1VITF

Thrombin:hirudin 51-65 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
150
structure length
150
Chain Sequence
IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPSILON THROMBIN
publication title Structure of a bovine thrombin-hirudin51-65 complex determined by a combination of molecular replacement and graphics. Incorporation of known structural information in molecular replacement.
pubmed doi rcsb
molecule tags Complex (serine protease/inhibitor)
total genus 14
structure length 150
sequence length 150
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 1996-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vitF00
1MKXK 3ATLA 1A1RA 1IHTH 3N7OA 1C4Y2 3MO3A 1SGTA 1TX7A 2BZ6H 1VJAU 4Q7XA 2LNCA 1T4VH 1A3BH 1WQSA 3SNEA 3RC4A 1UMAH 2Y82A 1C5TA 5A09A 3UY9A 3NZIA 1O0DH 1V2RT 1LHGH 4A6LA 3PWCA 2GDEH 1K22H 3VB7A 1BZXE 1Y8TA 5JBTA 1O2YA 5LGOA 1BBRE 4HFPB 3TJOA 2WPHS 1VITH 4NWKA 1TBZH 1O3NA 2QF3A 2TGTA 3FP6E 1HNEE 2PKAA 3MNSA 3HKJB 4DIIH 2ODPA 1O3AA 3A82A 5K0HA 2AMDA 1K1PA 1ZHPA 2C8XB 3RXJA 1BIOA 4BTTB 1TNLA 2AGIX 1P2KA 1C5WB 1LHDH 1A46H 5DP4A 3SJ9A 3VB5A 4A1XA 1ELBA 1CT2E 3UWIA 1HB0B 1TPOA 2GDDA 1MKWK 1C2IA 1DWDH 2P16A 2D1JA 3RXCA 3FAOA 4O03A 2J92A 1FY1A 1MKXH 3I77A 1MAYA 4MLFB 4VGCC 8ESTE 4NWLA 3L3TA 1SPJA 2BB4A 2BD3A 3T29A 4BAMB 1V2MT 3F1SB 1UK2A 2FODA 2C8ZB 1AD8H 2QGRA 2AGGX 1UTQA 4OS6A 2VINA 1A7SA 3S9CA 4NCYA 3UNSA 1J14A 3AW0A 4TYDA 1D6RA 5GPIB 3RU4D 1UTLM 3LOXA 3SQEE 1T32A 1GI9B 2R3YA 4MVNA 1RTLA 2Y81A 1XUIA 5T6GA 1ZGIA 1AZ8A 1O2QA 5G4BA 1UK3A 1V2LT 1O37A 3EGKH 1GI3A 3MU0A 3P8FA 3ZZ9A 9ESTA 1C1NA 2ZECA 1MKWH 4DCDA 1Z1JA 1TPPA 1L4ZA 1BQYA 1BRUP 1MTVA 3W94A 1VCQA 1B0EA 1SL3A 1ABIH 2FS9A 3ZZ8A 1W11U 3VB3A 4HTCH 3Q76A 4X8VH 2C3SA 5EPYA 3TK6A 1GVKB 1HAHH 1MTNB 1QJ1B 2CV3A 2UUYA 3NCLA 1MZAA 1P10A 1XKBC 3SV8A 5FCKA 4RKOB 3EA9A 1QY6A 1V2ST 2GP9B 1G2MA 1JIRA 1ETTH 4AN7A 2Z3DA 2QY0B 3S69A 3GDVA 5T6FA 3S7HB 5LH8A 1NRQH 1GJ9B 3Q3YA 1ZPZA 1HAPH 2F83A 4IBLH 1C5YB 2B8OH 5BPEA 5FXLA 1BHXF 4U01A 9LPRA 1UTKA 2O8WA 1OPHB 1NY22 3PROA 1C5NH 2AH4X 1QURH 2P3UB 2PHBA 1EOLA 1W13U 2QC2A 3BTGE 1J8AA 1YGCH 2JH6D 4X8TH 2FX4A 1L1GA 1A4WH 3M37A 2G51A 1A0HB 2A31A 2XWAA 5EGMA 2Y5FA 2C8YB 2Q6DA 4B2AA 2BHGA 4KELA 3UPEA 3M5OA 4Y8YA 8GCHF 3PYHA 3DFLA 1T8NA 3ZZCA 1J17T 3T27A 4E7NA 1GBLA 4ZAEA 7KMEH 6LPRA 3Q00A 1FJSA 1FDPA 5DP5A 1OXGA 1NU7B 5DP7A 1O2MA 3TIUA 1O3FA 3LONA 4ABJA 3RU4E 1HUTH 2FO9A 4DW2U 1RGQA 2ODQA 1JXPA 2BZAA 3L33A 1Y59T 4GAWA 1GBIA 2ALPA 1YBWA 4A5TS 5GCHF 3SJIA 1GHYH 2YNBA 1ZLRA 2OC8A 2NU3E 1O5AB 3SNCA 3SUDA 3DD2H 3FANA 1TNJA 3A7TA 1JBUH 3F9FA 3TITA 4FUGA 3Q77A 1EZUC 3PWBA 3BV9B 5E2OA 3RXMA 3TVJB 1O2SA 4K2YA 4GPGA 2QN5T 3E3TA 1FV9A 1O5CB 4UFFH 1O2XA 1ANDA 3A8DA 1CU1A 1K9OE 1SFIA 1EP6A 2FLBH 5DP9A 3OY6U 1O2RA 2ZGHA 4AYYB 1TALA 1AZZA 4XBDA 4YLUA 1ZPBA 2W3IA 5IDKA 1TGNA 1LVOA 3HK3B 3ZVGA 1ZMNA 1O3CA 1OOKB 4J2YB 3PMHB 3RXDA 7LPRA 4WY3A 2P3FH 3UQOA 2XTTB 3ZZ3A 1O2HA 1O2LA 1RRKA 1H4WA 1TYNA 1P2NA 1CHGA 1DITH 5J4SA 2A32A 2O8UA 2FI5E 2G8TA 4AB9A 1LKAA 2FOGA 3QZQA 3SU0A 1YPHE 1O3KA 1LPKB 3RLWH 1HAOH 1Y3VA 3GCTF 5DPAA 2C8WB 1U6QA 2PR3A 4X8SH 3QLPH 1HXFH 1GI8B 1GBEA 4K3JA 5JB8S 3VXFH 1S0RA 3E91A 3MH5A 1QRZA 4Y79A 2FEQH 3S7KB 4ZKRU 2IPHA 3TNTA 1FY3A 5GCHG 8KME2 2LPRA 3UUZA 1VR1H 2Y5GA 2PGQB 3GCNA 2WPKS 1AUTC 2ANKH 1E0FD 2BDGA 6CHAB 1T8MA 1ZRKA 1EJAA 1C5RA 1GBJA 2ZZUH 3MI4A 1OWJA 4K69A 2GV7A 1TA6A 3MMGA 2GT7A 4OS5A 4WH6A 2ZTXA 1YYY1 4Y7AA 4B76A 2VWOA 3UQVA 3F9GA 2ZHEH 1GBBA 4XBBA 3CS7A 4U2WA 1HLTH 1HBTH 4K1SA 1GI1A 4BXSA 2A1DB 4XFQA 3U69H 3V12A 1K1IA 4NIXA 2OC7A 2DE9A 3I78A 1T4UH 3B8JA 4D8NA 5JB9S 1AHTH 2VIPA 2H5DA 2H9HA 1C2MA 3ATWA 2SFAA 5I25A 3SV7A 3PMBB 5EQQA 2FOFA 5EXNA 1K1NA 1GL0E 1O3IA 2H6MA 2PGBB 1LDTT 1GCDA 1DICA 3F9EA 4YM9A 2STBE 3RXHA 1JRTA 2VB0A 2G5VA 4D7GA 2FMJA 1QRXA 1TMTH 1EPTA 2H9TH 2J95A 1KIGH 1E38B 1EUFA 1EZQA 1OP0A 1DVAH 2CF9H 2BD7A 2GVFA 4NFEA 1OP2A 3CENA 6GCHF 1V2NT 3MH7A 2BD8A 1TQ0B 2NU0E 5DO4H 3DT0H 3RXTA 5GDSH 1JOUB 1GCTC 2F9VA 3MU1A 1BJVA 3AAVA 2VWLA 1TRMA 4JZFH 4B73A 1DX5M 1ID5H 3E90B 1LQEA 4E7RG 1C2JA 1KXFA 2ZCLP 1ELDE 3RMLH 2FI3E 3K6YA 4Y0YE 1YLDA 5FBEA 2V0BA 2RG3A 2WPIS 3QX5H 3JZ1B 2TGAA 1YCPK 5EXMA 1DWBH 1NN6A 3SU3A 2ZQ1A 2A5AA 2ANYA 1G32B 4CR5A 1NTPA 3KCGH 1DY9A 4Q80A 1GGDB 4ABFA 3BTME 1AGJA 1D3QB 3LT3A 4D9RA 2FWWA 5B6OA 1HFDA 3GY5A 5AFYH 1YM0A 1TGBA 2B7DH 2FM2A 2ZC9H 4B2BA 1HJ8A 2HNTF 3NPSA 2Y80A 1C1VH 1HAGE 1V2TT 2B9LA 5T6DA 1C1RA 2BY6X 4YT7H 1GJ5H 1TGSZ 1D3PB 2A45B 4FUDA 2ESTE 1PJPA 2ZDNA 3DA9B 1THSH 4FUCA 4NIWA 5C1XA 4ABEA 1ELVA 2ZKSA 3PMJA 3B23B 2XCNA 1GMCF 2PWXA 1KDQA 3M61U 1LVMA 2FOBA 6GCHG 1SQOA 5E0GA 1G3EA 1N6XA 4UFDH 4GHQA 2C93B 3LKWA 3I29A 3RUOA 1F5LA 1L1JA 3SNBA 3MNXA 3ZVEA 4ZHLU 1SLVB 3ELAH 4ISOA 2G55A 1FIWA 1LPGB 3BEIB 1C5PA 3MWIU 4R0IA 3E16B 2HLCA 3SBKA 1F0UA 2FIRH 1AVWA 1FI8A 1ESBA 4JK5A 1EZSC 2FPZA 5EXLA 2Z6BD 1KLIH 3MU8A 1K1MA 1QJ6B 1CT0E 3BEFB 3HPTB 1XUHA 1NRRH 1WYKA 1ZTJA 1ANCA 3EDXB 3U8RH 3E6PH 3GCHC 1FY5A 1RXPA 1NRNH 2ZF0H 1GI0A 2ZGJA 3GY4A 3PLKA 2HALA 3BIVH 1TRYA 1UK4A 1SGRE 3DHKH 1C1OA 1LHEH 1ZOMA 3A7VA 1XVOA 1TX6A 3QUMP 2V3OH 2OBOA 1RIWC 1AWHB 3MU4A 3QN7A 3KL6A 1F2SE 3MHWU 5A8YA 1DWEH 4KGAA 2UWLA 5E0HA 1V2KT 4WWYA 1LMWB 1THPB 2VIQA 1BRAA 3TK9A 1C1QA 2ANWA 2H9EH 1GMCG 2GT8A 1QB9A 5FCRA 5EW2H 1NZQH 2VGCB 3NK8A 5C1YA 2ANMH 1A0LA 1SHHB 1IAUA 4ZKSU 1SVPA 3SZNA 2VIVA 1PQ8A 1IQLA 2ZGXH 2HRVA 2ZU1A 3ESTA 4WMFA 1K2I1 2J38A 3W95A 7ESTE 4GCHF 4LK4A 1C2EA 1GJ8B 1DPOA 2EI6A 2ZCHP 1OWEA 2ZDVH 3MYWA 4B2CA 1Y3XA 2FTMA 2CXVA 5TJXA 1E35B 4LZ4B 3LPRA 2STAE 1Y3UA 4CH8B 3RXVA 1ZR0A 2FYRA 1G37A 2IJOB 1C1MA 1V6DA 2FDAA 1BJUA 5IYTA 1UHBB 4I8GA 3TH4H 3TGJE 3ZVDA 1A2CH 3F68H 1BA8B 3GY6A 1S81A 2ZEBA 1SQAA 1YPKH 4AFSA 1D6WA 3R0FA 3BTWE 2B5TB 1G36A 1CVWH 1ESAA 1SGIB 2BD9A 5L2YH 3SN8A 5FAHA 3H7TA 1BB0B 1O2UA 1TFXA 1HV7A 4CRFA 2VVCA 3ATKA 1SOTA 1QL8A 1O3OA 2ZWLH 4YO9A 1SGQE 3SORA 1F0TA 1AKSB 2D26C 2W7SA 3GCOA 1XUFA 1GHWH 3VPKA 3L6PA 3O8DA 1Z8RA 1HIAB 2VH6A 4Q7ZA 3U1JB 1GWAA 5F03A 4X6MA 3UOPA 4DOQA 1UCYE 2EC9H 1IQMA 2ZU4A 4JK6A 4KKDA 4GCHG 1MD7A 2AMPA 1BTUA 4DG4A 3GOVB 5K7RA 3UR9A 3SOSA 5JBAS 1S84A 1F5KU 1MBMA 5F8TA 1SQTA 3BTHE 2FS8A 4NSVA 4K1EA 3KIDU 4CBOA 4AFQA 2A7CA 2CHAC 5FBIA 4IC6A 1WTHD 1DOJA 3IG6B 4I8JA 4ZHMU 1FUJA 1TIOA 1ELCA 1DANH 5A8XA 1W0ZU 3BEUA 4B75A 1P2QA 5ABWA 8LPRA 1SI5H 1ANEA 1DXWA 4X1PU 2AIPA 1NT1A 2UWPA 1F7ZA 1J15A 1GPZA 3FP8E 3EAJA 4JMYA 3R3GB 1CA0C 3PO1C 2ZGBH 1Q31A 5PTPA 4BTUB 1P2OA 1F0RA 2H1UA 1UTNA 3IWMA 3OY5U 3GCHB 5JPMH 3RXKA 2BY7X 3FFGA 1ELEE 3RXUA 1AFQC 3SQHE 3UIRA 3V7TA 4WVPE 1J16A 1C1SA 4BOHA 4A1TA 1OX1A 3A81A 2PUXB 1V2WT 2I6QA 1RIWB 2BYAX 1GJAB 1SG8B 3A7XA 1YF4A 1DS2E 1GI2A 1SGFA 1EOJA 4GVUA 5EG4A 4DT7B 1O3HA 1GBTA 1XM1A 4CRBA 4DGJA 3NUMA 1BOQA 2GGVB 1V2OT 2BDCA 3NWUA 1EP5A 3LGIA 2V35A 1JIMA 3C1KA 3QDZB 2W26A 2ALVA 5H4IB 6CHAC 1ZMJA 3QK1A 1TX8A 2Q6GA 1PPFE 2GZ8A 1LKBA 1NFUA 2NU4E 3M3VA 3RXAA 3URDA 2JKHA 1SGDE 2O9QA 3RXIA 1NO9H 2QF0A 1W8BH 3LGYA 1V2JT 1O3EA 1QR3E 2BM2A 3OSYA 4ABDA 1YP9A 1MCTA 3ZVBA 1GBCA 2TIOA 2XBWA 4K5ZA 1HJAC 4DVAU 2CMYA 2VIWA 1A5HA 4I7YH 5AFZH 1AVGH 2GV6A 4IGDA 2P8OC 1CGIE 1GBMA 1ZYOA 2ZHWH 1AU8A 3MFJA 1C9PA 1S85A 2HOBA 5GJ4B 3LGUA 4B71A 3SUFA 4IMQA 4CRAA 1MBQA 1LVBA 1IQHA 2SGAA 2XYAA 2DUCA 1ZHMA 4NFFA 1A5GH 2O8LA 3RXOA 1C1PA 1FY8E 1E34B 1MU8B 3TPIZ 1P0SH 1WOFA 1ABJH 3SUGA 3KEEA 1YKTA 1ORFA 4LXBH 2WUBA 4ISIH 2EI8A 3Q3KA 2BDYA 4WH8A 3RXEA 1W0YH 3ZV8A 5EW1H 1O5EH 2BXUH 1GDNA 3LU9B 1OWHA 1P3CA 1TQ7B 1P57B 1FLEE 2F9UA 1BDAA 2Y7ZA 3M5MA 2XRCA 5EQRA 1XUGA 2XXLA 3K2UA 3ZYDA 1GVLA 1SGFG 3KHVA 5FPTA 2ZFQH 4XOJA 1KSNA 4XDEA 1DSUA 1NPMA 5DP3A 3S0NA 2CGAA 2KAIA 4JZEH 4WXVA 2WPJS 1FXYA 5GIBA 2RA3A 1BBRK 4MNVA 4E06H 3NXPA 3D23A 1GDUA 2ZPSA 1VZQH 2CHAB 1GGDC 2BD2A 2QV1A 3AASA 1HXEH 1TONA 1NRPH 3M35A 1K21H 3PLPA 4JZIA 1ACBE 2VVVA 1EB2A 1CE5A 4MTBA 4CR9A 1SGPE 1Q3XA 2BY5X 1ZJKA 1P2IA 1RJXB 5EPNA 2RDLA 3STJA 1AWFH 2VWNA 2Z9LA 3UNRA 1TPAE 1JWTA 1EX3A 1GL1A 3C27B 3SU4A 3STIA 4NZQA 1NC6A 2XBXA 3A83A 4A7IB 1CA0B 1N8OC 3PO1B 1TBRH 1NFYA 4NG9H 8GCHG 2BVXH 3A7YA 2ZU5A 2GZ9A 4F49A 3QO6A 1AKSA 2FOHA 2CF8H 1O2GH 1SBWA 1AFQB 1MH0A 5HM2A 3DUXH 1FMGA 3S9AA 2ODYB 2PLXA 1P02A 1SOZA 2XBYA 4FUHA 4OS7A 1N1LA 2WPMS 4H6TA 4RKJB 4FU8A 2V6NA 3RXPA 3RXRA 1G3DA 2ZU3A 3M36A 1Y5UT 2SGQE 3BSQA 4ABAA 1W2KH 1AO5A 1BMNH 3PM3A 4X2YA 2NU1E 1XUKA 4Y76A 3EA8A 3KF2A 3A86A 3SU5A 4Y11E 2BDIA 2AGEX 2FESH 2OLGA 3U98H 4ZXXH 1QA0A 3NKKA 2Z3CA 2TGDA 3ZZ6A 4AGJA 1PPCE 1L2EA 2IOTA 3RC6A 5AHGH 5DP6A 1H9IE 3SJKA 1KXEA 3MNBA 1NU9A 1GHAF 1TAWA 5C5NA 2Z9JA 2PW8H 4XSKU 1QL9A 2SGEE 1HJAB 5C67A 3KQBA 1MU6B 1QL7A 1YLCA 1ARCA 4X1RU 5AVDA 1O2JA 3EA7A 1Z6JH 1BMLA 3KQEA 2P8OB 4OS2A 4H4FA 5CE1A 1O5FH 1SB1H 3SNDA 2QIQA 2XCFA 1LVYA 2BY8X 2FOMB 4FUJA 3RMMH 3UWJH 2Z9GA 3TJUA 1ZGVA 1GBHA 2BY9X 2BDHA 1RTFB 2FZZA 2QXIA 1FONA 1HGTH 1TWXB 2VGCC 3DFJA 5DG6A 4CH2B 3E0PB 1C2FA 3ATIA 3GCTG 5HM9A 2WYJA 3K6ZA 1DFPA 4BAKB 4D76A 1S6HA 1ARBA 1S0QA 4KTUA 1FN8A 1W3CA 4BTIB 1P9SA 5JBCS 1O3LA 1TA2A 3FVFB 1NS3A 2JETB 2JH5D 5CMXH 4IN1A 4ISLA 2FI4E 3P8NA 2GKVE 1C4U2 4X8UH 3BIUH 3RM2H 2VH0A 2WINI 1FPHH 2PKAB 4PROA 4ZROA 4A92A 1NFWA 1MAXA 4X6NA 2ASUB 4HI3A 2ZFFH 2EEKA 5FPSA 1GHAG 3T62A 1WTGH 4ESTE 1YPGH 4WXIA 1OWKA 4BAHB 1O31A 2BQ6B 3A7ZA 1KXCA 3MNCA 1KY9A 1KYNA 1AFEH 3F9HA 2XNIA 1O3GA 3SU1A 2HPQH 3BTQE 3T25A 3M7TA 1O2OA 3HGPA 1D3TB 4LZ1H 3P6ZB 5DGJA 1C2LA 3P8OA 2GMTC 1SGCA 3LGVA 4JZDH 1N6YA 1UO6A 5BRRE 5L6NH 2QXJA 2P59A 3WY8A 2Y7XA 1OS8A 4KP0A 2ZGCA 3LGTA 2ZNKH 3LIWA 1N8OB 4IW4E 4O3UA 1FAXA 5CHAC 4I33A 2UWOA 2Z9KA 2ZHQH 4YOIA 3GYMA 2G81E 5FX5A 1BMMH 2ZFSA 2PTCE 1LQDB 1O36A 1UTMA 4NIYA 4Y6DA 2Q6FA 4IN2A 1TGCA 3BTFE 1UTOA 4B1TA 1CA8B 2CN0H 4INLA 1C5VA 4M7GA 1BMAA 1AE8H 1YCPH 1GBFA 1O2KA 1GHZA 3ZZ7A 4X6OA 4FUFA 5A2MH 3M3TA 2HPPH 1QFKH 4DJZB 4HZHA 1W14U 2A4OA 2R0KA 1VITF 1VCPA 4WJG2 3T26A 1O34A 4I8LA 1IQFA 3AAUA 2Z9IA 1GJ4H 3URCA 1T31A 2ZFPH 2WV4A 1ELTA 3H7OA 1C1UH 2R3UA 2FOAA 4WF8A 1XUJA 1V2PT 1YPJH 1P01A 1BRCE 2QA9E 1INCA 3SO3A 4OS4A 4RN6A 1BHXB 3QZRA 2SNVA 1O32A 1BUIA 5GXPA 2BLVA 2OBQA 2Z7FE 3BTKE 2AIQA 3ITIA 3BG4C 1C5OH 2ZPRA 1O30A 1GJDB 1QCPA 4AORA 2FYQA 1UVUH 3Q3XA 3VEQB 2XWBI 1GBDA 1KXDA 1O5DH 3ZVFA 3G01A 4BNRA 3MU5A 1D4PB 2D2DA 1QBOA 2SNWA 5EOKA 3GY3A 3SU6A 4CRCA 1IQKA 1CSOE 1QGFA 4ABIA 1AIXH 2PSXA 4OS1A 1DLKB 2ZIQH 1C5QA 4A1VA 1BTWA 2F9PA 1GBAA 5C1UA 2ZPQA 3FZZA 4AZ2B 4THNH 3OTJE 3ENSB 1KLTA 2GX4A 4UONA 1CQQA 5A0AE 1CGJE 3QGJA 1GDQA 3GICB 4NSYA 1EPTC 2M5TA 3MH4A 1O2WA 1P09A 1GJ7B 1MUEB 1C2HA 2P93A 3TU7H 4CREA 4YTAA 1GI4A 2AFQB 3PB1E 1DM4B 5LPRA 1EAXA 5DKMA 3ATMA 1WUNH 2ZO3H 2A5KA 2TBSA 2Q1JA 2RA0A 1PYTD 1DE7H 2BMGB 1BTHH 1EATA 1ZSJA 1DDJA 1V3XA 1QNJA 5ESTE 2I6SA 1C5UA 1GJ6A 2ULLA 2XW9A 1BRBE 4JYUH 4U32A 1HPGA 3JZ2B 1C1WH 1DLEA 1K28D 1A0JA 2HWLB 4O97A 1BTPA 3OU0A 1C2KA 1OWDA 2BQWB 2PV9B 3SNAA 1HCGA 2XC5A 1MCVA 1EB1H 1SR5C 4BANB 1DUEA 4SGBE 2QCYA 1O2TA 1W10U 2J94A 3GDSA 1S82A 1IQGA 1CBWB 1EAIA 2VU8E 3M3SA 3VGCC 3ZZDA 3PLBA 1MZDA 2F9BH 2GCTC 1O3MA 4TY7A 2GMTB 4K60A 1FY4A 1QB6A 4HGCA 4K1TA 1GG6C 3A89A 2QXHA 2AS9A 3LH1A 4FUIA 4Y0ZE 2R2MB 5EU8A 1IQIA 2OUAA 1CHOF 5DK1A 1V2UT 3TK5A 5CHAB 1TNHA 1FQ3A 2W3KA 4GSOA 4OGXA 1QIXB 3EE0B 3PTNA 4K8BA 3VB6A 1ZTLA 1S5SA 1VJ9U 1P03A 1NESE 4UFGH 2FOEA 4BAQB 3ZVAA 5EQSA 1EAUA 4Z0KA 1T7CA 3V3MA 1KTSB 3BG8A 3P70B 4AOQA 3SV6A 3HKIB 1EJMA 4D7FA 2PUQH 4FVBA 1A3EH 1Z71A 2FLRH 2PTNA 3UR6A 1AB9C 1AI8H 1DXPA 3GISB 4NA7A 4E05H 1EZXC 1GHXH 2A5IA 1RS0A 1DY8A 3D49H 2W7UA 3SHAH 2IN2A 1KTTB 1QRWA 3LH3A 2QYIA 3BN9A 2OINA 1H9HE 4GUXA 4I31A 5SGAE 1MMJN 1CGHA 4MPUA 1TB6H 4IS5A 4QT8C 3QGNB 2BDAA 1H9LB 1ESTA 2XC4A 1OYTH 1IOEA 1QBNA 1V2QT 2G00A 3RDZA 2AERH 2OXSA 3BG4B 2BD5A 1GMDF 4TPYA 2A4GA 2BXTH 2W5EA 1Q2WA 2CJIA 4Y8XA 4Y71A 1Z6EA 2C90B 1D9IA 4FVDA 3RU4T 3UFAA 1G3BA 1JRSA 5FPYA 3FP7E 5ESBA 3A80A 3AW1A 1VGCC 1CHOG 1BTZA 2SGPE 3ZZ5A 2BD4A 1EJNA 3A88A 4I8KA 4IMZA 4MPXA 1V2VT 4WMDA 2THFB 5JDUB 1DUAA 4YLQH 2A4QA 2BOHB 3D65E 1THRH 2A2XH 4AX9H 4GLYA 5HMAA 2ZA5A 1O5GH 1UJ1A 1J9CH 1EPTB 4INHA 4MNXA 1ZHRA 2TPIZ 3E1XB 1MQ5A 2FTLE 2P3TB 4UD9H 5F8XA 3T28A 2AMQA 2UUFB 1AN1E 1TMUH 3A8AA 3VFEA 1LTOA 1YC0A 6ESTA 4MDSA 1TLDA 2BLQA 3K65B 1P2MA 1PPZA 2BTCE 2YNAA 3PTBA 4ABGA 4H42U 4TWYA 1EAWA 4IC5A 3AVZA 4ZXYH 1RFNA 3O8BA 1EQ9A 1NFXA 1OYQA 3CS0A 3GYLB 2F91A 1MD8A 2A2QH 2OP9A 3BF6H 3F6UH 3V0XA 1P04A 3OX7U 4J1YA 2ZI2H 4NA9H 3B9FH 3MO6A 4MNYA 4CHAB 3LGWA 3UREA 1B0FA 1GMDG 1YPEH 4X2XA 4AGKA 1IQEA 4TY6A 2ZHDA 4WMEA 1UTPA 1C5SA 5TCCA 4ABBA 1HAVB 1C5XB 3GY2A 4KTSA 3V13A 3VGCB 4BXWA 2ZTZA 1TPSA 2JETC 4D9QA 1G9IE 1GBKA 2GCTB 1GHVH 2ZU2A 3RXGA 2TRMA 1GG6B 1A61H 1NM6A 1O2IA 1TABE 2BOKA 2WYGA 1K1LA 3EYDA 2A7JA 2R9PA 1C9TA 4DY7B 1O35A 3U9AH 5F6MA 1SLUB 4BAOB 5EODA 1C5MD 3QWCH 2ZCKP 1EXFA 1KDQB 3SV2H 2G52A 1T8OA 1WCZA 7GCHF 3IITA 2J9NA 1NROH 2ZFTA 3E0NB 1O3PB 1Z8JB 1PPHE 1QTFA 3M5LA 1UHBA 3SJOA 3O8CA 1PQAA 1MTSA 1FN6A 1O3JA 2BLOA 3P95A 5HXFA 1FIZA 4ABHA 1OWIA 2FXRA 3A84A 3TLOA 1HAIH 3FZDA 2VNTA 3VXEH 1AB9B 1AVXA 4AFZA 5T3HA 1DSTA 1UCYK 5GWZA 5FX6A 4F4OC 5C2ZA 3RXBA 1C2GA 4R8TB 4FUEA 4YESB 2Y6TA 4NGAH 1TOMH 2J34A 4MG3A 1YPLH 3SU2A 1UTJA 4INKA 2H5CA 4VGCB 4AFUA 4X2VA 4X2WA 1TMBH 4OGYA 1ELAA 1TNIA 2GTBA 2VIOA 2OC1A 2V3HH 1T8LA 1O2VA 1IHSH 2J2UA 3SGAE 1KXBA 1GMHF 1HIAA 4MQAA 4X1NU 1G2LA 1YCPM 3RMNH 1NRSH 2HGTH 5DJ7A 1UVOA 3KQDA 3BTTE 1LHFH 4CRGA 4UEHH 3ODFA 2UUKB 4H6SB 3RP2A 1Y5BT 3A85A 1VGCB 1BBRH 1FAKH 4CRDA 4TWWA 5C5OA 3A8BA 1O33A 2G4UA 2ILNA 1M9UA 1HRTH 1ELFA 1VCWA 3M7UA 1G3CA 1S6FA 1ZSKA 1H8DH 1PPEE 5ETXA 7GCHG 3ZV9A 3UTUH 4YOJA 1UCYH 3U8TH 1F92A 1SGNE 2HVXA 4FXGH 1SHYA 3RLYH 2BVRH 2D8WA 2TGPZ 5HGGA 1KLJH 2K1QA 1EASA 2PKSC 4NIVA 2RCEA 2GD4B 2OTVA 3MOCA 1QQ4A 3U8OH 2C4FH 3KGPA 1AE5A 2OQUA 4FU7A 3RXLA 2F9NA 2NWNA 2HNTE 4K8YA 5TCAA 4AG2A 1SSXA 4ZH8A 1KXAA 2EA3A 1WBGB 3HGNA 1L1NA 1MTUA 1W7GH 4X1QU 1HJ9A 3SW2B 1D3DB 4JYVH 4NZLA 4YT6H 3D62A 4AB8A 1CO7E 1PYTC 2A4RA 1HAZB 5A8ZA 4UDWH 5L2ZH 1ZMLA 3PV4A 3A8CA 2B0FA 1PQ7A 4YZUA 3MO9A 1GMHG 4ZKOU 1Z1IA 3TGIE 4Y10E 2PFEA 1GI5A 1ZSLA 4XE4A 4Z6AH 1DT2A 1GJBB 3T5FH 4U30A 1C5ZB 4Q7YA 4DURA 2JH0D 2VIDA 3OYPA 2SGDE 2G5NA 2EI7A 1BT7A 1PPGE 4NA8A 1P12E 2OD3B 1XXDA 3TNSA 1C4V2 3UNQA 1L4DA 4X6PA 1W7XH 1FPCH 2ZHFH 3QTOH 1B7XB 2AYWA 1Y3YA 2OCVB 2ZDAH 1O39A 1ZTKA 1GI6A 3ZVCA 1TNGA 3KNXA 4KTCA 5E2PA 3QTVH 1YPMH 1Y5AT 1XXFA 1ZPCA 1AUJA 1H8IH 2GCHF 4I8HA 1QHRB 1DWCH 1G30B 3TH2H 1GVZA 2FP7B 4O3TA 1ETRH 1LO6A 1TBQH 2P95A 2A0QB 4MNWA 5JYIA 1CBWC 4ISHH 2R0LA 3EQ0H 1TGTA 1SFQB 1AQ7A 1ANBA 2BDBA 1MTWA 2FX6A 1BTXA 2Z94A 3ZZAA 3O8RA 4Q2KA 5A0CA 5C3NA 4YOGA 1LCYA 1O3BA 3M7QA 3RXSA 2QXGA 1BTYA 1C1TA 5I46H 1FZZA 1OSSA 2O8MA 3T2NA 1E37B 1O5BB 1HDTH 4LOYH 2H2ZA 2VWMA 2SGFE 1HAVA 2ZDMA 4ZUHA 1PPBH 3ZZ4A 1WAYB 4DIHH 2NU2E 3SHCH 1P9UA 1QQUA 3PMAB 3A7WA 1P8VC 4ASHA 4CBNA 1ZRBA 5C20A 3KN2A 2ZFRH 1SLXB 1OKXA 2A7HA 3MTYA 1SC8U 3MH6A 1B5GH 1P05A 5J4QA 4X0WU 4Y7BA 1O2NA 1IQJA 1F0SA 1S83A 2O8TA 1ZJDA 1AY6H 4ZHAA 4MPWA 1LPZB 3LC3A 3LDXH 4JYTA 2BLWA 1H1BA 2ZP0H 1EKBB 3RXFA 3CP7A 1MQ6A 1K1JA 1XX9A 1O3DA 4O9VA 3SV9A 1UVPA 3P17H 1O38A 2FOCA 3BTDE 1SGYE 1QBVH 2VVUA 4AG1A 1QB1A 1IQNA 1O2ZA 1OP8A 2BVSH 4RSPA 1A5IA 1X7AC 1UVSH 1L0ZA 2GCHG 2GZ7A 4FU9A 3E8LA 1SGEE 1Z7KA 2UUJB 2DE8A 5AF9H 3RXQA 4UE7H 4UFEH 1C2DA 1GHBF 4Y8ZA 2OQ5A 3HATH 1PQ5A 2PSYA 4XBCA 1XMNB 2PKSB 5E0JA 1UVTH 3LJJA 4AYVB 3M5NA 2ZDLA 3SJ8A 3U1IB 1WQVH 1WSSH 2XBVA 1P3EA 1P11E 5F8ZA 3GY7A 3P8GA 4GHTA 4X1SU 4ZKNU 3RM0H 1BITA 2OC0A 2P94A 2VJ1A 4JCNA 3HK6B 2F9OA 3SGQE 1RD3B 4ISNA 2ZG0H 4JZ1A 1K1OA 5LPFA 3A87A 4TPIZ 1JMOH 1P2JA 1ELGA 2ZQ2A 4MPVA 2Z3EA 2F3CE 2R2WU 2ZDKA 3SUEA 3GY8A 1HYLA 5DP8A 3SGBE 3BTEE 3P92A 3RMOH 3TJVA 1AMHA 4I32A 2J4IA 1O2PA 1GJCB 1W12U 1ETSH 1XVMA 5A0BA 1HAXB 1E36B 3LC5A 5JBBS 1BCUH 1FNIA 5HYOA 2YOLA 1CT4E 1YPHC 1PFXC 1XKAC 3ODDA 3TJNA 2WV5A 1LHCH 5L30H 3TH3H 2BX3A 2WUCA 3SI3H 2WPLS 1WV7H 1VITG 3LJOA 1GI7B 1SLWB 3K9XB 1Z8GA 3ZZBA 1QJ7B 1SMFE 1WU1A 3TGKE 1MTNC 3S9BA 3ZYEA 5E8EH 1TE0A 3GDUA 2QAAA 1TOCB 3KQCA 1RTKA 2BQ7B 3H5CB 2BX4A 1TRNA 2Y5HA 1GHBG 1Y3WA 4FUBA 5LPEA 3SI4H 2KAIB 1GCTB 1TNKA 4SGAE 1C5LH 2G4TA 2HNTC 3VB4A 4CHAC 1QA7A 2ZTYA 5FHTA 3UOUA 4B74A 1P06A 3RC5A 1F5RA 1HAYB 4ZMAH 1ZZZA 2AEIH 1Z8IB 2XC0A
chains in the Genus database with same CATH superfamily
1MKXK 3ATLA 1A1RA 1IHTH 3N7OA 1C4Y2 3MO3A 1SGTA 1TX7A 2BZ6H 1VJAU 4Q7XA 2LNCA 1T4VH 1A3BH 1WQSA 3SNEA 3RC4A 1UMAH 2Y82A 1C5TA 5A09A 3UY9A 3NZIA 4B6FA 1O0DH 1V2RT 1LHGH 4A6LA 3PWCA 2GDEH 1K22H 3VB7A 1BZXE 1Y8TA 5JBTA 1O2YA 5LGOA 1BBRE 4HFPB 3TJOA 2WPHS 1VITH 4NWKA 1TBZH 1O3NA 2QF3A 4P00A 2TGTA 3FP6E 1HNEE 2PKAA 3MNSA 3HKJB 4DIIH 2ODPA 1O3AA 3A82A 3F3BA 5K0HA 2AMDA 1K1PA 1ZHPA 2C8XB 3RXJA 1BIOA 4BTTB 1TNLA 2AGIX 1P2KA 2GJGA 1C5WB 1LHDH 1A46H 5DP4A 3SJ9A 3VB5A 4A1XA 1ELBA 1CT2E 3UWIA 1HB0B 4Q63A 1TPOA 2GDDA 1MKWK 1C2IA 1DWDH 2P16A 5KECA 3PLKA 2D1JA 3RXCA 3FAOA 4O03A 2KR7A 2J92A 1FY1A 1MKXH 3I77A 1MAYA 4MLFB 4VGCC 8ESTE 4NWLA 3L3TA 1SPJA 2BB4A 2BD3A 3T29A 4BAMB 1V2MT 3F1SB 1UK2A 2FODA 2XOKD 2C8ZB 1AD8H 2QGRA 2AGGX 1UTQA 3FOAA 4OS6A 4P02A 2VINA 1A7SA 3S9CA 4NCYA 3UNSA 1J14A 3AW0A 4TYDA 1D6RA 5GPIB 3RU4D 1UTLM 3LOXA 3SQEE 1T32A 1GI9B 2R3YA 4MVNA 1RTLA 2Y81A 1XUIA 5T6GA 1ZGIA 1AZ8A 1O2QA 5G4BA 3FO8D 1UK3A 1V2LT 1O37A 3EGKH 1GI3A 3MU0A 3P8FA 3ZZ9A 9ESTA 1C1NA 3OTPA 2ZECA 1MKWH 4DCDA 1Z1JA 1TPPA 1L4ZA 5EJLA 1BQYA 1BRUP 1MTVA 3W94A 1VCQA 1B0EA 1SL3A 1ABIH 2FS9A 3ZZ8A 1W11U 3VB3A 4HTCH 1FX0B 2EY4C 3Q76A 4X8VH 2C3SA 5EPYA 3TK6A 1GVKB 1HAHH 1MTNB 1QJ1B 2CV3A 2UUYA 3NCLA 1MZAA 1P10A 1XKBC 3SV8A 5FCKA 4RKOB 3EA9A 1QY6A 1V2ST 2GP9B 1G2MA 1JIRA 1ETTH 4AN7A 2Z3DA 2QY0B 3S69A 3GDVA 5T6FA 3S7HB 1EFRD 5LH8A 1NRQH 1GJ9B 3Q3YA 1ZPZA 1NBMD 1HAPH 2F83A 4IBLH 1C5YB 2B8OH 5BPEA 5FXLA 1BHXF 4U01A 9LPRA 1UTKA 2O8WA 1OPHB 1NY22 3PROA 1C5NH 2AH4X 1QURH 2P3UB 2PHBA 1EOLA 1W13U 2QC2A 3BTGE 1J8AA 1YGCH 2JH6D 4X8TH 2FX4A 1L1GA 1A4WH 3M37A 2G51A 1A0HB 2A31A 2XWAA 5EGMA 2XNDD 2K8IA 2Y5FA 2C8YB 2Q6DA 4B2AA 2BHGA 4KELA 3UPEA 3M5OA 4Y8YA 8GCHF 3PYHA 3DFLA 1T8NA 3ZZCA 1J17T 3F2GA 3T27A 4E7NA 1GBLA 4ZAEA 7KMEH 6LPRA 3Q00A 1FJSA 1FDPA 5DP5A 1OXGA 1NU7B 5DP7A 1O2MA 3TIUA 1O3FA 3LONA 4ABJA 3RU4E 1HUTH 2FO9A 4DW2U 2WZQA 1RGQA 2ODQA 1JXPA 2BZAA 3FKSD 3L33A 1Y59T 4GAWA 1YY3A 1GBIA 2ALPA 1YBWA 4A5TS 5GCHF 3SJIA 1GHYH 2YNBA 1ZLRA 2OC8A 2NU3E 1O5AB 3SNCA 3SUDA 3DD2H 3FANA 1TNJA 3A7TA 1JBUH 3F9FA 3TITA 4FUGA 3Q77A 1EZUC 3PWBA 3BV9B 2F43B 5E2OA 3RXMA 3TVJB 1O2SA 4K2YA 4GPGA 2QN5T 3E3TA 1H8HD 1FV9A 1O5CB 4UFFH 1O2XA 3KYFA 1ANDA 1OHHD 3A8DA 1CU1A 1K9OE 1SFIA 1EP6A 2FLBH 4F48B 5DP9A 3OY6U 1O2RA 2ZGHA 4AYYB 1TALA 1AZZA 4XBDA 4YLUA 1ZPBA 2W3IA 3DSGA 1TGNA 5IDKA 1LVOA 3HK3B 3ZVGA 1ZMNA 1O3CA 1OOKB 4J2YB 3PMHB 3RXDA 7LPRA 2JJ1D 4WY3A 2P3FH 3UQOA 2XTTB 3ZZ3A 1O2HA 1O2LA 1RRKA 1H4WA 1TYNA 1P2NA 1CHGA 1DITH 5J4SA 2A32A 2O8UA 2FI5E 2G8TA 2CK3D 4AB9A 1LKAA 2FOGA 2WPDD 3QZQA 3SU0A 1YPHE 1O3KA 1LPKB 3RLWH 1HAOH 1Y3VA 3GCTF 5DPAA 2C8WB 1U6QA 2PR3A 4X8SH 3QLPH 1HXFH 1GI8B 1GBEA 4K3JA 5JB8S 3VXFH 1S0RA 3E91A 3MH5A 1QRZA 4Y79A 2FEQH 3S7KB 4ZKRU 2IPHA 3TNTA 3NRLA 1FY3A 5GCHG 8KME2 2LPRA 3UUZA 1VR1H 2Y5GA 2PGQB 4Z1MD 3GCNA 2WPKS 1AUTC 2ANKH 1E0FD 2BDGA 6CHAB 1T8MA 1ZRKA 1EJAA 1C5RA 1GBJA 2ZZUH 3MI4A 1OWJA 4K69A 2GV7A 1TA6A 3MMGA 2GT7A 4OS5A 4WH6A 2ZTXA 1YYY1 5C0UA 4Y7AA 4B76A 2VWOA 3UQVA 3F9GA 5CDFE 2ZHEH 1GBBA 4XBBA 3CS7A 4U2WA 1HLTH 1HBTH 4K1SA 1GI1A 4BXSA 2A1DB 4XFQA 3U69H 3V12A 1K1IA 4NIXA 2OC7A 2DE9A 3I78A 1T4UH 3B8JA 4TSFD 4D8NA 5JB9S 1AHTH 2VIPA 2H5DA 2H9HA 1C2MA 3ATWA 2SFAA 5I25A 3SV7A 3PMBB 5EQQA 2FOFA 5EXNA 1K1NA 1GL0E 1O3IA 2H6MA 2PGBB 1LDTT 1GCDA 1DICA 3F9EA 4YM9A 2STBE 3RXHA 1JRTA 2VB0A 2G5VA 4D7GA 2FMJA 1QRXA 1TMTH 1EPTA 2H9TH 2J95A 1KIGH 1E38B 1EUFA 1EZQA 1OP0A 1DVAH 2CF9H 2BD7A 2GVFA 4NFEA 1OP2A 3CENA 3OEHD 6GCHF 3N7DA 1V2NT 3MH7A 2BD8A 1TQ0B 2NU0E 5DO4H 3DT0H 3RXTA 5GDSH 1JOUB 1GCTC 2F9VA 3MU1A 1BJVA 3AAVA 2VWLA 1TRMA 4JZFH 4B73A 1DX5M 1ID5H 3E90B 1LQEA 4E7RG 1C2JA 1KXFA 2ZCLP 1ELDE 3RMLH 2FI3E 3K6YA 1E79D 4Y0YE 1YLDA 5FBEA 2V0BA 2RG3A 5C0TA 2WPIS 3QX5H 2JJ2D 3JZ1B 2TGAA 1YCPK 5EXMA 1DWBH 1NN6A 3SU3A 2ZQ1A 2A5AA 2ANYA 1G32B 4CR5A 1NTPA 3KCGH 1DY9A 4Q80A 1GGDB 4ABFA 3BTME 1AGJA 1D3QB 3LT3A 4D9RA 2FWWA 5B6OA 1HFDA 3GY5A 5AFYH 1YM0A 1TGBA 2B7DH 2FM2A 2ZC9H 4B2BA 1HJ8A 2HNTF 3NPSA 2Y80A 1C1VH 1HAGE 1V2TT 2B9LA 5T6DA 1C1RA 2BY6X 4YT7H 1GJ5H 1TGSZ 1D3PB 2A45B 4FETA 4FUDA 2ESTE 1PJPA 2ZDNA 3DA9B 1THSH 4FUCA 4NIWA 5C1XA 4ABEA 1ELVA 2ZKSA 3PMJA 3B23B 2XCNA 1GMCF 2PWXA 1KDQA 3M61U 1LVMA 2FOBA 6GCHG 1SQOA 5E0GA 2PP6A 1G3EA 1N6XA 4UFDH 4GHQA 2C93B 3LKWA 3I29A 3RUOA 1F5LA 1L1JA 3SNBA 2LELA 3MNXA 3ZVEA 4ZHLU 1SLVB 3ELAH 4ISOA 2G55A 1FIWA 1LPGB 4RI0A 3BEIB 1C5PA 3MWIU 4R0IA 3E16B 2HLCA 3SBKA 1F0UA 2FIRH 1AVWA 1FI8A 1ESBA 4JK5A 1EZSC 3SYJA 2FPZA 1BMFD 5EXLA 2Z6BD 1KLIH 3MU8A 1K1MA 1QJ6B 1CT0E 3DSPA 3BEFB 3HPTB 1XUHA 1NRRH 1WYKA 1ZTJA 1ANCA 3EDXB 3U8RH 3E6PH 3GCHC 1FY5A 1RXPA 1NRNH 2ZF0H 1GI0A 2ZGJA 3DSOA 3GY4A 2HALA 3BIVH 4RT0A 1TRYA 1UK4A 1SGRE 3DHKH 1C1OA 1LHEH 1ZOMA 2QE7D 3A7VA 1XVOA 4ZCNA 1TX6A 3QUMP 2V3OH 2OBOA 1RIWC 1AWHB 3MU4A 3QN7A 5B6LA 5KEDA 3KL6A 1F2SE 3MHWU 5A8YA 1DWEH 4KGAA 2UWLA 5E0HA 1V2KT 4WWYA 3F0PA 1LMWB 1THPB 2VIQA 1BRAA 3TK9A 1C1QA 2ANWA 2H9EH 1GMCG 2GT8A 1QB9A 5FCRA 5EW2H 1NZQH 2VGCB 3NK8A 4AC9A 5C1YA 2ANMH 5FL7D 1A0LA 1SHHB 1IAUA 4ZKSU 1SVPA 3SZNA 2VIVA 1PQ8A 1IQLA 2ZGXH 2HRVA 2ZU1A 3ESTA 4WMFA 1K2I1 2J38A 3W95A 7ESTE 4GCHF 4LK4A 1C2EA 1GJ8B 1DPOA 2EI6A 2ZCHP 1OWEA 2ZDVH 3MYWA 4ACAA 4B2CA 1Y3XA 2FTMA 2CXVA 5TJXA 1E35B 4LZ4B 3LPRA 2STAE 1Y3UA 4CH8B 3RXVA 1ZR0A 2FYRA 1G37A 2IJOB 1C1MA 1V6DA 2J98B 2FDAA 1BJUA 4ACBA 5IYTA 1UHBB 4I8GA 3TH4H 3TGJE 3ZVDA 1A2CH 3F68H 1BA8B 3GY6A 1S81A 2ZEBA 1SQAA 1YPKH 3ZIAD 4AFSA 3VG8A 1WXRA 1D6WA 3R0FA 3BTWE 2B5TB 1G36A 1CVWH 1ESAA 1SGIB 2BD9A 1E1RD 5L2YH 3SN8A 5FAHA 1QZ8A 3H7TA 1BB0B 2JDID 1W0KD 1O2UA 1TFXA 1HV7A 4CRFA 2VVCA 3ATKA 1SOTA 1QL8A 1O3OA 2ZWLH 4YO9A 1SGQE 1H8ED 3SORA 1F0TA 1AKSB 3OEED 2D26C 2W7SA 3GCOA 1XUFA 1GHWH 3VPKA 3L6PA 3O8DA 2VBCA 1Z8RA 1HIAB 2VH6A 4Q7ZA 3U1JB 1GWAA 5F03A 4X6MA 3UOPA 4DOQA 1UCYE 2EC9H 1IQMA 2ZU4A 4JK6A 4KKDA 4GCHG 1MD7A 2AMPA 1BTUA 4DG4A 3GOVB 5K7RA 3UR9A 3SOSA 5JBAS 1S84A 1F5KU 1MBMA 5F8TA 1SQTA 3BTHE 2FS8A 4NSVA 4K1EA 3KIDU 4CBOA 4AFQA 2A7CA 2CHAC 5FBIA 4IC6A 1WTHD 1DOJA 3IG6B 4I8JA 4ZHMU 1FUJA 1TIOA 1ELCA 1DANH 5A8XA 1W0ZU 2V3MA 3BEUA 4B75A 1P2QA 5ABWA 8LPRA 1SI5H 1ANEA 2JIZD 1DXWA 2EQNA 4X1PU 2AIPA 1NT1A 2UWPA 1F7ZA 2L74A 1J15A 1GPZA 3FP8E 3EAJA 4JMYA 3R3GB 1CA0C 4RT1A 3PO1C 2ZGBH 1Q31A 5PTPA 4BTUB 1P2OA 1F0RA 2H1UA 1UTNA 3IWMA 3OY5U 3GCHB 5JPMH 3RXKA 2BY7X 3FFGA 1ELEE 3RXUA 1AFQC 3SQHE 3UIRA 3V7TA 4WVPE 1J16A 1C1SA 4BOHA 4A1TA 1OX1A 3A81A 1VKYA 1V2WT 2I6QA 2PUXB 1RIWB 2BYAX 1GJAB 1SG8B 3A7XA 1YF4A 1DS2E 1GI2A 1SGFA 1EOJA 4GVUA 5EG4A 4DT7B 1O3HA 1GBTA 1XM1A 4CRBA 4DGJA 3NUMA 1BOQA 2GGVB 1V2OT 2BDCA 3NWUA 1EP5A 3LGIA 2V35A 1JIMA 3C1KA 3QDZB 2W26A 2ALVA 5H4IB 6CHAC 1ZMJA 3QK1A 1TX8A 2Q6GA 1PPFE 2GZ8A 1LKBA 1NFUA 2NU4E 3M3VA 3GS9A 3RXAA 3URDA 2JKHA 1SGDE 2W6ID 2O9QA 3RXIA 1NO9H 2QF0A 1W8BH 3LGYA 1V2JT 1O3EA 1QR3E 2BM2A 3OSYA 4ABDA 1YP9A 1MCTA 3ZVBA 1GBCA 2TIOA 2XBWA 4K5ZA 1HJAC 4DVAU 2CMYA 4TT3D 2VIWA 2IJD1 1A5HA 4I7YH 5AFZH 1AVGH 2GV6A 4IGDA 3N7EA 2P8OC 1CGIE 1GBMA 1ZYOA 2ZHWH 1AU8A 3MFJA 1C9PA 1S85A 2HOBA 5GJ4B 3LGUA 4B71A 3SUFA 4IMQA 4CRAA 1MBQA 1LVBA 2KCYA 4DT4A 1IQHA 2SGAA 2XYAA 2DUCA 1ZHMA 4NFFA 1A5GH 2O8LA 3RXOA 2F4LA 1C1PA 1FY8E 1E34B 2M2AA 1MU8B 3TPIZ 1P0SH 1WOFA 1ABJH 3SUGA 3KEEA 1YKTA 1ORFA 4LXBH 2WUBA 4ISIH 2EI8A 3Q3KA 2BDYA 4WH8A 3RXEA 1W0YH 3ZV8A 5EW1H 1O5EH 2BXUH 1GDNA 3LU9B 1OWHA 1P3CA 1TQ7B 1P57B 1FLEE 2F9UA 1BDAA 2Y7ZA 3M5MA 2XRCA 5EQRA 1XUGA 2XXLA 3K2UA 3ZYDA 1GVLA 1SGFG 3KHVA 5FPTA 2ZFQH 4XOJA 1KSNA 4XDEA 1DSUA 1NPMA 5DP3A 3S0NA 2CGAA 2KAIA 4JZEH 4WXVA 2WPJS 1FXYA 5GIBA 2RA3A 1BBRK 4MNVA 4E06H 3NXPA 3D23A 1GDUA 2ZPSA 1VZQH 2CHAB 1GGDC 2BD2A 3F0OA 2QV1A 3AASA 1HXEH 1TONA 1NRPH 3M35A 1K21H 3PLPA 4JZIA 1ACBE 2VVVA 1EB2A 1CE5A 4MTBA 4CR9A 1SGPE 1Q3XA 2BY5X 1YWUA 4Q4LA 1ZJKA 5EJZA 1P2IA 1RJXB 5EPNA 2RDLA 3STJA 1AWFH 2VWNA 2Z9LA 3UNRA 1TPAE 1JWTA 1EX3A 1GL1A 3C27B 3KYGA 3STIA 3SU4A 4NZQA 1NC6A 2XBXA 3A83A 4A7IB 1CA0B 1N8OC 3PO1B 1TBRH 1NFYA 4NG9H 8GCHG 2BVXH 3A7YA 2ZU5A 2GZ9A 4F49A 3QO6A 1AKSA 2FOHA 2CF8H 1O2GH 1SBWA 1AFQB 1MH0A 5HM2A 3DUXH 4F55A 1FMGA 3S9AA 2ODYB 2PLXA 1P02A 1SOZA 2XBYA 4FUHA 4OS7A 1N1LA 2WPMS 4H6TA 4RKJB 4FU8A 2V6NA 5CHBA 3RXPA 3UB0A 3RXRA 1G3DA 2ZU3A 3M36A 1Y5UT 2SGQE 3BSQA 4ABAA 1W2KH 1AO5A 1BMNH 3PM3A 4X2YA 2NU1E 1XUKA 4Y76A 3EA8A 3KF2A 3A86A 3SU5A 4Y11E 2BDIA 2AGEX 2FESH 2OLGA 3U98H 4ZXXH 2QF4A 1W0JD 1QA0A 3NKKA 2Z3CA 2TGDA 3ZZ6A 4AGJA 1PPCE 1L2EA 2IOTA 3RC6A 5AHGH 5DP6A 1H9IE 3SJKA 3F2HA 1KXEA 3MNBA 1NU9A 1GHAF 3U28C 1TAWA 5C5NA 2Z9JA 2PW8H 4XSKU 1QL9A 2SGEE 1HJAB 5C67A 3KQBA 1MU6B 1QL7A 1YLCA 1ARCA 4X1RU 5AVDA 1O2JA 3EA7A 1Z6JH 1BMLA 3KQEA 2P8OB 3CNRA 4OS2A 4H4FA 5F53A 5CE1A 1O5FH 1SB1H 5IK2D 3SNDA 2QIQA 2XCFA 1LVYA 2BY8X 2FOMB 4FUJA 3RMMH 3UWJH 2Z9GA 4YXWD 3TJUA 1ZGVA 1GBHA 2BY9X 1YLNA 2OK5A 2BDHA 1RTFB 3UAIC 2YMSC 2FZZA 2QXIA 1FONA 1HGTH 1TWXB 2VGCC 3DFJA 2HVYB 5DG6A 4CH2B 3E0PB 1C2FA 3ATIA 3GCTG 5HM9A 2WYJA 3K6ZA 1DFPA 4BAKB 4D76A 1S6HA 2W6JD 1ARBA 1S0QA 4KTUA 1FN8A 1W3CA 4BTIB 1P9SA 5JBCS 1O3LA 1TA2A 3FVFB 1NS3A 2JETB 2JH5D 5CMXH 2AHME 4IN1A 4ISLA 2FI4E 3P8NA 2GKVE 1C4U2 4X8UH 3BIUH 3RM2H 2VH0A 2WINI 1FPHH 2PKAB 4PROA 4ZROA 4A92A 1NFWA 1MAXA 4X6NA 2ASUB 4HI3A 2ZFFH 2EEKA 5FPSA 1GHAG 3T62A 1WTGH 4ESTE 1YPGH 4WXIA 1OWKA 4BAHB 1O31A 2BQ6B 3A7ZA 1KXCA 3MNCA 1KY9A 3PV2A 1KYNA 1AFEH 3F9HA 2XNIA 1O3GA 3SU1A 2HPQH 3SZEA 3BTQE 3T25A 3M7TA 1O2OA 3HGPA 1D3TB 4LZ1H 3P6ZB 2J5UA 5DGJA 1C2LA 3P8OA 2GMTC 1SGCA 3LGVA 4JZDH 1N6YA 1UO6A 5BRRE 5L6NH 2QXJA 2P59A 3WY8A 2Y7XA 1OS8A 2RFKC 4KP0A 2ZGCA 3LGTA 2ZNKH 3LIWA 1N8OB 4IW4E 4O3UA 1FAXA 5CHAC 4I33A 2UWOA 2Z9KA 2ZHQH 4YOIA 3GYMA 4FOUC 2G81E 5FX5A 1BMMH 2ZFSA 5EJ1A 4B6EA 2PTCE 1LQDB 1O36A 1UTMA 4NIYA 4Y6DA 2Q6FA 4IN2A 1TGCA 3BTFE 1UTOA 4B1TA 1CA8B 1COWD 2CN0H 4INLA 1C5VA 4M7GA 1BMAA 1AE8H 1YCPH 1GBFA 1O2KA 1GHZA 3ZZ7A 4X6OA 4FUFA 5A2MH 3M3TA 2HPPH 1UW7A 1QFKH 4DJZB 4HZHA 1W14U 2A4OA 2KCOA 2R0KA 1VITF 1VCPA 4WJG2 3T26A 1O34A 4I8LA 1IQFA 3AAUA 2Z9IA 1GJ4H 3URCA 1T31A 2ZFPH 2WV4A 1ELTA 3H7OA 1C1UH 2R3UA 2FOAA 4WF8A 1XUJA 1V2PT 1YPJH 1P01A 1BRCE 2QA9E 1INCA 3SO3A 2KM0A 4OS4A 4RN6A 1BHXB 3QZRA 2SNVA 1O32A 1BUIA 5C94A 5GXPA 2BLVA 2OBQA 2Z7FE 3BTKE 2AIQA 3ITIA 3BG4C 1C5OH 2ZPRA 1O30A 1GJDB 1QCPA 4AORA 2FYQA 1UVUH 3Q3XA 3VEQB 2XWBI 1GBDA 1KXDA 1O5DH 3ZVFA 3G01A 4BNRA 3MU5A 1D4PB 2D2DA 5DSFA 1QBOA 2SNWA 5EOKA 3GY3A 3SU6A 4CRCA 1IQKA 1CSOE 1QGFA 4ABIA 1AIXH 2PSXA 4OS1A 1DLKB 2ZIQH 1C5QA 4A1VA 1BTWA 2YMSB 2F9PA 1GBAA 5C1UA 2ZPQA 3FZZA 4AZ2B 3F2FA 4THNH 3OTJE 3ENSB 1KLTA 2GX4A 4UONA 1CQQA 5A0AE 1CGJE 3QGJA 1GDQA 3WWBA 3GICB 4NSYA 1EPTC 2M5TA 3MH4A 1O2WA 1P09A 1GJ7B 1MUEB 1C2HA 2P93A 3TU7H 4CREA 4YTAA 2L6OA 1GI4A 2AFQB 3PB1E 1DM4B 5LPRA 1EAXA 5DKMA 3ATMA 1WUNH 2ZO3H 2A5KA 2TBSA 2Q1JA 2KCPA 2RA0A 1PYTD 2YMSD 1DE7H 2BMGB 1BTHH 1EATA 1ZSJA 1DDJA 1V3XA 1QNJA 5ESTE 2I6SA 3EE7A 1C5UA 1GJ6A 2ULLA 2XW9A 1BRBE 4JYUH 4U32A 1HPGA 3JZ2B 1C1WH 1DLEA 1K28D 1A0JA 2HWLB 4O97A 1BTPA 3OU0A 1C2KA 1OWDA 2BQWB 2PV9B 3SNAA 1HCGA 2XC5A 1MCVA 1EB1H 4XD7D 1SR5C 4BANB 1DUEA 4SGBE 2QCYA 1O2TA 1W10U 2J94A 3GDSA 1S82A 1IQGA 1CBWB 1EAIA 2VU8E 3M3SA 3VGCC 3ZZDA 3PLBA 1MZDA 2F9BH 2GCTC 1O3MA 4TY7A 2GMTB 4K60A 1FY4A 1QB6A 4HGCA 4K1TA 1GG6C 3A89A 2QXHA 2AS9A 3LH1A 4FUIA 4Y0ZE 2R2MB 5EU8A 1IQIA 2OUAA 1CHOF 5DK1A 1V2UT 3TK5A 5CHAB 1TNHA 1FQ3A 2W3KA 4GSOA 4OGXA 1QIXB 3EE0B 3PTNA 1E1QD 4K8BA 3VB6A 1ZTLA 1S5SA 1VJ9U 1P03A 1NESE 4UFGH 2FOEA 4BAQB 3ZVAA 5EQSA 1EAUA 4Z0KA 1T7CA 3V3MA 1KTSB 3BG8A 3P70B 4AOQA 3SV6A 3HKIB 1EJMA 4D7FA 2PUQH 4FVBA 1A3EH 1Z71A 2FLRH 2PTNA 3UR6A 1AB9C 1AI8H 1DXPA 3GISB 4NA7A 4E05H 1EZXC 1GHXH 2A5IA 1RS0A 1DY8A 3D49H 2W7UA 3SHAH 2IN2A 1KTTB 1QRWA 3LH3A 2QYIA 3BN9A 2OINA 1H9HE 4GUXA 4I31A 5SGAE 1MMJN 1CGHA 4MPUA 3PV5A 1TB6H 5HIYA 4IS5A 4QT8C 3QGNB 2BDAA 1H9LB 1ESTA 4OM9A 2XC4A 1OYTH 1IOEA 1QBNA 1V2QT 2G00A 3RDZA 2AERH 2OXSA 3BG4B 2BD5A 1GMDF 4TPYA 2A4GA 2BXTH 2W5EA 1Q2WA 1MABB 2CJIA 4Y8XA 4Y71A 1Z6EA 2C90B 1D9IA 4FVDA 3RU4T 3UFAA 1G3BA 1JRSA 5FPYA 3FP7E 5ESBA 2IPQX 3A80A 3AW1A 1VGCC 1CHOG 1BTZA 2SGPE 3ZZ5A 2BD4A 1EJNA 3A88A 4I8KA 4IMZA 4MPXA 1V2VT 4WMDA 2THFB 5JDUB 1DUAA 2WSSD 2V7QD 4YLQH 2A4QA 2BOHB 3D65E 1THRH 2A2XH 4AX9H 4GLYA 5HMAA 2ZA5A 1O5GH 1WDIA 1UJ1A 1J9CH 1EPTB 4INHA 5T1VA 4MNXA 1ZHRA 2TPIZ 3E1XB 1MQ5A 2FTLE 2P3TB 4UD9H 5F8XA 3T28A 2AMQA 2UUFB 5DN6D 1AN1E 1TMUH 3A8AA 3VFEA 1LTOA 1YC0A 6ESTA 4MDSA 1TLDA 2BLQA 3K65B 2HLDD 1P2MA 1PPZA 2BTCE 2YNAA 3PTBA 4ABGA 4H42U 4TWYA 1EAWA 4IC5A 3AVZA 4ZXYH 1RFNA 3O8BA 1EQ9A 1NFXA 3OFND 1OYQA 3CS0A 3GYLB 2F91A 1MD8A 2A2QH 2OP9A 3BF6H 1SQRA 3F6UH 3V0XA 1P04A 3OX7U 4J1YA 2KCAA 2ZI2H 4NA9H 3B9FH 3MO6A 4MNYA 4CHAB 3LGWA 3UREA 1B0FA 1GMDG 2K0QA 1YPEH 4X2XA 4AGKA 1IQEA 4TY6A 2ZHDA 4WMEA 1UTPA 1C5SA 5TCCA 2LP6A 4ABBA 1HAVB 1C5XB 3OE7D 3GY2A 4KTSA 3V13A 3VGCB 4BXWA 2ZTZA 1TPSA 2JETC 4D9QA 1G9IE 1GBKA 2GCTB 1GHVH 2ZU2A 3RXGA 2TRMA 1GG6B 1A61H 1NM6A 1O2IA 1TABE 5C17A 2BOKA 2WYGA 1K1LA 3EYDA 2A7JA 2R9PA 1C9TA 4DY7B 1O35A 3U9AH 5F6MA 1SLUB 4BAOB 4ASUD 5EODA 1C5MD 3QWCH 2ZCKP 5HIZA 1EXFA 1KDQB 3SV2H 2G52A 1T8OA 1WCZA 7GCHF 3IITA 2J9NA 1NROH 2ZFTA 3E0NB 1O3PB 2J98A 1Z8JB 1PPHE 1QTFA 3M5LA 1UHBA 3SJOA 3O8CA 1PQAA 1MTSA 1FN6A 1O3JA 2BLOA 3P95A 5HXFA 1FIZA 4ABHA 1OWIA 2FXRA 3A84A 3TLOA 1HAIH 3FZDA 2VNTA 3VXEH 1AB9B 1AVXA 4AFZA 5T3HA 1DSTA 1UCYK 5GWZA 5FX6A 4F4OC 5C2ZA 3RXBA 1C2GA 4R8TB 4FUEA 4YESB 2Y6TA 4NGAH 1TOMH 2J34A 4MG3A 1YPLH 3SU2A 1UTJA 4INKA 2H5CA 2WV9A 4VGCB 4AFUA 4X2VA 4X2WA 1TMBH 4OGYA 1ELAA 1TNIA 2GTBA 2VIOA 2OC1A 2V3HH 1T8LA 1O2VA 1IHSH 2J2UA 3SGAE 1KXBA 1GMHF 1HIAA 4MQAA 4X1NU 1G2LA 1YCPM 3RMNH 1NRSH 2HGTH 5DJ7A 1UVOA 2J97A 3BTTE 3KQDA 1LHFH 4CRGA 4UEHH 3ODFA 2UUKB 4H6SB 3RP2A 1Y5BT 3A85A 1VGCB 1BBRH 1FAKH 4CRDA 3OAAD 4TWWA 5C5OA 3A8BA 1O33A 2G4UA 2ILNA 1M9UA 1HRTH 1ELFA 1VCWA 3M7UA 1G3CA 1S6FA 1NBME 1ZSKA 1H8DH 1PPEE 5ETXA 1KMHB 7GCHG 3ZV9A 3UTUH 4YOJA 1UCYH 3U8TH 1F92A 1SGNE 2HVXA 4FXGH 1SHYA 3MQKC 3RLYH 3PRBA 2BVRH 2D8WA 2TGPZ 5HGGA 3FN8A 1KLJH 2K1QA 1EASA 2PKSC 4NIVA 2RCEA 2GD4B 2OTVA 3MOCA 1QQ4A 3U8OH 2C4FH 3KGPA 1AE5A 2OQUA 4FU7A 3RXLA 2F9NA 2NWNA 2HNTE 4K8YA 5TCAA 4AG2A 3WW7A 1SSXA 4ZH8A 1KXAA 2EA3A 1WBGB 3HGNA 1L1NA 1K0HA 1MTUA 1W7GH 4X1QU 1HJ9A 3SW2B 1D3DB 4JYVH 4NZLA 4YT6H 3D62A 4AB8A 1CO7E 1PYTC 2A4RA 1HAZB 5A8ZA 4UDWH 5L2ZH 1ZMLA 3PV4A 3A8CA 2B0FA 1PQ7A 4YZUA 3MO9A 1GMHG 4ZKOU 1Z1IA 3TGIE 4Y10E 2PFEA 1GI5A 1ZSLA 4M9FA 4XE4A 4Z6AH 1DT2A 1GJBB 3T5FH 4U30A 1C5ZB 4Q7YA 4DURA 2JH0D 2VIDA 3OYPA 2SGDE 2G5NA 2EI7A 1BT7A 1PPGE 4NA8A 1P12E 1S6LA 2OD3B 1XXDA 2KFWA 3TNSA 1C4V2 3UNQA 1L4DA 4X6PA 1W7XH 1FPCH 2ZHFH 3QTOH 1B7XB 2AYWA 1Y3YA 2OCVB 2ZDAH 1O39A 1ZTKA 1GI6A 3ZVCA 1TNGA 3KNXA 3AK5A 4KTCA 5E2PA 3QTVH 1YPMH 1Y5AT 1XXFA 1ZPCA 1AUJA 1H8IH 2GCHF 2QF5A 4I8HA 1QHRB 1DWCH 1G30B 3TH2H 1GVZA 2FP7B 4O3TA 1ETRH 1LO6A 1TBQH 2P95A 2A0QB 4MNWA 5JYIA 1CBWC 4ISHH 2R0LA 3EQ0H 1TGTA 1SFQB 1AQ7A 1ANBA 2BDBA 1MTWA 2FX6A 3KQ5A 1BTXA 2Z94A 5GNDA 3ZZAA 3O8RA 4Q2KA 5A0CA 5C3NA 4YOGA 1LCYA 1O3BA 3M7QA 3WWFA 3RXSA 2QXGA 1BTYA 1C1TA 5I46H 1FZZA 1OSSA 2O8MA 3T2NA 1E37B 5EIYA 1O5BB 1HDTH 4LOYH 2H2ZA 2VWMA 2SGFE 1HAVA 2ZDMA 4ZUHA 1PPBH 3ZZ4A 2KZ4A 1WAYB 4DIHH 2NU2E 3SHCH 1P9UA 1QQUA 3PMAB 3DCLA 3A7WA 1P8VC 4ASHA 4CBNA 1ZRBA 5C20A 3KN2A 2ZFRH 1SLXB 1OKXA 2A7HA 3MTYA 1SC8U 3MH6A 1B5GH 1P05A 5J4QA 4X0WU 4Y7BA 1O2NA 1IQJA 1F0SA 1S83A 1ZJDA 2O8TA 2RDEA 1AY6H 4ZHAA 4MPWA 1LPZB 3LC3A 3LDXH 4JYTA 2BLWA 1H1BA 2ZP0H 1EKBB 3RXFA 3CP7A 1MQ6A 4I86A 1K1JA 1XX9A 1O3DA 4O9VA 3SV9A 1UVPA 3P17H 1O38A 2FOCA 3BTDE 1SGYE 1QBVH 2VVUA 4AG1A 1QB1A 1IQNA 1O2ZA 1OP8A 5HKKD 2BVSH 3PRDA 3W1EA 4RSPA 1A5IA 1X7AC 1UVSH 4XRNA 1L0ZA 2GCHG 2GZ7A 4FU9A 1SKYE 3E8LA 1SGEE 1Z7KA 2UUJB 2DE8A 5AF9H 3RXQA 4UE7H 4UFEH 3N99A 1C2DA 1GHBF 4Y8ZA 2OQ5A 3HATH 1PQ5A 2PSYA 4XBCA 1XMNB 2PKSB 5E0JA 1UVTH 3LJJA 4AYVB 3M5NA 2ZDLA 3SJ8A 3U1IB 1WQVH 1WSSH 2XBVA 1P3EA 2KX4A 3H09A 1P11E 5F8ZA 3GY7A 3P8GA 4GHTA 4X1SU 4ZKNU 3RM0H 1BITA 2OC0A 2P94A 2VJ1A 4JCNA 3HK6B 2F9OA 5KGOA 3SGQE 1RD3B 4ISNA 2ZG0H 4JZ1A 1K1OA 5LPFA 3A87A 4TPIZ 1JMOH 1P2JA 1ELGA 2ZQ2A 4MPVA 2Z3EA 2F3CE 2R2WU 2ZDKA 3SUEA 3GY8A 1HYLA 5DP8A 3SGBE 3BTEE 3P92A 3RMOH 3TJVA 1AMHA 4I32A 2J4IA 1O2PA 1GJCB 1W12U 1ETSH 1XVMA 5A0BA 1HAXB 1E36B 3LC5A 5JBBS 4HG6A 1BCUH 1FNIA 5HYOA 2YOLA 1CT4E 1YPHC 1PFXC 1XKAC 3ODDA 3TJNA 2WV5A 1LHCH 5L30H 3TH3H 2BX3A 2WUCA 3SI3H 2WPLS 1WV7H 1VITG 3LJOA 1GI7B 1SLWB 3K9XB 1Z8GA 3ZZBA 1QJ7B 1SMFE 1WU1A 3TGKE 1MTNC 3S9BA 3ZYEA 5E8EH 1TE0A 3GDUA 2QAAA 1TOCB 3KQCA 1RTKA 2BQ7B 3H5CB 2BX4A 1TRNA 2Y5HA 1GHBG 1Y3WA 4FUBA 2WHXA 5LPEA 3SI4H 2KAIB 1GCTB 1TNKA 4SGAE 1C5LH 2G4TA 2HNTC 3VB4A 4CHAC 1QA7A 2ZTYA 5FHTA 3UOUA 4B74A 1P06A 3RC5A 1F5RA 1HAYB 4ZMAH 1ZZZA 2AEIH 1Z8IB 2XC0A
chains in the Genus database with same CATH topology
1MKXK 3ATLA 1A1RA 1IHTH 3N7OA 1C4Y2 3MO3A 1SGTA 1TX7A 2BZ6H 1VJAU 4Q7XA 2LNCA 1T4VH 1A3BH 1WQSA 3SNEA 3RC4A 1UMAH 2Y82A 1C5TA 5A09A 3UY9A 3NZIA 1O0DH 1V2RT 1LHGH 4A6LA 3PWCA 2GDEH 1K22H 3VB7A 1BZXE 1Y8TA 5JBTA 1O2YA 5LGOA 1BBRE 4HFPB 3TJOA 2WPHS 1VITH 4NWKA 1TBZH 1O3NA 2QF3A 2TGTA 3FP6E 1HNEE 2PKAA 3MNSA 3HKJB 4DIIH 2ODPA 1O3AA 3A82A 5K0HA 2AMDA 1K1PA 1ZHPA 2C8XB 3RXJA 1BIOA 4BTTB 1TNLA 2AGIX 1P2KA 1C5WB 1LHDH 1A46H 5DP4A 3SJ9A 3VB5A 4A1XA 1ELBA 1CT2E 3UWIA 1HB0B 1TPOA 2GDDA 1MKWK 1C2IA 1DWDH 2P16A 2D1JA 3RXCA 3FAOA 4O03A 2J92A 1FY1A 1MKXH 3I77A 1MAYA 4MLFB 4VGCC 8ESTE 4NWLA 3L3TA 1SPJA 2BB4A 2BD3A 3T29A 4BAMB 1V2MT 3F1SB 1UK2A 2FODA 2C8ZB 1AD8H 2QGRA 2AGGX 1UTQA 4OS6A 2VINA 1A7SA 3S9CA 4NCYA 3UNSA 1J14A 3AW0A 4TYDA 1D6RA 5GPIB 3RU4D 1UTLM 3LOXA 3SQEE 1T32A 1GI9B 2R3YA 4MVNA 1RTLA 2Y81A 1XUIA 5T6GA 1ZGIA 1AZ8A 1O2QA 5G4BA 1UK3A 1V2LT 1O37A 3EGKH 1GI3A 3MU0A 3P8FA 3ZZ9A 9ESTA 1C1NA 2ZECA 1MKWH 4DCDA 1Z1JA 1TPPA 1L4ZA 1BQYA 1BRUP 1MTVA 3W94A 1VCQA 1B0EA 1SL3A 1ABIH 2FS9A 3ZZ8A 1W11U 3VB3A 4HTCH 3Q76A 4X8VH 2C3SA 5EPYA 3TK6A 1GVKB 1HAHH 1MTNB 1QJ1B 2CV3A 2UUYA 3NCLA 1MZAA 1P10A 1XKBC 3SV8A 5FCKA 4RKOB 3EA9A 1QY6A 1V2ST 2GP9B 1G2MA 1JIRA 1ETTH 4AN7A 2Z3DA 2QY0B 3S69A 3GDVA 5T6FA 3S7HB 5LH8A 1NRQH 1GJ9B 3Q3YA 1ZPZA 1HAPH 2F83A 4IBLH 1C5YB 2B8OH 5BPEA 5FXLA 1BHXF 4U01A 9LPRA 1UTKA 2O8WA 1OPHB 1NY22 3PROA 1C5NH 2AH4X 1QURH 2P3UB 2PHBA 1EOLA 1W13U 2QC2A 3BTGE 1J8AA 1YGCH 2JH6D 4X8TH 2FX4A 1L1GA 1A4WH 3M37A 2G51A 1A0HB 2A31A 2XWAA 5EGMA 2Y5FA 2C8YB 2Q6DA 4B2AA 2BHGA 4KELA 3UPEA 3M5OA 4Y8YA 8GCHF 3PYHA 3DFLA 1T8NA 3ZZCA 1J17T 3T27A 4E7NA 1GBLA 4ZAEA 7KMEH 6LPRA 3Q00A 1FJSA 1FDPA 5DP5A 1OXGA 1NU7B 5DP7A 1O2MA 3TIUA 1O3FA 3LONA 4ABJA 3RU4E 1HUTH 2FO9A 4DW2U 1RGQA 2ODQA 1JXPA 2BZAA 3L33A 1Y59T 4GAWA 1GBIA 2ALPA 1YBWA 4A5TS 5GCHF 3SJIA 1GHYH 2YNBA 1ZLRA 2OC8A 2NU3E 1O5AB 3SNCA 3SUDA 3DD2H 3FANA 1TNJA 3A7TA 1JBUH 3F9FA 3TITA 4FUGA 3Q77A 1EZUC 3PWBA 3BV9B 5E2OA 3RXMA 3TVJB 1O2SA 4K2YA 4GPGA 2QN5T 3E3TA 1FV9A 1O5CB 4UFFH 1O2XA 1ANDA 3A8DA 1CU1A 1K9OE 1SFIA 1EP6A 2FLBH 5DP9A 3OY6U 1O2RA 2ZGHA 4AYYB 1TALA 1AZZA 4XBDA 4YLUA 1ZPBA 2W3IA 5IDKA 1TGNA 1LVOA 3HK3B 3ZVGA 1ZMNA 1O3CA 1OOKB 4J2YB 3PMHB 3RXDA 7LPRA 4WY3A 2P3FH 3UQOA 2XTTB 3ZZ3A 1O2HA 1O2LA 1RRKA 1H4WA 1TYNA 1P2NA 1CHGA 1DITH 5J4SA 2A32A 2O8UA 2FI5E 2G8TA 4AB9A 1LKAA 2FOGA 3QZQA 3SU0A 1YPHE 1O3KA 1LPKB 3RLWH 1HAOH 1Y3VA 3GCTF 5DPAA 2C8WB 1U6QA 2PR3A 4X8SH 3QLPH 1HXFH 1GI8B 1GBEA 4K3JA 5JB8S 3VXFH 1S0RA 3E91A 3MH5A 1QRZA 4Y79A 2FEQH 3S7KB 4ZKRU 2IPHA 3TNTA 1FY3A 5GCHG 8KME2 2LPRA 3UUZA 1VR1H 2Y5GA 2PGQB 3GCNA 2WPKS 1AUTC 2ANKH 1E0FD 2BDGA 6CHAB 1T8MA 1ZRKA 1EJAA 1C5RA 1GBJA 2ZZUH 3MI4A 1OWJA 4K69A 2GV7A 1TA6A 3MMGA 2GT7A 4OS5A 4WH6A 2ZTXA 1YYY1 4Y7AA 4B76A 2VWOA 3UQVA 3F9GA 2ZHEH 1GBBA 4XBBA 3CS7A 4U2WA 1HLTH 1HBTH 4K1SA 1GI1A 4BXSA 2A1DB 4XFQA 3U69H 3V12A 1K1IA 4NIXA 2OC7A 2DE9A 3I78A 1T4UH 3B8JA 4D8NA 5JB9S 1AHTH 2VIPA 2H5DA 2H9HA 1C2MA 3ATWA 2SFAA 5I25A 3SV7A 3PMBB 5EQQA 2FOFA 5EXNA 1K1NA 1GL0E 1O3IA 2H6MA 2PGBB 1LDTT 1GCDA 1DICA 3F9EA 4YM9A 2STBE 3RXHA 1JRTA 2VB0A 2G5VA 4D7GA 2FMJA 1QRXA 1TMTH 1EPTA 2H9TH 2J95A 1KIGH 1E38B 1EUFA 1EZQA 1OP0A 1DVAH 2CF9H 2BD7A 2GVFA 4NFEA 1OP2A 3CENA 6GCHF 1V2NT 3MH7A 2BD8A 1TQ0B 2NU0E 5DO4H 3DT0H 3RXTA 5GDSH 1JOUB 1GCTC 2F9VA 3MU1A 1BJVA 3AAVA 2VWLA 1TRMA 4JZFH 4B73A 1DX5M 1ID5H 3E90B 1LQEA 4E7RG 1C2JA 1KXFA 2ZCLP 1ELDE 3RMLH 2FI3E 3K6YA 4Y0YE 1YLDA 5FBEA 2V0BA 2RG3A 2WPIS 3QX5H 3JZ1B 2TGAA 1YCPK 5EXMA 1DWBH 1NN6A 3SU3A 2ZQ1A 2A5AA 2ANYA 1G32B 4CR5A 1NTPA 3KCGH 1DY9A 4Q80A 1GGDB 4ABFA 3BTME 1AGJA 1D3QB 3LT3A 4D9RA 2FWWA 5B6OA 1HFDA 3GY5A 5AFYH 1YM0A 1TGBA 2B7DH 2FM2A 2ZC9H 4B2BA 1HJ8A 2HNTF 3NPSA 2Y80A 1C1VH 1HAGE 1V2TT 2B9LA 5T6DA 1C1RA 2BY6X 4YT7H 1GJ5H 1TGSZ 1D3PB 2A45B 4FUDA 2ESTE 1PJPA 2ZDNA 3DA9B 1THSH 4FUCA 4NIWA 5C1XA 4ABEA 1ELVA 2ZKSA 3PMJA 3B23B 2XCNA 1GMCF 2PWXA 1KDQA 3M61U 1LVMA 2FOBA 6GCHG 1SQOA 5E0GA 1G3EA 1N6XA 4UFDH 4GHQA 2C93B 3LKWA 3I29A 3RUOA 1F5LA 1L1JA 3SNBA 3MNXA 3ZVEA 4ZHLU 1SLVB 3ELAH 4ISOA 2G55A 1FIWA 1LPGB 3BEIB 1C5PA 3MWIU 4R0IA 3E16B 2HLCA 3SBKA 1F0UA 2FIRH 1AVWA 1FI8A 1ESBA 4JK5A 1EZSC 2FPZA 5EXLA 2Z6BD 1KLIH 3MU8A 1K1MA 1QJ6B 1CT0E 3BEFB 3HPTB 1XUHA 1NRRH 1WYKA 1ZTJA 1ANCA 3EDXB 3U8RH 3E6PH 3GCHC 1FY5A 1RXPA 1NRNH 2ZF0H 1GI0A 2ZGJA 3GY4A 3PLKA 2HALA 3BIVH 1TRYA 1UK4A 1SGRE 3DHKH 1C1OA 1LHEH 1ZOMA 3A7VA 1XVOA 1TX6A 3QUMP 2V3OH 2OBOA 1RIWC 1AWHB 3MU4A 3QN7A 3KL6A 1F2SE 3MHWU 5A8YA 1DWEH 4KGAA 2UWLA 5E0HA 1V2KT 4WWYA 1LMWB 1THPB 2VIQA 1BRAA 3TK9A 1C1QA 2ANWA 2H9EH 1GMCG 2GT8A 1QB9A 5FCRA 5EW2H 1NZQH 2VGCB 3NK8A 5C1YA 2ANMH 1A0LA 1SHHB 1IAUA 4ZKSU 1SVPA 3SZNA 2VIVA 1PQ8A 1IQLA 2ZGXH 2HRVA 2ZU1A 3ESTA 4WMFA 1K2I1 2J38A 3W95A 7ESTE 4GCHF 4LK4A 1C2EA 1GJ8B 1DPOA 2EI6A 2ZCHP 1OWEA 2ZDVH 3MYWA 4B2CA 1Y3XA 2FTMA 2CXVA 5TJXA 1E35B 4LZ4B 3LPRA 2STAE 1Y3UA 4CH8B 3RXVA 1ZR0A 2FYRA 1G37A 2IJOB 1C1MA 1V6DA 2FDAA 1BJUA 5IYTA 1UHBB 4I8GA 3TH4H 3TGJE 3ZVDA 1A2CH 3F68H 1BA8B 3GY6A 1S81A 2ZEBA 1SQAA 1YPKH 4AFSA 1D6WA 3R0FA 3BTWE 2B5TB 1G36A 1CVWH 1ESAA 1SGIB 2BD9A 5L2YH 3SN8A 5FAHA 3H7TA 1BB0B 1O2UA 1TFXA 1HV7A 4CRFA 2VVCA 3ATKA 1SOTA 1QL8A 1O3OA 2ZWLH 4YO9A 1SGQE 3SORA 1F0TA 1AKSB 2D26C 2W7SA 3GCOA 1XUFA 1GHWH 3VPKA 3L6PA 3O8DA 1Z8RA 1HIAB 2VH6A 4Q7ZA 3U1JB 1GWAA 5F03A 4X6MA 3UOPA 4DOQA 1UCYE 2EC9H 1IQMA 2ZU4A 4JK6A 4KKDA 4GCHG 1MD7A 2AMPA 1BTUA 4DG4A 3GOVB 5K7RA 3UR9A 3SOSA 5JBAS 1S84A 1F5KU 1MBMA 5F8TA 1SQTA 3BTHE 2FS8A 4NSVA 4K1EA 3KIDU 4CBOA 4AFQA 2A7CA 2CHAC 5FBIA 4IC6A 1WTHD 1DOJA 3IG6B 4I8JA 4ZHMU 1FUJA 1TIOA 1ELCA 1DANH 5A8XA 1W0ZU 3BEUA 4B75A 1P2QA 5ABWA 8LPRA 1SI5H 1ANEA 1DXWA 4X1PU 2AIPA 1NT1A 2UWPA 1F7ZA 1J15A 1GPZA 3FP8E 3EAJA 4JMYA 3R3GB 1CA0C 3PO1C 2ZGBH 1Q31A 5PTPA 4BTUB 1P2OA 1F0RA 2H1UA 1UTNA 3IWMA 3OY5U 3GCHB 5JPMH 3RXKA 2BY7X 3FFGA 1ELEE 3RXUA 1AFQC 3SQHE 3UIRA 3V7TA 4WVPE 1J16A 1C1SA 4BOHA 4A1TA 1OX1A 3A81A 2PUXB 1V2WT 2I6QA 1RIWB 2BYAX 1GJAB 1SG8B 3A7XA 1YF4A 1DS2E 1GI2A 1SGFA 1EOJA 4GVUA 5EG4A 4DT7B 1O3HA 1GBTA 1XM1A 4CRBA 4DGJA 3NUMA 1BOQA 2GGVB 1V2OT 2BDCA 3NWUA 1EP5A 3LGIA 2V35A 1JIMA 3C1KA 3QDZB 2W26A 2ALVA 5H4IB 6CHAC 1ZMJA 3QK1A 1TX8A 2Q6GA 1PPFE 2GZ8A 1LKBA 1NFUA 2NU4E 3M3VA 3RXAA 3URDA 2JKHA 1SGDE 2O9QA 3RXIA 1NO9H 2QF0A 1W8BH 3LGYA 1V2JT 1O3EA 1QR3E 2BM2A 3OSYA 4ABDA 1YP9A 1MCTA 3ZVBA 1GBCA 2TIOA 2XBWA 4K5ZA 1HJAC 4DVAU 2CMYA 2VIWA 1A5HA 4I7YH 5AFZH 1AVGH 2GV6A 4IGDA 2P8OC 1CGIE 1GBMA 1ZYOA 2ZHWH 1AU8A 3MFJA 1C9PA 1S85A 2HOBA 5GJ4B 3LGUA 4B71A 3SUFA 4IMQA 4CRAA 1MBQA 1LVBA 1IQHA 2SGAA 2XYAA 2DUCA 1ZHMA 4NFFA 1A5GH 2O8LA 3RXOA 1C1PA 1FY8E 1E34B 1MU8B 3TPIZ 1P0SH 1WOFA 1ABJH 3SUGA 3KEEA 1YKTA 1ORFA 4LXBH 2WUBA 4ISIH 2EI8A 3Q3KA 2BDYA 4WH8A 3RXEA 1W0YH 3ZV8A 5EW1H 1O5EH 2BXUH 1GDNA 3LU9B 1OWHA 1P3CA 1TQ7B 1P57B 1FLEE 2F9UA 1BDAA 2Y7ZA 3M5MA 2XRCA 5EQRA 1XUGA 2XXLA 3K2UA 3ZYDA 1GVLA 1SGFG 3KHVA 5FPTA 2ZFQH 4XOJA 1KSNA 4XDEA 1DSUA 1NPMA 5DP3A 3S0NA 2CGAA 2KAIA 4JZEH 4WXVA 2WPJS 1FXYA 5GIBA 2RA3A 1BBRK 4MNVA 4E06H 3NXPA 3D23A 1GDUA 2ZPSA 1VZQH 2CHAB 1GGDC 2BD2A 2QV1A 3AASA 1HXEH 1TONA 1NRPH 3M35A 1K21H 3PLPA 4JZIA 1ACBE 2VVVA 1EB2A 1CE5A 4MTBA 4CR9A 1SGPE 1Q3XA 2BY5X 1ZJKA 1P2IA 1RJXB 5EPNA 2RDLA 3STJA 1AWFH 2VWNA 2Z9LA 3UNRA 1TPAE 1JWTA 1EX3A 1GL1A 3C27B 3SU4A 3STIA 4NZQA 1NC6A 2XBXA 3A83A 4A7IB 1CA0B 1N8OC 3PO1B 1TBRH 1NFYA 4NG9H 8GCHG 2BVXH 3A7YA 2ZU5A 2GZ9A 4F49A 3QO6A 1AKSA 2FOHA 2CF8H 1O2GH 1SBWA 1AFQB 1MH0A 5HM2A 3DUXH 1FMGA 3S9AA 2ODYB 2PLXA 1P02A 1SOZA 2XBYA 4FUHA 4OS7A 1N1LA 2WPMS 4H6TA 4RKJB 4FU8A 2V6NA 3RXPA 3RXRA 1G3DA 2ZU3A 3M36A 1Y5UT 2SGQE 3BSQA 4ABAA 1W2KH 1AO5A 1BMNH 3PM3A 4X2YA 2NU1E 1XUKA 4Y76A 3EA8A 3KF2A 3A86A 3SU5A 4Y11E 2BDIA 2AGEX 2FESH 2OLGA 3U98H 4ZXXH 1QA0A 3NKKA 2Z3CA 2TGDA 3ZZ6A 4AGJA 1PPCE 1L2EA 2IOTA 3RC6A 5AHGH 5DP6A 1H9IE 3SJKA 1KXEA 3MNBA 1NU9A 1GHAF 1TAWA 5C5NA 2Z9JA 2PW8H 4XSKU 1QL9A 2SGEE 1HJAB 5C67A 3KQBA 1MU6B 1QL7A 1YLCA 1ARCA 4X1RU 5AVDA 1O2JA 3EA7A 1Z6JH 1BMLA