1VITF

Thrombin:hirudin 51-65 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
150
structure length
150
Chain Sequence
b'IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPSILON THROMBIN
molecule tags Complex (serine protease/inhibitor)
publication title Structure of a bovine thrombin-hirudin51-65 complex determined by a combination of molecular replacement and graphics. Incorporation of known structural information in molecular replacement.
pubmed doi rcsb
total genus 14
structure length 150
sequence length 150
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 1996-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vitF00
1DFPA 1O3JA 1D3TB 1DICA 1O3NA 1O2OA 3SORA 3PWBA 2W26A 4ISHH 2ZA5A 4MG3A 1E37B 1ELEE 4Z0KA 1GHXH 1Z71A 3QLPH 2GCTB 3Q00A 1HJ8A 1C5OH 3A86A 2BX4A 3F9HA 3UTUH 1TOCB 2R2WU 5K7RA 2SNVA 3A7VA 2STAE 3FZDA 1GI1A 3K9XB 1XUGA 1O37A 1SGYE 4XBCA 1KLJH 1O2WA 2NU2E 4GPGA 1TPPA 3A7WA 3M3SA 2BVRH 3QTOH 4IMQA 1NFUA 5E2PA 1K1PA 1K28D 5K0HA 2QV1A 2FX4A 1CHOG 3BTFE 1E34B 2FESH 3TPIZ 3URCA 1HNEE 1EPTB 5JB9S 5AVDA 5JBTA 4ABJA 1K2I1 4KELA 2QCYA 4HTCH 4RKJB 4YO9A 4AYYB 2UUKB 1ESAA 3I29A 1J16A 1EOLA 1W11U 5CMXH 3ZZAA 1FPCH 1MH0A 2PKAA 1E35B 3FP6E 3UREA 4U32A 6CHAC 1BIOA 3EA9A 2GVFA 2XWAA 3N7OA 4K8YA 3ELAH 3SUFA 1OWHA 4CBNA 3O8RA 3RXQA 1CE5A 1P2JA 1DS2E 2BLQA 2ZGCA 4Q7YA 3SQHE 1ELBA 5EQRA 1CHGA 2FOGA 3T2NA 3ZVDA 4ZKNU 2HALA 2FOFA 1GGDB 2BDGA 3M61U 3U69H 1UVTH 3LT3A 3RC4A 1O2PA 3URDA 3GYLB 4LK4A 3ZV9A 1QURH 1A0HB 3MNCA 1SGCA 1O2GH 3V7TA 1AFQB 1YGCH 1V6DA 1YP9A 4JCNA 1LKAA 3GCTF 1C4V2 1ZGVA 2ZHQH 5EU8A 1MBQA 1D6WA 2QAAA 4MPVA 2QXGA 1LVMA 1EZXC 1O2XA 4OS4A 4IMZA 1XXFA 1B5GH 1P8VC 1Y5BT 4ISNA 1NROH 2ANMH 1O5DH 1QBNA 1B0FA 1T31A 4DVAU 2J95A 1CT2E 3RXGA 2BD9A 1ZTLA 1HYLA 4AG1A 1WQSA 1AIXH 4AN7A 2WUBA 1UVOA 3A88A 4ZXYH 2C3SA 1DWEH 1IQFA 3RXJA 3SJ9A 2M5TA 6ESTA 1H9IE 2GT7A 3PM3A 4DT7B 4I8HA 1XUKA 2PGQB 1C1PA 1QR3E 1TX6A 2A7JA 1GGDC 1KXFA 3S9AA 4ABDA 3LONA 1A0JA 4ZHMU 1JOUB 3BTHE 1ANBA 3RXDA 1Y3YA 4XBDA 4RSPA 4H6TA 2C8WB 2ODQA 2ZPQA 4AB8A 3H5CB 1HJAC 1ELFA 4FU8A 3MWIU 5LH8A 3EDXB 2A5AA 4BOHA 4Y11E 4ABEA 4DIHH 1FQ3A 1J9CH 1WBGB 5ESTE 1SGFG 5PTPA 1BMMH 1AZZA 2AH4X 3RXAA 1NN6A 1HV7A 4J1YA 5JPMH 1O2UA 3RLYH 5LGOA 3M37A 2ANKH 3H7OA 1UTNA 1HAGE 5TCCA 2ZU3A 1PPGE 4IC6A 1W14U 3UWIA 3MU4A 1RGQA 1NRQH 3RXOA 2W3IA 4ZH8A 5JDUB 1TGTA 1A5IA 4X6OA 4AB9A 4LZ1H 2G4UA 2H9TH 2OC7A 4NFFA 5C2ZA 4MPUA 1GDNA 1H1BA 1SMFE 2O8MA 1SGRE 3KCGH 2OD3B 3L6PA 3M3TA 1XXDA 2C4FH 2GV6A 1P03A 1C2DA 1P9SA 1YC0A 4A1VA 1W2KH 4CH2B 5DO4H 5DP3A 1HJAB 2JH5D 2CF8H 4TYDA 1THPB 1ZPZA 5T6FA 3O8CA 3PWCA 8LPRA 1BTPA 3BEUA 2ZIQH 4BNRA 5EPNA 1O2TA 2G5NA 2XC4A 1VITH 4B73A 1C5UA 1XUHA 4NSVA 1GI6A 2FEQH 5LPRA 1QL9A 1DITH 4OS2A 1GBBA 1F0SA 2DUCA 2NWNA 7LPRA 1K21H 3UOUA 1C5NH 3PV4A 1QFKH 4WH6A 5G4BA 7KMEH 3S0NA 2PTNA 3ZZBA 1O5CB 3BTME 1KXAA 1BHXF 1PPCE 4RN6A 4OS7A 1BBRK 1QBVH 1C1SA 3IG6B 3W94A 1YCPH 3GCNA 4KKDA 4YOGA 1P2MA 1N6XA 2P95A 2BQWB 1GG6B 1WTHD 1LHFH 3B23B 8GCHF 1TWXB 3A89A 2PSYA 4DW2U 1EATA 4I8LA 1ZSJA 1IQEA 5A8ZA 2OCVB 3SI4H 1C2MA 1RTFB 2BY8X 7ESTE 1JMOH 4K1SA 1AE5A 2PUXB 2ZU5A 4TPIZ 1OWDA 1V2TT 2OBOA 3MO9A 3Q3XA 3MNBA 3PLBA 1L0ZA 5GIBA 1YPKH 1F0UA 2G4TA 3UNRA 1OP8A 2Z9JA 4BAQB 4ABFA 5JBBS 4CRFA 2F9NA 2VINA 4JK5A 2VIDA 1SGIB 3GY2A 6CHAB 1HAHH 2J9NA 3BEIB 4GCHF 5GJ4B 3FP7E 5AF9H 3LGTA 2BDBA 1GI2A 4FU9A 1EQ9A 1YCPM 2PKSB 3ZZ9A 1MTNB 1V2MT 1LKBA 1S82A 1SOZA 5FX5A 1LVOA 4BAKB 2FIRH 3RXRA 1UO6A 1GBIA 1FN8A 4Y0ZE 3P6ZB 1MU8B 1GL1A 3MU0A 1EKBB 1ZRBA 2TIOA 3RXBA 3TJNA 1GI8B 3GCTG 3TK6A 4UD9H 1Y59T 1CT4E 1TNLA 1GI5A 1S85A 4TPYA 4Y8XA 2PWXA 1O3BA 4DGJA 1QB6A 1GCTC 1VZQH 2ZU4A 2VH6A 5FPYA 1X7AC 2ZECA 2PUQH 2GDEH 2HLCA 3M5OA 4B74A 1HAVA 3HGPA 4GLYA 5F6MA 1HIAA 4OS1A 2IJOB 1P05A 1FXYA 1UTKA 2A5IA 1O33A 1ETTH 3U8RH 4D7FA 1GMDF 1Z1JA 4H6SB 1NO9H 4BAMB 1LDTT 5DGJA 1RTKA 1NZQH 3TNTA 1L1GA 2Y5GA 1T8MA 4FUJA 1SHYA 2FYQA 5EODA 2VWMA 4BTIB 1YPEH 3ATKA 4DURA 4Y6DA 1PQ5A 4D9RA 1BQYA 2ZNKH 1GMCF 2VU8E 3TK9A 1GVKB 3ZZ7A 4K60A 1TB6H 1BJUA 1MQ6A 1SGPE 2A4OA 2ZFSA 1ZTKA 3O8BA 1QJ6B 2CV3A 2XRCA 3TH4H 5TJXA 1P2NA 2RCEA 2BDCA 2WPIS 3CS0A 3TJUA 5C5NA 2JETB 2GCHG 4KGAA 1PPEE 2WV5A 1GJAB 2C90B 2G5VA 1HIAB 1KXDA 2GDDA 2WPLS 2GMTB 1RJXB 3MMGA 1D3DB 1WOFA 2FI3E 8KME2 4IS5A 1C5ZB 1LHDH 1T8LA 2HNTC 1QRXA 3M7QA 5T6GA 1EOJA 1Q3XA 1LTOA 3FFGA 5EQSA 1XKBC 1T8OA 2UWOA 1AWFH 3SU1A 1OP2A 1O2KA 3ODDA 4OS6A 1A4WH 1Y3UA 1Y5UT 1NFXA 2BTCE 2C93B 3LGYA 3QZRA 1ABJH 2SGEE 3SJIA 3UUZA 4AORA 5DPAA 3ZZ6A 1W7GH 1G30B 1KLTA 1P2QA 1SVPA 3KIDU 1QL8A 1RS0A 3GDUA 4FVBA 2SGDE 1SHHB 3BG4B 1MCVA 3SNEA 4BTTB 1AU8A 1TX8A 1SGFA 4Y71A 2G00A 1EAWA 3PO1C 4Y0YE 1V2LT 1SG8B 1GJBB 3I78A 3TH3H 3PMHB 1DOJA 1OXGA 3LGVA 2EI7A 1UTJA 2P59A 2FPZA 2VIWA 3UIRA 1B7XB 4I32A 2YOLA 2STBE 2F9VA 1FDPA 1P10A 4XE4A 1MTSA 5FPSA 6LPRA 2IOTA 2VH0A 2W7SA 3PMBB 1C9TA 3AW1A 2P8OC 4K1TA 3PMAB 2VB0A 2UUFB 2GTBA 1S0RA 3FZZA 1RFNA 1EB1H 1FI8A 3P8FA 1V3XA 3KF2A 2QC2A 4B76A 2BQ6B 1IAUA 2BD7A 4Y8ZA 3OYPA 4NGAH 2F83A 1NTPA 3K65B 3KQBA 1IQKA 6GCHG 1CBWB 4CRDA 1YPHE 2UWLA 4NA9H 3GY5A 1CHOF 2P94A 1C2EA 1ELDE 1NT1A 4ABAA 1GJ5H 4A1TA 1O35A 1G3BA 1M9UA 1OWKA 1JRSA 2C8XB 2FI5E 3QK1A 2P93A 3ZZ5A 3T25A 3DUXH 4HZHA 3ZYDA 2PSXA 2ZGHA 1O3MA 4GAWA 1A46H 1O2JA 1XUIA 3ATWA 3S9BA 1W10U 1CGHA 1FONA 1MD8A 4A7IB 2PKSC 2AMPA 3SI3H 1QHRB 2XBYA 1D6RA 1BTHH 2ZDVH 3MU1A 1GDQA 2THFB 3T62A 2A5KA 4OS5A 5C1UA 1EXFA 2PKAB 4U2WA 3TVJB 2BY9X 4X8TH 2CXVA 3FAOA 1AQ7A 1TBQH 5E0GA 1QTFA 4X1RU 1MZAA 3BN9A 4CRBA 1MAYA 2VIPA 4IN2A 5C5OA 1G3DA 5JBAS 1K9OE 2XC5A 4AFZA 2Y80A 2WPJS 1AVXA 3STIA 3FANA 4U01A 3DT0H 3JZ1B 2Y81A 3ZVBA 5ABWA 3VGCC 4ZROA 5C1XA 3QWCH 1C4Y2 2ANYA 1C5QA 1Y3XA 4DJZB 2H5DA 4KTSA 1HUTH 3ATIA 1ZHMA 2BD3A 3QDZB 2GD4B 1FY1A 4H42U 3BG8A 1Z1IA 4JYUH 1V2UT 3TJVA 1THRH 1NU9A 2QY0B 1O3HA 2ESTE 2PV9B 4BXSA 1V2KT 3RMMH 1WUNH 3ZVCA 1CT0E 3ENSB 2BVSH 3CP7A 5B6OA 2BQ7B 2P8OB 2ZP0H 1GJ6A 1GMDG 1JWTA 1G3EA 1PQ7A 2WYJA 2AFQB 2BXTH 1O3EA 1HAPH 1FV9A 1SBWA 1TPAE 1SGEE 4X6MA 4X2VA 1MZDA 4FXGH 4IN1A 3UQOA 3A84A 3P17H 4ZHLU 1ZSLA 2A4RA 1ARBA 4CRGA 1ELGA 3ZZ4A 5HM2A 2GZ7A 2UWPA 4KTCA 3UNSA 1GJ9B 2BD4A 3VGCB 1XVOA 5LPEA 4CRAA 2TRMA 2ZGJA 3NKKA 2O9QA 4YESB 1G36A 3SJKA 4CBOA 3EAJA 3E90B 4UFFH 1O3IA 1ELVA 1ZGIA 2HOBA 4SGBE 2CGAA 2FS9A 3SU0A 1O3AA 1HB0B 2ODYB 1PYTD 2O8UA 3ODFA 3BTKE 3V0XA 4NSYA 3BIVH 1VCQA 3HK6B 4AFSA 1L4ZA 1MKWH 2RDLA 2ZGXH 2Q6DA 1O2VA 1ESTA 3D49H 1ZOMA 2XTTB 2ZHWH 1K1OA 4X1PU 1ELCA 3E16B 1V2NT 2G51A 4FUHA 2D8WA 3E6PH 4ZXXH 1EX3A 3VXEH 1TIOA 2TGDA 1LVYA 1PQAA 2H5CA 3LJOA 3M36A 2QF3A 2ZDNA 4TWYA 5DP6A 3SV9A 5LPFA 1CU1A 3B9FH 4NWLA 4FUCA 3LOXA 1MTUA 3SU5A 1GJCB 2GZ9A 3F9FA 1HDTH 3D65E 1GJ8B 1L1JA 3QGJA 1DLKB 1O3LA 4GCHG 1AFQC 2OQUA 4A92A 1LMWB 4IW4E 1C2IA 3EA7A 2F91A 1UCYK 1SB1H 1F92A 3TLOA 2VWNA 1GHAF 5HXFA 2H9HA 4MNXA 1AVGH 2Z9GA 4Z6AH 1QQUA 3E8LA 4ISOA 3PTBA 3TITA 3BTEE 4F4OC 1ZPBA 3T28A 2HNTF 5A0AE 2ZFPH 2XXLA 7GCHG 2B0FA 5DG6A 3ITIA 3L33A 3RXPA 2ODPA 1LQEA 2OXSA 3SGBE 3EQ0H 1C1OA 4LZ4B 3SJOA 2FOBA 1P0SH 1TABE 1V2VT 3A7TA 5L2YH 4MNWA 4FUFA 2HPQH 3T26A 3EYDA 1BRUP 1ACBE 1GI4A 1FNIA 2ZQ2A 3ZZ3A 5DP8A 4D8NA 1C2JA 1TMTH 1ORFA 1OWEA 1HGTH 3MTYA 3Q76A 2NU1E 3A83A 1LQDB 4NIYA 4IC5A 4RKOB 1SOTA 1GMHG 5A0BA 2IPHA 2BHGA 1B0EA 2J92A 3GISB 2LPRA 2GCTC 1NM6A 4B2AA 1IQGA 1TRMA 2XNIA 4OGXA 5JB8S 2GV7A 2OC1A 3GICB 1N6YA 5AFYH 3TIUA 5FPTA 1A7SA 2V35A 3BTQE 1FIWA 1ANDA 3E0NB 1YLDA 2FO9A 3RXFA 1HRTH 3OX7U 1GHBG 1MTWA 1YPMH 2WPMS 4ESTE 1XM1A 1EPTC 3SUEA 1TFXA 1KIGH 5IYTA 4VGCB 2O8LA 2JETC 1GHAG 2XBXA 1TMBH 4K3JA 2BY6X 1BTXA 1KYNA 1O38A 1DX5M 1TBRH 1QBOA 1KXBA 1O2SA 2ZDAH 1TLDA 2FOMB 3MNSA 3QTVH 3U98H 2QN5T 2F9UA 2QYIA 1O3CA 1CBWC 2ZQ1A 2OLGA 1GMCG 1Y3VA 3UOPA 1BUIA 3H7TA 1GI0A 3GCOA 4NG9H 2RA3A 2ZWLH 4HGCA 1GJDB 1A5GH 3M7UA 1O2ZA 1H9LB 1O5EH 1A3BH 3MYWA 1L2EA 2B5TB 2O8TA 3U1IB 3SV6A 2BLWA 1G3CA 2NU4E 1OOKB 1C5PA 1WV7H 1WSSH 1PPZA 4ISIH 1HFDA 1Y5AT 3HATH 3F1SB 4FVDA 2BOKA 1FUJA 4FUGA 4UE7H 1S5SA 3LGWA 1J8AA 3K2UA 5GCHF 2GCHF 1IOEA 1XUJA 2JKHA 1MD7A 2ZG0H 2R0KA 1G37A 2V3OH 1ZPCA 4U30A 4WJG2 5JYIA 3VPKA 3ZZDA 3TU7H 1C5SA 4O03A 2Y6TA 1Z8IB 1SPJA 1J17T 3BIUH 1GBDA 3LDXH 5HYOA 1NRRH 1WQVH 1GBFA 1TE0A 4JZEH 1OP0A 3BG4C 2GKVE 2A0QB 4AYVB 1TRYA 3E91A 1DXPA 1RTLA 3RMNH 4X1SU 4AOQA 1DWCH 1V2PT 1JIRA 2FLBH 1TNKA 5L2ZH 1UTOA 2VIVA 3LIWA 2BZAA 1EUFA 3LPRA 1O30A 2VGCB 2ZZUH 1P09A 1GCTB 2H6MA 1AUJA 1GWAA 1ANCA 1PPHE 3F9GA 1CA0C 1O36A 4MQAA 5A2MH 1NFWA 2A1DB 3RU4D 4B1TA 1V2RT 4E06H 1OSSA 1BJVA 3MNXA 5I25A 1YKTA 1OPHB 1C5VA 3CENA 4MTBA 1P3CA 2R9PA 1O3OA 4WMEA 1Z8GA 2W7UA 1AZ8A 2ZEBA 2ZFTA 2ULLA 2CN0H 4GHQA 1O5AB 5GWZA 1P57B 1LVBA 4JMYA 3RDZA 4M7GA 1QB9A 1UTMA 3HPTB 3G01A 1TNIA 3QUMP 3OTJE 3P95A 1YPGH 1CQQA 2EI6A 5C1YA 4WMFA 1GI3A 3A8BA 4IBLH 2V6NA 1BBRE 4ZKSU 2J4IA 4I7YH 1ZSKA 5C67A 1TGCA 1WTGH 1P06A 3RXCA 2DE9A 1HAVB 1T7CA 2B9LA 4KP0A 5AFZH 2ZTYA 3VB7A 2QA9E 2XYAA 2ZGBH 1NS3A 1SLUB 4OGYA 1KDQA 1Y3WA 2OTVA 5EW1H 1N8OC 4A6LA 3OSYA 3PLKA 2HPPH 4FU7A 4MPXA 3UWJH 1TMUH 1PQ8A 4CRCA 1MTNC 4MNVA 1P9UA 3GY7A 1FAXA 4AFQA 2GMTC 5ETXA 1BRAA 1MU6B 3SU3A 2PTCE 4NIWA 1UCYE 1PYTC 1HLTH 3LKWA 3RXLA 1LPKB 1QRWA 1KSNA 3QO6A 1GG6C 1BOQA 1DE7H 2WUCA 4INHA 1BT7A 3R0FA 1PPBH 2ZHDA 3EGKH 2BM2A 3A80A 3P70B 3P8OA 5GPIB 1DY9A 1LPZB 2WINI 1DUEA 3A8CA 4ZKOU 6GCHF 1AKSB 1S6HA 2NU0E 4JYVH 1SI5H 3C1KA 2TPIZ 3MH5A 2WPHS 1HAZB 4CHAC 1DM4B 1XKAC 2EC9H 1MKWK 4ASHA 3F68H 3PYHA 4UONA 5C3NA 2BDHA 1W3CA 1C2GA 1SL3A 1TNGA 1A1RA 3MH6A 4Q2KA 2Q1JA 1F5LA 3SV7A 4K69A 2YNAA 2TGAA 1TRNA 1SSXA 3SZNA 1QA0A 5EXLA 3HKJB 4O9VA 1UK4A 1MKXK 3F9EA 1LHEH 1SR5C 1TPSA 1ZJKA 4INKA 5TCAA 1AHTH 3ATMA 4X8SH 1N1LA 1AB9C 1EB2A 1QB1A 1TNJA 3C27B 3A8AA 3MI4A 1GHVH 2FOHA 1XUFA 1V2ST 3TNSA 2GX4A 2I6QA 1Z6JH 1U6QA 1VJ9U 4FUIA 2R3UA 2SFAA 3OU0A 4XBBA 2FXRA 3DD2H 1W0ZU 1ZZZA 1C4U2 4NIXA 1VR1H 3EA8A 3SU4A 2P16A 5EG4A 5HGGA 5SGAE 2Z9IA 4FUDA 4QT8C 1C5MD 1CSOE 1O3GA 2KAIB 3E1XB 3T5FH 4K5ZA 1S6FA 3MO3A 2UUJB 3RU4T 2Y82A 1XVMA 2B7DH 2GT8A 3F6UH 4YLQH 2FS8A 2ZFFH 1F5KU 3NWUA 2RA0A 1OS8A 4Q7ZA 4B71A 5A8XA 5EPYA 4CR5A 1AB9B 3HK3B 2W3KA 2QF0A 3NUMA 3RXHA 2F9OA 3MFJA 4TWWA 2FTMA 2ZC9H 1JRTA 3AAVA 3KQDA 1UHBA 1V2JT 5F8TA 5JBCS 2TBSA 3AW0A 1O2LA 3TGKE 1HJ9A 1C9PA 3RMOH 3GDVA 3LH3A 1LPGB 2ASUB 3K6ZA 5F8XA 3U1JB 3VXFH 2JH0D 1J15A 1JXPA 1QJ1B 4ZAEA 1EZSC 1BTZA 2HWLB 1PFXC 1MKXH 2ZO3H 1ZLRA 1P12E 1O32A 5HMAA 4CHAB 1D4PB 1O2NA 4UFEH 4WWYA 3PLPA 3RXTA 4B2CA 1O2YA 1TPOA 1HAXB 1DPOA 1TNHA 3SGQE 2Z3DA 1CO7E 1Z8JB 2SGFE 1LO6A 1FN6A 1ZR0A 3GDSA 1UTQA 2F3CE 1WYKA 2VWLA 2F9PA 2CF9H 2QXHA 4TY6A 3PMJA 3VB6A 1GBJA 4DY7B 3RUOA 4DG4A 2VWOA 4R0IA 1AO5A 1MQ5A 1C5XB 4YTAA 1ZHRA 2R2MB 1NU7B 3IITA 1BBRH 1GBTA 4ZMAH 4F49A 3T29A 1C5WB 2FYRA 1P11E 5BRRE 5DP9A 2A4GA 5A8YA 2TGPZ 1ELAA 1BTYA 5F03A 3WY8A 2EA3A 3BTTE 2ZCKP 5F8ZA 1Z8RA 3VB3A 1DT2A 3MHWU 1H9HE 1KTTB 1DWBH 1C1MA 1GBHA 2J34A 1K1MA 1O5BB 1OX1A 2XCNA 4ISLA 1O2RA 3NPSA 3M5NA 5GXPA 1PJPA 2VJ1A 5DJ7A 1XMNB 3D23A 2VVUA 1NRPH 4BAHB 3A7YA 3AVZA 3QN7A 2PFEA 4I33A 4BTUB 3RXSA 4FUEA 2A7HA 5BPEA 1GI9B 4I31A 1SQTA 1E36B 1NFYA 4AX9H 2ZU2A 2Y5FA 3JZ2B 1Z7KA 2FOCA 1CGIE 2CMYA 3RMLH 1CVWH 3P8GA 2A2QH 2QXJA 2Z9LA 1GBMA 3GYMA 5IDKA 1NRNH 4X8UH 3RXEA 4K8BA 2A7CA 2BD5A 1FLEE 3SUGA 3A8DA 1QQ4A 3U8TH 1FY3A 2D26C 4JZDH 1C1WH 4R8TB 1AWHB 1BB0B 3BSQA 5H4IB 4CR9A 3LC5A 1D3PB 2H9EH 2Z9KA 4B75A 1AMHA 2ZCHP 1UVSH 3KQCA 2ZDMA 1O2MA 3V3MA 3UY9A 3Q3KA 1HAOH 3S7KB 4JZFH 1RD3B 2WV4A 4O3UA 3SNBA 1HBTH 1C2HA 5FXLA 2BLVA 1F2SE 2XBVA 4NZLA 4UFDH 2AIQA 4LXBH 2IN2A 3SQEE 3RP2A 3DA9B 2OBQA 3M3VA 2FM2A 3SW2B 1TA2A 2TGTA 1LCYA 1W12U 1H4WA 1TALA 4O97A 3UNQA 2K1QA 2B8OH 2G55A 4Y10E 4LOYH 1IQMA 4WY3A 1VITG 3FP8E 1ZMJA 5DP7A 4WXVA 2BY7X 1H8DH 4WH8A 2J94A 1WCZA 3A87A 3RXMA 1C5YB 5CHAC 4X2WA 3HKIB 1TAWA 2BLOA 3U9AH 3Q3YA 4A1XA 3KL6A 2ZHFH 1GHWH 9LPRA 5T6DA 1UVPA 1S81A 2J2UA 1NPMA 1AVWA 1C1VH 4IGDA 1CA0B 1V2WT 1AI8H 1UJ1A 1TBZH 4INLA 4O3TA 4D76A 4ZKRU 1C2LA 8ESTE 1O0DH 2AEIH 1IQLA 1HAYB 3ZVFA 5L6NH 1EP6A 4JZ1A 1C5TA 1NY22 2PW8H 1O5FH 1AN1E 1GJ7B 1ELTA 3S9CA 1YLCA 3ATLA 3NCLA 1SLWB 2FDAA 3RM0H 1JBUH 5EXNA 1FPHH 1PPFE 2P3TB 4UFGH 2BDAA 3MU5A 4GUXA 2OUAA 1SQOA 3ZVAA 4HFPB 2ZF0H 1NESE 2FOEA 5L30H 2BB4A 4ABIA 4NA7A 3M5MA 1TQ7B 2BY5X 1EAUA 2BOHB 4VGCC 3OY6U 5GCHG 1G2MA 4WF8A 1O5GH 1GHBF 1FIZA 3NZIA 1SQAA 5FCRA 4Y76A 3RXIA 1G9IE 2PLXA 1ETSH 5DP5A 2ZFQH 3TGIE 1GVLA 4NIVA 1C1QA 1YM0A 4Y7AA 3M35A 4ABGA 3DFLA 1BZXE 3BTWE 1S83A 2P3FH 2WPKS 4Q7XA 1IHSH 1C1UH 3Q77A 4ABHA 5DK1A 4WMDA 4NZQA 1QY6A 1S84A 2C8ZB 5FX6A 4UDWH 3ZVEA 4GHTA 2QXIA 1SLVB 5FBIA 1RIWB 4X1NU 3BV9B 3SU6A 2A4QA 1L4DA 1DSUA 2F9BH 3QZQA 5A09A 2BD8A 4H4FA 1P2OA 4NCYA 1F7ZA 3VEQB 2VVCA 1QCPA 5J4SA 2HGTH 3A7XA 5DKMA 1GBKA 3VB5A 1MAXA 5A0CA 4UEHH 3E3TA 5AHGH 3ESTA 5CHAB 3RXKA 2BZ6H 2PHBA 2XWBI 2P3UB 2AYWA 1SFQB 3LGIA 9ESTA 1UTPA 2GZ8A 1C5LH 1HAIH 4WXIA 1ZYOA 1O3FA 1O3DA 1D3QB 1WU1A 2D2DA 4X6PA 1BITA 1XX9A 2YNBA 1K1IA 1VCWA 5CE1A 4TY7A 4CREA 4JZIA 3TGJE 1VGCC 1NRSH 3E0PB 1AUTC 1BTUA 3UFAA 3GCHB 1SLXB 2DE8A 4NFEA 1SGDE 4X2YA 2PR3A 1RRKA 1L1NA 3RXVA 2AMQA 1GI7B 2O8WA 1AD8H 2SGPE 3PB1E 1MMJN 2D1JA 2Y5HA 2VVVA 5E2OA 2ZI2H 1AE8H 4E7RG 1DDJA 5E0JA 1TYNA 3BEFB 1EPTA 5FHTA 2Q6FA 1W7XH 1GBEA 8GCHG 2EI8A 2AGIX 1OKXA 1MBMA 1O31A 1DSTA 5FBEA 2I6SA 3DHKH 2SGQE 4NWKA 4Y7BA 4X8VH 1TGSZ 2EEKA 2H2ZA 3SO3A 4FUBA 3V12A 2C8YB 3KEEA 2Z94A 3ZVGA 1GBCA 1T8NA 3GY6A 3CS7A 2OP9A 4E05H 1A0LA 1P02A 1EJNA 2KAIA 3SGAE 3QGNB 3SNCA 1BA8B 2FWWA 2ZU1A 1IQNA 1KLIH 3P92A 1C2FA 2BYAX 1ZRKA 1MTVA 1EZQA 3SV8A 3GCHC 2A45B 1UK2A 1FZZA 3TH2H 3V13A 2FLRH 3BTGE 4XDEA 4AG2A 4XOJA 1ZMLA 2SGAA 2BDYA 3MU8A 3SBKA 3LH1A 1KXCA 1YBWA 2BMGB 4YLUA 4ABBA 4DOQA 2FMJA 4MDSA 2XCFA 1P2KA 1E38B 2W5EA 2VIQA 2OC8A 3L3TA 2ZFRH 1YF4A 2HNTE 4K2YA 2R3YA 1QJ7B 1EAXA 1ZHPA 4D9QA 3MH7A 3VFEA 3AAUA 1G32B 2ZHEH 1BCUH 3MOCA 2A31A 2Z3CA 2CJIA 4Y8YA 3KN2A 4MNYA 1BRBE 3ZYEA 4X6NA 2ZPSA 5EGMA 3RC5A 4AZ2B 2VIOA 5EOKA 1GBLA 2GP9B 1TGNA 1O2HA 1VGCB 4AGJA 2R0LA 3UQVA 3SJ8A 2BX3A 2CHAC 1F0TA 1DUAA 1ABIH 1ESBA 2Z7FE 1TX7A 1P04A 1IQIA 2OQ5A 4ZUHA 1Q2WA 3UPEA 1EASA 2NU3E 1H8IH 1EJMA 1K1LA 1DXWA 2RG3A 4GSOA 2ZDLA 3ZZ8A 4JK6A 4MVNA 2ZCLP 1SC8U 5FAHA 1TOMH 1NC6A 2G52A 1GHYH 1QGFA 5FCKA 1GL0E 5ESBA 3GY3A 1OYQA 3OY5U 1HCGA 3R3GB 1EZUC 1V2QT 3K6YA 1A5HA 3KHVA 1K22H 3EE0B 1YPJH 4YT7H 1C1RA 3SHCH 3SN8A 1ZTJA 4YOJA 1FY4A 2FTLE 2A2XH 2FX6A 3PTNA 4XFQA 3SU2A 1AKSA 1UCYH 1AY6H 1BMAA 2A32A 1YCPK 3MO6A 1HXFH 3GY8A 1FMGA 4DCDA 2ZDKA 4JYTA 5E0HA 1EP5A 2ALVA 3RU4E 1GPZA 1HPGA 1P2IA 1SFIA 1A2CH 1J14A 1EJAA 4X1QU 1GHZA 1IHTH 1W8BH 1F5RA 1AGJA 3RC6A 4ZHAA 1CA8B 1T4UH 2FODA 3A82A 1MUEB 2AGGX 3SHAH 2JH6D 1FY5A 3M7TA 3M5LA 2ZTZA 2VNTA 1ETRH 4XSKU 1AFEH 1P3EA 3KGPA 3ZZCA 1TQ0B 1SGNE 4Q80A 1UMAH 4D7GA 1SGQE 1IQJA 1Z6EA 3D62A 2FI4E 2Y7ZA 3LU9B 4AFUA 4I8GA 4YOIA 2Q6GA 1ID5H 3SOSA 1KDQB 2BVXH 1KY9A 5EW2H 1DY8A 1C5RA 1MCTA 1C1NA 2ZKSA 2BD2A 3TK5A 2HRVA 3LC3A 2UUYA 2ZTXA 2ZPRA 1P01A 3S7HB 2FP7B 1O34A 5GDSH 1TONA 3P8NA 1GMHF 1QNJA 2FOAA 1QIXB 1W13U 1UVUH 3U8OH 1O3KA 1BTWA 1DLEA 1K1NA 1BRCE 1CGJE 4MPWA 1ZJDA 1OWJA 1V2OT 1K1JA 2AIPA 4E7NA 1C2KA 3LGUA 4YT6H 1YPLH 2QGRA 1INCA 1ANEA 3BF6H 1FY8E 1LHCH 2HVXA 1SGTA 5J4QA 4THNH 2ANWA 3TJOA 3O8DA 1RIWC 1W0YH 1TGBA 4YZUA 1FAKH 3KQEA 4BANB 1T4VH 4GVUA 2LNCA 4YM9A 1GVZA 2XBWA 1GCDA 1BMLA 1O39A 3GOVB 3SV2H 2XW9A 1Y8TA 1N8OB 4A5TS 1KTSB 3A85A 1EAIA 1D9IA 2ALPA 1IQHA 2V0BA 5E8EH 5T3HA 3HGNA 1VJAU 1TA6A 3BTDE 1QA7A 3I77A 4SGAE 1LHGH 3LJJA 2AMDA 1A61H 3NXPA 2ILNA 2Z6BD 4K1EA 2AGEX 1UHBB 3MH4A 3ZV8A 1WAYB 1O2QA 3IWMA 1E0FD 2GGVB 1F0RA 3VB4A 1BMNH 1QL7A 4I8JA 4CH8B 1UTLM 3UR9A 2FZZA 3SNDA 1O2IA 3SNAA 3S69A 5EQQA 2Y7XA 2H1UA 1VITF 1GBAA 3AASA 1A3EH 5HM9A 1Q31A 1BDAA 3T27A 1UK3A 5DP4A 1GJ4H 4B2BA 2VGCC 2OC0A 2BDIA 1JIMA 3A7ZA 1O3PB 1FJSA 2SNWA 4BAOB 4AGKA 4MLFB 4WVPE 2J38A 3RXUA 2BXUH 2AERH 3PROA 2QIQA 4HI3A 3KNXA 3GY4A 1ARCA 4BXWA 2AS9A 2CHAB 3SUDA 2V3HH 2G8TA 1G2LA 3PO1B 4Y79A 1C1TA 1YPHC 2PGBB 1GDUA 3QX5H 4X0WU 2Z3EA 1T32A 3A81A 2XC0A 3NK8A 1HXEH 1VCPA 2WYGA 1KXEA 4DIIH 4PROA 4X2XA 1THSH 4J2YB 1RXPA 4KTUA 1QRZA 3RM2H 1BHXB 3B8JA 2G81E 3W95A 1DANH 3DFJA 5EXMA 1S0QA 7GCHF 3UR6A 5C20A 1DWDH 5I46H 3RLWH 1OWIA 3FVFB 1YYY1 1DVAH 1OYTH 4I8KA 3STJA 2OINA 4NA8A 1ZMNA
chains in the Genus database with same CATH superfamily
1DFPA 1O3JA 1D3TB 1DICA 1O3NA 1O2OA 3SORA 3PWBA 2W26A 4ISHH 2ZA5A 4MG3A 1E37B 1ELEE 4Z0KA 1GHXH 1Z71A 3QLPH 2GCTB 3Q00A 1HJ8A 1C5OH 3A86A 2BX4A 3F9HA 3UTUH 1TOCB 2R2WU 5K7RA 2SNVA 3A7VA 2STAE 3FZDA 1GI1A 3K9XB 1XUGA 1O37A 1SGYE 2OK5A 4XBCA 1KLJH 1O2WA 2NU2E 5KEDA 4GPGA 5EJZA 1TPPA 3A7WA 3M3SA 2BVRH 3QTOH 4IMQA 1NFUA 5E2PA 1K1PA 1K28D 5K0HA 5C17A 2QV1A 2FX4A 1CHOG 3BTFE 1E34B 2FESH 3TPIZ 2F4LA 1HNEE 3URCA 1EPTB 5JB9S 5AVDA 5JBTA 4ABJA 1K2I1 4KELA 2QCYA 4HTCH 4RKJB 4YO9A 4AYYB 2UUKB 3F0OA 1ESAA 3DSGA 3I29A 1J16A 1EOLA 1W11U 5CMXH 3ZZAA 1FPCH 1MH0A 2JIZD 1E35B 2PKAA 3FP6E 3UREA 4U32A 6CHAC 1BIOA 3EA9A 2GVFA 2XWAA 3N7OA 4K8YA 2YMSD 3ELAH 3SUFA 1OWHA 4CBNA 3O8RA 3RXQA 1CE5A 1P2JA 1DS2E 2BLQA 2ZGCA 4Q7YA 3SQHE 1ELBA 5EQRA 1CHGA 2FOGA 2KR7A 3T2NA 3ZVDA 4ZKNU 2HALA 2FOFA 1GGDB 2BDGA 3M61U 3U69H 1UVTH 3LT3A 3RC4A 1O2PA 3URDA 3GYLB 4LK4A 3ZV9A 1QURH 1A0HB 3MNCA 1SGCA 1O2GH 1OHHD 3V7TA 3N99A 1AFQB 1YGCH 1V6DA 1YP9A 4JCNA 1LKAA 3GCTF 1C4V2 1ZGVA 2ZHQH 2KCAA 5EU8A 1MBQA 1D6WA 2QAAA 4MPVA 2QXGA 1LVMA 1EZXC 1O2XA 4OS4A 4IMZA 1XXFA 1B5GH 1P8VC 1Y5BT 4ISNA 1NROH 2ANMH 1O5DH 1QBNA 1B0FA 1T31A 4DVAU 2J95A 1CT2E 3RXGA 2BD9A 1ZTLA 1HYLA 4AG1A 1WQSA 1AIXH 4AN7A 2WUBA 1UVOA 3A88A 4ZXYH 2C3SA 1DWEH 1IQFA 3RXJA 3SJ9A 2M5TA 6ESTA 1H9IE 2GT7A 3PM3A 4DT7B 4I8HA 1XUKA 2PGQB 1C1PA 1QR3E 1TX6A 2A7JA 1GGDC 1KXFA 1WDIA 3S9AA 4ABDA 3LONA 1A0JA 4ZHMU 1JOUB 3BTHE 1ANBA 3RXDA 1Y3YA 4XBDA 4RSPA 4H6TA 2C8WB 2ODQA 2ZPQA 2WPDD 4AB8A 3H5CB 1HJAC 1ELFA 2J5UA 4FU8A 3MWIU 5LH8A 3EDXB 2A5AA 4BOHA 4Y11E 4ABEA 4DIHH 1FQ3A 1J9CH 1WBGB 5ESTE 1SGFG 5PTPA 1BMMH 1AZZA 2AH4X 3VG8A 3RXAA 1NN6A 1HV7A 4J1YA 5JPMH 1O2UA 3RLYH 5LGOA 3M37A 2ANKH 3H7OA 1UTNA 1HAGE 1YWUA 5TCCA 2ZU3A 1PPGE 4IC6A 1W14U 3UWIA 3MU4A 1RGQA 1NRQH 3RXOA 2W3IA 4ZH8A 5JDUB 3UAIC 1TGTA 1A5IA 4X6OA 4AB9A 4LZ1H 2G4UA 2H9TH 2OC7A 4NFFA 5C2ZA 4MPUA 1GDNA 1H1BA 1SMFE 2O8MA 1SGRE 3KCGH 5DN6D 2OD3B 3L6PA 3M3TA 1XXDA 2C4FH 2GV6A 1P03A 1C2DA 1P9SA 1YC0A 4A1VA 1W2KH 4CH2B 3KYGA 3UB0A 5DO4H 5DP3A 1HJAB 2JH5D 2CF8H 4TYDA 1THPB 1ZPZA 5T6FA 3O8CA 3PWCA 8LPRA 1BTPA 3BEUA 2ZIQH 4BNRA 5EPNA 1O2TA 2G5NA 2XC4A 1VITH 4B73A 1C5UA 1XUHA 4NSVA 1GI6A 2FEQH 5LPRA 1QL9A 1DITH 4OS2A 3PRBA 1GBBA 1F0SA 3F0PA 2DUCA 2NWNA 7LPRA 1K21H 3UOUA 1C5NH 3PV4A 1QFKH 4WH6A 5G4BA 7KMEH 3S0NA 2PTNA 4ASUD 3ZZBA 1O5CB 3BTME 1KXAA 1BHXF 1PPCE 4RN6A 4OS7A 1BBRK 1QBVH 1C1SA 3IG6B 3W94A 1YCPH 3GCNA 4KKDA 4YOGA 1P2MA 1N6XA 2P95A 2BQWB 1GG6B 1WTHD 5IK2D 1LHFH 3B23B 8GCHF 1TWXB 3A89A 2PSYA 4DW2U 1EATA 4I8LA 1ZSJA 1IQEA 5A8ZA 2OCVB 3SI4H 1C2MA 1RTFB 2BY8X 7ESTE 1JMOH 4K1SA 1AE5A 2PUXB 2ZU5A 4TPIZ 1OWDA 2OBOA 1V2TT 3MO9A 3Q3XA 2EQNA 2J98B 3OFND 3MNBA 3PLBA 1L0ZA 5GIBA 1YPKH 1F0UA 2G4TA 3UNRA 1OP8A 2Z9JA 4BAQB 3FOAA 4ABFA 5JBBS 4CRFA 2F9NA 2VINA 4JK5A 2VIDA 1SGIB 3GY2A 6CHAB 1HAHH 2J9NA 3BEIB 4GCHF 5GJ4B 3FP7E 5AF9H 3LGTA 2BDBA 1GI2A 4FU9A 1EQ9A 1YCPM 2PKSB 3ZZ9A 1MTNB 1V2MT 1LKBA 1S82A 1SOZA 4Q4LA 2IPQX 5FX5A 1LVOA 4BAKB 2FIRH 3RXRA 1UO6A 1GBIA 1FN8A 4Y0ZE 3P6ZB 1MU8B 1GL1A 3MU0A 1EKBB 1ZRBA 2TIOA 3RXBA 3TJNA 1GI8B 3GCTG 3TK6A 4UD9H 1Y59T 1CT4E 1TNLA 1GI5A 1S85A 4TPYA 4Y8XA 2PWXA 1O3BA 4DGJA 1QB6A 1GCTC 1VZQH 2ZU4A 2VH6A 5FPYA 1X7AC 2ZECA 2PUQH 2GDEH 2HLCA 3M5OA 4B74A 3OAAD 1HAVA 1COWD 3HGPA 4GLYA 5F6MA 1HIAA 4OS1A 2IJOB 1P05A 1FXYA 1UTKA 2A5IA 1O33A 1ETTH 3U8RH 4D7FA 1GMDF 1Z1JA 4H6SB 1NO9H 4BAMB 1LDTT 5DGJA 1RTKA 1NZQH 3TNTA 1L1GA 2Y5GA 1T8MA 4FUJA 1SHYA 2FYQA 5EODA 2VWMA 4BTIB 1YPEH 3ATKA 4DURA 1YY3A 4Y6DA 1PQ5A 5FL7D 4D9RA 1NBME 1BQYA 3W1EA 2ZNKH 1GMCF 2VU8E 3TK9A 1GVKB 3ZZ7A 4K60A 1TB6H 1BJUA 1MQ6A 1SGPE 2A4OA 2ZFSA 1ZTKA 3O8BA 1QJ6B 2CV3A 2XRCA 3TH4H 5TJXA 1P2NA 2RCEA 2BDCA 2WPIS 3CS0A 3TJUA 5C5NA 2JETB 2GCHG 4KGAA 1PPEE 2WV5A 1GJAB 2W6ID 2C90B 3F3BA 2G5VA 1HIAB 1KXDA 2GDDA 2WPLS 2GMTB 1RJXB 3MMGA 1D3DB 4B6FA 1WOFA 2FI3E 8KME2 4IS5A 1C5ZB 1LHDH 4OM9A 1T8LA 2HNTC 1QRXA 3M7QA 5T6GA 1EOJA 1Q3XA 1LTOA 3FFGA 5EQSA 1XKBC 1T8OA 2UWOA 4M9FA 2JJ1D 1AWFH 3SU1A 3KYFA 1OP2A 1O2KA 3ODDA 4OS6A 1A4WH 1Y3UA 1Y5UT 1NFXA 2BTCE 2C93B 3LGYA 3QZRA 1ABJH 2SGEE 3SJIA 3UUZA 4AORA 5DPAA 3ZZ6A 1W7GH 1G30B 1KLTA 1P2QA 1SVPA 3KIDU 1QL8A 1RS0A 3GDUA 4FVBA 2SGDE 1SHHB 3BG4B 1MCVA 3SNEA 4BTTB 1AU8A 1VKYA 1TX8A 1SGFA 2V7QD 4Y71A 2G00A 1EAWA 3PO1C 4Y0YE 1V2LT 1SG8B 1GJBB 2M2AA 3I78A 3TH3H 3PMHB 1DOJA 1OXGA 3LGVA 2EI7A 1UTJA 2P59A 2FPZA 2VIWA 3UIRA 1B7XB 4I32A 2YOLA 2STBE 3KQ5A 2F9VA 1FDPA 1P10A 4XE4A 1MTSA 5FPSA 5EJ1A 6LPRA 2IOTA 2VH0A 2W7SA 3PMBB 1C9TA 2YMSC 3AW1A 2P8OC 4K1TA 3PMAB 2VB0A 2UUFB 2GTBA 1S0RA 3FZZA 1RFNA 1EB1H 1FI8A 3P8FA 1V3XA 3KF2A 2QC2A 4B76A 2BQ6B 1IAUA 2BD7A 4FETA 4Y8ZA 3OYPA 4NGAH 2F83A 1NTPA 3K65B 3KQBA 1IQKA 6GCHG 1CBWB 4CRDA 1YPHE 2LELA 2UWLA 4NA9H 3GY5A 1CHOF 2P94A 1C2EA 1ELDE 1NT1A 4ABAA 1GJ5H 4A1TA 1O35A 1G3BA 1M9UA 1OWKA 1JRSA 2C8XB 2FI5E 3QK1A 2P93A 3ZZ5A 3T25A 3DUXH 4HZHA 3ZYDA 2PSXA 2ZGHA 1O3MA 4GAWA 1A46H 1O2JA 1XUIA 3ATWA 3S9BA 1W10U 1CGHA 1FONA 1MD8A 4A7IB 2PKSC 2AMPA 3SI3H 1QHRB 2XBYA 1D6RA 1BTHH 2ZDVH 3MU1A 1GDQA 2THFB 3T62A 2A5KA 2QF4A 4OS5A 5C1UA 1EXFA 2PKAB 4U2WA 3TVJB 2BY9X 4X8TH 2CXVA 3FAOA 1AQ7A 1TBQH 5E0GA 1QTFA 4X1RU 1MZAA 3BN9A 4CRBA 1MAYA 2VIPA 4IN2A 5C5OA 1G3DA 5JBAS 1K9OE 2XC5A 4AFZA 2Y80A 2WPJS 1AVXA 3STIA 3FANA 4U01A 3DT0H 3JZ1B 2Y81A 3ZVBA 5ABWA 3VGCC 4ZROA 5C1XA 3QWCH 1C4Y2 2ANYA 1C5QA 1Y3XA 4DJZB 2H5DA 4KTSA 1HUTH 3ATIA 1ZHMA 2BD3A 3QDZB 1SKYE 2GD4B 1FY1A 4H42U 5B6LA 3BG8A 1Z1IA 4JYUH 1V2UT 3TJVA 1THRH 1NU9A 2QY0B 1O3HA 2ESTE 2PV9B 4BXSA 1V2KT 3RMMH 1WUNH 3ZVCA 1CT0E 3ENSB 2BVSH 3CP7A 5B6OA 2BQ7B 2P8OB 2ZP0H 1GJ6A 1GMDG 1JWTA 4TSFD 1G3EA 1PQ7A 2WYJA 2AFQB 2BXTH 1O3EA 1HAPH 1FV9A 1SBWA 1TPAE 1SGEE 4X6MA 4X2VA 1MZDA 4FXGH 4IN1A 3UQOA 1QZ8A 3A84A 3P17H 4ZHLU 1ZSLA 2A4RA 3OEHD 5DSFA 1ARBA 4CRGA 1ELGA 3ZZ4A 5HM2A 2GZ7A 2UWPA 4KTCA 3UNSA 1GJ9B 2BD4A 3VGCB 1XVOA 5LPEA 4CRAA 2TRMA 2ZGJA 3NKKA 2O9QA 4YESB 1G36A 3SJKA 4CBOA 3EAJA 3E90B 4UFFH 4F55A 1O3IA 1ELVA 1ZGIA 2HOBA 4SGBE 2CGAA 2FS9A 3SU0A 1O3AA 1HB0B 2ODYB 1PYTD 2O8UA 3ODFA 2KX4A 3BTKE 3V0XA 4NSYA 3BIVH 1VCQA 3HK6B 4AFSA 1L4ZA 1MKWH 2RDLA 2ZGXH 2Q6DA 1O2VA 1ESTA 3D49H 1ZOMA 2XTTB 2ZHWH 1K1OA 4X1PU 1ELCA 1BMFD 1V2NT 3E16B 2G51A 5HIZA 4FUHA 2D8WA 3E6PH 2WHXA 4ZXXH 1EX3A 3VXEH 1TIOA 2TGDA 1LVYA 1PQAA 3CNRA 2H5CA 3LJOA 3M36A 2QF3A 2ZDNA 4TWYA 5DP6A 3SV9A 3DSOA 5LPFA 1CU1A 3B9FH 4NWLA 4FUCA 3LOXA 3NRLA 1MTUA 3SU5A 1GJCB 2GZ9A 3F9FA 1HDTH 3D65E 1GJ8B 1L1JA 3QGJA 1DLKB 1O3LA 4GCHG 1AFQC 2OQUA 4A92A 1LMWB 4IW4E 1C2IA 3EA7A 2F91A 1UCYK 1SB1H 1F92A 2XNDD 3TLOA 2VWNA 1GHAF 1FX0B 5HXFA 2H9HA 4FOUC 1AVGH 2Z9GA 4MNXA 4Z6AH 1QQUA 3E8LA 4ISOA 3PTBA 3TITA 2XOKD 3BTEE 4F4OC 1ZPBA 3N7EA 3T28A 2HNTF 5A0AE 2ZFPH 2XXLA 7GCHG 2B0FA 5DG6A 3ITIA 3L33A 3RXPA 2ODPA 1LQEA 2OXSA 3SGBE 3EQ0H 1C1OA 4LZ4B 3SJOA 2FOBA 1P0SH 1TABE 1V2VT 3A7TA 5L2YH 4MNWA 4FUFA 2HPQH 4XRNA 3T26A 3EYDA 1BRUP 1ACBE 1GI4A 2RDEA 1FNIA 2ZQ2A 3ZZ3A 5DP8A 4D8NA 1C2JA 1TMTH 1ORFA 1OWEA 1HGTH 3MTYA 5CHBA 3Q76A 2NU1E 3A83A 1LQDB 2PP6A 4NIYA 4IC5A 4RKOB 1SOTA 1GMHG 5A0BA 2IPHA 2BHGA 1B0EA 2J92A 3GISB 2LPRA 2GCTC 1NM6A 4B2AA 1IQGA 1TRMA 2XNIA 4OGXA 5JB8S 2GV7A 2OC1A 3GICB 1N6YA 5AFYH 3TIUA 5FPTA 1A7SA 2V35A 3BTQE 1FIWA 1ANDA 3E0NB 1YLDA 2FO9A 3RXFA 1HRTH 3OX7U 1GHBG 1MTWA 1YPMH 2WPMS 4ESTE 1XM1A 1EPTC 3SUEA 1TFXA 1KIGH 5IYTA 4VGCB 2O8LA 2JETC 1GHAG 2XBXA 1TMBH 4K3JA 2BY6X 1BTXA 1KYNA 1O38A 1DX5M 1TBRH 1QBOA 1KXBA 1O2SA 2ZDAH 1TLDA 2FOMB 3MNSA 1K0HA 3QTVH 3U98H 2QN5T 2F9UA 2QYIA 1E79D 1O3CA 1CBWC 2ZQ1A 2OLGA 1GMCG 1Y3VA 3UOPA 1BUIA 3H7TA 1GI0A 3GCOA 4NG9H 2RA3A 2ZWLH 4HGCA 1GJDB 1A5GH 3M7UA 1O2ZA 1H9LB 1O5EH 1A3BH 3MYWA 1L2EA 2B5TB 2O8TA 3U1IB 3SV6A 2BLWA 1G3CA 2NU4E 1OOKB 1C5PA 1WV7H 1WSSH 1PPZA 4ISIH 1HFDA 1Y5AT 3HATH 3F1SB 4FVDA 2BOKA 1FUJA 4FUGA 4UE7H 5F53A 5C94A 1S5SA 3LGWA 5HKKD 1J8AA 3K2UA 5GCHF 2GCHF 3PV2A 1IOEA 1XUJA 2JKHA 1MD7A 2ZG0H 2R0KA 1G37A 2KM0A 2V3OH 1ZPCA 4U30A 4WJG2 5JYIA 3VPKA 3ZZDA 3TU7H 1C5SA 4O03A 2Y6TA 1Z8IB 1SPJA 1J17T 3BIUH 1GBDA 3LDXH 5HYOA 2KFWA 1NRRH 1WQVH 1GBFA 1TE0A 4JZEH 1OP0A 3BG4C 2GKVE 2A0QB 4AYVB 1TRYA 3E91A 1DXPA 1RTLA 3RMNH 4X1SU 4AOQA 1DWCH 1V2PT 1JIRA 2FLBH 1TNKA 5L2ZH 1UTOA 2VIVA 3LIWA 2BZAA 4AC9A 1EUFA 3LPRA 1O30A 2VGCB 2ZZUH 1P09A 1GCTB 2H6MA 1AUJA 1GWAA 1ANCA 1PPHE 3F9GA 1CA0C 1O36A 4MQAA 5A2MH 1NFWA 2A1DB 3RU4D 4B1TA 1V2RT 3GS9A 4E06H 1OSSA 1BJVA 3MNXA 5I25A 1YKTA 1OPHB 1C5VA 3CENA 4MTBA 1P3CA 2R9PA 1O3OA 4WMEA 1Z8GA 2KZ4A 2W7UA 1AZ8A 2ZEBA 2ZFTA 3H09A 2ULLA 2CN0H 2IJD1 4GHQA 1O5AB 5GWZA 1P57B 1LVBA 4JMYA 3RDZA 2J97A 1QB9A 4M7GA 1UTMA 3HPTB 3G01A 1TNIA 3QUMP 3OTJE 3P95A 1YPGH 1CQQA 3F2FA 2EI6A 5C1YA 4WMFA 1GI3A 3A8BA 4IBLH 2V6NA 1BBRE 4ZKSU 2J4IA 4I7YH 1ZSKA 5C67A 1TGCA 1WTGH 1P06A 2KCPA 3RXCA 2DE9A 3EE7A 1HAVB 1T7CA 2B9LA 4KP0A 5AFZH 2ZTYA 3VB7A 2QA9E 2XYAA 2ZGBH 1NS3A 1SLUB 4OGYA 1KDQA 1Y3WA 2OTVA 5EW1H 1N8OC 4A6LA 3OSYA 3PLKA 5KECA 2HPPH 4FU7A 4MPXA 3UWJH 1TMUH 1PQ8A 4CRCA 1MTNC 4MNVA 1P9UA 3GY7A 1FAXA 4AFQA 2K8IA 2GMTC 5ETXA 1BRAA 1MU6B 3SU3A 2PTCE 4NIWA 1UCYE 1PYTC 1HLTH 4RT0A 3OTPA 3LKWA 3RXLA 1LPKB 1QRWA 1KSNA 3QO6A 1GG6C 1BOQA 1DE7H 2WUCA 4INHA 1BT7A 3R0FA 1PPBH 2ZHDA 3EGKH 2BM2A 3A80A 3P70B 3P8OA 5GPIB 1DY9A 1LPZB 2WINI 1DUEA 1W0KD 3A8CA 4ZKOU 6GCHF 1AKSB 1S6HA 2NU0E 4JYVH 1SI5H 4RT1A 3C1KA 2TPIZ 3MH5A 2WPHS 1HAZB 4CHAC 1DM4B 1XKAC 2EC9H 1MKWK 2KCOA 4ASHA 3F68H 3PYHA 4UONA 5C3NA 2BDHA 1W3CA 1C2GA 1SL3A 1TNGA 1A1RA 3MH6A 4Q2KA 2Q1JA 1F5LA 3SV7A 4K69A 2YNAA 1W0JD 2TGAA 1TRNA 1SSXA 3SZNA 1QA0A 5EXLA 4ZCNA 3HKJB 4O9VA 1UK4A 1MKXK 3F9EA 1LHEH 1SR5C 1TPSA 1ZJKA 4INKA 5TCAA 1AHTH 3ATMA 4X8SH 1N1LA 1AB9C 1EB2A 1QB1A 1TNJA 3C27B 3A8AA 3MI4A 1GHVH 2FOHA 1XUFA 5EJLA 1V2ST 3TNSA 2GX4A 2I6QA 1Z6JH 1U6QA 1VJ9U 4FUIA 2R3UA 2SFAA 3OU0A 4XBBA 2FXRA 3DD2H 1W0ZU 1ZZZA 4F48B 1C4U2 4NIXA 1VR1H 3EA8A 3SU4A 2P16A 5EG4A 5HGGA 5SGAE 2Z9IA 4FUDA 4QT8C 1C5MD 1CSOE 1O3GA 2KAIB 3E1XB 3T5FH 4K5ZA 1S6FA 3MO3A 2UUJB 2K0QA 3RU4T 2Y82A 1XVMA 2B7DH 2GT8A 3F6UH 4YLQH 2FS8A 2ZFFH 1F5KU 3NWUA 2RA0A 1OS8A 4Q7ZA 2RFKC 4B71A 5A8XA 5EPYA 4CR5A 1AB9B 3HK3B 3ZIAD 2W3KA 2QF0A 3NUMA 3RXHA 2F9OA 3MFJA 4TWWA 2FTMA 2ZC9H 1JRTA 3AAVA 3KQDA 1UHBA 1V2JT 5F8TA 5JBCS 3F2GA 2TBSA 3AW0A 1O2LA 3TGKE 1HJ9A 1C9PA 2L74A 3RMOH 3GDVA 3LH3A 1LPGB 2ASUB 3K6ZA 5F8XA 3U1JB 3VXFH 2JH0D 4RI0A 1YLNA 1J15A 1JXPA 1QJ1B 4ZAEA 1EZSC 1BTZA 2HWLB 1PFXC 1MKXH 2ZO3H 1ZLRA 1P12E 1O32A 5HMAA 4CHAB 2V3MA 1D4PB 1O2NA 4UFEH 4WWYA 3PLPA 3RXTA 4B2CA 5C0TA 1O2YA 1TPOA 3SZEA 1HAXB 1DPOA 1TNHA 3SGQE 2Z3DA 2WV9A 1CO7E 1Z8JB 2SGFE 1LO6A 1FN6A 1ZR0A 3GDSA 1UTQA 2F3CE 1WYKA 2VWLA 2F9PA 2CF9H 2QXHA 4TY6A 3PMJA 3VB6A 1GBJA 4DY7B 3RUOA 4DG4A 2VWOA 4R0IA 1AO5A 1MQ5A 1C5XB 4YTAA 1ZHRA 2R2MB 1NU7B 3IITA 1BBRH 1GBTA 4ZMAH 4F49A 4B6EA 3T29A 1C5WB 2FYRA 1P11E 5BRRE 5DP9A 2A4GA 5A8YA 2TGPZ 1ELAA 1BTYA 5F03A 3WY8A 2EA3A 3BTTE 2ZCKP 5F8ZA 1Z8RA 3VB3A 1DT2A 3MHWU 1H9HE 1KTTB 1DWBH 1C1MA 1GBHA 3DCLA 2HLDD 2J34A 1K1MA 1O5BB 3WWFA 1OX1A 2XCNA 4ISLA 1O2RA 3U28C 2LP6A 3NPSA 3M5NA 5GXPA 1PJPA 2VJ1A 5DJ7A 1XMNB 3D23A 2VVUA 1NRPH 4BAHB 3A7YA 3AVZA 3QN7A 2PFEA 4I33A 4BTUB 3FN8A 3RXSA 4FUEA 2A7HA 5BPEA 3AK5A 1GI9B 4I31A 1SQTA 2L6OA 1E36B 1NFYA 4AX9H 2ZU2A 2Y5FA 3JZ2B 1Z7KA 2FOCA 1CGIE 2CMYA 3RMLH 1CVWH 3P8GA 2A2QH 2QXJA 2Z9LA 1GBMA 3GYMA 5IDKA 1NRNH 4X8UH 3RXEA 4K8BA 2A7CA 2BD5A 1FLEE 3SUGA 3A8DA 1QQ4A 3U8TH 1FY3A 2D26C 4JZDH 1C1WH 4R8TB 1AWHB 1BB0B 3BSQA 5H4IB 4CR9A 2J98A 3LC5A 1D3PB 2H9EH 2Z9KA 4B75A 1AMHA 2ZCHP 1UVSH 3KQCA 2ZDMA 1O2MA 3V3MA 3UY9A 3Q3KA 1HAOH 3S7KB 4JZFH 1RD3B 2WV4A 4O3UA 3SNBA 1HBTH 1C2HA 5FXLA 2BLVA 1F2SE 2XBVA 4NZLA 4UFDH 2AIQA 4LXBH 2IN2A 3SQEE 3RP2A 3DA9B 2OBQA 3M3VA 2FM2A 3SW2B 1TA2A 2TGTA 1LCYA 1S6LA 1W12U 1H4WA 1TALA 4O97A 3UNQA 2K1QA 2B8OH 2G55A 4Y10E 5KGOA 4LOYH 1IQMA 4WY3A 1VITG 3FP8E 1ZMJA 5DP7A 4WXVA 2BY7X 1H8DH 4WH8A 2J94A 1WCZA 3A87A 3RXMA 1C5YB 4P00A 5CHAC 4X2WA 3HKIB 1TAWA 2BLOA 3U9AH 3Q3YA 4A1XA 3KL6A 2ZHFH 1GHWH 9LPRA 2HVYB 5T6DA 1UVPA 1S81A 2J2UA 1NPMA 1AVWA 1C1VH 4IGDA 1CA0B 1V2WT 1AI8H 1UJ1A 1TBZH 4INLA 4O3TA 4D76A 4ZKRU 3WWBA 1C2LA 8ESTE 1O0DH 2AEIH 1IQLA 1HAYB 3ZVFA 5L6NH 1EP6A 4JZ1A 1C5TA 1NY22 2PW8H 1O5FH 1AN1E 1GJ7B 1ELTA 3S9CA 1YLCA 3ATLA 3NCLA 1SLWB 2FDAA 3RM0H 1JBUH 5EXNA 1FPHH 1PPFE 2P3TB 4UFGH 2BDAA 3MU5A 4GUXA 2OUAA 1SQOA 3ZVAA 4HFPB 2ZF0H 1NESE 2FOEA 5L30H 2BB4A 4ABIA 4NA7A 3M5MA 1TQ7B 2BY5X 1EAUA 2BOHB 4VGCC 3OY6U 5GCHG 1G2MA 4WF8A 1O5GH 1GHBF 1FIZA 3NZIA 1SQAA 5FCRA 4Y76A 3RXIA 1G9IE 2PLXA 1ETSH 5DP5A 2ZFQH 3TGIE 1GVLA 4Z1MD 4NIVA 1C1QA 1YM0A 4Y7AA 3M35A 4ABGA 2AHME 3DFLA 1BZXE 3BTWE 1S83A 2P3FH 2WPKS 4Q7XA 1IHSH 2VBCA 1C1UH 3Q77A 4ABHA 5DK1A 1WXRA 4WMDA 4NZQA 1QY6A 1S84A 2C8ZB 5FX6A 4UDWH 3ZVEA 4GHTA 2QXIA 1SLVB 5FBIA 1RIWB 4X1NU 3BV9B 3SU6A 2A4QA 1L4DA 1DSUA 2F9BH 3QZQA 5A09A 2BD8A 4H4FA 1P2OA 4NCYA 1F7ZA 3VEQB 2VVCA 1QCPA 5J4SA 2HGTH 3A7XA 5DKMA 1GBKA 3VB5A 1MAXA 5A0CA 4UEHH 3E3TA 5AHGH 3ESTA 5CHAB 3RXKA 1H8HD 2BZ6H 2PHBA 2EY4C 2XWBI 2P3UB 2AYWA 1NBMD 1SFQB 3LGIA 9ESTA 4P02A 1UTPA 2GZ8A 1C5LH 1E1QD 2WZQA 1HAIH 4WXIA 1ZYOA 4Q63A 1O3FA 1O3DA 1D3QB 1WU1A 2D2DA 3F2HA 2CK3D 4X6PA 1BITA 1XX9A 2YNBA 1K1IA 1VCWA 2F43B 2KCYA 5CE1A 4I86A 4TY7A 4CREA 4JZIA 3TGJE 1VGCC 1NRSH 3E0PB 1AUTC 1BTUA 3UFAA 3GCHB 1SLXB 2DE8A 4NFEA 1SGDE 4X2YA 2PR3A 1RRKA 1L1NA 3RXVA 2AMQA 1GI7B 2O8WA 1AD8H 2SGPE 3PB1E 1MMJN 2D1JA 2Y5HA 2VVVA 5E2OA 2ZI2H 1AE8H 4E7RG 4ACAA 1DDJA 5E0JA 1TYNA 3BEFB 2JDID 4XD7D 1EPTA 5FHTA 2Q6FA 1W7XH 1GBEA 8GCHG 2EI8A 2AGIX 1OKXA 4HG6A 1MBMA 1O31A 1DSTA 5FBEA 2I6SA 3DHKH 2SGQE 4NWKA 4Y7BA 4X8VH 1TGSZ 2EEKA 2H2ZA 3SO3A 4FUBA 3V12A 2C8YB 2GJGA 3KEEA 2Z94A 3ZVGA 1GBCA 3OEED 5EIYA 1T8NA 3GY6A 3CS7A 2OP9A 4E05H 1A0LA 1P02A 1EJNA 2KAIA 3SGAE 3QGNB 3SNCA 1BA8B 2FWWA 3PRDA 2ZU1A 1IQNA 1KLIH 3P92A 1C2FA 2BYAX 1ZRKA 1MTVA 1EZQA 3SV8A 5HIYA 3GCHC 2A45B 1UK2A 1FZZA 3TH2H 3DSPA 3V13A 2FLRH 3BTGE 4XDEA 4AG2A 1EFRD 1ZMLA 2SGAA 2BDYA 4XOJA 3MU8A 3SBKA 3LH1A 1KXCA 1YBWA 2BMGB 4YLUA 4ABBA 4DOQA 2FMJA 4MDSA 2XCFA 1P2KA 1E38B 2W5EA 2VIQA 2OC8A 3L3TA 2ZFRH 1YF4A 2JJ2D 2HNTE 4K2YA 2R3YA 1QJ7B 1EAXA 1ZHPA 4D9QA 3MH7A 3VFEA 3AAUA 1G32B 2ZHEH 1BCUH 3MOCA 2A31A 2Z3CA 2CJIA 4Y8YA 3KN2A 4MNYA 1BRBE 3ZYEA 4X6NA 2ZPSA 5EGMA 3RC5A 2QF5A 4AZ2B 2VIOA 5EOKA 1GBLA 2GP9B 1TGNA 1O2HA 1VGCB 4AGJA 2R0LA 3UQVA 3SJ8A 2BX3A 2CHAC 1F0TA 1DUAA 1ABIH 1ESBA 2Z7FE 1H8ED 1TX7A 1P04A 1IQIA 2OQ5A 5CDFE 4ZUHA 1Q2WA 2WSSD 3UPEA 2YMSB 1EASA 2NU3E 1H8IH 3MQKC 1EJMA 1K1LA 1DXWA 2RG3A 4GSOA 2ZDLA 3ZZ8A 4JK6A 4MVNA 2ZCLP 1E1RD 1SC8U 5FAHA 1TOMH 1NC6A 2G52A 3SYJA 1GHYH 1QGFA 5FCKA 1GL0E 5ESBA 3GY3A 1OYQA 3OY5U 1HCGA 3R3GB 1EZUC 1V2QT 3K6YA 1A5HA 3KHVA 1K22H 3EE0B 1YPJH 4YT7H 1C1RA 3SHCH 3SN8A 1ZTJA 4YOJA 1FY4A 2FTLE 2A2XH 2FX6A 3PTNA 4XFQA 3SU2A 1AKSA 1UCYH 1AY6H 5C0UA 1BMAA 2A32A 1YCPK 3MO6A 1HXFH 3GY8A 1FMGA 4DCDA 2ZDKA 4JYTA 5E0HA 1EP5A 2ALVA 3RU4E 1GPZA 1HPGA 1P2IA 1SFIA 1A2CH 1J14A 1EJAA 4X1QU 1GHZA 1IHTH 1UW7A 1W8BH 2W6JD 1F5RA 1AGJA 3RC6A 4ZHAA 1CA8B 1T4UH 2FODA 3A82A 1MUEB 2AGGX 3SHAH 2JH6D 1FY5A 3M7TA 3M5LA 2ZTZA 2VNTA 1ETRH 4XSKU 1AFEH 1P3EA 3KGPA 3ZZCA 1TQ0B 1SGNE 4Q80A 1UMAH 4D7GA 1SGQE 1IQJA 1Z6EA 3D62A 2FI4E 2Y7ZA 3LU9B 4AFUA 4I8GA 4YOIA 2Q6GA 1ID5H 3SOSA 1KDQB 2BVXH 1KY9A 5EW2H 1DY8A 1C5RA 1MCTA 1MABB 1C1NA 2ZKSA 2BD2A 3FO8D 3TK5A 2HRVA 3LC3A 2UUYA 2ZTXA 2ZPRA 1P01A 3S7HB 2FP7B 1O34A 4DT4A 5GDSH 1TONA 3P8NA 1GMHF 1QNJA 2FOAA 1QIXB 1W13U 1UVUH 3U8OH 1O3KA 1BTWA 1DLEA 1K1NA 1BRCE 1CGJE 4MPWA 1ZJDA 1OWJA 1V2OT 1K1JA 2AIPA 4E7NA 1C2KA 3LGUA 4YT6H 1YPLH 2QGRA 1INCA 1ANEA 3BF6H 1FY8E 1LHCH 2HVXA 1SGTA 5J4QA 4THNH 2ANWA 3TJOA 3O8DA 1RIWC 1W0YH 1TGBA 4YZUA 1FAKH 5T1VA 3KQEA 4BANB 1T4VH 4GVUA 2LNCA 4YM9A 4ACBA 1GVZA 2XBWA 1GCDA 1BMLA 1O39A 3GOVB 3SV2H 2XW9A 1Y8TA 1N8OB 4A5TS 1KTSB 1KMHB 3A85A 1EAIA 3OE7D 1D9IA 2ALPA 1IQHA 2V0BA 3PV5A 5E8EH 5T3HA 3HGNA 2QE7D 1VJAU 1TA6A 3BTDE 1QA7A 3I77A 4SGAE 1LHGH 3LJJA 2AMDA 1A61H 3NXPA 4TT3D 2ILNA 2Z6BD 4K1EA 2AGEX 1UHBB 3MH4A 3ZV8A 1WAYB 1O2QA 3IWMA 1E0FD 2GGVB 1F0RA 3VB4A 1BMNH 1QL7A 4I8JA 4CH8B 1UTLM 5GNDA 3UR9A 2FZZA 3SNDA 1O2IA 3SNAA 3FKSD 3S69A 5EQQA 2Y7XA 2H1UA 1VITF 1GBAA 3AASA 1A3EH 5HM9A 1Q31A 1BDAA 3T27A 1UK3A 5DP4A 1GJ4H 4B2BA 2VGCC 4YXWD 2OC0A 2BDIA 1JIMA 3A7ZA 1O3PB 1FJSA 2SNWA 4BAOB 4AGKA 4MLFB 4WVPE 2J38A 3RXUA 2BXUH 2AERH 3PROA 2QIQA 4HI3A 3KNXA 3GY4A 1ARCA 4BXWA 2AS9A 2CHAB 3SUDA 2V3HH 2G8TA 1G2LA 3PO1B 4Y79A 1C1TA 1YPHC 3WW7A 2PGBB 1GDUA 3QX5H 4X0WU 2Z3EA 1T32A 3A81A 2XC0A 3NK8A 1HXEH 1VCPA 2WYGA 1KXEA 4DIIH 4PROA 4X2XA 1THSH 4J2YB 1RXPA 4KTUA 1QRZA 3RM2H 1BHXB 3B8JA 2G81E 3W95A 1DANH 3DFJA 5EXMA 1S0QA 7GCHF 3UR6A 5C20A 1DWDH 5I46H 3RLWH 1OWIA 3FVFB 1YYY1 1DVAH 1OYTH 3N7DA 4I8KA 3STJA 1SQRA 2OINA 4NA8A 1ZMNA
chains in the Genus database with same CATH topology
1DFPA 1O3JA 1D3TB 1DICA 1O3NA 1O2OA 3SORA 3PWBA 2W26A 4ISHH 2ZA5A 4MG3A 1E37B 1ELEE 4Z0KA 1GHXH 1Z71A 3QLPH 2GCTB 3Q00A 1HJ8A 1C5OH 3A86A 2BX4A 3F9HA 3UTUH 1TOCB 2R2WU 5K7RA 2SNVA 3A7VA 2STAE 3FZDA 1GI1A 3K9XB 1XUGA 1O37A 1SGYE 4XBCA 1KLJH 1O2WA 2NU2E 4GPGA 1TPPA 3A7WA 3M3SA 2BVRH 3QTOH 4IMQA 1NFUA 5E2PA 1K1PA 1K28D 5K0HA 2QV1A 2FX4A 1CHOG 3BTFE 1E34B 2FESH 3TPIZ 3URCA 1HNEE 1EPTB 5JB9S 5AVDA 5JBTA 4ABJA 1K2I1 4KELA 2QCYA 4HTCH 4RKJB 4YO9A 4AYYB 2UUKB 1ESAA 3I29A 1J16A 1EOLA 1W11U 5CMXH 3ZZAA 1FPCH 1MH0A 2PKAA 1E35B 3FP6E 3UREA 4U32A 6CHAC 1BIOA 3EA9A 2GVFA 2XWAA 3N7OA 4K8YA 3ELAH 3SUFA 1OWHA 4CBNA 3O8RA 3RXQA 1CE5A 1P2JA 1DS2E 2BLQA 2ZGCA 4Q7YA 3SQHE 1ELBA 5EQRA 1CHGA 2FOGA 3T2NA 3ZVDA 4ZKNU 2HALA 2FOFA 1GGDB 2BDGA 3M61U 3U69H 1UVTH 3LT3A 3RC4A 1O2PA 3URDA 3GYLB 4LK4A 3ZV9A 1QURH 1A0HB 3MNCA 1SGCA 1O2GH 3V7TA 1AFQB 1YGCH 1V6DA 1YP9A 4JCNA 1LKAA 3GCTF 1C4V2 1ZGVA 2ZHQH 5EU8A 1MBQA 1D6WA 2QAAA 4MPVA 2QXGA 1LVMA 1EZXC 1O2XA 4OS4A 4IMZA 1XXFA 1B5GH 1P8VC 1Y5BT 4ISNA 1NROH 2ANMH 1O5DH 1QBNA 1B0FA 1T31A 4DVAU 2J95A 1CT2E 3RXGA 2BD9A 1ZTLA 1HYLA 4AG1A 1WQSA 1AIXH 4AN7A 2WUBA 1UVOA 3A88A 4ZXYH 2C3SA 1DWEH 1IQFA 3RXJA 3SJ9A 2M5TA 6ESTA 1H9IE 2GT7A 3PM3A 4DT7B 4I8HA 1XUKA 2PGQB 1C1PA 1QR3E 1TX6A 2A7JA 1GGDC 1KXFA 3S9AA 4ABDA 3LONA 1A0JA 4ZHMU 1JOUB 3BTHE 1ANBA 3RXDA 1Y3YA 4XBDA 4RSPA 4H6TA 2C8WB 2ODQA 2ZPQA 4AB8A 3H5CB 1HJAC 1ELFA 4FU8A 3MWIU 5LH8A 3EDXB 2A5AA 4BOHA 4Y11E 4ABEA 4DIHH 1FQ3A 1J9CH 1WBGB 5ESTE 1SGFG 5PTPA 1BMMH 1AZZA 2AH4X 3RXAA 1NN6A 1HV7A 4J1YA 5JPMH 1O2UA 3RLYH 5LGOA 3M37A 2ANKH 3H7OA 1UTNA 1HAGE 5TCCA 2ZU3A 1PPGE 4IC6A 1W14U 3UWIA 3MU4A 1RGQA 1NRQH 3RXOA 2W3IA 4ZH8A 5JDUB 1TGTA 1A5IA 4X6OA 4AB9A 4LZ1H 2G4UA 2H9TH 2OC7A 4NFFA 5C2ZA 4MPUA 1GDNA 1H1BA 1SMFE 2O8MA 1SGRE 3KCGH 2OD3B 3L6PA 3M3TA 1XXDA 2C4FH 2GV6A 1P03A 1C2DA 1P9SA 1YC0A 4A1VA 1W2KH 4CH2B 5DO4H 5DP3A 1HJAB 2JH5D 2CF8H 4TYDA 1THPB 1ZPZA 5T6FA 3O8CA 3PWCA 8LPRA 1BTPA 3BEUA 2ZIQH 4BNRA 5EPNA 1O2TA 2G5NA 2XC4A 1VITH 4B73A 1C5UA 1XUHA 4NSVA 1GI6A 2FEQH 5LPRA 1QL9A 1DITH 4OS2A 1GBBA 1F0SA 2DUCA 2NWNA 7LPRA 1K21H 3UOUA 1C5NH 3PV4A 1QFKH 4WH6A 5G4BA 7KMEH 3S0NA 2PTNA 3ZZBA 1O5CB 3BTME 1KXAA 1BHXF 1PPCE 4RN6A 4OS7A 1BBRK 1QBVH 1C1SA 3IG6B 3W94A 1YCPH 3GCNA 4KKDA 4YOGA 1P2MA 1N6XA 2P95A 2BQWB 1GG6B 1WTHD 1LHFH 3B23B 8GCHF 1TWXB 3A89A 2PSYA 4DW2U 1EATA 4I8LA 1ZSJA 1IQEA 5A8ZA 2OCVB 3SI4H 1C2MA 1RTFB 2BY8X 7ESTE 1JMOH 4K1SA 1AE5A 2PUXB 2ZU5A 4TPIZ 1OWDA 1V2TT 2OBOA 3MO9A 3Q3XA 3MNBA 3PLBA 1L0ZA 5GIBA 1YPKH 1F0UA 2G4TA 3UNRA 1OP8A 2Z9JA 4BAQB 4ABFA 5JBBS 4CRFA 2F9NA 2VINA 4JK5A 2VIDA 1SGIB 3GY2A 6CHAB 1HAHH 2J9NA 3BEIB 4GCHF 5GJ4B 3FP7E 5AF9H 3LGTA 2BDBA 1GI2A 4FU9A 1EQ9A 1YCPM 2PKSB 3ZZ9A 1MTNB 1V2MT 1LKBA 1S82A 1SOZA 5FX5A 1LVOA 4BAKB 2FIRH 3RXRA 1UO6A 1GBIA 1FN8A 4Y0ZE 3P6ZB 1MU8B 1GL1A 3MU0A 1EKBB 1ZRBA 2TIOA 3RXBA 3TJNA 1GI8B 3GCTG 3TK6A 4UD9H 1Y59T 1CT4E 1TNLA 1GI5A 1S85A 4TPYA 4Y8XA 2PWXA 1O3BA 4DGJA 1QB6A 1GCTC 1VZQH 2ZU4A 2VH6A 5FPYA 1X7AC 2ZECA 2PUQH 2GDEH 2HLCA 3M5OA 4B74A 1HAVA 3HGPA 4GLYA 5F6MA 1HIAA 4OS1A 2IJOB 1P05A 1FXYA 1UTKA 2A5IA 1O33A 1ETTH 3U8RH 4D7FA 1GMDF 1Z1JA 4H6SB 1NO9H 4BAMB 1LDTT 5DGJA 1RTKA 1NZQH 3TNTA 1L1GA 2Y5GA 1T8MA 4FUJA 1SHYA 2FYQA 5EODA 2VWMA 4BTIB 1YPEH 3ATKA 4DURA 4Y6DA 1PQ5A 4D9RA 1BQYA 2ZNKH 1GMCF 2VU8E 3TK9A 1GVKB 3ZZ7A 4K60A 1TB6H 1BJUA 1MQ6A 1SGPE 2A4OA 2ZFSA 1ZTKA 3O8BA 1QJ6B 2CV3A 2XRCA 3TH4H 5TJXA 1P2NA 2RCEA 2BDCA 2WPIS 3CS0A 3TJUA 5C5NA 2JETB 2GCHG 4KGAA 1PPEE 2WV5A 1GJAB 2C90B 2G5VA 1HIAB 1KXDA 2GDDA 2WPLS 2GMTB 1RJXB 3MMGA 1D3DB 1WOFA 2FI3E 8KME2 4IS5A 1C5ZB 1LHDH 1T8LA 2HNTC 1QRXA 3M7QA 5T6GA 1EOJA 1Q3XA 1LTOA 3FFGA 5EQSA 1XKBC 1T8OA 2UWOA 1AWFH 3SU1A 1OP2A 1O2KA 3ODDA 4OS6A 1A4WH 1Y3UA 1Y5UT 1NFXA 2BTCE 2C93B 3LGYA 3QZRA 1ABJH 2SGEE 3SJIA 3UUZA 4AORA 5DPAA 3ZZ6A 1W7GH 1G30B 1KLTA 1P2QA 1SVPA 3KIDU 1QL8A 1RS0A 3GDUA 4FVBA 2SGDE 1SHHB 3BG4B 1MCVA 3SNEA 4BTTB 1AU8A 1TX8A 1SGFA 4Y71A 2G00A 1EAWA 3PO1C 4Y0YE 1V2LT 1SG8B 1GJBB 3I78A 3TH3H 3PMHB 1DOJA 1OXGA 3LGVA 2EI7A 1UTJA 2P59A 2FPZA 2VIWA 3UIRA 1B7XB 4I32A 2YOLA 2STBE 2F9VA 1FDPA 1P10A 4XE4A 1MTSA 5FPSA 6LPRA 2IOTA 2VH0A 2W7SA 3PMBB 1C9TA 3AW1A 2P8OC 4K1TA 3PMAB 2VB0A 2UUFB 2GTBA 1S0RA 3FZZA 1RFNA 1EB1H 1FI8A 3P8FA 1V3XA 3KF2A 2QC2A 4B76A 2BQ6B 1IAUA 2BD7A 4Y8ZA 3OYPA 4NGAH 2F83A 1NTPA 3K65B 3KQBA 1IQKA 6GCHG 1CBWB 4CRDA 1YPHE 2UWLA 4NA9H 3GY5A 1CHOF 2P94A 1C2EA 1ELDE 1NT1A 4ABAA 1GJ5H 4A1TA 1O35A 1G3BA 1M9UA 1OWKA 1JRSA 2C8XB 2FI5E 3QK1A 2P93A 3ZZ5A 3T25A 3DUXH 4HZHA 3ZYDA 2PSXA 2ZGHA 1O3MA 4GAWA 1A46H 1O2JA 1XUIA 3ATWA 3S9BA 1W10U 1CGHA 1FONA 1MD8A 4A7IB 2PKSC 2AMPA 3SI3H 1QHRB 2XBYA 1D6RA 1BTHH 2ZDVH 3MU1A 1GDQA 2THFB 3T62A 2A5KA 4OS5A 5C1UA 1EXFA 2PKAB 4U2WA 3TVJB 2BY9X 4X8TH 2CXVA 3FAOA 1AQ7A 1TBQH 5E0GA 1QTFA 4X1RU 1MZAA 3BN9A 4CRBA 1MAYA 2VIPA 4IN2A 5C5OA 1G3DA 5JBAS 1K9OE 2XC5A 4AFZA 2Y80A 2WPJS 1AVXA 3STIA 3FANA 4U01A 3DT0H 3JZ1B 2Y81A 3ZVBA 5ABWA 3VGCC 4ZROA 5C1XA 3QWCH 1C4Y2 2ANYA 1C5QA 1Y3XA 4DJZB 2H5DA 4KTSA 1HUTH 3ATIA 1ZHMA 2BD3A 3QDZB 2GD4B 1FY1A 4H42U 3BG8A 1Z1IA 4JYUH 1V2UT 3TJVA 1THRH 1NU9A 2QY0B 1O3HA 2ESTE 2PV9B 4BXSA 1V2KT 3RMMH 1WUNH 3ZVCA 1CT0E 3ENSB 2BVSH 3CP7A 5B6OA 2BQ7B 2P8OB 2ZP0H 1GJ6A 1GMDG 1JWTA 1G3EA 1PQ7A 2WYJA 2AFQB 2BXTH 1O3EA 1HAPH 1FV9A 1SBWA 1TPAE 1SGEE 4X6MA 4X2VA 1MZDA 4FXGH 4IN1A 3UQOA 3A84A 3P17H 4ZHLU 1ZSLA 2A4RA 1ARBA 4CRGA 1ELGA 3ZZ4A 5HM2A 2GZ7A 2UWPA 4KTCA 3UNSA 1GJ9B 2BD4A 3VGCB 1XVOA 5LPEA 4CRAA 2TRMA 2ZGJA 3NKKA 2O9QA 4YESB 1G36A 3SJKA 4CBOA 3EAJA 3E90B 4UFFH 1O3IA 1ELVA 1ZGIA 2HOBA 4SGBE 2CGAA 2FS9A 3SU0A 1O3AA 1HB0B 2ODYB 1PYTD 2O8UA 3ODFA 3BTKE 3V0XA 4NSYA 3BIVH 1VCQA 3HK6B 4AFSA 1L4ZA 1MKWH 2RDLA 2ZGXH 2Q6DA 1O2VA 1ESTA 3D49H 1ZOMA 2XTTB 2ZHWH 1K1OA 4X1PU 1ELCA 3E16B 1V2NT 2G51A 4FUHA 2D8WA 3E6PH 4ZXXH 1EX3A 3VXEH 1TIOA 2TGDA 1LVYA 1PQAA 2H5CA 3LJOA 3M36A 2QF3A 2ZDNA 4TWYA 5DP6A 3SV9A 5LPFA 1CU1A 3B9FH 4NWLA 4FUCA 3LOXA 1MTUA 3SU5A 1GJCB 2GZ9A 3F9FA 1HDTH 3D65E 1GJ8B 1L1JA 3QGJA 1DLKB 1O3LA 4GCHG 1AFQC 2OQUA 4A92A 1LMWB 4IW4E 1C2IA 3EA7A 2F91A 1UCYK 1SB1H 1F92A 3TLOA 2VWNA 1GHAF 5HXFA 2H9HA 4MNXA 1AVGH 2Z9GA 4Z6AH 1QQUA 3E8LA 4ISOA 3PTBA 3TITA 3BTEE 4F4OC 1ZPBA 3T28A 2HNTF 5A0AE 2ZFPH 2XXLA 7GCHG 2B0FA 5DG6A 3ITIA 3L33A 3RXPA 2ODPA 1LQEA 2OXSA 3SGBE 3EQ0H 1C1OA 4LZ4B 3SJOA 2FOBA 1P0SH 1TABE 1V2VT 3A7TA 5L2YH 4MNWA 4FUFA 2HPQH 3T26A 3EYDA 1BRUP 1ACBE 1GI4A 1FNIA 2ZQ2A 3ZZ3A 5DP8A 4D8NA 1C2JA 1TMTH 1ORFA 1OWEA 1HGTH 3MTYA 3Q76A 2NU1E 3A83A 1LQDB 4NIYA 4IC5A 4RKOB 1SOTA 1GMHG 5A0BA 2IPHA 2BHGA 1B0EA 2J92A 3GISB 2LPRA 2GCTC 1NM6A 4B2AA 1IQGA 1TRMA 2XNIA 4OGXA 5JB8S 2GV7A 2OC1A 3GICB 1N6YA 5AFYH 3TIUA 5FPTA 1A7SA 2V35A 3BTQE 1FIWA 1ANDA 3E0NB 1YLDA 2FO9A 3RXFA 1HRTH 3OX7U 1GHBG 1MTWA 1YPMH 2WPMS 4ESTE 1XM1A 1EPTC 3SUEA 1TFXA 1KIGH 5IYTA 4VGCB 2O8LA 2JETC 1GHAG 2XBXA 1TMBH 4K3JA 2BY6X 1BTXA 1KYNA 1O38A 1DX5M 1TBRH 1QBOA 1KXBA 1O2SA 2ZDAH 1TLDA 2FOMB 3MNSA 3QTVH 3U98H 2QN5T 2F9UA 2QYIA 1O3CA 1CBWC 2ZQ1A 2OLGA 1GMCG 1Y3VA 3UOPA 1BUIA 3H7TA 1GI0A 3GCOA 4NG9H 2RA3A 2ZWLH 4HGCA 1GJDB 1A5GH 3M7UA 1O2ZA 1H9LB 1O5EH 1A3BH 3MYWA 1L2EA 2B5TB 2O8TA 3U1IB 3SV6A 2BLWA 1G3CA 2NU4E 1OOKB 1C5PA 1WV7H 1WSSH 1PPZA 4ISIH 1HFDA 1Y5AT 3HATH 3F1SB 4FVDA 2BOKA 1FUJA 4FUGA 4UE7H 1S5SA 3LGWA 1J8AA 3K2UA 5GCHF 2GCHF 1IOEA 1XUJA 2JKHA 1MD7A 2ZG0H 2R0KA 1G37A 2V3OH 1ZPCA 4U30A 4WJG2 5JYIA 3VPKA 3ZZDA 3TU7H 1C5SA 4O03A 2Y6TA 1Z8IB 1SPJA 1J17T 3BIUH 1GBDA 3LDXH 5HYOA 1NRRH 1WQVH 1GBFA 1TE0A 4JZEH 1OP0A 3BG4C 2GKVE 2A0QB 4AYVB 1TRYA 3E91A 1DXPA 1RTLA 3RMNH 4X1SU 4AOQA 1DWCH 1V2PT 1JIRA 2FLBH 1TNKA 5L2ZH 1UTOA 2VIVA 3LIWA 2BZAA 1EUFA 3LPRA 1O30A 2VGCB 2ZZUH 1P09A 1GCTB 2H6MA 1AUJA 1GWAA 1ANCA 1PPHE 3F9GA 1CA0C 1O36A 4MQAA 5A2MH 1NFWA 2A1DB 3RU4D 4B1TA 1V2RT 4E06H 1OSSA 1BJVA 3MNXA 5I25A 1YKTA 1OPHB 1C5VA 3CENA 4MTBA 1P3CA 2R9PA 1O3OA 4WMEA 1Z8GA 2W7UA 1AZ8A 2ZEBA 2ZFTA 2ULLA 2CN0H 4GHQA 1O5AB 5GWZA 1P57B 1LVBA 4JMYA 3RDZA 4M7GA 1QB9A 1UTMA