1VINA

Bovine cyclin a3
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
252
structure length
252
Chain Sequence
b'DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN A
publication title The crystal structure of cyclin A.
pubmed doi rcsb
source organism Bos taurus
molecule tags Binding protein
total genus 92
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 1996-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00134 Cyclin_N Cyclin, N-terminal domain
A PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1vinA01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1vinA02
1H26B 2QDJA 1OIUB 4BCFB 1H1RB 2C6TB 1H1PB 2IVXA 2W9ZA 2PK9B 5HBEB 1FVVB 2WMAB 2C5NB 4EOOB 4BCMD 3M03A 2B9RA 1E9HB 4ROEA 1OKWB 2CCHB 5CEIB 1UNGD 1OIYB 4BCOB 4YOZA 2V22B 1GY3B 2IW6B 1GUXB 1G3NC 3QHRB 4CFUB 4KRDB 3TNHB 4BCNB 1URCB 1F5QB 2W96A 2C5OB 4CFXB 1BU2A 4BCHB 4F70B 1PKDB 2F2CA 4EOIB 2WIHB 5CYIB 4BCQD 2W99A 2R7GA 3DOGB 1JKWA 1H27B 1UNHD 2UZDB 3BLHB 1H28B 4F7SB 4CFUD 3H4CA 4I3ZB 4BCND 2C5XB 3POMA 4EORB 2IW8B 1H4LD 4FX3B 3MY1B 1D3UB 4EOMB 2WHBB 3F5XB 2EUFA 2JGZB 3BHVB 3BHUB 1N4MA 1AD6A 1O9KA 4CRLB 1VOLA 2UZLB 2C4GB 2UZBB 5BNJB 2BKZB 3QHWB 1FINB 1OI9B 1JSUB 1OL2B 3EJ1B 3RGFB 4CXAB 1P5EB 1VYWB 2WMBB 4NSTB 1OGUB 3BLRB 5HQ0B 4ROCA 5IDNB 2WPAB 5ICPB 4EC9B 1AISB 4CFNB 1VINA 4F6SB 3G33B 2G9XB 4EOPB 3BHTB 2WFYB 4F7LB 1OKVB 4G6LB 3LQ5B 3TNWB 1H1QB 4YOOA 1ZP2A 4EONB 1JSTB 4BCKB 2W9FA 5IF1B 1H24B 1TFBA 1KXUA 4ELJA 1QMZB 1C9BA 1GUXA 1W98B 4KRCB 4Y72B 4BCGB 4CFWB 1XO2A 4IMYB 4EC8B 5FGKB 4II5B 2IW9B 4F7NB 5L2WB 4TTHA 2UUEB 2X1NB 4BCIB 5EFQB 4YOSA 3TNIB 5I5ZB 2CCIB 1JOWA 4F6UB 1H25B 1GH6B 2CJMB 5HBHB 4OR5B 5HBJB 2UZEB 3EIDB 4RODA 5LMKB 2BPMB 2WEVB 4BCQB 4EOKB 3DDQB 2PHGA 4ELLA 4EOSB 2WIPB 2WXVB 3TN8B 4CFVB 4BCJB 2I53A 4OGRB 1OL1B 3EOCB 4YC3B 4EOQB 4EOJB 4F6WB 2I40B 1O9KB 4BCPB 5HVYB 3MI9B 4BCMB 5IDPB 4UN0A 2W2HA 2PMIB 1UNLD 2C5VB 3MY5B 4EOLB 5LQFB 3BLQB 1H1SB 3MIAB 5HNBB 3O0GD 5ACBA 4F7JB 4CFMB 3K7AM 3DDPB 2PK2A
chains in the Genus database with same CATH superfamily
1H26B 2QDJA 2B9RA 3QYEA 1OKWB 2CCHB 1IREB 4OB1B 4BCOB 4YOZA 1G3NC 3QHRB 3WVDB 4BCNB 4HNUA 3TW7A 4F70B 2F2CA 5CYIB 2WIHB 3X24B 2G77A 1H28B 2C5XB 1D3UB 3F5XB 2EUFA 2BS3A 2JGZB 3BHUB 3BHVB 3QZ5B 1O9KA 2QGSA 3X28B 1OI9B 3BG5A 2WMBB 4OB3B 5IDNB 2DD4B 3QYHB 3G33B 2G9XB 3BHTB 4G6LB 3TNWB 4HL4A 2ZPGB 4EONB 1UGRB 1JSTB 4BCKB 1H24B 3HB9A 4NC6A 2CZ6B 4ELJA 4BCGB 4CFWB 4II5B 4TTHA 4BCIB 2IN3A 2CCIB 3VYGB 4FM4B 4OR5B 4CFVB 2I53A 2DXCB 4YC3B 5HVYB 3MI9B 4HNTA 4UN0A 2PMIB 3MIAB 5ACBA 4F7JB 3A8LB 3K7AM 2PK2A 2ZZDB 4BCMD 2KR6A 1UNGD 1OIYB 2V22B 2IW6B 4CFUB 1GUXB 3HHTB 3QWLA 2C5OB 2DPPB 2AHJB 1BU2A 4EOIB 2W99A 3DOGB 1H27B 1QLBA 2DMEA 2PJQA 4I3ZB 4BCND 2IW8B 1H4LD 5EJCA 3MY1B 2UZBB 3PO3S 3QHWB 1JSUB 2QQ8A 5HQ0B 3BLRB 2DXBB 4OB2B 1VINA 2WFYB 1H1QB 3KHIA 2QDYB 4JX5A 4JX6A 1W98B 4KRCB 3DJBA 2IW9B 4F7NB 2QF7A 2WJ9A 4OB0B 5I5ZB 1JOWA 4F6UB 1GH6B 2BPMB 2WEVB 4EOKB 4Z6YA 4EOSB 2WXVB 3TN8B 4BCJB 4BXXX 4OGRB 4BY1X 4AI6A 4EOJB 1O9KB 2DD5B 2CYZB 4HLQA 3HBLA 2W2HA 3X25B 3MY5B 3BLQB 3O0GD 4CFMB 4BY7X 3TW6A 2WMAB 3DDPB 1OIUB 1H1RB 2C6TB 2IVXA 4BBRM 1FVVB 2C5NB 4ROEA 2BS4A 5CEIB 1UGQB 4KRDB 3TNHB 1UGSB 3B57A 4MIMA 4CFXB 3X20B 1ENWA 1PKDB 4BCQD 4ZGDB 1JKWA 3A8OB 3DL1A 4CFUD 4EORB 4EOMB 2WHBB 4HNVA 3DTOA 2CZ0B 4CRLB 1VOLA 2C4GB 2BKZB 3GTMS 1OL2B 3EJ1B 3RGFB 3QYGB 4CXAB 4NSTB 1VYWB 2ZPBB 4EC9B 1AISB 4CFNB 4F6SB 4EOPB 4F7LB 1OKVB 4YOOA 1ZP2A 3BG3A 1KXUA 2ZCFB 3BG9A 1C9BA 5FGKB 2CZ1B 2X1NB 2BS2A 5EFQB 4YOSA 2ZPFB 3QXEB 5HBHB 3NDQA 2UZEB 3EIDB 3DDQB 3A8MB 1OL1B 4ZGEB 4EOQB 2I40B 5DQVA 5IDPB 1UNLD 2C5VB 1H1SB 3A8GB 3QYBA 4BCFB 1E7PA 1H1PB 2W9ZA 2PK9B 5HBEB 4EOOB 4BBSM 3M03A 1E9HB 4AKIA 3HO8A 1GY3B 5IHYA 1URCB 1F5QB 2W96A 2KMGA 4AKGA 4JX4A 1V29B 4BCHB 3WVEB 3VKHA 2R7GA 1UNHD 2UZDB 3BLHB 3VKGA 4F7SB 3H4CA 3X26B 3POMA 4FX3B 1N4MA 1AD6A 2UZLB 5BNJB 1FINB 1P5EB 4QSHA 4ROCA 1OGUB 1AHJB 3VYHB 2WPAB 5ICPB 3A8HB 2LW4A 3LQ5B 2ZPIB 2CZ7B 4LOCA 4MFDA 2W9FA 5IF1B 1TFBA 2ZPEB 1QMZB 1GUXA 4Y72B 1XO2A 4IMYB 4EC8B 1TD6A 3QZ9B 5L2WB 1FKMA 2UUEB 2D0QB 3TNIB 1UGPB 5DQWA 1H25B 2CJMB 5HBJB 4RODA 5LMKB 4BCQB 2PHGA 4ELLA 4ZGJB 2WIPB 2ZPHB 4AKHA 3EOCB 4F6WB 4BCPB 4M6VA 4BCMB 5LQFB 4EOLB 5HNBB 4MFEA 3HZJA 2QFZA
chains in the Genus database with same CATH topology
1H26B 2QDJA 1OIUB 4BCFB 1H1RB 2C6TB 1H1PB 2IVXA 2W9ZA 2PK9B 5HBEB 1FVVB 2WMAB 2C5NB 4EOOB 4BCMD 3M03A 2B9RA 1E9HB 4ROEA 1OKWB 2CCHB 5CEIB 1UNGD 1OIYB 4BCOB 4YOZA 2V22B 1GY3B 2IW6B 1GUXB 1G3NC 3QHRB 4CFUB 4KRDB 3TNHB 4BCNB 1URCB 1F5QB 2W96A 2C5OB 4CFXB 1BU2A 4BCHB 4F70B 1PKDB 2F2CA 4EOIB 2WIHB 5CYIB 4BCQD 2W99A 2R7GA 3DOGB 1JKWA 1H27B 1UNHD 2UZDB 3BLHB 1H28B 4F7SB 4CFUD 3H4CA 4I3ZB 4BCND 2C5XB 3POMA 4EORB 2IW8B 1H4LD 4FX3B 3MY1B 1D3UB 4EOMB 2WHBB 3F5XB 2EUFA 2JGZB 3BHVB 3BHUB 1N4MA 1AD6A 1O9KA 4CRLB 1VOLA 2UZLB 2C4GB 2UZBB 5BNJB 2BKZB 3QHWB 1FINB 1OI9B 1JSUB 1OL2B 3EJ1B 3RGFB 4CXAB 1P5EB 1VYWB 2WMBB 4NSTB 1OGUB 3BLRB 5HQ0B 4ROCA 5IDNB 2WPAB 5ICPB 4EC9B 1AISB 4CFNB 1VINA 4F6SB 3G33B 2G9XB 4EOPB 3BHTB 2WFYB 4F7LB 1OKVB 4G6LB 3LQ5B 3TNWB 1H1QB 4YOOA 1ZP2A 4EONB 1JSTB 4BCKB 2W9FA 5IF1B 1H24B 1TFBA 1KXUA 4ELJA 1QMZB 1C9BA 1GUXA 1W98B 4KRCB 4Y72B 4BCGB 4CFWB 1XO2A 4IMYB 4EC8B 5FGKB 4II5B 2IW9B 4F7NB 5L2WB 4TTHA 2UUEB 2X1NB 4BCIB 5EFQB 4YOSA 3TNIB 5I5ZB 2CCIB 1JOWA 4F6UB 1H25B 1GH6B 2CJMB 5HBHB 4OR5B 5HBJB 2UZEB 3EIDB 4RODA 5LMKB 2BPMB 2WEVB 4BCQB 4EOKB 3DDQB 2PHGA 4ELLA 4EOSB 2WIPB 2WXVB 3TN8B 4CFVB 4BCJB 2I53A 4OGRB 1OL1B 3EOCB 4YC3B 4EOQB 4EOJB 4F6WB 2I40B 1O9KB 4BCPB 5HVYB 3MI9B 4BCMB 5IDPB 4UN0A 2W2HA 2PMIB 1UNLD 2C5VB 3MY5B 4EOLB 5LQFB 3BLQB 1H1SB 3MIAB 5HNBB 3O0GD 5ACBA 4F7JB 4CFMB 3K7AM 3DDPB 2PK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H26 B;  2QDJ A;  1OIU B;  4BCF B;  1H1R B;  2C6T B;  1H1P B;  2IVX A;  2W9Z A;  2PK9 B;  5HBE B;  1FVV B;  2WMA B;  2C5N B;  4EOO B;  4BCM D;  3M03 A;  2B9R A;  1E9H B;  4ROE A;  1OKW B;  2CCH B;  5CEI B;  1UNG D;  1OIY B;  4BCO B;  4YOZ A;  2V22 B;  1GY3 B;  2IW6 B;  1GUX B;  1G3N C;  3QHR B;  4CFU B;  4KRD B;  3TNH B;  4BCN B;  1URC B;  1F5Q B;  2W96 A;  2C5O B;  4CFX B;  1BU2 A;  4BCH B;  4F70 B;  1PKD B;  2F2C A;  4EOI B;  2WIH B;  5CYI B;  4BCQ D;  2W99 A;  2R7G A;  3DOG B;  1JKW A;  1H27 B;  1UNH D;  2UZD B;  3BLH B;  1H28 B;  4F7S B;  4CFU D;  3H4C A;  4I3Z B;  4BCN D;  2C5X B;  3POM A;  4EOR B;  2IW8 B;  1H4L D;  4FX3 B;  3MY1 B;  1D3U B;  4EOM B;  2WHB B;  3F5X B;  2EUF A;  2JGZ B;  3BHV B;  3BHU B;  1N4M A;  1AD6 A;  1O9K A;  4CRL B;  1VOL A;  2UZL B;  2C4G B;  2UZB B;  5BNJ B;  2BKZ B;  3QHW B;  1FIN B;  1OI9 B;  1JSU B;  1OL2 B;  3EJ1 B;  3RGF B;  4CXA B;  1P5E B;  1VYW B;  2WMB B;  4NST B;  1OGU B;  3BLR B;  5HQ0 B;  4ROC A;  5IDN B;  2WPA B;  5ICP B;  4EC9 B;  1AIS B;  4CFN B;  1VIN A;  4F6S B;  3G33 B;  2G9X B;  4EOP B;  3BHT B;  2WFY B;  4F7L B;  1OKV B;  4G6L B;  3LQ5 B;  3TNW B;  1H1Q B;  4YOO A;  1ZP2 A;  4EON B;  1JST B;  4BCK B;  2W9F A;  5IF1 B;  1H24 B;  1TFB A;  1KXU A;  4ELJ A;  1QMZ B;  1C9B A;  1GUX A;  1W98 B;  4KRC B;  4Y72 B;  4BCG B;  4CFW B;  1XO2 A;  4IMY B;  4EC8 B;  5FGK B;  4II5 B;  2IW9 B;  4F7N B;  5L2W B;  4TTH A;  2UUE B;  2X1N B;  4BCI B;  5EFQ B;  4YOS A;  3TNI B;  5I5Z B;  2CCI B;  1JOW A;  4F6U B;  1H25 B;  1GH6 B;  2CJM B;  5HBH B;  4OR5 B;  5HBJ B;  2UZE B;  3EID B;  4ROD A;  5LMK B;  2BPM B;  2WEV B;  4BCQ B;  4EOK B;  3DDQ B;  2PHG A;  4ELL A;  4EOS B;  2WIP B;  2WXV B;  3TN8 B;  4CFV B;  4BCJ B;  2I53 A;  4OGR B;  1OL1 B;  3EOC B;  4YC3 B;  4EOQ B;  4EOJ B;  4F6W B;  2I40 B;  1O9K B;  4BCP B;  5HVY B;  3MI9 B;  4BCM B;  5IDP B;  4UN0 A;  2W2H A;  2PMI B;  1UNL D;  2C5V B;  3MY5 B;  4EOL B;  5LQF B;  3BLQ B;  1H1S B;  3MIA B;  5HNB B;  3O0G D;  5ACB A;  4F7J B;  4CFM B;  3K7A M;  3DDP B;  2PK2 A; 
#chains in the Genus database with same CATH topology
 1H26 B;  2QDJ A;  2B9R A;  3QYE A;  1OKW B;  2CCH B;  1IRE B;  4OB1 B;  4BCO B;  4YOZ A;  1G3N C;  3QHR B;  3WVD B;  4BCN B;  4HNU A;  3TW7 A;  4F70 B;  2F2C A;  5CYI B;  2WIH B;  3X24 B;  2G77 A;  1H28 B;  2C5X B;  1D3U B;  3F5X B;  2EUF A;  2BS3 A;  2JGZ B;  3BHU B;  3BHV B;  3QZ5 B;  1O9K A;  2QGS A;  3X28 B;  1OI9 B;  3BG5 A;  2WMB B;  4OB3 B;  5IDN B;  2DD4 B;  3QYH B;  3G33 B;  2G9X B;  3BHT B;  4G6L B;  3TNW B;  4HL4 A;  2ZPG B;  4EON B;  1UGR B;  1JST B;  4BCK B;  1H24 B;  3HB9 A;  4NC6 A;  2CZ6 B;  4ELJ A;  4BCG B;  4CFW B;  4II5 B;  4TTH A;  4BCI B;  2IN3 A;  2CCI B;  3VYG B;  4FM4 B;  4OR5 B;  4CFV B;  2I53 A;  2DXC B;  4YC3 B;  5HVY B;  3MI9 B;  4HNT A;  4UN0 A;  2PMI B;  3MIA B;  5ACB A;  4F7J B;  3A8L B;  3K7A M;  2PK2 A;  2ZZD B;  4BCM D;  2KR6 A;  1UNG D;  1OIY B;  2V22 B;  2IW6 B;  4CFU B;  1GUX B;  3HHT B;  3QWL A;  2C5O B;  2DPP B;  2AHJ B;  1BU2 A;  4EOI B;  2W99 A;  3DOG B;  1H27 B;  1QLB A;  2DME A;  2PJQ A;  4I3Z B;  4BCN D;  2IW8 B;  1H4L D;  5EJC A;  3MY1 B;  2UZB B;  3PO3 S;  3QHW B;  1JSU B;  2QQ8 A;  5HQ0 B;  3BLR B;  2DXB B;  4OB2 B;  1VIN A;  2WFY B;  1H1Q B;  3KHI A;  2QDY B;  4JX5 A;  4JX6 A;  1W98 B;  4KRC B;  3DJB A;  2IW9 B;  4F7N B;  2QF7 A;  2WJ9 A;  4OB0 B;  5I5Z B;  1JOW A;  4F6U B;  1GH6 B;  2BPM B;  2WEV B;  4EOK B;  4Z6Y A;  4EOS B;  2WXV B;  3TN8 B;  4BCJ B;  4BXX X;  4OGR B;  4BY1 X;  4AI6 A;  4EOJ B;  1O9K B;  2DD5 B;  2CYZ B;  4HLQ A;  3HBL A;  2W2H A;  3X25 B;  3MY5 B;  3BLQ B;  3O0G D;  4CFM B;  4BY7 X;  3TW6 A;  2WMA B;  3DDP B;  1OIU B;  1H1R B;  2C6T B;  2IVX A;  4BBR M;  1FVV B;  2C5N B;  4ROE A;  2BS4 A;  5CEI B;  1UGQ B;  4KRD B;  3TNH B;  1UGS B;  3B57 A;  4MIM A;  4CFX B;  3X20 B;  1ENW A;  1PKD B;  4BCQ D;  4ZGD B;  1JKW A;  3A8O B;  3DL1 A;  4CFU D;  4EOR B;  4EOM B;  2WHB B;  4HNV A;  3DTO A;  2CZ0 B;  4CRL B;  1VOL A;  2C4G B;  2BKZ B;  3GTM S;  1OL2 B;  3EJ1 B;  3RGF B;  3QYG B;  4CXA B;  4NST B;  1VYW B;  2ZPB B;  4EC9 B;  1AIS B;  4CFN B;  4F6S B;  4EOP B;  4F7L B;  1OKV B;  4YOO A;  1ZP2 A;  3BG3 A;  1KXU A;  2ZCF B;  3BG9 A;  1C9B A;  5FGK B;  2CZ1 B;  2X1N B;  2BS2 A;  5EFQ B;  4YOS A;  2ZPF B;  3QXE B;  5HBH B;  3NDQ A;  2UZE B;  3EID B;  3DDQ B;  3A8M B;  1OL1 B;  4ZGE B;  4EOQ B;  2I40 B;  5DQV A;  5IDP B;  1UNL D;  2C5V B;  1H1S B;  3A8G B;  3QYB A;  4BCF B;  1E7P A;  1H1P B;  2W9Z A;  2PK9 B;  5HBE B;  4EOO B;  4BBS M;  3M03 A;  1E9H B;  4AKI A;  3HO8 A;  1GY3 B;  5IHY A;  1URC B;  1F5Q B;  2W96 A;  2KMG A;  4AKG A;  4JX4 A;  1V29 B;  4BCH B;  3WVE B;  3VKH A;  2R7G A;  1UNH D;  2UZD B;  3BLH B;  3VKG A;  4F7S B;  3H4C A;  3X26 B;  3POM A;  4FX3 B;  1N4M A;  1AD6 A;  2UZL B;  5BNJ B;  1FIN B;  1P5E B;  4QSH A;  4ROC A;  1OGU B;  1AHJ B;  3VYH B;  2WPA B;  5ICP B;  3A8H B;  2LW4 A;  3LQ5 B;  2ZPI B;  2CZ7 B;  4LOC A;  4MFD A;  2W9F A;  5IF1 B;  1TFB A;  2ZPE B;  1QMZ B;  1GUX A;  4Y72 B;  1XO2 A;  4IMY B;  4EC8 B;  1TD6 A;  3QZ9 B;  5L2W B;  1FKM A;  2UUE B;  2D0Q B;  3TNI B;  1UGP B;  5DQW A;  1H25 B;  2CJM B;  5HBJ B;  4ROD A;  5LMK B;  4BCQ B;  2PHG A;  4ELL A;  4ZGJ B;  2WIP B;  2ZPH B;  4AKH A;  3EOC B;  4F6W B;  4BCP B;  4M6V A;  4BCM B;  5LQF B;  4EOL B;  5HNB B;  4MFE A;  3HZJ A;  2QFZ A; 
#chains in the Genus database with same CATH homology
 1H26 B;  2QDJ A;  1OIU B;  4BCF B;  1H1R B;  2C6T B;  1H1P B;  2IVX A;  2W9Z A;  2PK9 B;  5HBE B;  1FVV B;  2WMA B;  2C5N B;  4EOO B;  4BCM D;  3M03 A;  2B9R A;  1E9H B;  4ROE A;  1OKW B;  2CCH B;  5CEI B;  1UNG D;  1OIY B;  4BCO B;  4YOZ A;  2V22 B;  1GY3 B;  2IW6 B;  1GUX B;  1G3N C;  3QHR B;  4CFU B;  4KRD B;  3TNH B;  4BCN B;  1URC B;  1F5Q B;  2W96 A;  2C5O B;  4CFX B;  1BU2 A;  4BCH B;  4F70 B;  1PKD B;  2F2C A;  4EOI B;  2WIH B;  5CYI B;  4BCQ D;  2W99 A;  2R7G A;  3DOG B;  1JKW A;  1H27 B;  1UNH D;  2UZD B;  3BLH B;  1H28 B;  4F7S B;  4CFU D;  3H4C A;  4I3Z B;  4BCN D;  2C5X B;  3POM A;  4EOR B;  2IW8 B;  1H4L D;  4FX3 B;  3MY1 B;  1D3U B;  4EOM B;  2WHB B;  3F5X B;  2EUF A;  2JGZ B;  3BHV B;  3BHU B;  1N4M A;  1AD6 A;  1O9K A;  4CRL B;  1VOL A;  2UZL B;  2C4G B;  2UZB B;  5BNJ B;  2BKZ B;  3QHW B;  1FIN B;  1OI9 B;  1JSU B;  1OL2 B;  3EJ1 B;  3RGF B;  4CXA B;  1P5E B;  1VYW B;  2WMB B;  4NST B;  1OGU B;  3BLR B;  5HQ0 B;  4ROC A;  5IDN B;  2WPA B;  5ICP B;  4EC9 B;  1AIS B;  4CFN B;  1VIN A;  4F6S B;  3G33 B;  2G9X B;  4EOP B;  3BHT B;  2WFY B;  4F7L B;  1OKV B;  4G6L B;  3LQ5 B;  3TNW B;  1H1Q B;  4YOO A;  1ZP2 A;  4EON B;  1JST B;  4BCK B;  2W9F A;  5IF1 B;  1H24 B;  1TFB A;  1KXU A;  4ELJ A;  1QMZ B;  1C9B A;  1GUX A;  1W98 B;  4KRC B;  4Y72 B;  4BCG B;  4CFW B;  1XO2 A;  4IMY B;  4EC8 B;  5FGK B;  4II5 B;  2IW9 B;  4F7N B;  5L2W B;  4TTH A;  2UUE B;  2X1N B;  4BCI B;  5EFQ B;  4YOS A;  3TNI B;  5I5Z B;  2CCI B;  1JOW A;  4F6U B;  1H25 B;  1GH6 B;  2CJM B;  5HBH B;  4OR5 B;  5HBJ B;  2UZE B;  3EID B;  4ROD A;  5LMK B;  2BPM B;  2WEV B;  4BCQ B;  4EOK B;  3DDQ B;  2PHG A;  4ELL A;  4EOS B;  2WIP B;  2WXV B;  3TN8 B;  4CFV B;  4BCJ B;  2I53 A;  4OGR B;  1OL1 B;  3EOC B;  4YC3 B;  4EOQ B;  4EOJ B;  4F6W B;  2I40 B;  1O9K B;  4BCP B;  5HVY B;  3MI9 B;  4BCM B;  5IDP B;  4UN0 A;  2W2H A;  2PMI B;  1UNL D;  2C5V B;  3MY5 B;  4EOL B;  5LQF B;  3BLQ B;  1H1S B;  3MIA B;  5HNB B;  3O0G D;  5ACB A;  4F7J B;  4CFM B;  3K7A M;  3DDP B;  2PK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...