK7A 2MSEB 1Y4ZA 4FMDF 4S3MA 3TIIA 3TCNA 1K7XB 2H2WA 2VDKB 3TLMA 4BLSA 2QL7A 4FFPA 1P2FA 4Y2SA 5FHRA 4EEZA 5IJZA 1X2BA 1IIRA 4Q7LA 4PX9A 5KYWB 1RWKA 4P92A 5T64A 5B7QA 3D7MA 1JNYA 4YAIA 1V8DA 4ZC1A 2DPLA 2C9OA 5AESA 3S70A 4IIDA 2OP1A 1BMFA 5C81A 5LP6B 1M2EA 1E6WA 1A50B 2C1ZA 2C2XA 4BQNA 4MDEA 4YP7A 2IZOA 3WV4A 3QKRA 5BR8B 1HDYA 2JLYA 1EHIA 2BFFB 3HA2A 4Q7KA 2OQ2A 3D64A 4KN6A 5KWIA 5HPYB 4PSCA 4AIIA 5BSTA 3K9LA 1BS2A 4UAJA 2C94A 5KSOA 3B5EA 3GMTA 4R41A 4ARZA 4ZHQF 2VDWA 2WNHA 3UK0A 1Z12A 4DMUB 2P0AA 3H97A 1U7ZA 5K1ZA 1I6KA 3QSGA 4C4OA 1NBMA 3GWGA 5EUCA 3TIVA 3GN1A 1FW6A 1G8KA 3ZW9A 4CM5A 2FFQA 4H0FA 5JVDB 3BWXA 1PAUA 3KLPX 4MV7A 4EKYA 1J22A 3PD1A 1QQTA 1JXAA 2QROA 1XTUA 3GRFA 4I7EA 2G1PA 3QPVA 4WHMA 2AYYA 2XQGA 3AOEC 4DLTA 1R8XA 2QX7A 3T9DA 3L05A 4QVGA 2BHNA 5AIBA 3EF1A 1N4DA 1WF3A 2JKZA 3NHAA 1W4BA 1WCV1 2CXHA 2DBRA 3MILA 4TM7A 4BNFA 4DNFA 3DVRX 3V46A 1NLUA 5JD4A 3QBDA 4K86A 2HGZA 3VUFA 3F5FA 4Q00A 1AT1A 3K8OE 4M46A 3N5CA 4ZOBA 1T24A 3LPCA 2VP9A 1CHNA 4H08A 1NN0A 2PSJA 2NUAB 3STTA 2YV2A 2WPNA 1HSZA 4EMBA 4ZK6A 2RKWA 5LQMA 3G2NA 3PTAA 4RYDA 2R8PA 1G8HA 3X1KA 1PJRA 2XCIA 3QELB 5ILQA 4GMDA 1T2DA 2Z8YM 3L0YA 2GZ1A 3GJYA 3OURA 4CGZA 3A4VA 1WZ2A 2I4LA 3VKUA 5HJ7A 1EVKA 2AA3A 3I72A 3SZLA 3AKYA 4P5EA 1BCRA 1KPIA 3I2JA 4J3JA 4KRGA 3INTA 3O8LA 5B1EA 1T9GS 3HG7A 4GZ3A 3VBEA 1OOEA 3T0FA 1L9KA 3A3NA 1ZD4A 2HDOA 2FDCA 2OEPA 1E32A 4NBSA 5EE3A 4EKIA 3TLYA 3MJHA 4TKVA 4F6RA 3IUMA 4CKZA 4UDYX 4BY9E 1UDWA 4M0LA 4JJZA 1POXA 3HEAA 1IXYA 1ZC3A 2CVZA 3M4YA 2O0JA 3LWZA 4O5AA 1N2JA 3DDSA 3BK7A 2XXAA 1N2CE 3DMYA 1SELA 3IDAA 3ZWDA 2XBMA 4X85A 2I3GA 4I8DA 1ISMA 3DPUA 3DV0A 2XGMA 2YWXA 4TYMA 1E3TA 4XE5A 1DMRA 1B41A 1UK8A 3NT2A 4YIHA 2QX9A 3RE1A 4GGMX 4FZJA 4JJ8A 3FHLA 4MRRA 2X23A 4Q3BA 1NKTA 3ZNQA 3UJ6A 1B14A 1HG1A 2C0PA 3QEKA 1RXYA 2WTUA 3LDGA 2AR0A 3FHOA 3NC0C 4PF1A 4E3WA 1XRLA 2H4XA 2WYIA 4NCIA 5DNYB 3HL4A 1F1BA 1NC3A 4ND7A 1CR6A 4CQNA 3LY5A 3VR5D 2PD4A 2GEKA 1KSFX 4P22A 4IQ8A 4RH3A 3RYIB 1NG1A 4TMFA 4L15A 1R6UA 3IKLA 3COSA 2PXHA 3AOGA 4OHZA 1KO5A 1OLXA 3VOTA 2BYTA 4CN9A 1LTKA 3OP1A 4R68A 1CR4A 1PWHA 1Z5UA 2E4YA 1L5NA 3TTXA 1LA2A 2GUWA 1NGSA 2L69A 2OB2A 4DIOA 5IZCC 4GPBA 3IESA 4QTXA 2CBXA 3NRBA 4KR9A 3SR3A 4ND1A 1YRAA 2YWJA 3QTBA 4DGQA 5BV2P 3TL2A 2M32A 5A3QA 2G83A 2G7MC 1WE2A 2ZVPX 5KU1A 3KQNA 1N32B 1Z5ZA 2AJBA 2F9FA 1M1UA 5HCUA 4F2DA 1VPVA 3DXZA 4FJ1A 4BAUA 1JEQB 5C8YF 1NN1A 3ICVA 4Q9KA 4JBGA 5F7ZA 4DCCA 3V33A 3FFBA 3IP9A 2X77A 3UYKA 2V74B 3KHTA 4HB2A 3V55A 4EY6A 3OJLA 1U8XX 4MQMA 3E1GA 4NV3A 1JLMA 2RI6A 5KNDA 3EYWA 1PQUA 2JPDA 5J4VA 3VJRA 5BNIA 4B6FA 4OM8A 1GTSA 2LGJA 1ZSNA 4CKWA 2P6OA 4E5UA 1ILWA 1CJTC 2UUPA 2Y77A 2AR7A 2OGTA 1T0UA 2PSSA 2Y1FA<