1VJ9U

Urokinase plasminogen activator b-chain-jt464 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords plasminogen activator, urokinase
molecule tags Hydrolase
source organism Homo sapiens
publication title Design of novel and selective inhibitors of urokinase-type plasminogen activator with improved pharmacokinetic properties for use as antimetastatic agents
pubmed doi rcsb
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vj9U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vj9U01
1K1OA 1ABIH 1P09A 1D4PB 4NG9H 3ZZ9A 4AFZA 1QBVH 3URDA 2VIOA 3LGVA 2NWNA 3WY8A 5E0HA 3BTME 1H8IH 1YM0A 1UCYE 2ZG0H 1CGHA 1W12U 3MH7A 4Y11E 4YOGA 4IW4E 3LKWA 1A5GH 3MO3A 1BMAA 3SORA 3F9EA 1P9UA 3PMBB 5JB9S 4TY7A 1MZAA 2HNTE 3OYPA 1IHSH 4IN1A 1EB2A 1PPCE 2AMQA 2FI3E 3LGYA 4A5TS 4ZHLU 4ZKNU 1E36B 3V3MA 3SJKA 2TGAA 4NIYA 2FXRA 3RU4E 1BA8B 1GJ5H 2ZDMA 3MI4A 1V2RT 3QTVH 1CGJE 1DUAA 1EAXA 4TYDA 2GV7A 1GVLA 2OUAA 4GAWA 3MO9A 3U9AH 5C5OA 2W7SA 1HB0B 1KLJH 1AQ7A 5HYOA 4JZEH 1W2KH 4CREA 1JWTA 5EGMA 3VB5A 3GDSA 4NA8A 3SV9A 3IG6B 1ZMJA 2UUYA 1BRCE 3FZZA 1GHBF 4JZIA 2W7UA 4CH2B 2GP9B 2WPMS 1G3BA 1HAVB 1ELGA 2WPIS 4O97A 3SV2H 1SGNE 3K6YA 1QHRB 4D8NA 4UDWH 1Y3UA 3E0PB 3P95A 4X1PU 3FANA 1P2QA 1SGYE 1ELAA 1A3EH 1TALA 4ZXYH 1AWFH 4O9VA 1VITH 4B2CA 3A86A 1KDQB 2GZ8A 4AYVB 5F8XA 1GHWH 5JB8S 3RXSA 1OWKA 3SJIA 1IQMA 1A0LA 1YLCA 4GSOA 4D7FA 2DUCA 1KLIH 3ZZ5A 1QL7A 1INCA 1JIRA 2H6MA 2CHAC 1C1WH 3A7YA 2PTNA 3KQEA 1CHOF 1JRTA 2OC7A 1TQ0B 3S69A 2AH4X 3BG4C 1THSH 1G32B 1UVTH 1QA7A 4ABEA 1DY8A 2DE8A 4MPWA 1OOKB 2PGBB 3SJ9A 4DY7B 2AERH 1V2QT 4IMQA 1TNKA 2SGFE 1NTPA 1AKSB 1ORFA 2IOTA 4ABDA 2Z94A 2ZWLH 1ZTJA 2XXLA 5I25A 4FUDA 1DY9A 2FYRA 3A80A 3SI4H 1XUJA 3HGNA 4ISNA 1Q3XA 3TGIE 2NU1E 1EKBB 2OINA 1GBAA 2FDAA 2ZTYA 4BNRA 2QXJA 5HXFA 2BVXH 1EAWA 3NZIA 2SFAA 2W3IA 1C1PA 2Z9KA 1E37B 4KELA 1OKXA 4KTSA 2PWXA 2HRVA 3OX7U 1UVSH 3M3TA 5T3HA 1FLEE 1TGBA 1S6FA 3P92A 1AY6H 1SG8B 2GT7A 1TYNA 3UWJH 2ZP0H 2I6SA 2AYWA 1V2TT 3EGKH 2P8OB 3RC4A 4JMYA 4UEHH 2HALA 3STJA 1H4WA 1V2WT 3E1XB 1SGFG 1V2NT 1GCTB 1NM6A 1O37A 3GY3A 1EPTB 1OX1A 4LZ1H 3DFJA 3TK5A 5H4IB 1ELCA 4NZLA 1VR1H 4ZAEA 2BXTH 4ABJA 2XBYA 2BD3A 2ZDVH 2QYIA 3SW2B 3SO3A 1GBLA 2Y7XA 2BD5A 5EQQA 1THPB 2RCEA 3PB1E 8GCHF 2BXUH 5ETXA 1IQFA 2BDHA 1UCYK 3GY8A 1P2OA 3ZZAA 4D9QA 1KXAA 1P2KA 1CBWC 1HAOH 4AGKA 3OTJE 6CHAB 4ISIH 1NO9H 1BQYA 1HAPH 2ZGJA 2Y82A 4M7GA 1XKAC 1BITA 1C5XB 1PPEE 4ZH8A 1BHXB 1BTXA 1QQ4A 1ZJDA 2BD4A 2LNCA 3FZDA 1PQ5A 3ESTA 2J92A 4X2WA 4QT8C 1AUTC 1NC6A 4K8BA 1TFXA 4NWKA 6LPRA 4ISHH 1KXEA 2C4FH 1IQKA 2THFB 3W95A 2C8ZB 1H9HE 1CGIE 1FJSA 4K3JA 1O3HA 1S85A 1D9IA 2BYAX 1YPLH 1RRKA 4KP0A 1JOUB 1UTLM 1C1SA 1C5TA 1MTVA 2HGTH 1C5SA 5GCHG 4GHTA 1TRMA 3TH4H 5AFYH 3AAVA 1CA0C 4FU8A 3ODFA 1OP0A 4F49A 1BRAA 2BY7X 3A7TA 1G2MA 3A7WA 1P2MA 2F83A 3A82A 3PM3A 1HUTH 2BHGA 3M61U 2A4RA 3KQBA 2OXSA 3A81A 1P2IA 2UWPA 4DGJA 1TB6H 1DUEA 1FI8A 3S9CA 5BRRE 3P17H 1HYLA 3F9FA 1TMTH 4O3TA 3LIWA 3A7XA 1GMDF 2LPRA 2IJOB 3DUXH 1A61H 4U01A 3ZZCA 3MMGA 2VNTA 2HNTF 1GBIA 1TABE 2W3KA 5K7RA 4B74A 4AFQA 1DT2A 1YGCH 5A09A 3G01A 2OBQA 1DVAH 1HDTH 4RKOB 2AMPA 1NFUA 1YPHE 1ZMLA 1ELDE 1FUJA 2G4TA 1BZXE 1C2MA 2O8MA 2TGTA 3DFLA 2R2MB 4ASHA 2AFQB 4ABHA 2BZAA 4ZROA 1GBJA 1TGNA 1HNEE 3UNSA 1MBQA 1MMJN 4X2XA 2C8XB 4JYUH 2CF8H 4A7IB 1WCZA 3MNCA 2JKHA 5EW2H 2ESTE 1OWJA 1RGQA 2XC4A 1MU8B 3SGAE 3SZNA 4RN6A 2AS9A 2H1UA 5A0AE 2UUFB 4BAHB 4KKDA 5L6NH 1J16A 1EJAA 3Q00A 2P8OC 1KTTB 1TOMH 8LPRA 1Z71A 1GI6A 3U98H 3LH3A 1LPKB 3E3TA 4H6SB 4WMFA 5LPFA 1YCPM 5J4QA 1XM1A 7GCHG 2G5NA 3GOVB 3OY6U 5JBCS 3UNRA 1WOFA 1XVMA 2GD4B 3D23A 1C4Y2 5DP8A 8ESTE 1L4ZA 3A87A 5FCKA 3PO1C 3AVZA 1LQEA 4FUCA 1C2IA 5EXNA 3CS0A 1AI8H 4Y0ZE 2BX4A 2GVFA 4O3UA 1AU8A 1AFQC 3C1KA 1QB9A 5HM9A 2STBE 2CMYA 3RMLH 3JZ2B 2RG3A 4CRAA 1NFWA 3GCTG 1Y3YA 3DD2H 3ZVGA 2FOMB 5FX6A 1TE0A 1YBWA 2FLBH 3MOCA 3L6PA 1O2WA 3UFAA 2HLCA 2UUKB 1WV7H 4JZDH 1O31A 2R0KA 1LO6A 1YPGH 1EP5A 1K1IA 4THNH 2GCTC 5ESTE 3ATLA 4DIHH 4DJZB 1AFEH 3KCGH 2WINI 1C9TA 1YCPH 4DOQA 3SNCA 1BTYA 2ZDAH 1H1BA 3SNEA 4MVNA 3BTQE 1ZPCA 3VGCC 1CA8B 1O2HA 4RSPA 1TMUH 2QY0B 4JK5A 2TPIZ 1N8OC 2Z3DA 1S84A 1W0YH 2PKSC 4U2WA 1UO6A 1S0QA 3SV7A 1Z8RA 1OP2A 2Z7FE 2WUBA 1P02A 4MG3A 2D8WA 1Y3WA 1HFDA 2PHBA 4F4OC 2XWBI 3Q77A 1GI8B 1Z8GA 1A5IA 1FN6A 3LGTA 1SBWA 2BDAA 1KTSB 2G8TA 2PFEA 1ESAA 2SGEE 1QL9A 2ZTXA 1C2HA 1GGDC 1QBOA 5C20A 1TBRH 2A4OA 3ATIA 4WMEA 2F91A 1O34A 3ZZ4A 4INKA 3QUMP 1XX9A 3MU8A 3NUMA 1FY1A 2XC0A 1SOZA 4WXIA 1IQLA 1XUHA 1YKTA 4Y76A 1KXCA 5E0JA 4WJG2 4K1SA 5LPEA 1QR3E 1GMDG 5AFZH 3E6PH 1ZJKA 3FAOA 1HXFH 4BTIB 4BAOB 1GBBA 3S9BA 2AMDA 3PMJA 1C2KA 4FVBA 1W3CA 1QB6A 1O3JA 3ELAH 4AOQA 5JBTA 2VVVA 3H7OA 1A5HA 1GI1A 2C93B 5LPRA 5IYTA 5GCHF 3U1IB 4ABGA 5SGAE 4UFGH 1OWIA 1SGFA 1TX6A 1O2RA 1O3AA 4FXGH 4I8HA 2KAIA 2WV5A 4WH8A 1D3QB 3SGBE 4ZHAA 3GY4A 2G5VA 1DWCH 1Z6JH 1DWEH 3BEIB 4X8UH 3V0XA 1O2GH 1G3EA 1SL3A 1MTUA 1YLDA 2YNAA 1BTZA 3V7TA 3RMOH 2SNVA 3BIVH 1N6XA 2ZTZA 1SVPA 1QFKH 1A2CH 1GBFA 3VB4A 3N7OA 3RXIA 3RM0H 1C1RA 1E38B 2BD7A 2TRMA 1TGSZ 1CSOE 4MTBA 1SFQB 4WH6A 4B76A 3TU7H 1C5PA 2STAE 1AFQB 1GJ4H 4JK6A 4X6PA 2OD3B 3ZZ3A 2PUQH 4IGDA 1UK3A 5DGJA 3ZYEA 4AB8A 2CHAB 3M7UA 1C5WB 2ODYB 1KDQA 2HNTC 2BVSH 4K60A 3RUOA 1HIAA 1V2ST 1GBCA 3SNDA 3URCA 1ELEE 1GBKA 1VITG 2QF3A 1IQIA 4AG2A 3EAJA 1W14U 5C67A 3OU0A 1Y59T 1LHDH 3FVFB 1O3MA 3UWIA 4CRFA 4NIWA 3SUFA 3GCOA 3SU4A 1TNHA 1O3NA 3A8BA 4TWYA 1C1TA 2OCVB 1ARCA 1RTFB 1V3XA 4X6OA 3ZVEA 1WQVH 1T7CA 3P8FA 1EAIA 3BSQA 1FY3A 1A4WH 4BAQB 5C1UA 2ZHEH 1P2NA 5DP5A 1GVKB 4Y7BA 1O5BB 3RXHA 1AE8H 1O39A 1XXFA 2F9PA 4X8VH 2BX3A 2NU3E 1TNLA 1IQJA 1TIOA 3FP7E 4GPGA 5C2ZA 4H6TA 5T6GA 1MQ5A 4JYVH 3A83A 4XE4A 3ZYDA 1GJCB 3K9XB 1P2JA 1BTUA 1SGEE 2ZDNA 3UOUA 4ZMAH 1V6DA 2GZ7A 3BF6H 1IHTH 4FUEA 3QDZB 2O8WA 1GHAF 1AE5A 1KLTA 1O3KA 1ZMNA 2VU8E 4LOYH 4R8TB 1K1JA 1W8BH 1AVWA 4MDSA 2A7JA 2ZU2A 1OP8A 3D49H 5JPMH 2ZU3A 1LHFH 3A7VA 2R0LA 1BHXF 2FOGA 2ZDLA 4NCYA 3ZVDA 4YLQH 3SUDA 2BM2A 3GCNA 5A0BA 2BLWA 1DSUA 1T32A 1Y8TA 2BQ7B 4Z6AH 4X0WU 2IPHA 2VVCA 5C3NA 1Q31A 1V2LT 4O03A 4TPYA 3TPIZ 4D9RA 2B9LA 3L33A 3TGKE 1O2SA 3TK6A 2EI6A 3T28A 3H5CB 1GL1A 4ABFA 1SR5C 2XBXA 3PMHB 3KNXA 1E0FD 1BTPA 2FM2A 1CBWB 1WAYB 2FS9A 1A46H 1O3GA 2GTBA 4R0IA 2VGCB 1RFNA 4IC6A 2G51A 4B73A 1C5NH 3BV9B 1O2UA 3CENA 1RS0A 1CE5A 3U69H 2TGPZ 2EEKA 1DLEA 3A7ZA 3A8DA 3T25A 2QN5T 1O3DA 3SU5A 1J8AA 3RXGA 1ZSJA 1BJUA 4GVUA 1RTLA 4OS7A 2ZHFH 5T6DA 3VXFH 5ABWA 1C5YB 5DP9A 3ATMA 1EZXC 2OQ5A 2F9OA 4YT7H 5GXPA 3BG8A 4K8YA 5C1XA 1C1UH 1SLUB 1K1LA 3GYLB 3M5OA 2A32A 1A1RA 3S9AA 1EZUC 3K2UA 3UR9A 3SGQE 3I77A 1ZTLA 1ETTH 5EG4A 2ODPA 2H5DA 2ZPSA 1PJPA 2O9QA 1T8MA 2PGQB 5DP7A 3GY5A 1BMNH 3LGWA 1LKBA 1L1GA 2ZU1A 3RMMH 3GISB 5TJXA 3RXEA 3MTYA 1GHBG 4I7YH 4X1NU 3BTGE 3MU0A 4J1YA 2G81E 4IC5A 2FX6A 2GKVE 2W26A 2A5IA 1SI5H 4X1RU 2ZU5A 1SC8U 4UE7H 1GDUA 2GGVB 4NWLA 1ANCA 3M7TA 4Z0KA 1GBEA 2Y81A 3SQHE 2GV6A 4Y8YA 5FX5A 2ZFPH 1FN8A 1TNGA 2FOHA 1QNJA 2O8TA 2O8UA 3UOPA 1HLTH 2UUJB 1EB1H 1UTNA 1ZSKA 2QXHA 3B9FH 1TBQH 5DJ7A 4OS1A 1NT1A 3M5MA 1TGCA 1FQ3A 2FMJA 5A8ZA 3Q76A 1AKSA 1BUIA 4FUBA 4HI3A 4UFEH 3DA9B 4VGCB 4BAMB 3F9GA 1V2VT 4FU9A 1J17T 4ZKRU 1ZYOA 2BY5X 1NN6A 1IQEA 1E34B 2SGAA 2ZFSA 3ZZ7A 2F9NA 3F1SB 4WF8A 1GCTC 1TOCB 2R2WU 1GI9B 2D1JA 1UTKA 2UWOA 5CHAC 2A7CA 3C27B 5FXLA 3MHWU 4FUIA 3MU5A 4BANB 2FOBA 2ZHWH 5AVDA 2BMGB 2AEIH 3QN7A 3TVJB 1Z7KA 2FOCA 4YO9A 1HJ8A 1C5VA 4YLUA 1EX3A 3UY9A 3E90B 2G4UA 5A8YA 2ZHQH 3MNBA 1GI5A 1MH0A 9ESTA 1C2JA 4NIVA 3K65B 1BOQA 3A85A 4MQAA 2PKAB 1YYY1 2ANWA 1K2I1 2GCHG 4WY3A 5L30H 4NFFA 7LPRA 2VB0A 3ZZ6A 2A45B 3T26A 1YPEH 3PWCA 1DLKB 2VH6A 4Y8XA 1O2IA 3SHAH 1MTWA 1UK4A 3T27A 4AFUA 3FFGA 2B0FA 1GBTA 2J2UA 1BBRH 1JBUH 2ZC9H 3RC5A 4B71A 2ZU4A 3O8RA 1HXEH 1QRZA 1PPHE 2XCFA 1TWXB 2WPLS 3PTBA 3SNBA 2Y7ZA 1K1NA 2WYGA 3QGNB 4K1TA 4A92A 1SB1H 1LMWB 2QXGA 1GMCG 1EAUA 1GI7B 6GCHG 3P8OA 2ZKSA 5EU8A 1G37A 1Z1IA 4DG4A 1PPBH 5HM2A 1ZPZA 5GIBA 4ZXXH 2A2XH 1LCYA 2XBVA 4X1SU 1MZDA 1B5GH 2PKSB 2WUCA 3SU0A 1G9IE 1DS2E 3QZQA 1N8OB 3CP7A 5FPTA 2FLRH 3RXLA 2P3UB 2BDBA 2F3CE 1BDAA 4YOIA 2ZCKP 3OY5U 1MKXK 4XOJA 1ZHPA 4B2BA 4CRGA 1TX8A 2QAAA 1NFYA 1F2SE 1NROH 2Y5GA 5F8ZA 2G00A 2GCTB 2A4QA 3ZV8A 1GG6C 4OGYA 2ZPRA 2BD8A 4Q7ZA 1OS8A 1KXFA 1A0JA 1O3LA 3NWUA 5CHAB 1HJAB 3VPKA 1FXYA 5DP6A 1O2KA 2BTCE 1GJ9B 3V13A 2CXVA 1TQ7B 2AIQA 3B8JA 2D26C 2OBOA 2YOLA 3HK6B 1D3TB 1PQ7A 3PMAB 1GHZA 5FPSA 4VGCC 3P8NA 4AGJA 3UNQA 3TH3H 3VB6A 4B1TA 3QTOH 1FY4A 3LOXA 2Q6GA 1XUIA 1UK2A 2XYAA 4FUHA 4ESTE 4YM9A 4UFFH 1O2XA 3A88A 1C5UA 4BAKB 5TCAA 6ESTA 4NGAH 3PO1B 3T29A 1BB0B 2BLVA 5F03A 4CH8B 2GX4A 5HGGA 1C5ZB 1L2EA 4X2YA 2Y80A 3RXAA 4AYYB 3MNXA 1QB1A 5BPEA 1SQOA 3SV6A 1XUKA 1DFPA 1GPZA 1XUFA 2BB4A 4JYTA 4WMDA 3ITIA 5L2YH 2P93A 1O3EA 3UREA 1WSSH 1O2VA 1O5CB 3SQEE 3EQ0H 4UD9H 1NRRH 2BLOA 1P8VC 3MFJA 4A1XA 1P01A 3RXJA 2ALPA 1FZZA 2XNIA 5FBEA 1ZOMA 5T6FA 3RXMA 1T4UH 1E35B 1AB9B 2ZIQH 1WUNH 2PSXA 3QX5H 1GJDB 2J4IA 1QY6A 4BTTB 1WQSA 1O5DH 3U8TH 1NZQH 1O3PB 1C4U2 2A5KA 1FNIA 1O5EH 1ZR0A 1JMOH 1GBHA 2NU0E 1T8NA 2G52A 3RP2A 2R3UA 3A84A 5JBAS 5EPYA 3RXKA 2SNWA 5LH8A 1O5AB 1GMHG 5FHTA 2VIVA 1O2JA 5EOKA 3ZVFA 2ZGCA 1BTWA 1WBGB 5EPNA 4XDEA 2NU4E 1GMCF 6GCHF 1AO5A 1OWEA 1O2QA 1RD3B 3BTKE 3TLOA 1C9PA 4D76A 1HAZB 3BTFE 3O8BA 3T2NA 1B0FA 5C5NA 1H9LB 4NSYA 4A1VA 1W11U 1PPZA 2AGGX 5LGOA 3HATH 3SU3A 1LPZB 1CHOG 1GJ7B 1SHHB 3RDZA 1YPMH 1P12E 2ZQ1A 5FPYA 1MKWH 2QA9E 2XTTB 1LVYA 3VGCB 1UVPA 3P70B 1C1NA 2KAIB 3ENSB 4ABIA 4NA9H 2VIPA 4ZKSU 1ELTA 1LHCH 5EQRA 4CHAC 1T4VH 2BD2A 3SJOA 1V2OT 3ZVCA 4I33A 1BMMH 2A0QB 2CN0H 1SSXA 1QRXA 2ANYA 3UQVA 4XSKU 2GMTC 4AFSA 1ABJH 1MTSA 3LC3A 1ESTA 2ULLA 3MO6A 1BRBE 2ZGHA 1Y5UT 3RXTA 3SHCH 1LQDB 2ZA5A 1EOJA 1F5RA 2J9NA 1YPKH 1MAYA 4CRDA 1EPTC 4SGAE 4BXWA 2V0BA 1ANEA 1QCPA 4AX9H 1A7SA 1V2UT 1K21H 3MH6A 1ELBA 3LGIA 1O2ZA 1WYKA 1KSNA 3SU1A 1SPJA 5EODA 1ZRBA 1O3CA 1CT0E 1UHBB 1P57B 3GCHC 2F9BH 4BOHA 7ESTE 1NRNH 3U8OH 1AD8H 4I8JA 2QCYA 3R0FA 2ZEBA 4HGCA 1C2FA 1HGTH 3LT3A 3M7QA 4GLYA 2CF9H 1FY8E 1TA2A 3M3VA 4YZUA 1SHYA 3GCHB 1UTOA 3UIRA 4DURA 4U32A 3EA9A 1SLWB 1ZPBA 2VWMA 2QF0A 4I8GA 3DT0H 4Q80A 4ZHMU 4Q7YA 1V2MT 2PV9B 3HPTB 3RU4T 4UFDH 3KQDA 4NSVA 1NY22 2M5TA 5PTPA 2BOKA 1BT7A 3I78A 4GHQA 2BY9X 1ANBA 3LPRA 1MQ6A 3RU4D 3RXRA 1NRSH 1OWHA 4AN7A 4XBDA 1OYTH 1VCWA 1IQGA 4DCDA 3UQOA 2QXIA 3K6ZA 4IS5A 1S0RA 1BIOA 1SQAA 1MKXH 3KEEA 2Z9IA 2BD9A 4AB9A 2D2DA 1KY9A 1O2PA 1YC0A 5GPIB 1B0EA 1GCDA 4XBBA 1F5LA 1ANDA 1DWDH 1GBDA 2WPHS 1AZ8A 1VJ9U 1W10U 2XRCA 1ZLRA 1DOJA 2VWOA 3GDUA 3QK1A 1FV9A 3HK3B 1T8OA 2B8OH 1TMBH 3TH2H 5EW1H 3E8LA 4D7GA 2SGQE 1VZQH 4INLA 3Q3KA 1P3CA 1V2PT 4OGXA 3U8RH 1BCUH 2PUXB 5E2OA 1QBNA 1HAYB 2V3OH 1O3OA 2H5CA 1O5GH 4HZHA 2Y6TA 5K0HA 2ZGXH 2P95A 1BBRE 2ZDKA 1BBRK 1QQUA 1GWAA 1QGFA 4INHA 3QWCH 4HFPB 5AF9H 2P94A 9LPRA 5GJ4B 1HPGA 3GICB 1GGDB 2F9UA 1NRPH 1GI2A 1PPGE 1O5FH 2XBWA 4CR5A 2WV4A 1MTNC 4KTUA 3JZ1B 1L1NA 1FMGA 4DVAU 2DE9A 1N6YA 1HAIH 1KXDA 2H9EH 3M5LA 3KN2A 2J34A 2AGEX 1SGCA 2FOFA 1XMNB 1C5OH 2ZCLP 3NCLA 4E7NA 3RC6A 3ZVAA 3P6ZB 2OC0A 4H4FA 1RTKA 3MU1A 5JBBS 3RLYH 1UTPA 3TJVA 4A6LA 4ZKOU 3TITA 1GJ8B 2QIQA 1C1OA 1Y5BT 1ETRH 1HAHH 3BTWE 1AVGH 3ZVBA 1NU7B 1TNIA 1EPTA 3E16B 2HWLB 3VFEA 3B23B 2WYJA 3D65E 1DX5M 1FIWA 4GUXA 3SUEA 3SN8A 1Z8JB 2VH0A 2FOEA 1EASA 2VWLA 3S7HB 4E7RG 2FI4E 1AIXH 4CR9A 2A2QH 1S81A 1LTOA 1P9SA 2EC9H 4MPVA 4ZUHA 1C2LA 1BMLA 1SGPE 1UVUH 4TWWA 2J95A 4K5ZA 2FI5E 2CJIA 2FYQA 3RXQA 5EXLA 2ZI2H 3PV4A 3QLPH 4DW2U 1AZZA 1JRSA 1FY5A 4Y8ZA 5CMXH 4WVPE 1EZSC 2RA3A 4RKJB 4YOJA 3GY6A 3H7TA 4AORA 1BTHH 1NRQH 1OWDA 2OQUA 2FODA 2EI7A 1YF4A 1Z1JA 1ELFA 1GG6B 4YESB 4X1QU 5E8EH 3O8DA 1AUJA 1QRWA 3GDVA 1LPGB 5B6OA 4CBNA 2BDCA 1LDTT 4MPXA 4K2YA 1ELVA 2XC5A 3LJJA 1P11E 3RXBA 2XCNA 1P03A 2SGDE 1MTNB 1FAXA 1O32A 4UONA 3Q3XA 3HKIB 1GBMA 1O3BA 1TPOA 5DO4H 1SLXB 1QTFA 4X8SH 3UUZA 1RIWC 4FU7A 1ESBA 2PW8H 2GDEH 1CQQA 2FO9A 2HPPH 3EA7A 1SGIB 1QA0A 5IDKA 2ZFQH 1P04A 2A31A 1EATA 1VCQA 1HJAC 2ZECA 1XKBC 5I46H 2ALVA 3CS7A 1CVWH 1PQAA 5GWZA 1P05A 1QJ6B 1O33A 3BIUH 4NFEA 1K9OE 4NA7A 3RXPA 1L4DA 1TGTA 1DICA 4X8TH 5TCCA 1J14A 1SQTA 4KGAA 3T62A 3LONA 1JXPA 4E06H 1KYNA 3RM2H 1O2TA 2P3TB 5DG6A 1EOLA 1HAXB 2BDIA 4DT7B 4I8LA 1F0UA 1MCVA 2ZHDA 1GI3A 2Y5HA 2JH0D 1LVMA 2V3HH 3ZZ8A 3EA8A 3UTUH 2ZF0H 2H9TH 2UWLA 2GZ9A 4IMZA 3VB7A 2CGAA 1N1LA 2ILNA 2P3FH 1LVOA 4IN2A 3IITA 1TONA 1SLVB 1GVZA 2GDDA 3LDXH 1C2EA 4Y79A 1AMHA 1H9IE 1D3PB 4LXBH 1OPHB 1AWHB 3AW0A 1NU9A 1YP9A 4MNXA 1CA0B 2QGRA 1X7AC 2FESH 3BTTE 2ODQA 2EA3A 2O8LA 4FUJA 3QGJA 4J2YB 1G30B 1GMHF 1IOEA 1FDPA 3E91A 1D6RA 3RXOA 1BRUP 1FPCH 2H2ZA 3TJUA 4CRBA 4Q7XA 1U6QA 1G36A 1W0ZU 1XUGA 4X6NA 2QV1A 3GY2A 4JZFH 1SFIA 3OSYA 2PKAA 2VWNA 2A4GA 4U30A 3FP8E 1HRTH 5FCRA 4B75A 4PROA 4JCNA 4Y7AA 2XW9A 3ZZBA 3V12A 2PR3A 2B5TB 3GY7A 2C3SA 3KQCA 2C8WB 2YNBA 4MLFB 1A3BH 3UPEA 4I8KA 1UTMA 3KIDU 2I6QA 1CHGA 1O3FA 1HV7A 1J9CH 1CT4E 4Y6DA 1PPFE 3PLPA 4XBCA 1V2JT 1GJ6A 5F6MA 2FEQH 1CU1A 1O30A 2ZFFH 3TIUA 1ZHMA 1Y5AT 3RXDA 1ID5H 2C90B 2R3YA 2VIDA 3NKKA 2TIOA 1MD7A 2Z9JA 1Y3VA 5A8XA 3EE0B 2BOHB 1B7XB 3SU6A 3TGJE 2RA0A 2FIRH 3O8CA 4NIXA 3AW1A 2OC8A 1J15A 2F9VA 1SOTA 1C1MA 2FTMA 2ZZUH 4OS2A 2FOAA 5E2PA 2A1DB 3STIA 2SGPE 4Y71A 2EI8A 1O35A 3MYWA 1MKWK 3BTDE 1C5RA 1DANH 1AGJA 2V35A 1Q2WA 1SGQE 1UTQA 2IN2A 4BTUB 2VGCC 5E0GA 2Z9LA 5ESBA 3NPSA 5DP3A 3M5NA 3T5FH 1TPPA 2ANKH 1EJNA 3KL6A 1VGCC 3EDXB 3TNTA 3ZZDA 3PYHA 6CHAC 2FWWA 1DITH 2TBSA 4MNYA 4E05H 2P59A 2Y5FA 3S7KB 1TBZH 1G3DA 1UVOA 1GJAB 3LU9B 1OYQA 2J38A 4OS4A 4X6MA 3RXUA 3MNSA 2BQ6B 2VJ1A 4MPUA 4JZ1A 1PYTC 1DE7H 3M3SA 1F5KU 4MNWA 1MAXA 1LHEH 1O0DH 3VB3A 3F6UH 4B2AA 2BLQA 1SGDE 1EXFA 3LJOA 3I29A 4NZQA 3MU4A 4DIIH 1EUFA 1SGRE 1O2YA 1HAVA 3BN9A 5L2ZH 4FVDA 1ZTKA 2FX4A 5EQSA 1MBMA 2HOBA 3BG4B 1AB9C 3PLBA 2ANMH 2ZPQA 4WXVA 4BXSA 1ARBA 3PTNA 1C5LH 1DSTA 1TRYA 2AIPA 3BTEE 1AN1E 5JYIA 3HKJB 2Q1JA 1L0ZA 1OXGA 4A1TA 3SNAA 3ZV9A 1EJMA 3TJOA 1P10A 2JETB 3TNSA 1RJXB 1T31A 1XVOA 4YTAA 2OTVA 3RLWH 2G55A 1C1VH 3UR6A 1VCPA 3RXCA 1S6HA 2Z3EA 2JH5D 3QZRA 1GHYH 2V6NA 3E0NB 4MNVA 4K69A 1TPSA 3RMNH 3Q3YA 1ZRKA 2BZ6H 2GCHF 2BY8X 4Q2KA 4TPIZ 3PLKA 1ZSLA 1FONA 4OS5A 1F7ZA 2ZNKH 1PYTD 2A7HA 1K28D 5JDUB 2Q6FA 1IQNA 1THRH 2HPQH 1H8DH 5DKMA 1TNJA 2HVXA 1S83A 1K1PA 1O38A 1F0TA 1VITF 3ODDA 2RDLA 1O2LA 3GYMA 4KTCA 4AG1A 3NK8A 3A8AA 4TY6A 3U1JB 2PLXA 2WPJS 1F0SA 1GJBB 1KXBA 3M37A 3PWBA 1SMFE 2FP7B 2VINA 2ZFRH 3SBKA 1EZQA 1WU1A 2VIQA 4CRCA 3BEUA 1MUEB 1NS3A 5DP4A 3TK9A 3BEFB 2B7DH 1DXWA 3PROA 1LKAA 1BJVA 5J4SA 8GCHG 3IWMA 1HIAB 1HBTH 1DPOA 1C5QA 1DDJA 1QURH 1GHVH 2AGIX 3AAUA 4I32A 1OSSA 1W13U 1DM4B 2OP9A 1O2MA 2R9PA 2C8YB 1HCGA 1O3IA 3AASA 1C1QA 1QL8A 1C2GA 4Y0YE 4ISOA 1DWBH 3NXPA 5A2MH 1QJ7B 1VJAU 2OLGA 1PFXC 3F68H 1O2OA 4X2VA 1DXPA 3GCTF 1K22H 1GI4A 4ISLA 1QJ1B 1MCTA 1D3DB 1LHGH 3R3GB 2CV3A 3MWIU 1ZGIA 2A5AA 1KIGH 1WTHD 3SV8A 3FP6E 1UTJA 1FAKH 5C1YA 5EXMA 1W7XH 1W7GH 7KMEH 5G4BA 3SI3H 1T8LA 2ZFTA 3EYDA 1V2KT 1Z6EA 1TRNA 1TAWA 2K1QA 2ZGBH 2OC1A 1MU6B 3VXEH 4LZ4B 7GCHF 2FZZA 2ASUB 1ACBE 2Z6BD 3A8CA 3KHVA 8KME2 1F92A 2FTLE 1IQHA 3LH1A 1EP6A 1ZZZA 1ZHRA 4Y10E 3KGPA 1P06A 2FS8A 1EQ9A 2P16A 2BVRH 1GI0A 1TPAE 5F8TA 3HGPA 1GDNA 1D6WA 3DHKH 4ABAA 2Z3CA 2JH6D 2JETC 4FUFA 1GL0E 1ETSH 2ZQ2A 4GCHG 5DK1A 5DPAA 4H42U 2J94A 1IAUA 1UHBA 1NPMA 1CT2E 4GCHF 1P0SH 1TX7A 1K1MA 4I31A 1ZGVA 1F0RA 5FAHA 2Q6DA 1YPJH 1G2LA 2GT8A 2BDYA 1SGTA 1Y3XA 3A89A 2BQWB 5A0CA 3ATWA 4HTCH 2GMTB 4ABBA 4CBOA 1FIZA 1YPHC 4AZ2B 2VIWA 1RXPA 1NESE 1M9UA 4CHAB 3QO6A 4FUGA 4XFQA 1S5SA 5HMAA 2H9HA 1UCYH 1RIWB 1HAGE 3M36A 2Z9GA 2BY6X 2BDGA 3MH5A 3D62A 3W94A 1GHAG 2PSYA 4LK4A 1HJ9A 3MH4A 1XXDA 1C2DA 1CO7E 1G3CA 1LVBA 5GDSH 3TJNA 2PTCE 3S0NA 1Z8IB 1P3EA 1S82A 1AVXA 3KF2A 4IBLH 2VVUA 1JIMA 1NFXA 1VGCB 3M35A 4YT6H 5AHGH 2TGDA 5CE1A 1O2NA 3LC5A 1TA6A 3P8GA 3RXFA 1WTGH 1O36A 1UJ1A 2XWAA 2W5EA 4SGBE 2WPKS 1C4V2 2FPZA 2QC2A 1YCPK 2NU2E 1TLDA 3SUGA 4OS6A 3RXVA 3VEQB 1UMAH 3SU2A 1GHXH 1MD8A 3SOSA 4WWYA 1L1JA 3BTHE 3SJ8A 5FBIA 3F9HA 1AHTH 1GDQA 1PQ8A 1C5MD 1A0HB 2ZCHP 1QIXB 4K1EA 1FPHH 2ZO3H 3L3TA 3LGUA 3ATKA
chains in the Genus database with same CATH superfamily
1K1OA 1ABIH 1P09A 1D4PB 4NG9H 5EJZA 3ZZ9A 4AFZA 1QBVH 3URDA 2VIOA 3LGVA 2NWNA 3WY8A 5E0HA 3BTME 1H8IH 1YM0A 1UCYE 2ZG0H 4AC9A 1CGHA 1W12U 4ZCNA 2K8IA 3MH7A 4Y11E 4YOGA 4IW4E 3PV2A 3LKWA 3PV5A 1A5GH 3MO3A 1BMAA 3SORA 3F9EA 1P9UA 3PMBB 5JB9S 4TY7A 1MZAA 2HNTE 3OYPA 1IHSH 4IN1A 1EB2A 1PPCE 2AMQA 2FI3E 3LGYA 4A5TS 4ZHLU 2V7QD 4ZKNU 1E36B 3V3MA 3SJKA 2TGAA 4NIYA 2FXRA 3RU4E 1BA8B 1GJ5H 2ZDMA 3MI4A 1V2RT 3QTVH 1CGJE 1DUAA 1EAXA 4TYDA 2GV7A 1GVLA 2OUAA 4GAWA 3WWFA 3MO9A 3U9AH 5C5OA 2W7SA 1HB0B 1KLJH 1AQ7A 5EJ1A 5HYOA 2WHXA 4JZEH 2VBCA 1W2KH 3FKSD 4CREA 1JWTA 5EGMA 3VB5A 3GDSA 4NA8A 3SV9A 3IG6B 1ZMJA 2UUYA 1BRCE 3FZZA 1GHBF 4JZIA 2W7UA 4CH2B 2GP9B 2WPMS 1G3BA 1HAVB 1ELGA 2WPIS 4O97A 3SV2H 1SGNE 3K6YA 1QHRB 4D8NA 4UDWH 1Y3UA 3E0PB 3P95A 4X1PU 3FANA 1P2QA 4Q63A 1SGYE 1ELAA 1A3EH 1TALA 4ZXYH 2JJ1D 1AWFH 4O9VA 1VITH 4B2CA 3A86A 1KDQB 2GZ8A 4AYVB 5F8XA 3OFND 1GHWH 5JB8S 3RXSA 1OWKA 3SJIA 1IQMA 1A0LA 1YLCA 4GSOA 4D7FA 2DUCA 1KLIH 3ZZ5A 1QL7A 1INCA 1JIRA 2H6MA 2CHAC 1C1WH 3A7YA 2PTNA 3KQEA 1CHOF 1JRTA 2OC7A 1TQ0B 3S69A 2AH4X 3BG4C 1THSH 1G32B 1UVTH 1QA7A 4ABEA 1DY8A 2DE8A 4MPWA 1OOKB 2PGBB 3SJ9A 4DY7B 2AERH 1V2QT 4IMQA 1TNKA 2SGFE 1NTPA 3N99A 1AKSB 1ORFA 2IOTA 4ABDA 2Z94A 2ZWLH 1ZTJA 2XXLA 5I25A 4FUDA 1DY9A 2FYRA 3A80A 3SI4H 1XUJA 3HGNA 4ISNA 1Q3XA 3TGIE 2NU1E 1EKBB 2OINA 1GBAA 2FDAA 2ZTYA 4BNRA 2QXJA 5HXFA 2BVXH 1EAWA 3NZIA 2SFAA 2W3IA 1C1PA 2Z9KA 1E37B 4KELA 1OKXA 4KTSA 2PWXA 2HRVA 3OX7U 1UVSH 3M3TA 5T3HA 1FLEE 1TGBA 1S6FA 3P92A 1AY6H 1SG8B 2GT7A 1TYNA 3UWJH 2ZP0H 2I6SA 2AYWA 1V2TT 3EGKH 2P8OB 3RC4A 4JMYA 4UEHH 2HALA 3STJA 1H4WA 1V2WT 3E1XB 1SGFG 1V2NT 1GCTB 1NM6A 1O37A 3GY3A 1EPTB 1OX1A 4LZ1H 3DFJA 3TK5A 5H4IB 1ELCA 4NZLA 1VR1H 4ZAEA 2BXTH 4ABJA 2XBYA 2BD3A 2ZDVH 2QYIA 3SW2B 3SO3A 1GBLA 2Y7XA 2BD5A 5EQQA 2RCEA 1THPB 5T1VA 3PB1E 8GCHF 2BXUH 5ETXA 1IQFA 2BDHA 1UCYK 3GY8A 1P2OA 3ZZAA 4D9QA 1KXAA 1H8ED 1P2KA 1CBWC 1HAOH 4AGKA 3OTJE 6CHAB 4ISIH 2HVYB 1NO9H 1BQYA 1HAPH 2ZGJA 2Y82A 4M7GA 1XKAC 1BITA 1C5XB 1PPEE 4ZH8A 1BHXB 1BTXA 1QQ4A 1ZJDA 2BD4A 2LNCA 2OK5A 3FZDA 1PQ5A 3ESTA 2J92A 4X2WA 4QT8C 1AUTC 1NC6A 4K8BA 1TFXA 4NWKA 6LPRA 4ISHH 1KXEA 2C4FH 1IQKA 2THFB 3W95A 2C8ZB 1H9HE 1CGIE 1FJSA 4K3JA 1O3HA 1WDIA 1S85A 1D9IA 2BYAX 1YPLH 1RRKA 4KP0A 1JOUB 1UTLM 1C1SA 1C5TA 1MTVA 2HGTH 1C5SA 5GCHG 4GHTA 1TRMA 3TH4H 5AFYH 3AAVA 1CA0C 4FU8A 3ODFA 1OP0A 2J5UA 4F49A 1BRAA 2BY7X 2YMSD 3A7TA 2KFWA 1G2MA 3A7WA 1P2MA 2F83A 3A82A 3PM3A 1HUTH 2BHGA 3M61U 2A4RA 3KQBA 2OXSA 4M9FA 3A81A 1P2IA 2UWPA 4DGJA 1TB6H 1DUEA 1FI8A 3S9CA 5BRRE 3P17H 1HYLA 3F9FA 1TMTH 4O3TA 3LIWA 3A7XA 1GMDF 2LPRA 2IJOB 3DUXH 1A61H 4U01A 5CHBA 3ZZCA 3MMGA 2VNTA 2HNTF 1GBIA 1TABE 2W3KA 4F55A 5K7RA 4B74A 4AFQA 1DT2A 1YGCH 5A09A 3G01A 2OBQA 1DVAH 1HDTH 4RKOB 2AMPA 1NFUA 2J97A 1YPHE 1ZMLA 1ELDE 1FUJA 2G4TA 1BZXE 1C2MA 2O8MA 2AHME 1UW7A 2TGTA 3DFLA 2R2MB 2QE7D 4ASHA 2AFQB 4ABHA 2BZAA 4ZROA 1GBJA 1TGNA 1HNEE 4TSFD 1MBQA 1MMJN 3UNSA 4RI0A 4X2XA 2C8XB 4JYUH 2CF8H 4A7IB 1WCZA 3MNCA 2JKHA 2HLDD 2JDID 5EW2H 2ESTE 1OWJA 1RGQA 2XC4A 1MU8B 3SGAE 3SZNA 4RN6A 2AS9A 2H1UA 5A0AE 2UUFB 2XNDD 4BAHB 4KKDA 5L6NH 1J16A 1EJAA 3Q00A 2P8OC 1KTTB 5CDFE 1TOMH 8LPRA 1Z71A 1GI6A 3U98H 3LH3A 2KCOA 1LPKB 3E3TA 4H6SB 4WMFA 5LPFA 1YCPM 5J4QA 1XM1A 7GCHG 2G5NA 3GOVB 3OY6U 5JBCS 3UNRA 1WOFA 1XVMA 2GD4B 1YY3A 3D23A 1C4Y2 5DP8A 8ESTE 1YWUA 1L4ZA 3A87A 5FCKA 3PO1C 3AVZA 1LQEA 4FUCA 1C2IA 5EXNA 3CS0A 1AI8H 4Y0ZE 2BX4A 2GVFA 4O3UA 1AU8A 1AFQC 2WZQA 3C1KA 1QB9A 5HM9A 2STBE 2CMYA 3RMLH 3JZ2B 2RG3A 4CRAA 1NFWA 3GCTG 3UAIC 1Y3YA 3DD2H 3ZVGA 2FOMB 5FX6A 1TE0A 1YBWA 2FLBH 5DN6D 3MOCA 3L6PA 1O2WA 3UFAA 2HLCA 2UUKB 1WV7H 4JZDH 1O31A 4TT3D 2R0KA 1LO6A 1YPGH 1EP5A 1K1IA 4THNH 4B6FA 2GCTC 5ESTE 3ATLA 4HG6A 4DIHH 4DJZB 1AFEH 3GS9A 3KCGH 1C9TA 1YCPH 2WINI 4DOQA 3SNCA 1BTYA 2ZDAH 1H1BA 1WXRA 3SNEA 4MVNA 3BTQE 1ZPCA 3VGCC 1CA8B 1O2HA 4RSPA 1TMUH 2QY0B 4JK5A 2TPIZ 1N8OC 2Z3DA 1S84A 1W0YH 2PKSC 4U2WA 1UO6A 1S0QA 3SV7A 1Z8RA 1OP2A 2Z7FE 2WUBA 1P02A 4MG3A 2J98B 2D8WA 1Y3WA 1HFDA 2PHBA 4F4OC 2XWBI 3Q77A 1GI8B 3KQ5A 1Z8GA 1A5IA 1FN6A 3LGTA 1SBWA 2BDAA 1KTSB 2G8TA 2PFEA 1ESAA 2IPQX 2SGEE 1QL9A 2ZTXA 1C2HA 1GGDC 1QBOA 5C20A 1TBRH 2A4OA 3ATIA 4WMEA 2F91A 1O34A 3ZZ4A 4INKA 3QUMP 1XX9A 3MU8A 3NUMA 1FY1A 2XC0A 1SOZA 4WXIA 1IQLA 1XUHA 1YKTA 4Y76A 1KXCA 5E0JA 3W1EA 4WJG2 4K1SA 5LPEA 1QR3E 1GMDG 5AFZH 3E6PH 1ZJKA 3FAOA 1HXFH 4BTIB 4BAOB 1GBBA 3S9BA 5EIYA 2AMDA 3PMJA 2KCPA 1C2KA 4FVBA 1W3CA 1QB6A 1O3JA 3ELAH 4AOQA 5JBTA 2VVVA 1FX0B 3H7OA 1A5HA 1GI1A 2C93B 5LPRA 5IYTA 5GCHF 3U1IB 4ABGA 5SGAE 4UFGH 1OWIA 1SGFA 1TX6A 1O2RA 1O3AA 4FXGH 4I8HA 5EJLA 5HIZA 2KAIA 2QF5A 2WV5A 1D3QB 4WH8A 3SGBE 4ZHAA 3GY4A 2G5VA 1DWCH 1Z6JH 1DWEH 3BEIB 4X8UH 3V0XA 1O2GH 1G3EA 1SL3A 1MTUA 1YLDA 2YNAA 1BTZA 3V7TA 3RMOH 2SNVA 3BIVH 1N6XA 2ZTZA 1SVPA 1QFKH 1A2CH 1GBFA 3VB4A 3N7OA 3RXIA 3RM0H 1C1RA 1E38B 2BD7A 2TRMA 1TGSZ 1CSOE 1YLNA 4MTBA 1SFQB 4WH6A 4B76A 3TU7H 1C5PA 2STAE 3PRBA 5F53A 1AFQB 1GJ4H 4JK6A 4X6PA 3AK5A 2OD3B 3ZZ3A 2PUQH 4IGDA 1UK3A 5DGJA 3ZYEA 4AB8A 3N7EA 2CHAB 3M7UA 1C5WB 2ODYB 1KDQA 2HNTC 2BVSH 4K60A 3RUOA 2WSSD 1HIAA 1V2ST 1GBCA 3SNDA 3URCA 1ELEE 1GBKA 1VITG 2QF3A 2KCYA 1IQIA 4AG2A 3EAJA 1W14U 5C67A 3OU0A 1Y59T 1LHDH 3FVFB 1O3MA 3UWIA 4CRFA 4NIWA 3SUFA 3EE7A 3SZEA 3GCOA 3SU4A 1TNHA 1O3NA 3A8BA 4TWYA 1C1TA 2OCVB 1ARCA 1RTFB 3ZIAD 1V3XA 4X6OA 3ZVEA 1WQVH 1T7CA 3P8FA 1EAIA 3BSQA 1FY3A 1A4WH 4BAQB 5C1UA 2ZHEH 2L74A 1P2NA 5DP5A 1GVKB 4Y7BA 1O5BB 3RXHA 1AE8H 1O39A 1XXFA 2F9PA 4X8VH 2BX3A 2NU3E 3F2GA 1TNLA 1IQJA 1TIOA 3FP7E 4GPGA 5C2ZA 4H6TA 5T6GA 1MQ5A 4JYVH 3A83A 4XE4A 3ZYDA 1GJCB 4FETA 3K9XB 1P2JA 1BTUA 1SGEE 2ZDNA 3UOUA 4ZMAH 1V6DA 2GZ7A 3BF6H 5HKKD 1IHTH 4FUEA 3QDZB 2O8WA 1GHAF 1AE5A 1KLTA 1O3KA 1ZMNA 2VU8E 4LOYH 4R8TB 1K1JA 1W8BH 1AVWA 4MDSA 2A7JA 2ZU2A 1OP8A 3D49H 5JPMH 2ZU3A 1LHFH 3A7VA 2R0LA 1BHXF 2FOGA 2ZDLA 4NCYA 3ZVDA 4YLQH 3SUDA 2BM2A 3GCNA 5A0BA 2BLWA 1DSUA 1T32A 1Y8TA 2BQ7B 4Z6AH 4X0WU 2IPHA 2VVCA 5C3NA 1Q31A 1V2LT 4O03A 4TPYA 3TPIZ 4D9RA 2B9LA 2K0QA 3L33A 1O2SA 3TK6A 3TGKE 2EI6A 3T28A 3H5CB 1GL1A 4ABFA 1SR5C 2XBXA 3PMHB 3KNXA 1E0FD 1BTPA 2FM2A 1CBWB 1WAYB 2FS9A 1A46H 1O3GA 2GTBA 4R0IA 2VGCB 1RFNA 4IC6A 2G51A 4B73A 1C5NH 3BV9B 1O2UA 3CENA 1RS0A 1CE5A 3U69H 2TGPZ 2EEKA 1DLEA 3A7ZA 3A8DA 3T25A 2QN5T 1O3DA 3SU5A 1J8AA 3RXGA 1ZSJA 1BJUA 4GVUA 1RTLA 4OS7A 2ZHFH 5T6DA 3VXFH 5ABWA 1C5YB 5DP9A 3ATMA 1EZXC 2OQ5A 2F9OA 4YT7H 5GXPA 3BG8A 4K8YA 5C1XA 1C1UH 1SLUB 1K1LA 3GYLB 3M5OA 2A32A 1A1RA 3S9AA 1EZUC 3K2UA 3UR9A 3KYFA 3SGQE 3I77A 1ZTLA 1ETTH 5EG4A 2ODPA 2H5DA 2ZPSA 1PJPA 2O9QA 1T8MA 2PGQB 5DP7A 3GY5A 1BMNH 3LGWA 4RT1A 1LKBA 1L1GA 2ZU1A 3RMMH 3GISB 5TJXA 3RXEA 2PP6A 3MTYA 1GHBG 4I7YH 2W6ID 4X1NU 3BTGE 3MU0A 4J1YA 4OM9A 2G81E 4IC5A 2FX6A 2GKVE 2W26A 2A5IA 1SI5H 1W0JD 4X1RU 2ZU5A 1SC8U 4UE7H 1GDUA 2GGVB 4NWLA 1ANCA 3M7TA 4Z0KA 1GBEA 2Y81A 3SQHE 2GV6A 4Y8YA 5FX5A 2ZFPH 1FN8A 1TNGA 2FOHA 1QNJA 2O8TA 2O8UA 3UOPA 1HLTH 2UUJB 4B6EA 1EB1H 1UTNA 1ZSKA 2QXHA 3B9FH 1TBQH 5DJ7A 4OS1A 1NT1A 3M5MA 1TGCA 1FQ3A 2FMJA 5A8ZA 3Q76A 1AKSA 1BUIA 4FUBA 4HI3A 4UFEH 3DA9B 4VGCB 4BAMB 3F9GA 1V2VT 4FU9A 1J17T 4ZKRU 1ZYOA 2F43B 2BY5X 1NN6A 1IQEA 1E34B 2SGAA 2ZFSA 3ZZ7A 2F9NA 3F1SB 4WF8A 1GCTC 1TOCB 2R2WU 1GI9B 2D1JA 1K0HA 1UTKA 2UWOA 5CHAC 2A7CA 3C27B 5FXLA 3MHWU 4FUIA 3MU5A 4BANB 2FOBA 2ZHWH 5AVDA 2BMGB 2AEIH 3QN7A 3TVJB 1Z7KA 2FOCA 4YO9A 1HJ8A 1C5VA 4YLUA 1EX3A 3UY9A 3E90B 2G4UA 5A8YA 2ZHQH 3MNBA 1GI5A 1MH0A 9ESTA 1C2JA 4NIVA 3K65B 1BOQA 3A85A 4MQAA 2PKAB 1YYY1 2ANWA 1K2I1 2GCHG 4WY3A 5L30H 4NFFA 7LPRA 2VB0A 3ZZ6A 2A45B 3T26A 1YPEH 3PWCA 1DLKB 2VH6A 4Y8XA 1O2IA 3SHAH 1MTWA 1UK4A 3T27A 4AFUA 3FFGA 2B0FA 1GBTA 2J2UA 1BBRH 1JBUH 2ZC9H 3RC5A 4B71A 2ZU4A 3O8RA 1HXEH 1QRZA 1PPHE 2XCFA 1TWXB 2WPLS 3PTBA 3SNBA 2Y7ZA 1K1NA 2WYGA 3QGNB 4K1TA 4A92A 1SB1H 1LMWB 2QXGA 1GMCG 1EAUA 1GI7B 6GCHG 3P8OA 2ZKSA 5EU8A 1G37A 1Z1IA 4DG4A 1PPBH 5HM2A 1ZPZA 5GIBA 4ZXXH 2A2XH 1LCYA 2XBVA 4X1SU 1MZDA 1B5GH 2PKSB 2WUCA 3SU0A 1G9IE 1DS2E 3QZQA 1N8OB 3CP7A 5FPTA 2FLRH 3RXLA 2P3UB 2BDBA 2F3CE 5GNDA 1BDAA 4YOIA 2ZCKP 3OY5U 1MKXK 4XOJA 1ZHPA 4B2BA 4CRGA 1TX8A 2QAAA 1NFYA 1F2SE 1NROH 2Y5GA 5F8ZA 2G00A 2GCTB 2A4QA 3ZV8A 1GG6C 4OGYA 2ZPRA 2BD8A 4Q7ZA 1OS8A 1KXFA 1A0JA 1O3LA 3NWUA 5CHAB 1HJAB 3VPKA 5HIYA 1FXYA 5DP6A 1O2KA 2BTCE 1GJ9B 3V13A 2CXVA 1TQ7B 2AIQA 2GJGA 3B8JA 2D26C 2JIZD 2OBOA 2YOLA 3HK6B 1D3TB 1PQ7A 3PMAB 1GHZA 5FPSA 4VGCC 3P8NA 4AGJA 3UNQA 3TH3H 3VB6A 4B1TA 3QTOH 1FY4A 3LOXA 2Q6GA 1XUIA 1UK2A 2XYAA 4FUHA 4ESTE 4YM9A 4UFFH 1O2XA 2KR7A 3A88A 1C5UA 4BAKB 5TCAA 6ESTA 4NGAH 3PO1B 3T29A 1BB0B 2BLVA 5F03A 5IK2D 4CH8B 2GX4A 5HGGA 1C5ZB 1L2EA 4X2YA 2Y80A 3RXAA 4P00A 3MNXA 4AYYB 1QB1A 5BPEA 1SQOA 3SV6A 1XUKA 1DFPA 1GPZA 1XUFA 2BB4A 4JYTA 3F3BA 3ITIA 4WMDA 5L2YH 2P93A 1O3EA 3UREA 3UB0A 1WSSH 1O2VA 1BMFD 1O5CB 3SQEE 3EQ0H 4UD9H 1E79D 1NRRH 2BLOA 1P8VC 3MFJA 4A1XA 1P01A 3RXJA 2ALPA 1FZZA 2XNIA 5FBEA 1ZOMA 3N7DA 5T6FA 3RXMA 1T4UH 1E35B 1AB9B 2ZIQH 5FL7D 1WUNH 2PSXA 3QX5H 1GJDB 5DSFA 2J4IA 1QY6A 4BTTB 1WQSA 1O5DH 3U8TH 1NZQH 1O3PB 1C4U2 2A5KA 1FNIA 1O5EH 1ZR0A 1JMOH 2IJD1 1GBHA 2NU0E 1T8NA 1MABB 2G52A 3RP2A 2R3UA 3A84A 5JBAS 5C0UA 5EPYA 3RXKA 2QF4A 2SNWA 5LH8A 1O5AB 1GMHG 5FHTA 2VIVA 3MQKC 1O2JA 5EOKA 3ZVFA 2ZGCA 1BTWA 1WBGB 5EPNA 4XDEA 2NU4E 1GMCF 6GCHF 1AO5A 1OWEA 1O2QA 1RD3B 3BTKE 3TLOA 1C9PA 4D76A 1HAZB 3BTFE 3O8BA 3T2NA 1B0FA 5C5NA 1H9LB 4NSYA 4A1VA 1W11U 1PPZA 2AGGX 5LGOA 3HATH 3SU3A 1LPZB 1CHOG 1GJ7B 1SHHB 3RDZA 1YPMH 1P12E 2ZQ1A 5FPYA 1MKWH 2QA9E 2XTTB 1LVYA 3VGCB 1UVPA 3P70B 1C1NA 2KAIB 3ENSB 4ABIA 4NA9H 2VIPA 4ZKSU 1ELTA 1LHCH 5EQRA 4CHAC 1T4VH 2BD2A 3SJOA 1V2OT 3ZVCA 4I33A 1BMMH 2A0QB 2CN0H 4RT0A 1SSXA 1QRXA 2ANYA 3UQVA 4XSKU 2GMTC 4AFSA 1ABJH 1MTSA 3LC3A 1ESTA 2ULLA 3MO6A 1BRBE 2ZGHA 1Y5UT 3RXTA 3SHCH 1LQDB 2ZA5A 1EOJA 1F5RA 2J9NA 1YPKH 1MAYA 4CRDA 1EPTC 4SGAE 4BXWA 2V0BA 1ANEA 1QCPA 4AX9H 1A7SA 1V2UT 1EFRD 1K21H 3MH6A 1ELBA 3LGIA 1O2ZA 1WYKA 1KSNA 3SU1A 1SPJA 2EQNA 5EODA 1ZRBA 1O3CA 1CT0E 1UHBB 1P57B 3GCHC 2F9BH 4BOHA 7ESTE 1NRNH 3U8OH 1AD8H 4I8JA 2QCYA 4XD7D 3R0FA 2ZEBA 4HGCA 1C2FA 2KCAA 1HGTH 3LT3A 3M7QA 4GLYA 2CF9H 1FY8E 1TA2A 3M3VA 4YZUA 1SHYA 3GCHB 1UTOA 3UIRA 4DURA 4U32A 3EA9A 1SLWB 1ZPBA 2VWMA 2QF0A 4I8GA 3DT0H 4Q80A 4ZHMU 4Q7YA 2J98A 1V2MT 2PV9B 3HPTB 3RU4T 4UFDH 5C17A 3KQDA 4NSVA 1NY22 2M5TA 5PTPA 2BOKA 1BT7A 3I78A 4GHQA 2BY9X 1ANBA 3LPRA 1MQ6A 3RU4D 3RXRA 1NRSH 1OWHA 4AN7A 4XBDA 1OYTH 2JJ2D 1VCWA 1IQGA 3H09A 4DCDA 3UQOA 2QXIA 3K6ZA 4IS5A 1S0RA 1BIOA 1SQAA 1MKXH 3KEEA 2Z9IA 2BD9A 4AB9A 2D2DA 1KY9A 1O2PA 1YC0A 5GPIB 1B0EA 1GCDA 4XBBA 1F5LA 1ANDA 1DWDH 1GBDA 2WPHS 1AZ8A 1VJ9U 1W10U 2XRCA 1ZLRA 1DOJA 2VWOA 3GDUA 3QK1A 1FV9A 3HK3B 1T8OA 2B8OH 1TMBH 3TH2H 5EW1H 3E8LA 4D7GA 2SGQE 1VZQH 4INLA 3Q3KA 1P3CA 1V2PT 4OGXA 3U8RH 1BCUH 2PUXB 5E2OA 1QBNA 1HAYB 2V3OH 1O3OA 2H5CA 1O5GH 4HZHA 2Y6TA 5K0HA 2ZGXH 2P95A 1BBRE 2ZDKA 1BBRK 1QQUA 1GWAA 1QGFA 4INHA 3QWCH 4HFPB 5AF9H 2P94A 9LPRA 5GJ4B 1HPGA 3GICB 1GGDB 2F9UA 1NRPH 1GI2A 1PPGE 1O5FH 2XBWA 4CR5A 2WV4A 2LELA 1MTNC 4KTUA 3JZ1B 1L1NA 1FMGA 4DVAU 2DE9A 1N6YA 1HAIH 1KXDA 2H9EH 3M5LA 3KN2A 2J34A 2AGEX 1SGCA 2FOFA 1XMNB 1C5OH 2ZCLP 3NCLA 4E7NA 3RC6A 3ZVAA 3P6ZB 2OC0A 4H4FA 1RTKA 3MU1A 5JBBS 3RLYH 1UTPA 3TJVA 4A6LA 4ZKOU 3TITA 1KMHB 1GJ8B 2QIQA 1C1OA 1Y5BT 1ETRH 1HAHH 3BTWE 1AVGH 3ZVBA 1NU7B 1TNIA 1EPTA 3OEED 3E16B 2HWLB 3VFEA 3B23B 2WYJA 3D65E 1DX5M 1FIWA 4GUXA 3SUEA 3SN8A 1QZ8A 1Z8JB 2VH0A 2FOEA 1EASA 2VWLA 1W0KD 3S7HB 4E7RG 2FI4E 1AIXH 4CR9A 2A2QH 1S81A 1LTOA 1P9SA 2M2AA 2EC9H 4MPVA 4ZUHA 1C2LA 1BMLA 1SGPE 1UVUH 4TWWA 4FOUC 2J95A 4K5ZA 2FI5E 2CJIA 2FYQA 3RXQA 5EXLA 2ZI2H 3PV4A 3QLPH 4DW2U 1AZZA 1JRSA 1FY5A 4Y8ZA 5CMXH 4WVPE 1EZSC 2RA3A 4RKJB 4YOJA 3GY6A 3H7TA 4AORA 1BTHH 1NRQH 1OWDA 1NBME 2OQUA 2FODA 2EI7A 1YF4A 1Z1JA 1ELFA 1GG6B 4YESB 4X1QU 5E8EH 4P02A 3O8DA 1AUJA 1QRWA 3GDVA 1LPGB 5B6OA 4CBNA 2BDCA 1LDTT 3F0OA 4MPXA 4K2YA 1ELVA 2XC5A 3LJJA 4DT4A 1P11E 3RXBA 2XCNA 1P03A 2SGDE 1MTNB 1FAXA 1O32A 4UONA 3Q3XA 3HKIB 1GBMA 1O3BA 1TPOA 5DO4H 1SLXB 1QTFA 4X8SH 3UUZA 1RIWC 4FU7A 1ESBA 2PW8H 2GDEH 1CQQA 2FO9A 2HPPH 3EA7A 1SGIB 1QA0A 5IDKA 2ZFQH 1P04A 2A31A 1EATA 1VCQA 1HJAC 2ZECA 1XKBC 5KEDA 5I46H 2ALVA 3CS7A 1CVWH 1PQAA 5GWZA 1P05A 1QJ6B 1O33A 3BIUH 4NFEA 1K9OE 4NA7A 3RXPA 1L4DA 1TGTA 1DICA 4X8TH 5TCCA 1J14A 1SQTA 4KGAA 3T62A 3LONA 1JXPA 4E06H 1KYNA 3RM2H 1O2TA 2P3TB 5DG6A 1EOLA 1HAXB 4XRNA 2BDIA 4DT7B 4I8LA 1F0UA 1MCVA 2ZHDA 1GI3A 2Y5HA 3F0PA 2JH0D 1LVMA 2V3HH 3ZZ8A 3EA8A 3UTUH 2ZF0H 2H9TH 2UWLA 2GZ9A 3CNRA 4IMZA 3VB7A 2CGAA 1N1LA 2ILNA 2P3FH 3OEHD 1LVOA 4IN2A 3IITA 1TONA 1SLVB 1GVZA 2GDDA 5KECA 3LDXH 1C2EA 4Y79A 1AMHA 1H9IE 1D3PB 4LXBH 1OPHB 1AWHB 3AW0A 3WWBA 1NU9A 1YP9A 4MNXA 1CA0B 2QGRA 1X7AC 2FESH 3BTTE 2ODQA 2EA3A 1E1QD 2O8LA 4FUJA 3QGJA 4J2YB 1G30B 1GMHF 1IOEA 1FDPA 2LP6A 3E91A 1D6RA 3RXOA 1BRUP 1FPCH 2H2ZA 3TJUA 4CRBA 4Q7XA 4Q4LA 1U6QA 1G36A 1W0ZU 1XUGA 4X6NA 2L6OA 2QV1A 3GY2A 4JZFH 1SFIA 3OSYA 2PKAA 2VWNA 2A4GA 4U30A 3FP8E 1HRTH 5FCRA 4B75A 1VKYA 4PROA 4JCNA 4Y7AA 2XW9A 3ZZBA 3V12A 2PR3A 2B5TB 3GY7A 2C3SA 3KQCA 2C8WB 2YNBA 4MLFB 1A3BH 3UPEA 4I8KA 1UTMA 3KIDU 2I6QA 1CHGA 1O3FA 1HV7A 1J9CH 1CT4E 3FOAA 4Y6DA 1PPFE 3PLPA 4XBCA 1V2JT 1GJ6A 5F6MA 2FEQH 1CU1A 1O30A 2ZFFH 3TIUA 1ZHMA 1Y5AT 3RXDA 1ID5H 2C90B 4ACBA 2V3MA 2R3YA 2VIDA 3NKKA 2TIOA 1MD7A 2Z9JA 1Y3VA 5A8XA 3EE0B 2BOHB 1B7XB 3SU6A 3TGJE 2RA0A 2FIRH 3O8CA 1SKYE 4NIXA 3AW1A 2OC8A 1J15A 3KYGA 2F9VA 1SOTA 1C1MA 2FTMA 2ZZUH 3NRLA 4OS2A 2FOAA 5E2PA 2A1DB 3STIA 2SGPE 4Y71A 2EI8A 1E1RD 1O35A 3F2FA 3MYWA 1MKWK 2YMSC 3BTDE 1C5RA 2XOKD 1DANH 1AGJA 2V35A 1Q2WA 1SGQE 1UTQA 2IN2A 4BTUB 2VGCC 5E0GA 2Z9LA 5ESBA 3NPSA 5DP3A 3M5NA 3T5FH 3U28C 1TPPA 2ANKH 1EJNA 3KL6A 1VGCC 3EDXB 3TNTA 3ZZDA 3PYHA 6CHAC 2FWWA 1DITH 2TBSA 4MNYA 4E05H 2P59A 2Y5FA 3S7KB 1TBZH 1G3DA 1UVOA 1GJAB 3LU9B 1OYQA 2J38A 4OS4A 4X6MA 3RXUA 3MNSA 2BQ6B 2VJ1A 4MPUA 4JZ1A 1PYTC 1DE7H 3M3SA 1F5KU 4MNWA 1MAXA 1LHEH 1O0DH 3VB3A 2RFKC 3F6UH 4B2AA 2BLQA 1SGDE 1EXFA 3LJOA 3I29A 4NZQA 3MU4A 4DIIH 1EUFA 1COWD 1O2YA 1SGRE 3VG8A 1HAVA 3BN9A 5L2ZH 4FVDA 1ZTKA 2FX4A 2WV9A 5EQSA 1MBMA 2HOBA 3BG4B 1AB9C 3PLBA 2ANMH 2ZPQA 4WXVA 4BXSA 1ARBA 3PTNA 3SYJA 1C5LH 1DSTA 1TRYA 2AIPA 2KM0A 3BTEE 1AN1E 3F2HA 5C94A 3HKJB 5JYIA 2Q1JA 1L0ZA 1OXGA 4A1TA 3SNAA 3ZV9A 1EJMA 3TJOA 1P10A 2JETB 3TNSA 1RJXB 1T31A 1XVOA 4YTAA 2OTVA 3RLWH 2G55A 1C1VH 3DCLA 3UR6A 1VCPA 3RXCA 1S6HA 2Z3EA 2JH5D 4I86A 3QZRA 1GHYH 2V6NA 3E0NB 4MNVA 4K69A 1TPSA 3RMNH 3Q3YA 1ZRKA 2BZ6H 2GCHF 2YMSB 2WPDD 2BY8X 4Q2KA 4TPIZ 3PLKA 1ZSLA 3PRDA 1FONA 4OS5A 1F7ZA 2ZNKH 1PYTD 2A7HA 1K28D 5JDUB 2Q6FA 1IQNA 3OE7D 1THRH 2HPQH 1H8DH 5DKMA 1TNJA 2HVXA 1S83A 1K1PA 1O38A 3DSOA 1F0TA 1VITF 3ODDA 2RDLA 1O2LA 3GYMA 4KTCA 4AG1A 3FN8A 3NK8A 3A8AA 4TY6A 3OAAD 3U1JB 2PLXA 2WPJS 1F0SA 1GJBB 1KXBA 3M37A 1H8HD 3PWBA 1SMFE 2FP7B 2VINA 2ZFRH 3SBKA 1EZQA 1WU1A 2VIQA 4CRCA 3BEUA 1MUEB 1NS3A 5DP4A 3TK9A 3BEFB 2B7DH 1DXWA 3PROA 1LKAA 1BJVA 5J4SA 8GCHG 3DSGA 3IWMA 1HIAB 1HBTH 1DPOA 1C5QA 1DDJA 1QURH 2KX4A 1GHVH 2AGIX 3AAUA 4I32A 1OSSA 1W13U 1DM4B 2OP9A 1O2MA 2R9PA 2C8YB 1HCGA 1O3IA 3AASA 1C1QA 1QL8A 1C2GA 4Y0YE 4ISOA 1DWBH 3NXPA 5A2MH 1QJ7B 1S6LA 1VJAU 2OLGA 1PFXC 3F68H 1O2OA 4X2VA 1DXPA 3GCTF 1K22H 1GI4A 4ISLA 1QJ1B 1MCTA 1D3DB 1LHGH 3R3GB 2CV3A 3MWIU 1ZGIA 2A5AA 1KIGH 1WTHD 3SV8A 3FP6E 1UTJA 1FAKH 5C1YA 5EXMA 1W7XH 1W7GH 7KMEH 5G4BA 3SI3H 1T8LA 2ZFTA 4YXWD 3EYDA 1V2KT 5C0TA 1Z6EA 1TRNA 1TAWA 2K1QA 2ZGBH 2OC1A 1MU6B 3VXEH 4LZ4B 7GCHF 2FZZA 2ASUB 1ACBE 2Z6BD 3A8CA 3KHVA 8KME2 1F92A 2FTLE 1IQHA 3LH1A 1EP6A 1ZZZA 1ZHRA 4Y10E 3KGPA 1P06A 2FS8A 1EQ9A 1SQRA 2P16A 2BVRH 1GI0A 1TPAE 5F8TA 3WW7A 3HGPA 4F48B 1GDNA 1D6WA 4Z1MD 3DHKH 4ABAA 2Z3CA 2JH6D 2JETC 4FUFA 1GL0E 1ETSH 2ZQ2A 4GCHG 5DK1A 5DPAA 4H42U 2J94A 1IAUA 1UHBA 1NPMA 1CT2E 4GCHF 1P0SH 1TX7A 1K1MA 4I31A 2CK3D 1ZGVA 1F0RA 5FAHA 2Q6DA 1YPJH 1G2LA 2GT8A 2BDYA 1SGTA 1Y3XA 3A89A 1OHHD 2BQWB 5A0CA 3ATWA 4HTCH 2GMTB 4ABBA 4CBOA 1FIZA 1YPHC 4AZ2B 2VIWA 1RXPA 1NESE 3OTPA 1M9UA 4CHAB 3QO6A 4FUGA 4XFQA 2RDEA 1S5SA 3FO8D 5KGOA 5HMAA 2H9HA 1UCYH 4ACAA 1RIWB 1NBMD 1HAGE 3M36A 2Z9GA 2BY6X 2BDGA 3MH5A 3D62A 3W94A 1GHAG 2PSYA 4LK4A 1HJ9A 3MH4A 1XXDA 1C2DA 1CO7E 1G3CA 1LVBA 5GDSH 2EY4C 3TJNA 2PTCE 2KZ4A 3S0NA 1Z8IB 1P3EA 1S82A 1AVXA 3KF2A 4IBLH 2VVUA 1JIMA 1NFXA 1VGCB 3M35A 4YT6H 5AHGH 2TGDA 5B6LA 5CE1A 1O2NA 3LC5A 1TA6A 3P8GA 2W6JD 3RXFA 1WTGH 2F4LA 1O36A 1UJ1A 2XWAA 2W5EA 4SGBE 4ASUD 2WPKS 1C4V2 2FPZA 2QC2A 1YCPK 2NU2E 3DSPA 1TLDA 3SUGA 4OS6A 3RXVA 3VEQB 1UMAH 3SU2A 1GHXH 1MD8A 3SOSA 4WWYA 1L1JA 3BTHE 3SJ8A 5FBIA 3F9HA 1AHTH 1GDQA 1PQ8A 1C5MD 1A0HB 2ZCHP 1QIXB 4K1EA 1FPHH 2ZO3H 3L3TA 3LGUA 3ATKA
chains in the Genus database with same CATH topology
1K1OA 1ABIH 1P09A 1D4PB 4NG9H 3ZZ9A 4AFZA 1QBVH 3URDA 2VIOA 3LGVA 2NWNA 3WY8A 5E0HA 3BTME 1H8IH 1YM0A 1UCYE 2ZG0H 1CGHA 1W12U 3MH7A 4Y11E 4YOGA 4IW4E 3LKWA 1A5GH 3MO3A 1BMAA 3SORA 3F9EA 1P9UA 3PMBB 5JB9S 4TY7A 1MZAA 2HNTE 3OYPA 1IHSH 4IN1A 1EB2A 1PPCE 2AMQA 2FI3E 3LGYA 4A5TS 4ZHLU 4ZKNU 1E36B 3V3MA 3SJKA 2TGAA 4NIYA 2FXRA 3RU4E 1BA8B 1GJ5H 2ZDMA 3MI4A 1V2RT 3QTVH 1CGJE 1DUAA 1EAXA 4TYDA 2GV7A 1GVLA 2OUAA 4GAWA 3MO9A 3U9AH 5C5OA 2W7SA 1HB0B 1KLJH 1AQ7A 5HYOA 4JZEH 1W2KH 4CREA 1JWTA 5EGMA 3VB5A 3GDSA 4NA8A 3SV9A 3IG6B 1ZMJA 2UUYA 1BRCE 3FZZA 1GHBF 4JZIA 2W7UA 4CH2B 2GP9B 2WPMS 1G3BA 1HAVB 1ELGA 2WPIS 4O97A 3SV2H 1SGNE 3K6YA 1QHRB 4D8NA 4UDWH 1Y3UA 3E0PB 3P95A 4X1PU 3FANA 1P2QA 1SGYE 1ELAA 1A3EH 1TALA 4ZXYH 1AWFH 4O9VA 1VITH 4B2CA 3A86A 1KDQB 2GZ8A 4AYVB 5F8XA 1GHWH 5JB8S 3RXSA 1OWKA 3SJIA 1IQMA 1A0LA 1YLCA 4GSOA 4D7FA 2DUCA 1KLIH 3ZZ5A 1QL7A 1INCA 1JIRA 2H6MA 2CHAC 1C1WH 3A7YA 2PTNA 3KQEA 1CHOF 1JRTA 2OC7A 1TQ0B 3S69A 2AH4X 3BG4C 1THSH 1G32B 1UVTH 1QA7A 4ABEA 1DY8A 2DE8A 4MPWA 1OOKB 2PGBB 3SJ9A 4DY7B 2AERH 1V2QT 4IMQA 1TNKA 2SGFE 1NTPA 1AKSB 1ORFA 2IOTA 4ABDA 2Z94A 2ZWLH 1ZTJA 2XXLA 5I25A 4FUDA 1DY9A 2FYRA 3A80A 3SI4H 1XUJA 3HGNA 4ISNA 1Q3XA 3TGIE 2NU1E 1EKBB 2OINA 1GBAA 2FDAA 2ZTYA 4BNRA 2QXJA 5HXFA 2BVXH 1EAWA 3NZIA 2SFAA 2W3IA 1C1PA 2Z9KA 1E37B 4KELA 1OKXA 4KTSA 2PWXA 2HRVA 3OX7U 1UVSH 3M3TA 5T3HA 1FLEE 1TGBA 1S6FA 3P92A 1AY6H 1SG8B 2GT7A 1TYNA 3UWJH 2ZP0H 2I6SA 2AYWA 1V2TT 3EGKH 2P8OB 3RC4A 4JMYA 4UEHH 2HALA 3STJA 1H4WA 1V2WT 3E1XB 1SGFG 1V2NT 1GCTB 1NM6A 1O37A 3GY3A 1EPTB 1OX1A 4LZ1H 3DFJA 3TK5A 5H4IB 1ELCA 4NZLA 1VR1H 4ZAEA 2BXTH 4ABJA 2XBYA 2BD3A 2ZDVH 2QYIA 3SW2B 3SO3A 1GBLA 2Y7XA 2BD5A 5EQQA 1THPB 2RCEA 3PB1E 8GCHF 2BXUH 5ETXA 1IQFA 2BDHA 1UCYK 3GY8A 1P2OA 3ZZAA 4D9QA 1KXAA 1P2KA 1CBWC 1HAOH 4AGKA 3OTJE 6CHAB 4ISIH 1NO9H 1BQYA 1HAPH 2ZGJA 2Y82A 4M7GA 1XKAC 1BITA 1C5XB 1PPEE 4ZH8A 1BHXB 1BTXA 1QQ4A 1ZJDA 2BD4A 2LNCA 3FZDA 1PQ5A 3ESTA 2J92A 4X2WA 4QT8C 1AUTC 1NC6A 4K8BA 1TFXA 4NWKA 6LPRA 4ISHH 1KXEA 2C4FH 1IQKA 2THFB 3W95A 2C8ZB 1H9HE 1CGIE 1FJSA 4K3JA 1O3HA 1S85A 1D9IA 2BYAX 1YPLH 1RRKA 4KP0A 1JOUB 1UTLM 1C1SA 1C5TA 1MTVA 2HGTH 1C5SA 5GCHG 4GHTA 1TRMA 3TH4H 5AFYH 3AAVA 1CA0C 4FU8A 3ODFA 1OP0A 4F49A 1BRAA 2BY7X 3A7TA 1G2MA 3A7WA 1P2MA 2F83A 3A82A 3PM3A 1HUTH 2BHGA 3M61U 2A4RA 3KQBA 2OXSA 3A81A 1P2IA 2UWPA 4DGJA 1TB6H 1DUEA 1FI8A 3S9CA 5BRRE 3P17H 1HYLA 3F9FA 1TMTH 4O3TA 3LIWA 3A7XA 1GMDF 2LPRA 2IJOB 3DUXH 1A61H 4U01A 3ZZCA 3MMGA 2VNTA 2HNTF 1GBIA 1TABE 2W3KA 5K7RA 4B74A 4AFQA 1DT2A 1YGCH 5A09A 3G01A 2OBQA 1DVAH 1HDTH 4RKOB 2AMPA 1NFUA 1YPHE 1ZMLA 1ELDE 1FUJA 2G4TA 1BZXE 1C2MA 2O8MA 2TGTA 3DFLA 2R2MB 4ASHA 2AFQB 4ABHA 2BZAA 4ZROA 1GBJA 1TGNA 1HNEE 3UNSA 1MBQA 1MMJN 4X2XA 2C8XB 4JYUH 2CF8H 4A7IB 1WCZA 3MNCA 2JKHA 5EW2H 2ESTE 1OWJA 1RGQA 2XC4A 1MU8B 3SGAE 3SZNA 4RN6A 2AS9A 2H1UA 5A0AE 2UUFB 4BAHB 4KKDA 5L6NH 1J16A 1EJAA 3Q00A 2P8OC 1KTTB 1TOMH 8LPRA 1Z71A 1GI6A 3U98H 3LH3A 1LPKB 3E3TA 4H6SB 4WMFA 5LPFA 1YCPM 5J4QA 1XM1A 7GCHG 2G5NA 3GOVB 3OY6U 5JBCS 3UNRA 1WOFA 1XVMA 2GD4B 3D23A 1C4Y2 5DP8A 8ESTE 1L4ZA 3A87A 5FCKA 3PO1C 3AVZA 1LQEA 4FUCA 1C2IA 5EXNA 3CS0A 1AI8H 4Y0ZE 2BX4A 2GVFA 4O3UA 1AU8A 1AFQC 3C1KA 1QB9A 5HM9A 2STBE 2CMYA 3RMLH 3JZ2B 2RG3A 4CRAA 1NFWA 3GCTG 1Y3YA 3DD2H 3ZVGA 2FOMB 5FX6A 1TE0A 1YBWA 2FLBH 3MOCA 3L6PA 1O2WA 3UFAA 2HLCA 2UUKB 1WV7H 4JZDH 1O31A 2R0KA 1LO6A 1YPGH 1EP5A 1K1IA 4THNH 2GCTC 5ESTE 3ATLA 4DIHH 4DJZB 1AFEH 3KCGH 2WINI 1C9TA 1YCPH 4DOQA 3SNCA 1BTYA 2ZDAH 1H1BA 3SNEA 4MVNA 3BTQE 1ZPCA 3VGCC 1CA8B 1O2HA 4RSPA 1TMUH 2QY0B 4JK5A 2TPIZ 1N8OC 2Z3DA 1S84A 1W0YH 2PKSC 4U2WA 1UO6A 1S0QA 3SV7A 1Z8RA 1OP2A 2Z7FE 2WUBA 1P02A 4MG3A 2D8WA 1Y3WA 1HFDA 2PHBA 4F4OC 2XWBI 3Q77A 1GI8B 1Z8GA 1A5IA 1FN6A 3LGTA 1SBWA 2BDAA 1KTSB 2G8TA 2PFEA 1ESAA 2SGEE 1QL9A 2ZTXA 1C2HA 1GGDC 1QBOA 5C20A 1TBRH 2A4OA 3ATIA 4WMEA 2F91A 1O34A 3ZZ4A 4INKA 3QUMP 1XX9A 3MU8A 3NUMA 1FY1A 2XC0A 1SOZA 4WXIA 1IQLA 1XUHA 1YKTA 4Y76A 1KXCA 5E0JA 4WJG2 4K1SA 5LPEA 1QR3E 1GMDG 5AFZH 3E6PH 1ZJKA 3FAOA 1HXFH 4BTIB 4BAOB 1GBBA 3S9BA 2AMDA 3PMJA 1C2KA 4FVBA 1W3CA 1QB6A 1O3JA 3ELAH 4AOQA 5JBTA 2VVVA 3H7OA 1A5HA 1GI1A 2C93B 5LPRA 5IYTA 5GCHF 3U1IB 4ABGA 5SGAE 4UFGH 1OWIA 1SGFA 1TX6A 1O2RA 1O3AA 4FXGH 4I8HA 2KAIA 2WV5A 4WH8A 1D3QB 3SGBE 4ZHAA 3GY4A 2G5VA 1DWCH 1Z6JH 1DWEH 3BEIB 4X8UH 3V0XA 1O2GH 1G3EA 1SL3A 1MTUA 1YLDA 2YNAA 1BTZA 3V7TA 3RMOH 2SNVA 3BIVH 1N6XA 2ZTZA 1SVPA 1QFKH 1A2CH 1GBFA 3VB4A 3N7OA 3RXIA 3RM0H 1C1RA 1E38B 2BD7A 2TRMA 1TGSZ 1CSOE 4MTBA 1SFQB 4WH6A 4B76A 3TU7H 1C5PA 2STAE 1AFQB 1GJ4H 4JK6A 4X6PA 2OD3B 3ZZ3A 2PUQH 4IGDA 1UK3A 5DGJA 3ZYEA 4AB8A 2CHAB 3M7UA 1C5WB 2ODYB 1KDQA 2HNTC 2BVSH 4K60A 3RUOA 1HIAA 1V2ST 1GBCA 3SNDA 3URCA 1ELEE 1GBKA 1VITG 2QF3A 1IQIA 4AG2A 3EAJA 1W14U 5C67A 3OU0A 1Y59T 1LHDH 3FVFB 1O3MA 3UWIA 4CRFA 4NIWA 3SUFA 3GCOA 3SU4A 1TNHA 1O3NA 3A8BA 4TWYA 1C1TA 2OCVB 1ARCA 1RTFB 1V3XA 4X6OA 3ZVEA 1WQVH 1T7CA 3P8FA 1EAIA 3BSQA 1FY3A 1A4WH 4BAQB 5C1UA 2ZHEH 1P2NA 5DP5A 1GVKB 4Y7BA 1O5BB 3RXHA 1AE8H 1O39A 1XXFA 2F9PA 4X8VH 2BX3A 2NU3E 1TNLA 1IQJA 1TIOA 3FP7E 4GPGA 5C2ZA 4H6TA 5T6GA 1MQ5A 4JYVH 3A83A 4XE4A 3ZYDA 1GJCB 3K9XB 1P2JA 1BTUA 1SGEE 2ZDNA 3UOUA 4ZMAH 1V6DA 2GZ7A 3BF6H 1IHTH 4FUEA 3QDZB 2O8WA 1GHAF 1AE5A 1KLTA 1O3KA 1ZMNA 2VU8E 4LOYH 4R8TB 1K1JA 1W8BH 1AVWA 4MDSA 2A7JA 2ZU2A 1OP8A 3D49H 5JPMH 2ZU3A 1LHFH 3A7VA 2R0LA 1BHXF 2FOGA 2ZDLA 4NCYA 3ZVDA 4YLQH 3SUDA 2BM2A 3GCNA 5A0BA 2BLWA 1DSUA 1T32A 1Y8TA 2BQ7B 4Z6AH 4X0WU 2IPHA 2VVCA 5C3NA 1Q31A 1V2LT 4O03A 4TPYA 3TPIZ 4D9RA 2B9LA 3L33A 3TGKE 1O2SA 3TK6A 2EI6A 3T28A 3H5CB 1GL1A 4ABFA 1SR5C 2XBXA 3PMHB 3KNXA 1E0FD 1BTPA 2FM2A 1CBWB 1WAYB 2FS9A 1A46H 1O3GA 2GTBA 4R0IA 2VGCB 1RFNA 4IC6A 2G51A 4B73A 1C5NH 3BV9B 1O2UA 3CENA 1RS0A 1CE5A 3U69H 2TGPZ 2EEKA 1DLEA 3A7ZA 3A8DA 3T25A 2QN5T 1O3DA 3SU5A 1J8AA 3RXGA 1ZSJA 1BJUA 4GVUA 1RTLA 4OS7A 2ZHFH 5T6DA 3VXFH 5ABWA 1C5YB 5DP9A 3ATMA 1EZXC 2OQ5A 2F9OA 4YT7H 5GXPA 3BG8A 4K8YA 5C1XA 1C1UH 1SLUB 1K1LA 3GYLB 3M5OA 2A32A 1A1RA 3S9AA 1EZUC 3K2UA 3UR9A 3SGQE 3I77A 1ZTLA 1ETTH 5EG4A 2ODPA 2H5DA 2ZPSA 1PJPA 2O9QA 1T8MA 2PGQB 5DP7A 3GY5A 1BMNH 3LGWA 1LKBA 1L1GA 2ZU1A 3RMMH 3GISB 5TJXA 3RXEA 3MTYA 1GHBG 4I7YH 4X1NU 3BTGE 3MU0A 4J1YA 2G81E 4IC5A 2FX6A 2GKVE 2W26A 2A5IA 1SI5H 4X1RU 2ZU5A 1SC8U 4UE7H 1GDUA 2GGVB 4NWLA 1ANCA 3M7TA 4Z0KA 1GBEA 2Y81A 3SQHE 2GV6A 4Y8YA 5FX5A 2ZFPH 1FN8A 1TNGA 2FOHA 1QNJA 2O8TA 2O8UA 3UOPA 1HLTH 2UUJB 1EB1H 1UTNA 1ZSKA 2QXHA 3B9FH 1TBQH 5DJ7A 4OS1A 1NT1A 3M5MA 1TGCA 1FQ3A 2FMJA 5A8ZA 3Q76A 1AKSA 1BUIA 4FUBA 4HI3A 4UFEH 3DA9B 4VGCB 4BAMB 3F9GA 1V2VT 4FU9A 1J17T 4ZKRU 1ZYOA 2BY5X 1NN6A 1IQEA 1E34B 2SGAA 2ZFSA 3ZZ7A 2F9NA 3F1SB 4WF8A 1GCTC 1TOCB 2R2WU 1GI9B 2D1JA 1UTKA 2UWOA 5CHAC 2A7CA 3C27B 5FXLA 3MHWU 4FUIA 3MU5A 4BANB 2FOBA 2ZHWH 5AVDA 2BMGB 2AEIH 3QN7A 3TVJB 1Z7KA 2FOCA 4YO9A 1HJ8A 1C5VA 4YLUA 1EX3A 3UY9A 3E90B 2G4UA 5A8YA 2ZHQH 3MNBA 1GI5A 1MH0A 9ESTA 1C2JA 4NIVA 3K65B 1BOQA 3A85A 4MQAA 2PKAB 1YYY1 2ANWA 1K2I1 2GCHG 4WY3A 5L30H 4NFFA 7LPRA 2VB0A 3ZZ6A 2A45B 3T26A 1YPEH 3PWCA 1DLKB 2VH6A 4Y8XA 1O2IA 3SHAH 1MTWA 1UK4A 3T27A 4AFUA 3FFGA 2B0FA 1GBTA 2J2UA 1BBRH 1JBUH 2ZC9H 3RC5A 4B71A 2ZU4A 3O8RA 1HXEH 1QRZA 1PPHE 2XCFA 1TWXB 2WPLS 3PTBA 3SNBA 2Y7ZA 1K1NA 2WYGA 3QGNB 4K1TA 4A92A 1SB1H 1LMWB 2QXGA 1GMCG 1EAUA 1GI7B 6GCHG 3P8OA 2ZKSA 5EU8A 1G37A 1Z1IA 4DG4A 1PPBH 5HM2A 1ZPZA 5GIBA 4ZXXH 2A2XH 1LCYA 2XBVA 4X1SU 1MZDA 1B5GH 2PKSB 2WUCA 3SU0A 1G9IE 1DS2E 3QZQA 1N8OB 3CP7A 5FPTA 2FLRH 3RXLA 2P3UB 2BDBA 2F3CE 1BDAA 4YOIA 2ZCKP 3OY5U 1MKXK 4XOJA 1ZHPA 4B2BA 4CRGA 1TX8A 2QAAA 1NFYA 1F2SE 1NROH 2Y5GA 5F8ZA 2G00A 2GCTB 2A4QA 3ZV8A 1GG6C 4OGYA 2ZPRA 2BD8A 4Q7ZA 1OS8A 1KXFA 1A0JA 1O3LA 3NWUA 5CHAB 1HJAB 3VPKA 1FXYA 5DP6A 1O2KA 2BTCE 1GJ9B 3V13A 2CXVA 1TQ7B 2AIQA 3B8JA 2D26C 2OBOA 2YOLA 3HK6B 1D3TB 1PQ7A 3PMAB 1GHZA 5FPSA 4VGCC 3P8NA 4AGJA 3UNQA 3TH3H 3VB6A 4B1TA