1VJEA

Crystal structure of a autoinducer-2 synthesis protein with bound selenomethionine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
148
Chain Sequence
b'ESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLMM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinducer-2 production protein LuxS
publication title A Structural Genomics Approach to the Study of Quorum Sensing: Crystal Structures of Three LuxS Orthologs
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 41
structure length 148
sequence length 149
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1vjeA00
5E68A 1JQWA 1VJEA 1J6XA 1INNA 2FQTA 1J6VA 1J6WA 1VGXA 1JOEA 1YCLA 2FQOA 1J98A 4XCHA 1VH2A 1JVIA 1IE0A
chains in the Genus database with same CATH superfamily
3FKIA 1F7UA 4GZYA 3S16K 3RZOK 1TWGA 4P5AA 1O2AA 3S2DK 5M5YK 4KM8A 3A8IA 3HKZD 2NVYK 3GEIA 1BS2A 1BJTA 1I3QK 3GTOK 1GE9A 3G4AA 2A69A 4YFNA 2R7ZA 3GTLK 1DD5A 1I50A 3HOVC 2NVXK 4P9SA 1Y1WC 3OPFA 3DXJA 4YG2A 3H0GC 4XLPA 2PMZL 3TFIA 3GTQK 4C2MK 2E2HA 5C3EC 3T02A 1HI9A 1WQGA 3Q3QA 4YFKA 2RGRA 3S1NC 3H3VD 1TWHC 4LK0A 3GTMA 4BY1K 3GEEA 4GTCA 4G7OA 2NVTK 3PO3K 1XZPB 1KQ4A 5IYBC 1O24A 3L4KA 4OINA 1TWCK 1XXCA 3BP3A 1XZQB 4BXXK 5TJ3A 3GTMK 3I4NC 5IORA 1J6VA 5IOTA 4ILDA 1O2FB 3LPXA 2GAGC 1IS1A 1WOSA 1O27A 2V6UA 3HOVK 3HOXC 5C4JC 2E2IC 3I4MC 4A3MC 1Y1WK 3T01A 3GTKC 4LLGA 5C4XK 1O26A 1EQRA 3H0GK 3S16C 4A3CC 4GTBA 1XPPA 5C3EK 3AQOA 2NVYC 2JA7A 2RH6A 2JA6A 4KATA 4OIRA 3S1NK 3CAGA 3FKIC 1F7VA 1TWHK 4A3JC 4QIWD 1TWGC 3RZDC 1X31C 1K83A 2R92A 2JA5A 3N3YA 2JA7K 4BKWA 2GSUA 3IPJA 4QJVB 4MQ9A 1UV7A 4KAWX 5TMFA 1I50C 1ZBSA 3I4NK 2CFAA 5EGHA 1B4BA 4FM9A 2Y0SD 4JK1A 3HOWC 3HOXK 2E2HC 5C4JK 2PA8L 1TWAK 4A3MK 3I4MK 2A68A 3GTKK 1O2BA 1AB4A 3OEPA 4KB4A 3L4JA 3M4OC 2JH3A 5IOQA 1TWCC 3PO2C 2E2JC 4M1XA 4XSXA 4A3CK 2A6HA 4BXXC 4G7ZA 3GTMC 2FQTA 3AD9C 2W7VA 3TFJA 5M5WK 3GTPA 3FKIK 2P8TA 4A3JK 3MMLB 1TWGK 3RZDK 3N0CA 4LK1A 2WAQD 4AYBD 2V6SA 5C4XC 4P5BA 2Y3PA 4WJ4A 3OREA 4KC6A 2R7ZK 4GTLA 5IP9C 5M5XK 1I50K 2WB1L 2R93A 3GIRA 3SZYA 4GFQA 3S15C 4BLAA 1O28A 1IW7A 3AH5A 5EGEA 3HOWK 3ERED 3S1QK 3HOYC 2E2HK 2JA7C 2R93K 3LAJA 3LAPA 3VA7A 4AH6A 3GTJA 2JA6C 1I6HC 3M4OK 1J6XA 3PO2K 4KM9A 3S0XA 3S14C 1TWFA 2E2JK 5M3MK 1F93A 1Y1VA 1K83C 2JA5C 2R92C 4Q5SA 4GTFA 1IQ0A 4BLBA 3CQZA 1XXBA 1JVIA 4A3LC 1DCHA 1WSVA 1C0AA 1TWAC 4XSZA 4A93K 1R9TA 4A3GC 1WCMA 5E68A 4LQYA 1VRQC 2YU9A 1WQFA 3JSTA 4PABA 3HKZL 5IP9K 1BGWA 3S2HC 4LOWA 2JA8C 3G4CA 1ZQ1C 4QJVA 3TFHA 3GDZA 1R9TK 3S15K 1O25A 4GTAA 2BE5A 3S1RK 2YU9K 1WSRA 4OIPA 2GAHC 1V5VA 3BUEA 5L46A 2WAQL 4YFXA 3S1MC 4MEYA 1YNNA 1INNA 4AYBL 3HOYK 1WOPA 4KN7A 2JA6K 1I6HK 2PMZD 1DCPA 4KN4A 1J6WA 5IP7C 2VUMA 2R7ZC 4XCHA 3S14K 4Y7NC 1SFOA 5IYCC 4LR2A 3TTGA 3AD7C 1K83K 2JA5K 2R92K 1ZYRA 3H3VL 2PPBA 3AD8C 1IE0A 2VUMK 4ZH4A 4KMUA 4A3LK 1JQWA 3S1QC 1VJEA 2EBBA 5HL8A 5M3FK 2R93C 4A3GK 4KDDA 3HOZC 1ISEA 2CW0A 2GSNA 3GTGA 1RU0A 4G0VA 1USMA 1BDFA 3S2HK 2JA8K 1YCLA 4C3JC 3GTJC 3HXAA 3K7AC 2ZFZA 4GTDA 1JOEA 4A3IC 2ZUFA 2NVYA 4C3HC 1TWFC 4X6AC 1I3QA 3S1MK 1EFWA 3GTOA 1Y1VC 1DCOA 4MEXA 1G51A 2CFAB 4A3EK 4A93C 5FLMC 1PJ5A 2ZUEA 3GTLA 4LJZA 4BY7C 5CHPA 4O2DA 4GTEA 2NVXA 5IP7K 4KMAA 1EH1A 3GTPK 5IYDC 3CQZC 4Y7NK 1XZPA 5IYCK 1WQHA 4G0WA 1O29A 2FQOA 1IBAA 3T00A 1WORA 1R9TC 2P5MA 3GTQA 1WCMC 1WIHA 1L0WA 1XZQA 5CJ9A 4QIWL 3A8JA 4C45A 3S1RC 2YU9C 5C44C 4Q4ZA 4FZBA 4Y52C 2XCQA 2O5JA 2NVQC 5JFEA 4OIQA 1J98A 4XLNA 1IL2A 1SMYA 4KMHA 3HOZK 4KB2A 3FOFA 4C3IC 3WODA 1EI6A 1I6VA 1HQMA 5D4DA 2B63A 4G7HA 4WJ3M 4A3DK 4WILA 3EQLA 1TWCA 4PAAA 3V4GA 1ZXOA 4C3JK 2D6FC 3GEHA 2Y0SL 3GTJK 3K7AK 4A3IK 3AQPA 2VUMC 2V6TA 2XCOA 4OIOA 4C3HK 1TWFK 4A3KC 4X6AK 1SFOC 2PA8D 2B63K 1Y1VK 4A3BC 5FLMK 4BBRC 4A3FC 4BY7K 3FHZA 4NOIA 3A8KA 5FJ8K 2KWAA 1Y1WA 5IYDK 3CQZK 5JVOA 3ADAC 3N0BA 3H0GA 3M3YC 4BBSC 1WCMK 1WOOA 1VLOA 3HOUC 3GTGC 5C44K 1YX2A 3S17C 4G0UA 4Y52K 1VGXA 2NVQK 4KARA 4A3EC 1VH2A 1TWHA 3RZOC 1EK8A 3S2DC 4C3IK 3GTPC 1ZVUA 4J3NA 4KMDA 2WB1D 2A6EA 1B4AA 1I3QC 4KASA 3SZZA 3GTOC 4RMFA 1XXAA 2GSOA 3GTLC 1YNJA 2NVXC 3NUHA 3QX3A 4A3KK 1SFOK 5IYBK 4A3BK 5TMCA 4BBRK 3GTQC 4A3FK 4C2MC 2E2IA 2PHCB 1PJ7A 3BP8C 1TWAA 2XCRB 3FOEA 3GTKA 3GSIA 1F9NA 5IOSA 3M3YK 4A3DC 4BBSK 2O5IA 1PJ6A 4BY1C 1USOA 3HOUK 2E2IK 3GTGK 2NVTC 3PO3C 3S17K 4DDQA 2B63C 4GT9A
chains in the Genus database with same CATH topology
5E68A 1JQWA 1VJEA 1J6XA 1INNA 2FQTA 1J6VA 1J6WA 1VGXA 1JOEA 1YCLA 2FQOA 1J98A 4XCHA 1VH2A 1JVIA 1IE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E68 A;  1JQW A;  1VJE A;  1J6X A;  1INN A;  2FQT A;  1J6V A;  1J6W A;  1VGX A;  1JOE A;  1YCL A;  2FQO A;  1J98 A;  4XCH A;  1VH2 A;  1JVI A;  1IE0 A; 
#chains in the Genus database with same CATH topology
 3FKI A;  1F7U A;  4GZY A;  3S16 K;  3RZO K;  1TWG A;  4P5A A;  1O2A A;  3S2D K;  5M5Y K;  4KM8 A;  3A8I A;  3HKZ D;  2NVY K;  3GEI A;  1BS2 A;  1BJT A;  1I3Q K;  3GTO K;  1GE9 A;  3G4A A;  2A69 A;  4YFN A;  2R7Z A;  3GTL K;  1DD5 A;  1I50 A;  3HOV C;  2NVX K;  4P9S A;  1Y1W C;  3OPF A;  3DXJ A;  4YG2 A;  3H0G C;  4XLP A;  2PMZ L;  3TFI A;  3GTQ K;  4C2M K;  2E2H A;  5C3E C;  3T02 A;  1HI9 A;  1WQG A;  3Q3Q A;  4YFK A;  2RGR A;  3S1N C;  3H3V D;  1TWH C;  4LK0 A;  3GTM A;  4BY1 K;  3GEE A;  4GTC A;  4G7O A;  2NVT K;  3PO3 K;  1XZP B;  1KQ4 A;  5IYB C;  1O24 A;  3L4K A;  4OIN A;  1TWC K;  1XXC A;  3BP3 A;  1XZQ B;  4BXX K;  5TJ3 A;  3GTM K;  3I4N C;  5IOR A;  1J6V A;  5IOT A;  4ILD A;  1O2F B;  3LPX A;  2GAG C;  1IS1 A;  1WOS A;  1O27 A;  2V6U A;  3HOV K;  3HOX C;  5C4J C;  2E2I C;  3I4M C;  4A3M C;  1Y1W K;  3T01 A;  3GTK C;  4LLG A;  5C4X K;  1O26 A;  1EQR A;  3H0G K;  3S16 C;  4A3C C;  4GTB A;  1XPP A;  5C3E K;  3AQO A;  2NVY C;  2JA7 A;  2RH6 A;  2JA6 A;  4KAT A;  4OIR A;  3S1N K;  3CAG A;  3FKI C;  1F7V A;  1TWH K;  4A3J C;  4QIW D;  1TWG C;  3RZD C;  1X31 C;  1K83 A;  2R92 A;  2JA5 A;  3N3Y A;  2JA7 K;  4BKW A;  2GSU A;  3IPJ A;  4QJV B;  4MQ9 A;  1UV7 A;  4KAW X;  5TMF A;  1I50 C;  1ZBS A;  3I4N K;  2CFA A;  5EGH A;  1B4B A;  4FM9 A;  2Y0S D;  4JK1 A;  3HOW C;  3HOX K;  2E2H C;  5C4J K;  2PA8 L;  1TWA K;  4A3M K;  3I4M K;  2A68 A;  3GTK K;  1O2B A;  1AB4 A;  3OEP A;  4KB4 A;  3L4J A;  3M4O C;  2JH3 A;  5IOQ A;  1TWC C;  3PO2 C;  2E2J C;  4M1X A;  4XSX A;  4A3C K;  2A6H A;  4BXX C;  4G7Z A;  3GTM C;  2FQT A;  3AD9 C;  2W7V A;  3TFJ A;  5M5W K;  3GTP A;  3FKI K;  2P8T A;  4A3J K;  3MML B;  1TWG K;  3RZD K;  3N0C A;  4LK1 A;  2WAQ D;  4AYB D;  2V6S A;  5C4X C;  4P5B A;  2Y3P A;  4WJ4 A;  3ORE A;  4KC6 A;  2R7Z K;  4GTL A;  5IP9 C;  5M5X K;  1I50 K;  2WB1 L;  2R93 A;  3GIR A;  3SZY A;  4GFQ A;  3S15 C;  4BLA A;  1O28 A;  1IW7 A;  3AH5 A;  5EGE A;  3HOW K;  3ERE D;  3S1Q K;  3HOY C;  2E2H K;  2JA7 C;  2R93 K;  3LAJ A;  3LAP A;  3VA7 A;  4AH6 A;  3GTJ A;  2JA6 C;  1I6H C;  3M4O K;  1J6X A;  3PO2 K;  4KM9 A;  3S0X A;  3S14 C;  1TWF A;  2E2J K;  5M3M K;  1F93 A;  1Y1V A;  1K83 C;  2JA5 C;  2R92 C;  4Q5S A;  4GTF A;  1IQ0 A;  4BLB A;  3CQZ A;  1XXB A;  1JVI A;  4A3L C;  1DCH A;  1WSV A;  1C0A A;  1TWA C;  4XSZ A;  4A93 K;  1R9T A;  4A3G C;  1WCM A;  5E68 A;  4LQY A;  1VRQ C;  2YU9 A;  1WQF A;  3JST A;  4PAB A;  3HKZ L;  5IP9 K;  1BGW A;  3S2H C;  4LOW A;  2JA8 C;  3G4C A;  1ZQ1 C;  4QJV A;  3TFH A;  3GDZ A;  1R9T K;  3S15 K;  1O25 A;  4GTA A;  2BE5 A;  3S1R K;  2YU9 K;  1WSR A;  4OIP A;  2GAH C;  1V5V A;  3BUE A;  5L46 A;  2WAQ L;  4YFX A;  3S1M C;  4MEY A;  1YNN A;  1INN A;  4AYB L;  3HOY K;  1WOP A;  4KN7 A;  2JA6 K;  1I6H K;  2PMZ D;  1DCP A;  4KN4 A;  1J6W A;  5IP7 C;  2VUM A;  2R7Z C;  4XCH A;  3S14 K;  4Y7N C;  1SFO A;  5IYC C;  4LR2 A;  3TTG A;  3AD7 C;  1K83 K;  2JA5 K;  2R92 K;  1ZYR A;  3H3V L;  2PPB A;  3AD8 C;  1IE0 A;  2VUM K;  4ZH4 A;  4KMU A;  4A3L K;  1JQW A;  3S1Q C;  1VJE A;  2EBB A;  5HL8 A;  5M3F K;  2R93 C;  4A3G K;  4KDD A;  3HOZ C;  1ISE A;  2CW0 A;  2GSN A;  3GTG A;  1RU0 A;  4G0V A;  1USM A;  1BDF A;  3S2H K;  2JA8 K;  1YCL A;  4C3J C;  3GTJ C;  3HXA A;  3K7A C;  2ZFZ A;  4GTD A;  1JOE A;  4A3I C;  2ZUF A;  2NVY A;  4C3H C;  1TWF C;  4X6A C;  1I3Q A;  3S1M K;  1EFW A;  3GTO A;  1Y1V C;  1DCO A;  4MEX A;  1G51 A;  2CFA B;  4A3E K;  4A93 C;  5FLM C;  1PJ5 A;  2ZUE A;  3GTL A;  4LJZ A;  4BY7 C;  5CHP A;  4O2D A;  4GTE A;  2NVX A;  5IP7 K;  4KMA A;  1EH1 A;  3GTP K;  5IYD C;  3CQZ C;  4Y7N K;  1XZP A;  5IYC K;  1WQH A;  4G0W A;  1O29 A;  2FQO A;  1IBA A;  3T00 A;  1WOR A;  1R9T C;  2P5M A;  3GTQ A;  1WCM C;  1WIH A;  1L0W A;  1XZQ A;  5CJ9 A;  4QIW L;  3A8J A;  4C45 A;  3S1R C;  2YU9 C;  5C44 C;  4Q4Z A;  4FZB A;  4Y52 C;  2XCQ A;  2O5J A;  2NVQ C;  5JFE A;  4OIQ A;  1J98 A;  4XLN A;  1IL2 A;  1SMY A;  4KMH A;  3HOZ K;  4KB2 A;  3FOF A;  4C3I C;  3WOD A;  1EI6 A;  1I6V A;  1HQM A;  5D4D A;  2B63 A;  4G7H A;  4WJ3 M;  4A3D K;  4WIL A;  3EQL A;  1TWC A;  4PAA A;  3V4G A;  1ZXO A;  4C3J K;  2D6F C;  3GEH A;  2Y0S L;  3GTJ K;  3K7A K;  4A3I K;  3AQP A;  2VUM C;  2V6T A;  2XCO A;  4OIO A;  4C3H K;  1TWF K;  4A3K C;  4X6A K;  1SFO C;  2PA8 D;  2B63 K;  1Y1V K;  4A3B C;  5FLM K;  4BBR C;  4A3F C;  4BY7 K;  3FHZ A;  4NOI A;  3A8K A;  5FJ8 K;  2KWA A;  1Y1W A;  5IYD K;  3CQZ K;  5JVO A;  3ADA C;  3N0B A;  3H0G A;  3M3Y C;  4BBS C;  1WCM K;  1WOO A;  1VLO A;  3HOU C;  3GTG C;  5C44 K;  1YX2 A;  3S17 C;  4G0U A;  4Y52 K;  1VGX A;  2NVQ K;  4KAR A;  4A3E C;  1VH2 A;  1TWH A;  3RZO C;  1EK8 A;  3S2D C;  4C3I K;  3GTP C;  1ZVU A;  4J3N A;  4KMD A;  2WB1 D;  2A6E A;  1B4A A;  1I3Q C;  4KAS A;  3SZZ A;  3GTO C;  4RMF A;  1XXA A;  2GSO A;  3GTL C;  1YNJ A;  2NVX C;  3NUH A;  3QX3 A;  4A3K K;  1SFO K;  5IYB K;  4A3B K;  5TMC A;  4BBR K;  3GTQ C;  4A3F K;  4C2M C;  2E2I A;  2PHC B;  1PJ7 A;  3BP8 C;  1TWA A;  2XCR B;  3FOE A;  3GTK A;  3GSI A;  1F9N A;  5IOS A;  3M3Y K;  4A3D C;  4BBS K;  2O5I A;  1PJ6 A;  4BY1 C;  1USO A;  3HOU K;  2E2I K;  3GTG K;  2NVT C;  3PO3 C;  3S17 K;  4DDQ A;  2B63 C;  4GT9 A; 
#chains in the Genus database with same CATH homology
 5E68 A;  1JQW A;  1VJE A;  1J6X A;  1INN A;  2FQT A;  1J6V A;  1J6W A;  1VGX A;  1JOE A;  1YCL A;  2FQO A;  1J98 A;  4XCH A;  1VH2 A;  1JVI A;  1IE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...