1VJ9U

Urokinase plasminogen activator b-chain-jt464 complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords plasminogen activator, urokinase
publication title Design of novel and selective inhibitors of urokinase-type plasminogen activator with improved pharmacokinetic properties for use as antimetastatic agents
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vj9U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vj9U01
1N1LA 1PPFE 3ZZCA 1SGPE 1Q2WA 1ANDA 1MCVA 1K1OA 2Y7ZA 1T8LA 5IYTA 1TRNA 1BRCE 2AH4X 2FOBA 3V3MA 1QJ6B 1LMWB 3Q3KA 1MQ5A 2EI8A 2XCFA 3QX5H 1NRPH 1UK3A 5FPSA 4BAQB 1O3OA 4Y0YE 1ANBA 2XBYA 2VWOA 1UHBA 1NZQH 1GMDG 1CU1A 3SU1A 1TPSA 1GG6B 1AO5A 2HVXA 4MQAA 1HAXB 1P3CA 3P8GA 3UOPA 2V3HH 2ZGBH 1L1GA 3LJJA 3TGJE 3PM3A 1NPMA 1EZSC 1AB9B 1P0SH 2G5NA 2VIVA 2A7HA 3PWCA 1TMUH 1EAUA 3SO3A 4WMEA 1YPMH 2VIQA 3ZV8A 3KQBA 4YO9A 4UFFH 5TCAA 2FP7B 2ZDVH 1BMAA 5LH8A 2CMYA 2UWLA 2ZDKA 1NT1A 3MNCA 3L3TA 3BTWE 3PMHB 1IQFA 4ASHA 4MNXA 1FV9A 2ILNA 4ZHMU 4LZ1H 1IQGA 1SLXB 2ESTE 3AVZA 3GOVB 3LGWA 1TNGA 5F8ZA 1KXDA 1HAVB 1MTWA 2OC8A 4ABJA 3SJOA 2ZFSA 1MTNB 2BYAX 3D65E 4TPYA 4CHAC 4F49A 1YBWA 3T26A 1S82A 1QJ1B 2ZHFH 5AHGH 2VIOA 1AD8H 1ZRKA 3U1JB 1GHXH 1THRH 3ZVBA 3T25A 1WU1A 3LH3A 5C5NA 1ZTLA 5DP6A 2IJOB 4ISHH 4KTSA 1SGDE 1A5IA 4VGCC 4GAWA 1LVMA 1WCZA 2GZ7A 1V3XA 3KGPA 1ZTJA 4LK4A 1Y8TA 4GVUA 1O5BB 3H7TA 1HV7A 1DSTA 2G4TA 2VVUA 1T4UH 2O9QA 2WPHS 4Y10E 1S0RA 1C2JA 3GISB 4D9RA 2XC4A 1HJ9A 3SN8A 4OGYA 1V2RT 3UQVA 1K21H 2JETB 3RXLA 3EDXB 3FP8E 1V2KT 4X2XA 2BY6X 3K2UA 1F2SE 3D23A 1O32A 3F9GA 3SV7A 5GXPA 2BLOA 1QGFA 1AZZA 3DD2H 1HUTH 5JBAS 4UFGH 1Y3YA 4FU7A 2KAIB 2JH5D 3RM2H 1CHOG 3EYDA 2ZDMA 3S0NA 3GY5A 5C1YA 1MTSA 4INHA 1C1QA 3P70B 3BTHE 3QK1A 4UD9H 1FY5A 4INKA 3EQ0H 1ZHRA 3MMGA 1EUFA 1OWEA 3FP6E 4UFDH 4TWYA 3VB3A 3SUDA 1Z6JH 3MNSA 4CH8B 2FX6A 2PHBA 2A2QH 3T27A 2XRCA 5DK1A 1BMNH 4H4FA 5DG6A 3TNTA 4Q7YA 1OSSA 4WMDA 3UPEA 1TRMA 3M7TA 1HJAB 1UVSH 2BDYA 3ZVCA 1DVAH 3E91A 1L1JA 1BBRE 3A7YA 2VGCC 1BIOA 3OY6U 1C5ZB 3U8RH 2XC5A 1K22H 2Y5HA 2XNIA 1IQHA 1C5TA 2ZNKH 1QNJA 2ZI2H 1KDQB 1LPZB 1LPKB 4SGAE 1ZPCA 4NIVA 4I7YH 1GGDB 4UEHH 1NFUA 3E90B 1S81A 5E8EH 1YM0A 3A80A 1FMGA 1BHXB 4THNH 1FY4A 1A2CH 3F68H 4TPIZ 1HLTH 1HAHH 4KP0A 4Z6AH 4K1EA 1KTSB 1DANH 3SV6A 1UTOA 1HAZB 2H5CA 2ZGCA 1DITH 1FZZA 4I8HA 2O8WA 3GDVA 4BAOB 1P02A 3OYPA 5C67A 4CRGA 1O2OA 3O8BA 1TX8A 4JK6A 2C8YB 5T3HA 1IQEA 4NG9H 1UO6A 5CMXH 2ZWLH 1N6YA 4HTCH 2OUAA 1O3GA 3UOUA 2ZPRA 2GDEH 4U2WA 4YESB 2FS9A 1UTPA 3OU0A 2NU3E 4IC6A 4TYDA 3TK5A 1F0TA 1XXDA 2XBVA 2ZTZA 1GBDA 3A8BA 1BMLA 2QGRA 3R3GB 2H5DA 3HATH 1G3CA 2ZG0H 2R2MB 2SGFE 1SGFA 4AB9A 2AMDA 1C2FA 1EASA 3SI3H 1KXCA 1W11U 1BTYA 1Z71A 3RP2A 1ZOMA 1SQTA 3LGYA 3RMLH 1SVPA 3TVJB 4D8NA 1UCYE 3SV8A 1FAXA 1TA2A 4ABIA 4WVPE 5FCKA 2OC1A 4ISNA 2G5VA 2Z6BD 1TGNA 1CA0C 3MU0A 3A83A 1SBWA 2A7JA 2OINA 4A1TA 2I6SA 4K60A 4BOHA 5I25A 5L2YH 2BXTH 3L6PA 1C5RA 1B0EA 3NK8A 3STIA 3ZZ9A 1D3QB 2F91A 1WV7H 2H9TH 1TIOA 2Y82A 3CS7A 2F9UA 3RXRA 2G51A 2HPQH 3U98H 2FLRH 4DCDA 1P11E 3MOCA 2PR3A 1VITG 3M5MA 1ZZZA 1UVUH 5DP8A 5B6OA 3S7KB 2WPIS 1T31A 1XUIA 3SGQE 3E0PB 4X1RU 5EOKA 4ABEA 1L2EA 8ESTE 2C8ZB 2P8OB 3I77A 4ZHLU 1A3BH 2AYWA 3DFJA 2SGEE 4JYTA 1BBRK 1LKAA 4UFEH 3PO1B 1EP5A 1PYTC 4X8SH 6CHAC 1YPGH 3MTYA 3SQHE 1Z7KA 3BN9A 8GCHF 1V2WT 2TIOA 3MO6A 1VCWA 1JRTA 1FPCH 4IW4E 1FY3A 5A0BA 4XDEA 1LVOA 1INCA 2O8UA 3EA9A 1SQOA 1K1PA 4CH2B 1GJ8B 1K1LA 1UTJA 3M7UA 4GLYA 3RU4E 1MKWH 4K69A 3S9AA 4Y7AA 5E0JA 1P8VC 5GCHG 1SGQE 1PPZA 5JBCS 4AYVB 1TMBH 2R0KA 3SQEE 1GG6C 2G4UA 3OSYA 2FYQA 2CF9H 3MU1A 3DA9B 1C1VH 2ZFPH 3TK6A 1JIRA 3RXJA 4DW2U 1XM1A 2OTVA 5HMAA 1AB9C 1D6RA 2ZHWH 4AYYB 2FOGA 1C2EA 4ZHAA 2A4RA 1NN6A 2PUQH 3SNBA 2ZHDA 3T29A 3TGIE 1L4ZA 3BF6H 4O9VA 2PTNA 1P2JA 3UR6A 4AZ2B 1GVZA 7GCHF 2F9BH 4B1TA 1O2ZA 3K9XB 2B0FA 2D2DA 4IC5A 2A32A 4H6SB 1SFQB 3C27B 2P3TB 4AORA 1TBRH 3U69H 1TX7A 2K1QA 2QXIA 2PKSB 3RDZA 4BXWA 1LPGB 1ZPZA 1BDAA 1W14U 1PPBH 2ZDAH 3DUXH 2NU1E 4BXSA 1MTNC 1FJSA 5J4QA 4KTUA 3S9CA 3RU4D 2ZHQH 1PYTD 4I8KA 4YLUA 1KXFA 1GMHF 4YOIA 2B9LA 2AGGX 1TOMH 1K2I1 1SGFG 1C5VA 1UCYK 4CRFA 1KTTB 1GI3A 2D26C 3BTDE 2HLCA 1SGNE 3A89A 3P92A 3MH5A 3RXCA 2FXRA 1OKXA 2BD4A 5C3NA 1JOUB 3KNXA 2VIPA 1O3AA 5DKMA 4U30A 3BV9B 2GV6A 1P3EA 4JYVH 1SLUB 1TWXB 1ELTA 1RJXB 2BD9A 1MAYA 4WXVA 3Q77A 1D4PB 1HIAA 1NROH 1ELBA 1HFDA 1W7XH 2ZFFH 2XWAA 1QB9A 2UUYA 1DUAA 3M7QA 4RKJB 2H2ZA 1LHGH 2BQ7B 2IN2A 4CBNA 2JETC 3DT0H 3RXSA 5FCRA 2Y7XA 1SGTA 1AUTC 4Y79A 2THFB 2FTMA 3SV2H 3ZZBA 1G9IE 3F6UH 4XBCA 4YZUA 1EJNA 1P09A 2BDCA 2BMGB 4O3UA 4MPWA 5TJXA 2GTBA 5AVDA 1T8NA 1MU6B 3V0XA 2QIQA 1IAUA 1QBNA 2XBXA 1S85A 2SGDE 1QHRB 1NRQH 3BG8A 5HGGA 4OGXA 2BDBA 3SBKA 2BQ6B 5C20A 4MNWA 1XUFA 1C1OA 1LVYA 3NXPA 3A8AA 1SR5C 3IG6B 4K2YA 3K6YA 1FN6A 4NIYA 2VWLA 1SHYA 2XWBI 2O8TA 3PMJA 4IN1A 1NESE 3ZVDA 1E0FD 2WPKS 1MD7A 5HM2A 1ZMJA 1AZ8A 1HJAC 1GL0E 1TNKA 2BZAA 4INLA 4Q2KA 4X8TH 2F9VA 2BX3A 2R3UA 1Y5BT 2PW8H 5T6GA 4B75A 2A7CA 4X6OA 3TJUA 3A8CA 1O2IA 3E3TA 5CE1A 1TA6A 3P6ZB 1QL9A 1QBOA 1YLCA 1C2GA 1QQUA 1UTMA 1DM4B 1KIGH 3UQOA 1O2XA 5JPMH 4DOQA 2RA3A 1LTOA 1GGDC 2QF3A 2OC7A 1DXPA 2ODQA 1ZRBA 2VJ1A 1O3MA 3F9HA 1TQ0B 1XUHA 3TH2H 4ABGA 1ETSH 1P04A 2PGQB 3RXIA 2FIRH 1TX6A 4I31A 3VXFH 4D7GA 1SC8U 1C1MA 1EZUC 3LGTA 3LONA 5G4BA 3SNEA 3NZIA 2ZU4A 1Z1IA 4CRBA 1A0JA 1EB1H 4D76A 1S6HA 4ABFA 1SGIB 4UE7H 3SU0A 3B23B 4NIWA 5JBBS 4YT7H 4XBBA 6ESTA 5EXNA 2A0QB 1G37A 2VH0A 1OYQA 1FXYA 2CXVA 5GPIB 2I6QA 1CT4E 2M5TA 3M3TA 1GI2A 1BQYA 2PWXA 1SOTA 4KTCA 1V2PT 4BANB 2ZCHP 2ZZUH 1MBMA 1UMAH 4JZ1A 3ATLA 2CGAA 1CT2E 2OCVB 3E1XB 2UUJB 3RUOA 4D7FA 1T8MA 4ZXXH 4E05H 1N6XA 1O5CB 4F4OC 7GCHG 1KLIH 2AMPA 3MH6A 3LC3A 2DE8A 4IBLH 1IQMA 5L30H 1PPGE 3M36A 1ZJDA 4ZROA 3ENSB 1TONA 3KQEA 3HGNA 5EQQA 1VJAU 1GHYH 3TH4H 2V6NA 1ANCA 3ATWA 1K1NA 2W7UA 1F92A 3RXBA 1P06A 1GMHG 1SSXA 1HAGE 4NZLA 1AUJA 4X1QU 3PB1E 3TJNA 2ANWA 1A7SA 1LHDH 2UUKB 3K65B 4LOYH 1H8DH 2WUBA 3M37A 1CE5A 3TJOA 1SL3A 2A4QA 2DUCA 4YT6H 2Z9LA 4BAKB 1Z8JB 1G3DA 2VB0A 2BTCE 2GV7A 1W0ZU 4JYUH 1HAOH 1VJ9U 3GY4A 4A5TS 1MBQA 2ZGHA 1TNHA 2BY5X 1P2IA 1MAXA 4Y71A 1EKBB 2FPZA 3EA7A 1O3NA 2Z7FE 1A4WH 1LKBA 3UWIA 5LPRA 1TBZH 1D3TB 4IS5A 3H7OA 2CN0H 4DVAU 1K1IA 1O3LA 1A5HA 3PO1C 5JBTA 4X6MA 8LPRA 1DSUA 2TGTA 2PGBB 4JZFH 2ZCKP 5LPFA 3O8CA 1Z8RA 1UJ1A 1V2MT 5EPYA 1ACBE 1TPAE 2BOHB 4WWYA 5ESTE 1A5GH 4BTIB 2QCYA 1GHAF 2RCEA 1AFEH 5EODA 1HIAB 5DO4H 4TY7A 3OX7U 4ABAA 1O2TA 1GBLA 4FUDA 1PQ5A 1ARBA 1ANEA 1P12E 2PUXB 3RXOA 4DURA 5E2OA 3UNSA 3O8RA 3PV4A 1MTUA 2ODPA 1O2KA 2BLQA 1JBUH 2GGVB 1FQ3A 4O97A 4ZH8A 2WV4A 3M5OA 4Q80A 2BM2A 3URCA 4CR9A 3QTVH 1OWDA 2FYRA 1V6DA 3URDA 2D8WA 2Y80A 1GBMA 1GCTC 2AS9A 2FWWA 5DPAA 1RXPA 1D3PB 3MHWU 3MO9A 2FS8A 4ZUHA 3RU4T 3A84A 1GBKA 1GHBF 4OS6A 5JYIA 4DGJA 5A0CA 5CHAB 5DP9A 1BTXA 3SJ8A 3QUMP 1SOZA 4RN6A 2ZCLP 3VPKA 3GY2A 3T5FH 1LDTT 5T6DA 2PKSC 5PTPA 1BTHH 2H9EH 1G36A 1QL8A 2R0LA 3F1SB 3S69A 3Q3YA 2QA9E 2TGAA 4NA8A 2GKVE 2BXUH 3P95A 3LIWA 1DOJA 3T28A 1GI7B 5K0HA 3QZRA 1TMTH 2ZPSA 1EQ9A 1Y5UT 7ESTE 2P3UB 3AASA 3M3SA 3RXVA 2Q6FA 3ATIA 2QV1A 3RXEA 2B5TB 4LXBH 1TOCB 1C4Y2 1GBIA 1TALA 2A45B 2JH6D 1C5YB 5J4SA 1EZQA 4MNVA 1J16A 1ZLRA 2VWMA 1C1NA 1V2OT 3ZZ8A 1YPKH 1ZPBA 4YLQH 5FX5A 3LGUA 1O2MA 3S7HB 2W3KA 1OX1A 2GZ8A 2V3OH 4HFPB 3RXUA 2HGTH 2Q6GA 5AF9H 3QZQA 1GDQA 2XTTB 1HXFH 1VITH 5EXLA 1O2SA 2O8MA 2XXLA 1EOLA 2A5IA 3G01A 3GCNA 8KME2 3GCHB 2G81E 1A0LA 5HM9A 1AVXA 1GI9B 1LQDB 2FEQH 4GUXA 3RLYH 3ZVGA 2PFEA 1FY1A 1L0ZA 1NO9H 2AGIX 4NA9H 2ZTXA 3A7WA 2ZDLA 1GBTA 1XX9A 2BB4A 1O2WA 3BTTE 3ODFA 1IQKA 3NKKA 5FPTA 1TNIA 4Y8ZA 2TBSA 3RC5A 3VB5A 3I78A 4DJZB 3BEFB 3BIVH 2UUFB 2OQUA 2ZTYA 1SFIA 1QCPA 1WTGH 1GI0A 1FUJA 4X6NA 5L6NH 3VB7A 2GCHF 3RXFA 4AN7A 1GVKB 1F0RA 4AG1A 1YCPM 1C5QA 4M7GA 1C9TA 2IPHA 3PROA 4XBDA 1PQ7A 1Y3XA 1P2OA 1Y5AT 2GMTB 1QY6A 1O2QA 3R0FA 4NFFA 1MU8B 2GD4B 2FDAA 1W10U 4ABBA 4ZKOU 4X8VH 1XUGA 3ZVFA 2H6MA 2Y81A 2FI5E 5F8TA 4J1YA 1UHBB 4A92A 1DFPA 1AVWA 2BX4A 3ZVEA 3GYMA 1SGYE 4MNYA 4DIIH 1TFXA 1NFXA 1O33A 1V2LT 1Z8IB 3B9FH 4A1VA 1H9LB 2A5AA 1JRSA 3UY9A 2VIDA 3OTJE 4GCHF 4DT7B 2ZFTA 1DY9A 1G30B 3SNCA 1AHTH 1B7XB 1P03A 5LGOA 2J9NA 2BVSH 2C3SA 5GJ4B 4FUGA 4O3TA 1FI8A 1WBGB 1DWDH 1RRKA 4RKOB 3KF2A 2NU4E 1YKTA 4MTBA 4AGJA 4NWKA 1QB6A 1DLEA 1OWJA 1E35B 4R8TB 1MD8A 4FXGH 2GP9B 2J95A 2FM2A 2YNBA 1PQAA 3RC4A 1C2DA 1GDNA 3FZZA 4AGKA 3CENA 4U01A 5GIBA 1GHBG 2WV5A 2D1JA 3BTKE 1QQ4A 1PPHE 2HWLB 2FOCA 2YOLA 2W7SA 4I8GA 1K1JA 3A7XA 1W8BH 4MLFB 2PV9B 5DP7A 5I46H 2EEKA 3QDZB 3E16B 2BLVA 1F0UA 1IQIA 3SUFA 1BJVA 1BUIA 1C5OH 3BTFE 4X2VA 3SU4A 1FONA 4NIXA 4GHQA 3VB4A 1O3KA 4Y11E 1EAIA 1O2NA 3M3VA 3P8OA 4K1SA 3LC5A 1ZMLA 1H4WA 4IMZA 1ESTA 2FI4E 3MU4A 1NFYA 1CQQA 4HGCA 4CHAB 1E37B 3ZZ3A 3TNSA 4BAMB 4X2WA 3SZNA 1YPHC 2G55A 4Y76A 2TPIZ 5EGMA 1IOEA 1WAYB 1YGCH 1O38A 1GCDA 2FX4A 1MKXH 5JB8S 1BTPA 1V2UT 3PTBA 1O5FH 7LPRA 2Q1JA 2OBQA 2ZU3A 1D6WA 1TGTA 5T6FA 2WUCA 2BQWB 3LKWA 1IHTH 1GVLA 2ZF0H 1DLKB 4U32A 3RXHA 1O5AB 2VINA 3B8JA 1YPHE 1CT0E 3SW2B 3GCOA 3QGJA 5E2PA 3BEIB 2P95A 1DWBH 1ZTKA 2CV3A 1GHWH 3SU5A 3ATMA 5FPYA 1ZGIA 3RMNH 2Z3DA 3F9FA 1G2MA 1YPJH 4X0WU 3UTUH 1HCGA 1XXFA 5K7RA 1THPB 1JIMA 3RMOH 4MDSA 3C1KA 5EQRA 3LGIA 2FLBH 4LZ4B 1F5LA 4AX9H 1FDPA 1YCPH 1W0YH 1H9HE 1AI8H 5AFZH 2G00A 2ZKSA 5TCCA 1PPCE 2AIPA 4B73A 1LHCH 1RFNA 1C1WH 5BRRE 4AFSA 5FBIA 2GCHG 3SORA 4FVDA 4YOJA 3FP7E 3NCLA 3TLOA 5JDUB 3AAVA 3SU6A 2Z9GA 1S5SA 2HPPH 2PSXA 3ZZDA 2ZECA 1RGQA 1GBEA 1ELVA 2SGQE 2PTCE 4FUHA 1K9OE 1KLTA 2VH6A 1ORFA 1OOKB 5L2ZH 2ZDNA 2JKHA 5A8XA 1MKWK 1HGTH 2FOFA 3DHKH 3BSQA 4GSOA 3SU2A 1BTZA 3AAUA 3W95A 1GMDF 3SJKA 3RM0H 3GDUA 4B2CA 2GT8A 3BG4B 4FU9A 1YYY1 1AWFH 2ZGXH 4BTTB 4AG2A 3PTNA 1AFQB 3ZZ4A 3A87A 2A2XH 5EQSA 1MKXK 5CHAC 1HB0B 5EG4A 1HRTH 1P05A 1ELGA 4CRCA 1NU9A 3PMAB 3M5NA 2BD5A 3RMMH 3E8LA 2STBE 2BHGA 3VXEH 1KXAA 4K1TA 3N7OA 2BDAA 1W7GH 1DE7H 4X1NU 1AIXH 3BTME 2Z3EA 1SLWB 3NUMA 1L1NA 2STAE 2HOBA 3V12A 2O8LA 1Q3XA 2ASUB 1BRUP 1TNLA 1C5WB 2ULLA 4X8UH 1TB6H 2FOMB 4R0IA 2XC0A 3O8DA 1O2UA 1C5SA 3L33A 3RC6A 5C5OA 4FUBA 4NSVA 1ESAA 4CRDA 3M35A 4UDWH 3UNRA 1V2ST 2TGPZ 4AOQA 4MPVA 3NWUA 4CR5A 1BA8B 3BTGE 2ALPA 3V13A 4ABHA 5A8YA 2P3FH 2GDDA 4OS1A 2XBWA 1MZAA 1AQ7A 1EPTA 3RXPA 1HYLA 3TGKE 4XOJA 1S6FA 1KXBA 1RS0A 3GCHC 3UNQA 3QGNB 1QFKH 1AWHB 4TY6A 3GYLB 9ESTA 2XCNA 2EI7A 1O34A 3MWIU 1NY22 8GCHG 1NRNH 2J38A 2VNTA 3LH1A 1OP0A 1O30A 1T4VH 3PYHA 4FUJA 2ZGJA 4IN2A 1VCPA 2QXHA 1C5NH 3P17H 4NFEA 5F03A 2OD3B 2AERH 1D9IA 2AGEX 1DT2A 2WPLS 2B7DH 1LVBA 3E6PH 5C1UA 1HPGA 3MI4A 1CGJE 1A46H 4Y8XA 4GPGA 4BAHB 4BTUB 1YC0A 1BMMH 1W2KH 1O36A 3SOSA 3TH3H 1BHXF 2BVRH 1FNIA 2SGAA 2H9HA 1EAXA 3SGAE 3FVFB 1P01A 1SHHB 1CHOF 1WYKA 2HALA 5H4IB 2ZO3H 3D49H 2GMTC 2RA0A 1NS3A 3A7VA 1QA7A 3ZYEA 1T7CA 1O2YA 2BY7X 1ZYOA 2SFAA 2UWOA 2V35A 3GICB 3ZZAA 1CSOE 1P10A 3LJOA 1KDQA 2Y6TA 1ZHMA 3UREA 1V2VT 1ETTH 1YP9A 5E0GA 3CS0A 3UWJH 2FI3E 2LPRA 2HNTC 2WPMS 5ABWA 1BTWA 1GMCF 1O5DH 4Q7ZA 4B2AA 2ANKH 4MG3A 4I8LA 2ZQ2A 3T62A 4AFUA 3BTEE 1V2JT 1BRBE 2FZZA 3KQCA 1W3CA 1B0FA 3PMBB 3ZZ6A 3U1IB 1O3DA 4A6LA 3QO6A 1VZQH 2QY0B 3QWCH 3SNAA 1IQLA 2ZEBA 1XKAC 2HNTE 5A2MH 2SNVA 2ZFQH 5DP5A 2QYIA 3AW1A 3A85A 3KN2A 1CO7E 2CF8H 1J15A 1UK4A 1TPOA 3H5CB 3T2NA 1MZDA 1AKSA 1O2RA 1WOFA 1C2LA 1A3EH 4K8BA 1C1TA 1OYTH 1BTUA 4X1SU 1GJ6A 1ESBA 2FTLE 1O39A 4X2YA 1ZSKA 1HAIH 2CJIA 2EC9H 3MNBA 1QR3E 3ELAH 2C8WB 1F7ZA 3AW0A 1UTQA 2WYJA 1LCYA 1X7AC 3RXKA 4FUIA 1GDUA 2YNAA 3BEUA 1QB1A 3Q76A 1O3PB 4MVNA 2P8OC 4WJG2 1O3FA 3D62A 1MH0A 1XVOA 2P16A 1U6QA 2Z9KA 1ZHPA 1WQVH 1VGCB 1T8OA 2DE9A 5FHTA 3K6ZA 5DP3A 2BD2A 1O31A 5DJ7A 2GZ9A 3QLPH 1EATA 2BOKA 3TPIZ 4MPUA 4DG4A 4Y0ZE 3RXMA 2OXSA 3HPTB 4D9QA 2A5KA 5A8ZA 3V7TA 1GBFA 2ANMH 3TU7H 3A7TA 4YTAA 1NC6A 1SGEE 1GI5A 2A1DB 1A61H 4QT8C 1CA8B 3EAJA 3MFJA 4I32A 1C2IA 3VGCB 1F0SA 3JZ1B 3A82A 1AE8H 1CGHA 2BDIA 1ELAA 1NTPA 1P2KA 1GI4A 3HK6B 4H6TA 1BJUA 1Y3WA 5C2ZA 2EI6A 1W12U 1ELFA 1Z1JA 3FFGA 1GBAA 2VU8E 3A8DA 3HKIB 5ESBA 1H1BA 2Z94A 3E0NB 1UTNA 1ETRH 1CHGA 1TYNA 3QTOH 4B76A 1VITF 4ZKSU 3OY5U 4ZMAH 1RTLA 2CHAB 1QURH 3GY6A 4SGBE 4WF8A 1NM6A 3SI4H 2FESH 1GHZA 2ZQ1A 2W3IA 4FU8A 3EGKH 1GI6A 2F9PA 1HAPH 1QRZA 4X6PA 4CRAA 1ID5H 4WH6A 4AB8A 1QIXB 5EW2H 2P94A 1O3IA 2J4IA 1EPTB 4I33A 1G3BA 1Y3VA 2QC2A 3TJVA 2RDLA 3U8TH 4ZKRU 1LHFH 2QF0A 3GCTF 5HYOA 1V2QT 1EB2A 1BCUH 2C8XB 3MH4A 1O2PA 4OS5A 1FIZA 1ABIH 1C2HA 1DS2E 1DICA 3IITA 3I29A 4Z0KA 4AFQA 1G32B 3SHAH 3VB6A 2NU2E 1C1SA 1H9IE 1ABJH 1P9UA 4E7NA 1UVPA 2HRVA 5FXLA 1GJ5H 1ELCA 1XUJA 4FUFA 3W94A 1FPHH 5GCHF 1UVOA 1AN1E 2AIQA 3A81A 1SI5H 1O2VA 1O3BA 1TGBA 4Y8YA 5F6MA 3BG4C 2Z9IA 1TQ7B 4KELA 4A1XA 4E06H 1AFQC 4ZXYH 1GMCG 2G8TA 2FMJA 5GWZA 2PKAA 2UWPA 2FOHA 2BLWA 1O3JA 1L4DA 2QXGA 4MPXA 3JZ2B 1KY9A 1C2MA 1IHSH 1CBWB 4ISLA 1AGJA 2C4FH 2F3CE 1DX5M 4Y6DA 1JMOH 1PQ8A 4A7IB 4ABDA 1SMFE 1ZSLA 2ODYB 4YM9A 1TPPA 2F9OA 1FAKH 1SPJA 3DFLA 1MUEB 1KXEA 1TGCA 1TAWA 4X1PU 1JXPA 2NU0E 4JZEH 4PROA 1AE5A 3MNXA 4FUCA 4GHTA 1MQ6A 1V2TT 3FZDA 1TBQH 1OXGA 4UONA 2J94A 3U9AH 1O2GH 1IQNA 2GCTB 2LNCA 2B8OH 1GJ4H 1EP6A 2P59A 3UFAA 1OP2A 1LQEA 1GI8B 1O5EH 1C5UA 1K1MA 1GBHA 1WQSA 2AMQA 2BVXH 2ZP0H 1GJCB 3SJ9A 1BZXE 2OLGA 4OS4A 3UUZA 3SJIA 3RXDA 1AKSB 1BBRH 4HI3A 3SU3A 2ZFRH 1GHVH 5A0AE 1N8OB 5FAHA 1GHAG 1TRYA 1HXEH 1J8AA 5EPNA 3KQDA 3HK3B 3MU5A 3SV9A 1OPHB 5FBEA 2OBOA 1RIWB 2OP9A 3BTQE 4WMFA 2OQ5A 1EXFA 3PLPA 1P9SA 2H1UA 3ZV9A 3LT3A 2C90B 1G3EA 2VIWA 2XYAA 3SHCH 4WY3A 4CREA 3P8NA 2XW9A 4B74A 3TK9A 5SGAE 3RXQA 2R9PA 3SGBE 3GY3A 4E7RG 5C1XA 2BZ6H 4DY7B 2G52A 1ZJKA 3P8FA 2ZA5A 1QL7A 3STJA 2ANYA 5F8XA 2RG3A 1RD3B 3NPSA 1C1PA 4I8JA 4H42U 4JZIA 1VR1H 4IGDA 1KSNA 1QTFA 1C4V2 1MTVA 2W5EA 3LOXA 4NGAH 1TLDA 3CP7A 1JWTA 3RXGA 3SNDA 2BY8X 1BB0B 2V0BA 1C9PA 4OS7A 2OC0A 1J17T 1NFWA 4K5ZA 1O0DH 1ZR0A 1A0HB 3A88A 1GWAA 6GCHF 4K8YA 1TE0A 4XSKU 1GL1A 1THSH 1UCYH 3GCTG 1GBBA 3RXTA 1SQAA 2C93B 1O3CA 1EJAA 1M9UA 1SGCA 1S84A 1O2JA 2ZU2A 3QN7A 1GJBB 1QBVH 1NU7B 3Q00A 4ESTE 1T32A 1PPEE 2ZIQH 1XVMA 4CBOA 2GT7A 3GY7A 1S0QA 5GDSH 2WYGA 1QA0A 3TITA 3HKJB 1YF4A 4JMYA 1C1RA 4VGCB 1FN8A 1PJPA 2AFQB 2Q6DA 1CVWH 1P2NA 1AVGH 4WXIA 1DPOA 2FODA 1ARCA 1H8IH 3HGPA 1Y59T 1O3EA 3TIUA 5LPEA 2J2UA 1AU8A 3FANA 1GCTB 4ISOA 3LPRA 5EU8A 5BPEA 1VGCC 1B5GH 1DY8A 1SG8B 2FOAA 1DWCH 1F5RA 3ZYDA 3F9EA 3EE0B 3ODDA 1E34B 1P2MA 4NSYA 1WSSH 1HJ8A 5EXMA 3ESTA 1V2NT 1AY6H 3ZVAA 1MCTA 2IOTA 3MO3A 1C1UH 1J14A 3ITIA 2BY9X 3SUEA 1O35A 1O2HA 2PKAB 3PLBA 3GY8A 4B2BA 1TNJA 1MMJN 2J34A 4FUEA 1C4U2 3VGCC 1FIWA 2BDHA 2PSYA 2VVVA 2ZU1A 2BDGA 1VCQA 2W26A 2ZPQA 2F9NA 1SGRE 1LO6A 3PWBA 1PFXC 1ZGVA 1UVTH 2ZU5A 1BOQA 1HAYB 3LDXH 1EAWA 2P93A 3SUGA 5HXFA 2AEIH 5FX6A 1HAVA 2VVCA 4XFQA 1RTFB 2R2WU 4BNRA 1QJ7B 2BD3A 2NWNA 4WH8A 1HDTH 1Q31A 2VGCB 2CHAC 2A4GA 3BIUH 1FLEE 1WTHD 1EX3A 4GCHG 2Z3CA 3RXAA 1UK2A 3WY8A 2QAAA 1C2KA 5EW1H 3KHVA 1GJAB 3LU9B 4ISIH 4KGAA 3ATKA 1EZXC 2TRMA 1ELEE 1EJMA 1EPTC 3KEEA 3U8OH 2ZHEH 3KL6A 1BT7A 4FVBA 1LHEH 1GI1A 3S9BA 1DUEA 1YCPK 4TWWA 1HBTH 3LGVA 1QRXA 1C5XB 1KYNA 1F5KU 1SB1H 1GPZA 1ZSJA 2A31A 3GDSA 1P57B 4JCNA 3VEQB 2Y5FA 3UR9A 4J2YB 1IQJA 4AFZA 1OWHA 2SGPE 1K28D 2FOEA 5JB9S 2FO9A 1NRSH 4Y7BA 1KLJH 4OS2A 1GJ7B 1AMHA 1ZMNA 4IMQA 1YPEH 1C5PA 2EA3A 1GJDB 3MH7A 4KKDA 1DXWA 2KAIA 1E36B 5DP4A 4B71A 5E0HA 1OWKA 1P2QA 3ZZ7A 5A09A 6GCHG 1CBWC 4YOGA 1Z8GA 9LPRA 3RLWH 2F83A 4NCYA 2WINI 5DGJA 1YPLH 3IWMA 5IDKA 1Z6EA 1DWEH 1RTKA 2JH0D 1C5LH 1WUNH 1BRAA 1HNEE 4JK5A 1SLVB 1Y3UA 1EOJA 3FAOA 3Q3XA 2BD7A 3UIRA 3M61U 1C5MD 2GVFA 1W13U 3MU8A 4K3JA 3VFEA 1TGSZ 3KCGH 1QRWA 4DIHH 1UTKA 1CA0B 3KIDU 2GCTC 1D3DB 2SNWA 2Y5GA 1O37A 1J9CH 4NZQA 1XMNB 1XUKA 1TABE 3EA8A 2ZC9H 2TGDA 4ZKNU 1GJ9B 2GX4A 3PLKA 5AFYH 3ZZ5A 6LPRA 2PLXA 2QXJA 3MYWA 3M5LA 1S83A 7KMEH 1OP8A 4XE4A 2R3YA 1G2LA 1GBCA 3A7ZA 1YLDA 1OWIA 1GBJA 1A1RA 4Q7XA 1O2LA 2Z9JA 4JZDH 2VWNA 1N8OC 1O3HA 4ZAEA 1CGIE 1DDJA 1E38B 2J92A 2ALVA 2A4OA 2BD8A 4NA7A 5ETXA 3A86A 1FY8E 1NRRH 1UTLM 2QN5T 2HNTF 1O5GH 4RSPA 1XKBC 4HZHA 6CHAB 4O03A 1BITA 1RIWC 4NWLA 2WPJS 1OS8A 1ELDE
chains in the Genus database with same CATH superfamily
1N1LA 1PPFE 3ZZCA 1SGPE 1Q2WA 1ANDA 1MCVA 1K1OA 2Y7ZA 1T8LA 5IYTA 1TRNA 1BRCE 2AH4X 2FOBA 3V3MA 1QJ6B 1LMWB 3Q3KA 1MQ5A 2EI8A 2XCFA 3QX5H 1NRPH 1UK3A 5FPSA 4BAQB 1O3OA 5FL7D 4Y0YE 1ANBA 2XBYA 2LELA 2VWOA 1UHBA 1NZQH 1GMDG 1CU1A 3SU1A 1TPSA 1GG6B 1AO5A 2HVXA 4MQAA 1HAXB 1P3CA 3P8GA 3OE7D 3UOPA 2V3HH 2ZGBH 1L1GA 3LJJA 3TGJE 3PM3A 1NPMA 1EZSC 1AB9B 1P0SH 2G5NA 2VIVA 2A7HA 2KZ4A 3PWCA 1TMUH 1EAUA 3SO3A 4WMEA 1YPMH 2VIQA 3ZV8A 3KQBA 4YO9A 4UFFH 5TCAA 2FP7B 2ZDVH 1BMAA 2KCPA 3FO8D 2CMYA 2UWLA 5LH8A 2ZDKA 1NT1A 3MNCA 3L3TA 3BTWE 3PMHB 1IQFA 4ASHA 4MNXA 1FV9A 2ILNA 4ZHMU 1OHHD 4LZ1H 4P02A 1IQGA 1SLXB 2ESTE 3AVZA 3GOVB 3LGWA 3PV2A 1TNGA 5F8ZA 1KXDA 1HAVB 1MTWA 5CDFE 2OC8A 4ABJA 3SJOA 2ZFSA 1MTNB 2BYAX 3D65E 4TPYA 4CHAC 4F49A 1YBWA 3T26A 1S82A 1QJ1B 2ZHFH 5AHGH 4XRNA 2VIOA 1AD8H 1ZRKA 3U1JB 1GHXH 1THRH 3ZVBA 3T25A 1WU1A 3LH3A 5C5NA 2L6OA 1ZTLA 5DP6A 2IJOB 4ISHH 4KTSA 1SGDE 1A5IA 4VGCC 4ACBA 4GAWA 1LVMA 1WCZA 2GZ7A 1V3XA 3KGPA 2WSSD 1ZTJA 4LK4A 1Y8TA 4GVUA 1O5BB 3H7TA 1HV7A 1DSTA 2G4TA 2VVUA 1T4UH 2O9QA 2WPHS 4Y10E 1S0RA 5HIYA 1C2JA 3GISB 4D9RA 2XC4A 1HJ9A 3SN8A 4OGYA 2KCAA 1V2RT 3UQVA 1K21H 2JETB 3RXLA 3EDXB 3FP8E 1V2KT 4X2XA 2BY6X 3K2UA 1F2SE 3D23A 1O32A 3F9GA 3SV7A 5GXPA 2BLOA 1QGFA 1AZZA 3DD2H 1HUTH 5JBAS 3N7EA 4UFGH 1Y3YA 4FU7A 2KAIB 2JH5D 3RM2H 1CHOG 3EYDA 2ZDMA 3S0NA 3GY5A 5C1YA 1MTSA 4INHA 1C1QA 3P70B 3BTHE 3QK1A 4UD9H 1FY5A 4INKA 3EQ0H 1ZHRA 3MMGA 1EUFA 1OWEA 3FP6E 4UFDH 4TWYA 3VB3A 2QE7D 3SUDA 1Z6JH 3MNSA 4CH8B 2FX6A 2PHBA 2A2QH 3T27A 2XRCA 5DK1A 1BMNH 4H4FA 5DG6A 3TNTA 4Q7YA 1OSSA 4WMDA 3UPEA 1TRMA 3M7TA 1HJAB 1UVSH 2BDYA 3ZVCA 1DVAH 3E91A 1L1JA 1BBRE 3A7YA 2VGCC 1BIOA 3OY6U 1C5ZB 4DT4A 3U8RH 2XC5A 1K22H 2Y5HA 2XNIA 1MABB 1IQHA 1C5TA 2ZNKH 1QNJA 2ZI2H 1KDQB 1LPZB 1LPKB 4SGAE 1ZPCA 4NIVA 4I7YH 1GGDB 4UEHH 1NFUA 3E90B 1S81A 5E8EH 1YM0A 3A80A 1FMGA 1BHXB 3F2HA 4THNH 1SQRA 1FY4A 1A2CH 3F68H 4TPIZ 1HLTH 1HAHH 4KP0A 4Z6AH 4K1EA 1KTSB 1DANH 3PRDA 3SV6A 1UTOA 1HAZB 2H5CA 2ZGCA 1DITH 1FZZA 4I8HA 2O8WA 3GDVA 4BAOB 1P02A 5KGOA 3OYPA 5C67A 4CRGA 1O2OA 3O8BA 1TX8A 4JK6A 2C8YB 2J98B 5T3HA 1IQEA 4NG9H 1UO6A 5CMXH 2ZWLH 1N6YA 4HTCH 3DCLA 2OUAA 1O3GA 3UOUA 2ZPRA 2GDEH 4U2WA 4YESB 2FS9A 1UTPA 3OU0A 2NU3E 4IC6A 4TYDA 3TK5A 1F0TA 1XXDA 2XBVA 2ZTZA 1GBDA 3A8BA 2F4LA 5C17A 1BMLA 2QGRA 3R3GB 2H5DA 3HATH 1G3CA 2ZG0H 2R2MB 2SGFE 1SGFA 4AB9A 2AMDA 1C2FA 1EASA 3SI3H 2V7QD 1KXCA 1W11U 2YMSB 1BTYA 1Z71A 3RP2A 1ZOMA 1SQTA 3LGYA 3RMLH 1SVPA 4F55A 3TVJB 4D8NA 3SYJA 1UCYE 3EE7A 3SV8A 1FAXA 1TA2A 4RT1A 4ABIA 4WVPE 5FCKA 2OC1A 4ISNA 2G5VA 2Z6BD 1TGNA 1CA0C 3MU0A 3A83A 1SBWA 2A7JA 2OINA 4A1TA 2I6SA 4K60A 4BOHA 5I25A 5L2YH 2BXTH 3L6PA 1C5RA 1B0EA 3NK8A 3STIA 3ZZ9A 1D3QB 2F91A 1W0JD 1WV7H 2H9TH 1TIOA 2Y82A 3CS7A 2F9UA 3RXRA 2G51A 2HPQH 3U98H 2FLRH 4DCDA 1P11E 3MOCA 2PR3A 1VITG 3M5MA 1ZZZA 1UVUH 5DP8A 5B6OA 3S7KB 2WPIS 1T31A 1XUIA 3SGQE 3E0PB 4X1RU 3F0PA 5EOKA 4ABEA 1L2EA 8ESTE 2C8ZB 2P8OB 3I77A 2WPDD 4ZHLU 1A3BH 2AYWA 3DFJA 2SGEE 4JYTA 1BBRK 1LKAA 4UFEH 3PO1B 1EP5A 1PYTC 4X8SH 6CHAC 1YPGH 3MTYA 3SQHE 1Z7KA 3BN9A 8GCHF 1V2WT 2TIOA 3MO6A 1VCWA 1JRTA 1FPCH 4IW4E 1FY3A 5A0BA 4XDEA 1LVOA 1INCA 2O8UA 3EA9A 1SQOA 1K1PA 4CH2B 1GJ8B 1K1LA 1UTJA 3M7UA 4GLYA 3RU4E 1MKWH 4K69A 3S9AA 4Y7AA 5E0JA 1P8VC 5GCHG 1SGQE 1PPZA 5JBCS 4AYVB 1TMBH 2R0KA 3SQEE 1GG6C 2G4UA 3OSYA 1QZ8A 2FYQA 2CF9H 3MU1A 3DA9B 1C1VH 2ZFPH 3TK6A 1JIRA 3RXJA 4DW2U 1XM1A 2OTVA 5HMAA 1AB9C 1D6RA 2ZHWH 4AYYB 2FOGA 1C2EA 2WZQA 4ZHAA 2A4RA 1NN6A 2PUQH 3SNBA 2ZHDA 3T29A 3TGIE 1L4ZA 3BF6H 4O9VA 2PTNA 1P2JA 3UR6A 4AZ2B 1GVZA 7GCHF 2F9BH 4B1TA 1O2ZA 3K9XB 2B0FA 2D2DA 4IC5A 2A32A 4H6SB 1SFQB 3C27B 2P3TB 4AORA 1TBRH 3U69H 1TX7A 2K1QA 2QXIA 2PKSB 3RDZA 4BXWA 1LPGB 1ZPZA 1BDAA 1W14U 1PPBH 2ZDAH 3DUXH 2NU1E 4BXSA 1MTNC 1FJSA 5J4QA 4KTUA 3S9CA 3RU4D 3FN8A 2ZHQH 1PYTD 4I8KA 4YLUA 3NRLA 1KXFA 1GMHF 4YOIA 2B9LA 2AGGX 1TOMH 2K8IA 1K2I1 4OM9A 1SGFG 1C5VA 1UCYK 4CRFA 1KTTB 1GI3A 2D26C 3BTDE 2HLCA 1SGNE 3A89A 3P92A 3MH5A 3RXCA 2FXRA 1OKXA 2BD4A 5C3NA 1JOUB 3KNXA 2VIPA 1O3AA 5DKMA 4U30A 3BV9B 2GV6A 1P3EA 4JYVH 1SLUB 1TWXB 1ELTA 1RJXB 2BD9A 1MAYA 4WXVA 3Q77A 1D4PB 2W6JD 1HIAA 1NROH 3DSGA 1ELBA 1HFDA 1W7XH 2ZFFH 2XWAA 1QB9A 2UUYA 1DUAA 3M7QA 4RKJB 2H2ZA 1LHGH 2BQ7B 2IN2A 4CBNA 2JETC 3DT0H 3RXSA 5FCRA 2Y7XA 1SGTA 1AUTC 4Y79A 2THFB 2FTMA 3SV2H 3ZZBA 1G9IE 3F6UH 4XBCA 4YZUA 1EJNA 1P09A 2BDCA 2BMGB 4O3UA 4MPWA 5TJXA 2EY4C 3FOAA 2GTBA 2PP6A 5AVDA 3MQKC 1T8NA 1MU6B 3V0XA 2QIQA 1IAUA 1QBNA 2XBXA 1S85A 2SGDE 1QHRB 1NRQH 3BG8A 5HGGA 4OGXA 2BDBA 5IK2D 3SBKA 2BQ6B 5C20A 4MNWA 1XUFA 1C1OA 1LVYA 3NXPA 3A8AA 1SR5C 3IG6B 4K2YA 3K6YA 5F53A 1FN6A 1H8ED 2JJ2D 4NIYA 2VWLA 1SHYA 2XWBI 2O8TA 3PMJA 1COWD 4IN1A 1NESE 3ZVDA 1E0FD 2WPKS 2RDEA 1MD7A 5HM2A 1ZMJA 1AZ8A 1HJAC 5CHBA 1GL0E 1TNKA 2BZAA 4INLA 4Q2KA 4X8TH 2F9VA 2BX3A 2R3UA 1Y5BT 2PW8H 5T6GA 4B75A 2A7CA 3OEED 4X6OA 3TJUA 3A8CA 1O2IA 3E3TA 5CE1A 1TA6A 3P6ZB 1QL9A 1QBOA 5KEDA 1YLCA 1C2GA 1QQUA 1UTMA 1DM4B 1KIGH 3UQOA 1O2XA 5JPMH 4DOQA 2RA3A 1LTOA 1GGDC 2QF3A 2OC7A 1DXPA 2ODQA 1ZRBA 2VJ1A 1O3MA 3F9HA 1TQ0B 1XUHA 3TH2H 4ABGA 1ETSH 1P04A 2PGQB 3RXIA 2FIRH 1TX6A 4I31A 3VXFH 4D7GA 3OFND 1SC8U 1C1MA 1EZUC 3LGTA 3LONA 5G4BA 3SNEA 5C94A 3NZIA 2ZU4A 1Z1IA 4CRBA 1A0JA 1EB1H 4D76A 1S6HA 4ABFA 1SGIB 4UE7H 3SU0A 3B23B 4NIWA 5JBBS 4YT7H 4XBBA 2L74A 6ESTA 5EXNA 2A0QB 1G37A 2VH0A 1OYQA 1FXYA 2CXVA 5GPIB 2I6QA 1CT4E 2M5TA 3M3TA 1GI2A 1BQYA 2PWXA 1SOTA 4KTCA 2HVYB 1V2PT 4BANB 1BMFD 2ZCHP 2ZZUH 1MBMA 1UMAH 4JZ1A 3ATLA 2CGAA 1CT2E 2OCVB 3E1XB 2UUJB 3RUOA 4D7FA 1T8MA 4ZXXH 4E05H 4Q4LA 1N6XA 1O5CB 4F4OC 7GCHG 1KLIH 2AMPA 3MH6A 3LC3A 2DE8A 4IBLH 2CK3D 1IQMA 5L30H 1PPGE 3M36A 1ZJDA 4ZROA 3ENSB 1TONA 2YMSC 3PRBA 3KQEA 3HGNA 5EQQA 1VJAU 1GHYH 3TH4H 2V6NA 1ANCA 3ATWA 1K1NA 2W7UA 1F92A 3RXBA 1P06A 1GMHG 1SSXA 1HAGE 4NZLA 1AUJA 4X1QU 3PB1E 3TJNA 2ANWA 3H09A 1A7SA 1LHDH 2UUKB 3F3BA 3K65B 4LOYH 1H8DH 2WUBA 3M37A 1CE5A 3TJOA 1SL3A 2A4QA 2DUCA 4YT6H 2Z9LA 4BAKB 1Z8JB 1G3DA 1S6LA 2VB0A 2BTCE 2GV7A 1W0ZU 4JYUH 1HAOH 1VJ9U 3GY4A 4A5TS 1MBQA 2ZGHA 1TNHA 2BY5X 1P2IA 1MAXA 4Y71A 1EKBB 2FPZA 3EA7A 1O3NA 2Z7FE 1A4WH 3U28C 1LKBA 3UWIA 3UAIC 5LPRA 1TBZH 1D3TB 4IS5A 3H7OA 2CN0H 4DVAU 1K1IA 1O3LA 1A5HA 3PO1C 5JBTA 4X6MA 8LPRA 1DSUA 2TGTA 2PGBB 4JZFH 2ZCKP 5LPFA 3O8CA 1Z8RA 1UJ1A 1V2MT 5EPYA 1ACBE 1TPAE 2BOHB 4WWYA 5ESTE 1A5GH 4BTIB 2QCYA 1GHAF 2RCEA 1AFEH 5EODA 1HIAB 5DO4H 4TY7A 3OX7U 4ABAA 1O2TA 1GBLA 4FUDA 2YMSD 1PQ5A 1ARBA 1ANEA 1P12E 2PUXB 3RXOA 4DURA 2KCOA 5E2OA 3UNSA 3O8RA 3PV4A 1MTUA 2ODPA 1O2KA 2BLQA 1JBUH 2GGVB 1FQ3A 4O97A 4ZH8A 2WV4A 3M5OA 4Q80A 2BM2A 3URCA 4CR9A 3QTVH 1OWDA 4RT0A 2FYRA 1V6DA 3URDA 2D8WA 2Y80A 1GBMA 1GCTC 2AS9A 2FWWA 5DPAA 1RXPA 1D3PB 5GNDA 3MHWU 3MO9A 2FS8A 4ZUHA 3RU4T 5EJLA 3A84A 1GBKA 1GHBF 4OS6A 5JYIA 4DGJA 5A0CA 5CHAB 5DP9A 1BTXA 3SJ8A 3QUMP 1SOZA 4RN6A 2ZCLP 3VPKA 3GY2A 3T5FH 1LDTT 5T6DA 2PKSC 5PTPA 1BTHH 2H9EH 2V3MA 1G36A 1QL8A 2R0LA 3F1SB 3S69A 3Q3YA 2QA9E 2TGAA 4NA8A 2GKVE 2BXUH 3P95A 3LIWA 1DOJA 3T28A 1GI7B 5K0HA 3QZRA 1TMTH 2ZPSA 1EQ9A 1Y5UT 7ESTE 2P3UB 3AASA 3M3SA 3RXVA 2JDID 2Q6FA 3ATIA 2QV1A 3RXEA 2B5TB 4LXBH 1TOCB 2JH6D 1C4Y2 1GBIA 1TALA 2A45B 1C5YB 5J4SA 1EZQA 4MNVA 1J16A 1ZLRA 2VWMA 1C1NA 1V2OT 3ZZ8A 1YPKH 1ZPBA 4YLQH 5FX5A 3LGUA 1O2MA 3S7HB 2W3KA 1OX1A 2GZ8A 2V3OH 4HFPB 3RXUA 2HGTH 2Q6GA 5AF9H 3QZQA 1GDQA 2XTTB 1HXFH 1VITH 5EXLA 1O2SA 2O8MA 2XXLA 1EOLA 2A5IA 3G01A 3GCNA 8KME2 3GCHB 2G81E 1A0LA 5HM9A 1AVXA 1GI9B 1LQDB 2FEQH 4GUXA 3RLYH 3ZVGA 2PFEA 1FY1A 1L0ZA 1NO9H 2AGIX 4NA9H 2ZTXA 3A7WA 2ZDLA 1GBTA 1XX9A 2BB4A 1O2WA 3BTTE 3ODFA 1IQKA 3NKKA 5FPTA 1TNIA 4Y8ZA 2TBSA 3RC5A 3VB5A 3I78A 4DJZB 3BEFB 3BIVH 2UUFB 2OQUA 2ZTYA 1SFIA 1QCPA 1WTGH 1GI0A 1FUJA 4X6NA 5L6NH 3VB7A 2GCHF 3RXFA 4AN7A 1GVKB 1F0RA 4AG1A 1YCPM 1C5QA 4M7GA 1C9TA 2IPHA 3PROA 4XBDA 3N7DA 1PQ7A 1Y3XA 1P2OA 1Y5AT 2GMTB 1QY6A 1O2QA 3R0FA 4NFFA 1MU8B 2GD4B 2FDAA 1W10U 4ABBA 4ZKOU 4X8VH 1XUGA 3ZVFA 2H6MA 2VBCA 2Y81A 2FI5E 5F8TA 4J1YA 1UHBB 4A92A 1DFPA 3ZIAD 1AVWA 2BX4A 3ZVEA 3GYMA 3WWBA 4ACAA 1SGYE 2OK5A 4MNYA 4DIIH 1TFXA 1NFXA 1O33A 1V2LT 1Z8IB 3B9FH 4A1VA 1H9LB 2A5AA 1JRSA 3UY9A 2VIDA 3OTJE 4GCHF 4DT7B 2ZFTA 1DY9A 1G30B 3SNCA 1AHTH 1E1RD 1B7XB 1P03A 5LGOA 2J9NA 2BVSH 2C3SA 5GJ4B 4FUGA 4O3TA 1FI8A 1WBGB 1DWDH 2AHME 1RRKA 4RKOB 3KF2A 2NU4E 1YKTA 4MTBA 4AGJA 4NWKA 1QB6A 1DLEA 1OWJA 1E35B 4R8TB 1MD8A 4FXGH 2GP9B 2J95A 2FM2A 2YNBA 1PQAA 3RC4A 1C2DA 2HLDD 1GDNA 3FZZA 4AGKA 3CENA 4U01A 5GIBA 1GHBG 2WV5A 2D1JA 3BTKE 1QQ4A 1PPHE 1KMHB 2HWLB 2FOCA 2YOLA 2W7SA 4I8GA 1K1JA 3A7XA 1W8BH 4MLFB 2PV9B 5DP7A 5I46H 2EEKA 3QDZB 3E16B 2BLVA 1F0UA 1IQIA 3SUFA 1BJVA 1BUIA 1FX0B 1C5OH 3BTFE 4X2VA 3SU4A 1FONA 4NIXA 4GHQA 3VB4A 1O3KA 4Y11E 1EAIA 1O2NA 3M3VA 3P8OA 4K1SA 3LC5A 1ZMLA 1H4WA 4IMZA 1ESTA 2FI4E 3MU4A 1NFYA 1CQQA 4HGCA 4CHAB 1E37B 3ZZ3A 3TNSA 4B6EA 4BAMB 5C0TA 4X2WA 3SZNA 1YPHC 2G55A 3FKSD 4Y76A 2TPIZ 5EGMA 1IOEA 1WAYB 1YGCH 1O38A 1GCDA 2FX4A 1MKXH 5JB8S 1BTPA 1V2UT 3PTBA 1O5FH 7LPRA 2Q1JA 2OBQA 1YY3A 2ZU3A 1D6WA 1TGTA 5T6FA 2WUCA 2BQWB 3LKWA 1IHTH 1GVLA 2ZF0H 1DLKB 4Z1MD 4U32A 3RXHA 1O5AB 2VINA 3B8JA 1YPHE 1CT0E 3SW2B 3GCOA 3QGJA 5E2PA 3BEIB 2P95A 1DWBH 1ZTKA 2CV3A 1GHWH 3SU5A 3ATMA 5FPYA 1ZGIA 3RMNH 2Z3DA 3F9FA 1G2MA 1YPJH 4X0WU 3UTUH 1HCGA 1XXFA 5K7RA 2XNDD 1THPB 3KQ5A 1JIMA 3RMOH 4MDSA 3C1KA 5EQRA 3LGIA 2FLBH 4LZ4B 1F5LA 2KCYA 4AX9H 1FDPA 1YCPH 1W0YH 1H9HE 1AI8H 5AFZH 2G00A 2ZKSA 5TCCA 4F48B 3KYFA 1PPCE 3DSPA 2AIPA 4B73A 1LHCH 1RFNA 1C1WH 5BRRE 4AFSA 5FBIA 2GCHG 3SORA 4FVDA 4YOJA 3FP7E 3NCLA 3TLOA 5JDUB 3AAVA 3SU6A 2Z9GA 1S5SA 2HPPH 2PSXA 1NBME 3ZZDA 2ZECA 1RGQA 1GBEA 1ELVA 2SGQE 2PTCE 4FUHA 1K9OE 1KLTA 2VH6A 2F43B 1ORFA 1OOKB 5L2ZH 2ZDNA 2JKHA 5A8XA 1MKWK 2RFKC 3KYGA 4B6FA 1HGTH 2FOFA 3DHKH 3BSQA 4GSOA 3SU2A 1BTZA 3AAUA 3GS9A 3W95A 1GMDF 3SJKA 3RM0H 3GDUA 4B2CA 2GT8A 3BG4B 4FU9A 1YYY1 1AWFH 2ZGXH 4BTTB 3OTPA 4AG2A 3PTNA 1AFQB 3ZZ4A 3A87A 2A2XH 5EQSA 1MKXK 5CHAC 1HB0B 5EG4A 1HRTH 1P05A 1ELGA 4CRCA 1NU9A 3PMAB 3M5NA 2BD5A 3RMMH 3OAAD 3F2GA 3E8LA 2STBE 2BHGA 3VXEH 1KXAA 4K1TA 3N7OA 2BDAA 1W7GH 1DE7H 5B6LA 4X1NU 1AIXH 3BTME 2Z3EA 1SLWB 1NBMD 3NUMA 1L1NA 2STAE 1EFRD 2HOBA 4RI0A 3V12A 2O8LA 1Q3XA 2ASUB 1BRUP 1TNLA 1C5WB 2ULLA 2W6ID 4X8UH 1TB6H 2FOMB 4R0IA 2XC0A 3O8DA 1O2UA 1C5SA 3L33A 3RC6A 5C5OA 4FUBA 4NSVA 1ESAA 4CRDA 3M35A 2KR7A 4UDWH 3UNRA 1V2ST 4TSFD 2TGPZ 4AOQA 4MPVA 3NWUA 4CR5A 1BA8B 3BTGE 2ALPA 3V13A 4ABHA 5A8YA 2P3FH 2GDDA 4OS1A 2XBWA 1MZAA 1AQ7A 1EPTA 3RXPA 4P00A 1HYLA 3TGKE 4XOJA 1S6FA 3F0OA 1KXBA 1RS0A 3GCHC 3UNQA 3QGNB 1QFKH 1AWHB 4TY6A 3GYLB 9ESTA 2XCNA 2EI7A 1O34A 3MWIU 1NY22 8GCHG 1NRNH 2J38A 2VNTA 3LH1A 1OP0A 1O30A 1T4VH 3PYHA 4FUJA 2ZGJA 4IN2A 1VCPA 2QXHA 1C5NH 3P17H 4NFEA 5F03A 2OD3B 2AERH 1D9IA 2WHXA 5C0UA 2AGEX 1DT2A 2XOKD 2WPLS 2B7DH 1LVBA 3E6PH 5C1UA 1YLNA 1HPGA 4ZCNA 3MI4A 1CGJE 1A46H 4Y8XA 4GPGA 4BAHB 4BTUB 1YC0A 1BMMH 1W2KH 3PV5A 1O36A 3SOSA 3TH3H 1BHXF 2BVRH 1FNIA 2SGAA 2H9HA 1EAXA 3SGAE 3FVFB 1P01A 1SHHB 1CHOF 1WYKA 2HALA 5H4IB 2ZO3H 3D49H 2GMTC 1E1QD 2RA0A 1NS3A 3A7VA 1QA7A 3ZYEA 1T7CA 1O2YA 2BY7X 1ZYOA 2SFAA 2UWOA 2V35A 3GICB 3ZZAA 1CSOE 1P10A 3LJOA 1KDQA 2Y6TA 1ZHMA 3UREA 1V2VT 1ETTH 1YP9A 5E0GA 3CS0A 3UWJH 2FI3E 2LPRA 2HNTC 2WPMS 5ABWA 1BTWA 1GMCF 2KX4A 1O5DH 4AC9A 4Q7ZA 4B2AA 2ANKH 4MG3A 4I8LA 2ZQ2A 3T62A 4AFUA 3BTEE 1V2JT 1BRBE 2FZZA 3KQCA 1W3CA 1B0FA 3PMBB 3ZZ6A 3U1IB 1O3DA 4I86A 4A6LA 3QO6A 1VZQH 2QY0B 3QWCH 3SNAA 1IQLA 2ZEBA 1XKAC 2HNTE 5A2MH 2SNVA 2ZFQH 5DP5A 2QYIA 3AW1A 1H8HD 3A85A 3KN2A 1CO7E 2CF8H 1J15A 1UK4A 1TPOA 3H5CB 3T2NA 1MZDA 1AKSA 1O2RA 1WOFA 1C2LA 1A3EH 4K8BA 1C1TA 1OYTH 1BTUA 4X1SU 1GJ6A 1ESBA 2FTLE 1O39A 4X2YA 1ZSKA 1HAIH 2CJIA 2EC9H 3MNBA 1QR3E 3ELAH 2C8WB 1F7ZA 2KM0A 3AW0A 1UTQA 2WYJA 1LCYA 1X7AC 3RXKA 4FUIA 1GDUA 2YNAA 3BEUA 1QB1A 3Q76A 1O3PB 4MVNA 2P8OC 1SKYE 4WJG2 1O3FA 3D62A 1MH0A 1XVOA 2P16A 1U6QA 2Z9KA 1ZHPA 1WQVH 1VGCB 1T8OA 2DE9A 5FHTA 3K6ZA 5DP3A 4FOUC 2BD2A 1O31A 5DJ7A 2GZ9A 3QLPH 1EATA 2BOKA 3TPIZ 4MPUA 4DG4A 4Y0ZE 3RXMA 2OXSA 3HPTB 4D9QA 2JIZD 2A5KA 5A8ZA 3V7TA 1GBFA 2ANMH 3TU7H 3A7TA 4YTAA 1NC6A 1SGEE 1GI5A 2A1DB 1A61H 4QT8C 1CA8B 3EAJA 3MFJA 4I32A 1C2IA 3VGCB 1F0SA 3JZ1B 3A82A 1AE8H 1YWUA 1CGHA 2BDIA 1ELAA 1NTPA 1P2KA 1GI4A 3HK6B 4H6TA 1BJUA 1Y3WA 5C2ZA 5EIYA 2EI6A 1W12U 1ELFA 1Z1JA 3FFGA 3UB0A 1GBAA 2VU8E 3A8DA 3HKIB 5ESBA 1H1BA 2Z94A 3E0NB 1UTNA 1ETRH 1CHGA 1TYNA 3QTOH 4B76A 1VITF 4ZKSU 3OY5U 4ZMAH 1RTLA 2CHAB 3CNRA 1QURH 3GY6A 4SGBE 4WF8A 1NM6A 3SI4H 2FESH 1GHZA 2ZQ1A 2W3IA 4FU8A 3EGKH 1GI6A 2F9PA 1HAPH 1QRZA 4X6PA 4CRAA 1ID5H 4WH6A 2J97A 1QIXB 4AB8A 5EW2H 2P94A 1O3IA 2J4IA 1EPTB 4I33A 1G3BA 1Y3VA 2QC2A 3TJVA 2RDLA 3DSOA 4XD7D 3U8TH 4ZKRU 1LHFH 3AK5A 2QF0A 3GCTF 5HYOA 1V2QT 1EB2A 1BCUH 2C8XB 3MH4A 1O2PA 4OS5A 1FIZA 1ABIH 1C2HA 1DS2E 1DICA 3IITA 2JJ1D 2J5UA 3I29A 4Z0KA 1K0HA 4AFQA 1G32B 3SHAH 3VB6A 2NU2E 1C1SA 1H9IE 1ABJH 1P9UA 4E7NA 1UVPA 2HRVA 5FXLA 1GJ5H 1ELCA 1XUJA 4FUFA 3W94A 1FPHH 5GCHF 1UVOA 1AN1E 2AIQA 3VG8A 3A81A 1SI5H 1O2VA 3F2FA 1O3BA 1TGBA 4Y8YA 5F6MA 3BG4C 2Z9IA 1TQ7B 4KELA 4A1XA 4E06H 1AFQC 2LP6A 4ZXYH 1GMCG 2G8TA 2FMJA 5GWZA 2PKAA 2UWPA 2FOHA 2BLWA 1O3JA 1L4DA 2QXGA 4MPXA 4HG6A 3JZ2B 1KY9A 3WWFA 1C2MA 1IHSH 1CBWB 1VKYA 4ISLA 1AGJA 2C4FH 2F3CE 1DX5M 4Y6DA 1JMOH 1PQ8A 3W1EA 4A7IB 4ABDA 1SMFE 1ZSLA 2ODYB 4YM9A 1TPPA 2F9OA 1FAKH 1SPJA 3DFLA 1MUEB 1KXEA 1TGCA 1TAWA 4X1PU 1JXPA 2NU0E 4JZEH 4PROA 1AE5A 3MNXA 4FUCA 4GHTA 1MQ6A 1V2TT 3FZDA 1TBQH 1OXGA 4UONA 2J94A 3U9AH 1O2GH 1IQNA 2GCTB 2LNCA 2B8OH 1GJ4H 1EP6A 2P59A 3UFAA 1OP2A 1LQEA 1GI8B 1O5EH 1C5UA 1K1MA 1GBHA 1WQSA 2AMQA 2BVXH 2ZP0H 1GJCB 3SJ9A 1BZXE 2OLGA 4OS4A 3UUZA 3SJIA 3RXDA 1AKSB 1BBRH 4HI3A 3SU3A 2ZFRH 1GHVH 5A0AE 1N8OB 5FAHA 1GHAG 1TRYA 1HXEH 1J8AA 5EPNA 3KQDA 3HK3B 3MU5A 3SV9A 1OPHB 5FBEA 2OBOA 1RIWB 2OP9A 3BTQE 2IPQX 4WMFA 2OQ5A 1EXFA 3PLPA 1P9SA 2H1UA 3ZV9A 3LT3A 2C90B 1G3EA 2GJGA 2VIWA 2XYAA 4WY3A 3SHCH 4CREA 3P8NA 2XW9A 4B74A 3TK9A 5SGAE 3RXQA 5EJZA 2R9PA 3SGBE 3GY3A 4E7RG 5C1XA 2BZ6H 4DY7B 2G52A 1ZJKA 3P8FA 2ZA5A 1QL7A 3STJA 2ANYA 5F8XA 2RG3A 1RD3B 1W0KD 3NPSA 1C1PA 4I8JA 4H42U 4JZIA 1VR1H 4IGDA 1KSNA 1QTFA 1C4V2 1MTVA 2W5EA 3LOXA 4NGAH 1TLDA 3CP7A 1JWTA 3RXGA 3SNDA 2BY8X 1BB0B 2V0BA 1C9PA 4OS7A 2OC0A 1J17T 1NFWA 4K5ZA 1O0DH 1ZR0A 1A0HB 3A88A 1GWAA 6GCHF 4K8YA 1TE0A 4XSKU 1GL1A 1THSH 5T1VA 1UCYH 3GCTG 1GBBA 3RXTA 1SQAA 2C93B 1O3CA 1EJAA 2EQNA 2QF5A 1M9UA 1SGCA 1S84A 1O2JA 2ZU2A 3OEHD 3QN7A 1GJBB 1QBVH 1NU7B 3Q00A 4ESTE 1T32A 1PPEE 2ZIQH 1XVMA 4CBOA 2GT7A 3GY7A 1S0QA 5GDSH 2WYGA 1QA0A 3TITA 3HKJB 1YF4A 4JMYA 1C1RA 4VGCB 1FN8A 1PJPA 2AFQB 2Q6DA 1CVWH 1P2NA 1AVGH 2QF4A 4WXIA 1DPOA 2FODA 1ARCA 1H8IH 3HGPA 1Y59T 1O3EA 3TIUA 5LPEA 2J2UA 1AU8A 3FANA 1GCTB 4ISOA 3LPRA 5EU8A 5BPEA 1E79D 1VGCC 1B5GH 1DY8A 1SG8B 2FOAA 1DWCH 1F5RA 3ZYDA 3F9EA 4Q63A 3N99A 3EE0B 3ODDA 1E34B 1P2MA 4NSYA 1WSSH 1HJ8A 5EXMA 3ESTA 1V2NT 1AY6H 3ZVAA 1MCTA 2IOTA 3MO3A 1C1UH 1J14A 3ITIA 2BY9X 3SUEA 1O35A 1O2HA 2PKAB 3PLBA 3GY8A 4B2BA 1TNJA 1MMJN 5HIZA 2J34A 4FUEA 1C4U2 3VGCC 1FIWA 2BDHA 2M2AA 2PSYA 2VVVA 2ZU1A 2BDGA 1VCQA 2W26A 2ZPQA 2F9NA 1SGRE 1LO6A 3PWBA 1PFXC 1ZGVA 1UVTH 2ZU5A 1BOQA 1HAYB 3LDXH 1EAWA 2P93A 3SUGA 5HXFA 5HKKD 2AEIH 5FX6A 1HAVA 2VVCA 4XFQA 1RTFB 2R2WU 4BNRA 1QJ7B 2BD3A 2NWNA 4WH8A 1HDTH 1Q31A 2VGCB 2CHAC 2A4GA 3BIUH 1FLEE 1WTHD 1EX3A 4GCHG 2Z3CA 3RXAA 1UK2A 3WY8A 2QAAA 1C2KA 5EW1H 3KHVA 1GJAB 3LU9B 4ISIH 4KGAA 2WV9A 3ATKA 1EZXC 2TRMA 1ELEE 1EJMA 1EPTC 3KEEA 3U8OH 2ZHEH 3KL6A 1BT7A 4FVBA 1LHEH 1GI1A 3S9BA 1DUEA 1YCPK 4TWWA 1HBTH 3LGVA 1QRXA 1C5XB 1KYNA 1F5KU 1SB1H 1GPZA 1ZSJA 2A31A 3GDSA 1P57B 4JCNA 2IJD1 3VEQB 2Y5FA 3UR9A 4J2YB 1IQJA 4AFZA 1OWHA 1WXRA 2SGPE 1K28D 2FOEA 5JB9S 5DN6D 2FO9A 1NRSH 4Y7BA 1KLJH 4OS2A 1GJ7B 1AMHA 1ZMNA 4IMQA 1YPEH 1C5PA 2EA3A 1GJDB 3MH7A 4KKDA 3WW7A 1DXWA 2KAIA 1E36B 5DP4A 4B71A 5E0HA 1OWKA 2K0QA 1P2QA 3ZZ7A 5A09A 6GCHG 1CBWC 4YOGA 1Z8GA 9LPRA 3RLWH 2F83A 4NCYA 2WINI 5DGJA 1YPLH 3IWMA 5IDKA 1Z6EA 1DWEH 1RTKA 2JH0D 1C5LH 1WUNH 1UW7A 1BRAA 1HNEE 4JK5A 1SLVB 1Y3UA 1EOJA 3FAOA 3Q3XA 2BD7A 3UIRA 3M61U 1C5MD 2GVFA 1W13U 3MU8A 4K3JA 3VFEA 1TGSZ 3KCGH 1QRWA 5EJ1A 4DIHH 1UTKA 1CA0B 3KIDU 2GCTC 1D3DB 2SNWA 2Y5GA 1O37A 4YXWD 1J9CH 4FETA 4NZQA 1XMNB 1XUKA 1TABE 3EA8A 4ASUD 2ZC9H 2TGDA 4ZKNU 1GJ9B 2GX4A 3PLKA 5AFYH 3ZZ5A 6LPRA 2PLXA 2QXJA 3MYWA 3M5LA 1S83A 7KMEH 1OP8A 4XE4A 2R3YA 1G2LA 1GBCA 3A7ZA 5DSFA 1WDIA 3SZEA 1YLDA 1OWIA 1GBJA 1A1RA 4Q7XA 2KFWA 1O2LA 2Z9JA 4JZDH 2VWNA 1N8OC 1O3HA 4M9FA 4ZAEA 1CGIE 1DDJA 1E38B 2J92A 4TT3D 2ALVA 2A4OA 2BD8A 4NA7A 5ETXA 3A86A 1FY8E 1NRRH 1UTLM 2QN5T 2HNTF 5KECA 1O5GH 4RSPA 1XKBC 4HZHA 6CHAB 4O03A 1BITA 1RIWC 2J98A 4NWLA 2WPJS 1OS8A 1ELDE
chains in the Genus database with same CATH topology
1N1LA 1PPFE 3ZZCA 1SGPE 1Q2WA 1ANDA 1MCVA 1K1OA 2Y7ZA 1T8LA 5IYTA 1TRNA 1BRCE 2AH4X 2FOBA 3V3MA 1QJ6B 1LMWB 3Q3KA 1MQ5A 2EI8A 2XCFA 3QX5H 1NRPH 1UK3A 5FPSA 4BAQB 1O3OA 4Y0YE 1ANBA 2XBYA 2VWOA 1UHBA 1NZQH 1GMDG 1CU1A 3SU1A 1TPSA 1GG6B 1AO5A 2HVXA 4MQAA 1HAXB 1P3CA 3P8GA 3UOPA 2V3HH 2ZGBH 1L1GA 3LJJA 3TGJE 3PM3A 1NPMA 1EZSC 1AB9B 1P0SH 2G5NA 2VIVA 2A7HA 3PWCA 1TMUH 1EAUA 3SO3A 4WMEA 1YPMH 2VIQA 3ZV8A 3KQBA 4YO9A 4UFFH 5TCAA 2FP7B 2ZDVH 1BMAA 5LH8A 2CMYA 2UWLA 2ZDKA 1NT1A 3MNCA 3L3TA 3BTWE 3PMHB 1IQFA 4ASHA 4MNXA 1FV9A 2ILNA 4ZHMU 4LZ1H 1IQGA 1SLXB 2ESTE 3AVZA 3GOVB 3LGWA 1TNGA 5F8ZA 1KXDA 1HAVB 1MTWA 2OC8A 4ABJA 3SJOA 2ZFSA 1MTNB 2BYAX 3D65E 4TPYA 4CHAC 4F49A 1YBWA 3T26A 1S82A 1QJ1B 2ZHFH 5AHGH 2VIOA 1AD8H 1ZRKA 3U1JB 1GHXH 1THRH 3ZVBA 3T25A 1WU1A 3LH3A 5C5NA 1ZTLA 5DP6A 2IJOB 4ISHH 4KTSA 1SGDE 1A5IA 4VGCC 4GAWA 1LVMA 1WCZA 2GZ7A 1V3XA 3KGPA 1ZTJA 4LK4A 1Y8TA 4GVUA 1O5BB 3H7TA 1HV7A 1DSTA 2G4TA 2VVUA 1T4UH 2O9QA 2WPHS 4Y10E 1S0RA 1C2JA 3GISB 4D9RA 2XC4A 1HJ9A 3SN8A 4OGYA 1V2RT 3UQVA 1K21H 2JETB 3RXLA 3EDXB 3FP8E 1V2KT 4X2XA 2BY6X 3K2UA 1F2SE 3D23A 1O32A 3F9GA 3SV7A 5GXPA 2BLOA 1QGFA 1AZZA 3DD2H 1HUTH 5JBAS 4UFGH 1Y3YA 4FU7A 2KAIB 2JH5D 3RM2H 1CHOG 3EYDA 2ZDMA 3S0NA 3GY5A 5C1YA 1MTSA 4INHA 1C1QA 3P70B 3BTHE 3QK1A 4UD9H 1FY5A 4INKA 3EQ0H 1ZHRA 3MMGA 1EUFA 1OWEA 3FP6E 4UFDH 4TWYA 3VB3A 3SUDA 1Z6JH 3MNSA 4CH8B 2FX6A 2PHBA 2A2QH 3T27A 2XRCA 5DK1A 1BMNH 4H4FA 5DG6A 3TNTA 4Q7YA 1OSSA 4WMDA 3UPEA 1TRMA 3M7TA 1HJAB 1UVSH 2BDYA 3ZVCA 1DVAH 3E91A 1L1JA 1BBRE 3A7YA 2VGCC 1BIOA 3OY6U 1C5ZB 3U8RH 2XC5A 1K22H 2Y5HA 2XNIA 1IQHA 1C5TA 2ZNKH 1QNJA 2ZI2H 1KDQB 1LPZB 1LPKB 4SGAE 1ZPCA 4NIVA 4I7YH 1GGDB 4UEHH 1NFUA 3E90B 1S81A 5E8EH 1YM0A 3A80A 1FMGA 1BHXB 4THNH 1FY4A 1A2CH 3F68H 4TPIZ 1HLTH 1HAHH 4KP0A 4Z6AH 4K1EA 1KTSB 1DANH 3SV6A 1UTOA 1HAZB 2H5CA 2ZGCA 1DITH 1FZZA 4I8HA 2O8WA 3GDVA 4BAOB 1P02A 3OYPA 5C67A 4CRGA 1O2OA 3O8BA 1TX8A 4JK6A 2C8YB 5T3HA 1IQEA 4NG9H 1UO6A 5CMXH 2ZWLH 1N6YA 4HTCH 2OUAA 1O3GA 3UOUA 2ZPRA 2GDEH 4U2WA 4YESB 2FS9A 1UTPA 3OU0A 2NU3E 4IC6A 4TYDA 3TK5A 1F0TA 1XXDA 2XBVA 2ZTZA 1GBDA 3A8BA 1BMLA 2QGRA 3R3GB 2H5DA 3HATH 1G3CA 2ZG0H 2R2MB 2SGFE 1SGFA 4AB9A 2AMDA 1C2FA 1EASA 3SI3H 1KXCA 1W11U 1BTYA 1Z71A 3RP2A 1ZOMA 1SQTA 3LGYA 3RMLH 1SVPA 3TVJB 4D8NA 1UCYE 3SV8A 1FAXA 1TA2A 4ABIA 4WVPE 5FCKA 2OC1A 4ISNA 2G5VA 2Z6BD 1TGNA 1CA0C 3MU0A 3A83A 1SBWA 2A7JA 2OINA 4A1TA 2I6SA 4K60A 4BOHA 5I25A 5L2YH 2BXTH 3L6PA 1C5RA 1B0EA 3NK8A 3STIA 3ZZ9A 1D3QB 2F91A 1WV7H 2H9TH 1TIOA 2Y82A 3CS7A 2F9UA 3RXRA 2G51A 2HPQH 3U98H 2FLRH 4DCDA 1P11E 3MOCA 2PR3A 1VITG 3M5MA 1ZZZA 1UVUH 5DP8A 5B6OA 3S7KB 2WPIS 1T31A 1XUIA 3SGQE 3E0PB 4X1RU 5EOKA 4ABEA 1L2EA 8ESTE 2C8ZB 2P8OB 3I77A 4ZHLU 1A3BH 2AYWA 3DFJA 2SGEE 4JYTA 1BBRK 1LKAA 4UFEH 3PO1B 1EP5A 1PYTC 4X8SH 6CHAC 1YPGH 3MTYA 3SQHE 1Z7KA 3BN9A 8GCHF 1V2WT 2TIOA 3MO6A 1VCWA 1JRTA 1FPCH 4IW4E 1FY3A 5A0BA 4XDEA 1LVOA 1INCA 2O8UA 3EA9A 1SQOA 1K1PA 4CH2B 1GJ8B 1K1LA 1UTJA 3M7UA 4GLYA 3RU4E 1MKWH 4K69A 3S9AA 4Y7AA 5E0JA 1P8VC 5GCHG 1SGQE 1PPZA 5JBCS 4AYVB 1TMBH 2R0KA 3SQEE 1GG6C 2G4UA 3OSYA 2FYQA 2CF9H 3MU1A 3DA9B 1C1VH 2ZFPH 3TK6A 1JIRA 3RXJA 4DW2U 1XM1A 2OTVA 5HMAA 1AB9C 1D6RA 2ZHWH 4AYYB 2FOGA 1C2EA 4ZHAA 2A4RA 1NN6A 2PUQH 3SNBA 2ZHDA 3T29A 3TGIE 1L4ZA 3BF6H 4O9VA 2PTNA 1P2JA 3UR6A 4AZ2B 1GVZA 7GCHF 2F9BH 4B1TA 1O2ZA 3K9XB 2B0FA 2D2DA 4IC5A 2A32A 4H6SB 1SFQB 3C27B 2P3TB 4AORA 1TBRH 3U69H 1TX7A 2K1QA 2QXIA 2PKSB 3RDZA 4BXWA 1LPGB 1ZPZA 1BDAA 1W14U 1PPBH 2ZDAH 3DUXH 2NU1E 4BXSA 1MTNC 1FJSA 5J4QA 4KTUA 3S9CA 3RU4D 2ZHQH 1PYTD 4I8KA 4YLUA 1KXFA 1GMHF 4YOIA 2B9LA 2AGGX 1TOMH 1K2I1 1SGFG 1C5VA 1UCYK 4CRFA 1KTTB 1GI3A 2D26C 3BTDE 2HLCA 1SGNE 3A89A 3P92A 3MH5A 3RXCA 2FXRA 1OKXA 2BD4A 5C3NA 1JOUB 3KNXA 2VIPA 1O3AA 5DKMA 4U30A 3BV9B 2GV6A 1P3EA 4JYVH 1SLUB 1TWXB 1ELTA 1RJXB 2BD9A 1MAYA 4WXVA 3Q77A 1D4PB 1HIAA 1NROH 1ELBA 1HFDA 1W7XH 2ZFFH 2XWAA 1QB9A 2UUYA 1DUAA 3M7QA 4RKJB 2H2ZA 1LHGH 2BQ7B 2IN2A 4CBNA 2JETC 3DT0H 3RXSA 5FCRA 2Y7XA 1SGTA 1AUTC 4Y79A 2THFB 2FTMA 3SV2H 3ZZBA 1G9IE 3F6UH 4XBCA 4YZUA 1EJNA 1P09A 2BDCA 2BMGB 4O3UA 4MPWA 5TJXA 2GTBA 5AVDA 1T8NA 1MU6B 3V0XA 2QIQA 1IAUA 1QBNA 2XBXA 1S85A 2SGDE 1QHRB 1NRQH 3BG8A 5HGGA 4OGXA 2BDBA 3SBKA 2BQ6B 5C20A 4MNWA 1XUFA 1C1OA 1LVYA 3NXPA 3A8AA 1SR5C 3IG6B 4K2YA 3K6YA 1FN6A 4NIYA 2VWLA 1SHYA 2XWBI 2O8TA 3PMJA 4IN1A 1NESE 3ZVDA 1E0FD 2WPKS 1MD7A 5HM2A 1ZMJA 1AZ8A 1HJAC 1GL0E 1TNKA 2BZAA 4INLA 4Q2KA 4X8TH 2F9VA 2BX3A 2R3UA 1Y5BT 2PW8H 5T6GA 4B75A 2A7CA 4X6OA 3TJUA 3A8CA 1O2IA 3E3TA 5CE1A 1TA6A 3P6ZB 1QL9A 1QBOA 1YLCA 1C2GA 1QQUA 1UTMA 1DM4B 1KIGH 3UQOA 1O2XA 5JPMH 4DOQA 2RA3A 1LTOA 1GGDC 2QF3A 2OC7A 1DXPA 2ODQA 1ZRBA 2VJ1A 1O3MA 3F9HA 1TQ0B 1XUHA 3TH2H 4ABGA 1ETSH 1P04A 2PGQB 3RXIA 2FIRH 1TX6A 4I31A 3VXFH 4D7GA 1SC8U 1C1MA 1EZUC 3LGTA 3LONA 5G4BA 3SNEA 3NZIA 2ZU4A 1Z1IA 4CRBA 1A0JA 1EB1H 4D76A 1S6HA 4ABFA 1SGIB 4UE7H 3SU0A 3B23B 4NIWA 5JBBS 4YT7H 4XBBA 6ESTA 5EXNA 2A0QB 1G37A 2VH0A 1OYQA 1FXYA 2CXVA 5GPIB 2I6QA 1CT4E 2M5TA 3M3TA 1GI2A 1BQYA 2PWXA 1SOTA 4KTCA 1V2PT 4BANB 2ZCHP 2ZZUH 1MBMA 1UMAH 4JZ1A 3ATLA 2CGAA 1CT2E 2OCVB 3E1XB 2UUJB 3RUOA 4D7FA 1T8MA 4ZXXH 4E05H 1N6XA 1O5CB 4F4OC 7GCHG 1KLIH 2AMPA 3MH6A 3LC3A 2DE8A 4IBLH 1IQMA 5L30H 1PPGE 3M36A 1ZJDA 4ZROA 3ENSB 1TONA 3KQEA 3HGNA 5EQQA 1VJAU 1GHYH 3TH4H 2V6NA 1ANCA 3ATWA 1K1NA 2W7UA 1F92A 3RXBA 1P06A 1GMHG 1SSXA 1HAGE 4NZLA 1AUJA 4X1QU 3PB1E 3TJNA 2ANWA 1A7SA 1LHDH 2UUKB 3K65B 4LOYH 1H8DH 2WUBA 3M37A 1CE5A 3TJOA 1SL3A 2A4QA 2DUCA 4YT6H 2Z9LA 4BAKB 1Z8JB 1G3DA 2VB0A 2BTCE 2GV7A 1W0ZU 4JYUH 1HAOH 1VJ9U 3GY4A 4A5TS 1MBQA 2ZGHA 1TNHA 2BY5X 1P2IA 1MAXA 4Y71A 1EKBB 2FPZA 3EA7A 1O3NA 2Z7FE 1A4WH 1LKBA 3UWIA 5LPRA 1TBZH 1D3TB 4IS5A 3H7OA 2CN0H 4DVAU 1K1IA 1O3LA 1A5HA 3PO1C 5JBTA 4X6MA 8LPRA 1DSUA 2TGTA 2PGBB 4JZFH 2ZCKP 5LPFA 3O8CA 1Z8RA 1UJ1A 1V2MT 5EPYA 1ACBE 1TPAE 2BOHB 4WWYA 5ESTE 1A5GH 4BTIB 2QCYA 1GHAF 2RCEA 1AFEH 5EODA 1HIAB 5DO4H 4TY7A 3OX7U 4ABAA 1O2TA 1GBLA 4FUDA 1PQ5A 1ARBA 1ANEA 1P12E 2PUXB 3RXOA 4DURA 5E2OA 3UNSA 3O8RA 3PV4A 1MTUA 2ODPA 1O2KA 2BLQA 1JBUH 2GGVB 1FQ3A 4O97A 4ZH8A 2WV4A 3M5OA 4Q80A 2BM2A 3URCA 4CR9A 3QTVH 1OWDA 2FYRA 1V6DA 3URDA 2D8WA 2Y80A 1GBMA 1GCTC 2AS9A 2FWWA 5DPAA 1RXPA 1D3PB 3MHWU 3MO9A 2FS8A 4ZUHA 3RU4T 3A84A 1GBKA 1GHBF 4OS6A 5JYIA 4DGJA 5A0CA 5CHAB 5DP9A 1BTXA 3SJ8A 3QUMP 1SOZA 4RN6A 2ZCLP 3VPKA 3GY2A 3T5FH 1LDTT 5T6DA 2PKSC 5PTPA 1BTHH 2H9EH 1G36A 1QL8A 2R0LA 3F1SB 3S69A 3Q3YA 2QA9E 2TGAA 4NA8A 2GKVE 2BXUH 3P95A 3LIWA 1DOJA 3T28A 1GI7B 5K0HA 3QZRA 1TMTH 2ZPSA 1EQ9A 1Y5UT 7ESTE 2P3UB 3AASA 3M3SA 3RXVA 2Q6FA 3ATIA 2QV1A 3RXEA 2B5TB 4LXBH 1TOCB 1C4Y2 1GBIA 1TALA 2A45B 2JH6D 1C5YB 5J4SA 1EZQA 4MNVA 1J16A 1ZLRA 2VWMA 1C1NA 1V2OT 3ZZ8A 1YPKH 1ZPBA 4YLQH 5FX5A 3LGUA 1O2MA 3S7HB 2W3KA 1OX1A 2GZ8A 2V3OH 4HFPB 3RXUA 2HGTH 2Q6GA 5AF9H 3QZQA 1GDQA 2XTTB 1HXFH 1VITH 5EXLA 1O2SA 2O8MA 2XXLA 1EOLA 2A5IA 3G01A 3GCNA 8KME2 3GCHB 2G81E 1A0LA 5HM9A 1AVXA 1GI9B 1LQDB 2FEQH 4GUXA 3RLYH 3ZVGA 2PFEA 1FY1A 1L0ZA 1NO9H 2AGIX 4NA9H 2ZTXA 3A7WA 2ZDLA 1GBTA 1XX9A 2BB4A 1O2WA 3BTTE 3ODFA 1IQKA 3NKKA 5FPTA 1TNIA 4Y8ZA 2TBSA 3RC5A 3VB5A 3I78A 4DJZB 3BEFB 3BIVH 2UUFB 2OQUA 2ZTYA 1SFIA 1QCPA 1WTGH 1GI0A 1FUJA 4X6NA 5L6NH 3VB7A 2GCHF 3RXFA 4AN7A 1GVKB 1F0RA 4AG1A 1YCPM 1C5QA 4M7GA 1C9TA 2IPHA 3PROA 4XBDA 1PQ7A 1Y3XA 1P2OA 1Y5AT 2GMTB 1QY6A 1O2QA 3R0FA 4NFFA 1MU8B 2GD4B 2FDAA 1W10U 4ABBA 4ZKOU 4X8VH 1XUGA 3ZVFA 2H6MA 2Y81A 2FI5E 5F8TA 4J1YA 1UHBB 4A92A 1DFPA 1AVWA 2BX4A 3ZVEA 3GYMA 1SGYE 4MNYA 4DIIH 1TFXA 1NFXA 1O33A 1V2LT 1Z8IB 3B9FH 4A1VA 1H9LB 2A5AA 1JRSA 3UY9A 2VIDA 3OTJE 4GCHF 4DT7B 2ZFTA 1DY9A 1G30B 3SNCA 1AHTH 1B7XB 1P03A 5LGOA 2J9NA 2BVSH 2C3SA 5GJ4B 4FUGA 4O3TA 1FI8A 1WBGB 1DWDH 1RRKA 4RKOB 3KF2A 2NU4E 1YKTA 4MTBA 4AGJA 4NWKA 1QB6A 1DLEA 1OWJA 1E35B 4R8TB 1MD8A 4FXGH 2GP9B 2J95A 2FM2A 2YNBA 1PQAA 3RC4A 1C2DA 1GDNA 3FZZA 4AGKA 3CENA 4U01A 5GIBA