1VJEA

Crystal structure of a autoinducer-2 synthesis protein with bound selenomethionine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
148
Chain Sequence
ESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Genomics Approach to the Study of Quorum Sensing: Crystal Structures of Three LuxS Orthologs
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords Autoinducer-2 production protein LuxS
total genus 41
structure length 148
sequence length 149
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1vjeA00
1INNA 1J6XA 5E68A 1VGXA 1J6VA 1IE0A 1VH2A 1J98A 2FQTA 1JQWA 1JOEA 1YCLA 4XCHA 1JVIA 1J6WA 1VJEA 2FQOA
chains in the Genus database with same CATH superfamily
1DCOA 4GZYA 2JA5A 1O25A 1WCMA 3S14C 5IYDC 5C4XC 4XSXA 4A3EK 1X31C 4G7OA 2JA7A 1IS1A 4BY1K 1HI9A 3GTKA 1YX2A 1XZQB 1TWAA 1I3QA 5HL8A 1EI6A 4KMUA 2JA8K 2XCQA 5FLMK 5IP9K 1F93A 3TTGA 1ZQ1C 4BXXK 5C4JK 1RU0A 4BY1C 4OIRA 1YCLA 1XZPA 4RMFA 3HKZD 2R93C 3S1QC 4WJ3M 4MEYA 2GAHC 4A3JK 2ZFZA 3BP3A 3CAGA 4ILDA 3QX3A 4YG2A 1XXAA 4J3NA 3S1MK 4KMHA 3A8JA 1USMA 4KAWX 1TWGK 3IPJA 3GTLK 1EFWA 3GDZA 3T01A 3I4MC 4XSZA 3L4JA 1WCMC 1Y1WC 4GT9A 3HOYK 4A3LK 1GE9A 1WOSA 2Y0SL 1TWFC 3TFIA 1BJTA 1VJEA 2FQOA 3FKIC 3ERED 4BBSK 2CFAA 3G4CA 1B4BA 3S14K 5C4XK 4Q5SA 1I50A 4A3KC 3M3YC 4Y52K 3GTGC 1IW7A 1JVIA 1F7UA 1WQFA 1WORA 2JA8C 2D6FC 4C45A 2NVTK 5FLMC 4KM8A 4KATA 2PPBA 4YFXA 3S1RC 4XLPA 2V6TA 1B4AA 4A3FK 1EK8A 3WODA 5C44C 3GTGK 2WAQD 2E2JC 4A3BK 3S17K 3RZOC 3N0BA 3PO2K 3CQZK 5EGEA 1XXBA 1IE0A 1I6HK 5EGHA 4C3IC 2V6SA 4QJVB 1O28A 1KQ4A 3S2DC 1VRQC 4A3DK 1INNA 3M4OK 2YU9A 4OIQA 2R92A 2GSOA 4WILA 4KARA 5IP9C 3S16C 1V5VA 3FKIA 1WQGA 3G4AA 1I6HC 3N0CA 1TWHK 4C3IK 1AB4A 3K7AK 2VUMC 4C2MK 3GTOC 4C3JC 3HXAA 2O5IA 2R93K 3EQLA 1J98A 1DCHA 1I50C 5M3MK 4LR2A 1L0WA 3RZDC 3LPXA 3HOUK 3VA7A 4A3IC 1VGXA 4KN7A 3GTQA 3GTMA 3AD7C 3HOXK 2P8TA 1TWCK 5FJ8K 4QIWD 3A8IA 3GEIA 1PJ6A 5D4DA 4GTDA 2B63C 2NVQC 3OEPA 3OPFA 4A3BC 2FQTA 1R9TK 2EBBA 5IOSA 3PO2C 4KMDA 4A3JC 3V4GA 2WAQL 2KWAA 3L4KA 1SFOK 4O2DA 3Q3QA 4M1XA 3GTJK 3GTPK 3PO3C 4OIPA 2JA7C 3BP8C 3GTLC 4BLBA 2R7ZK 2BE5A 1O24A 2JA6K 1TWAC 3GTOA 2VUMA 1I3QC 4KASA 3AD9C 2JA5K 1O2BA 4X6AC 3LAJA 3K7AC 3RZOK 4BBSC 4MEXA 2ZUEA 5JVOA 4OIOA 4OINA 4JK1A 5M5YK 1WOOA 2A69A 3H0GA 2WB1D 2E2HK 4LK1A 4GFQA 2B63A 1Y1VK 1EQRA 3AQOA 4Y52C 3H3VL 4MQ9A 3S15K 1SMYA 1WQHA 5IP7K 4C2MC 4BY7C 4WJ4A 3AH5A 4AYBL 1R9TC 4GTCA 1ZYRA 3S17C 1Y1WA 4GTBA 4A3CC 1TWFA 3HOVC 3S1RK 5C4JC 5TMCA 3GTLA 5C3EC 1O2FB 5JFEA 4XCHA 3S2HC 4LK0A 1K83K 3GTKK 4QJVA 2PA8D 3TFJA 2A6EA 2NVYA 3HOVK 4YFNA 4A3KK 1YNJA 3GSIA 4LJZA 4G0UA 2PMZD 4BBRC 1WOPA 4Y7NC 3H0GC 1K83C 1F9NA 3FOFA 1ZXOA 2A6HA 1WCMK 5E68A 1O26A 1IBAA 2RH6A 3GTJC 2E2IA 2JA7K 4LOWA 4QIWL 3HOUC 2NVXK 4Y7NK 3RZDK 1WSRA 4C3HC 2O5JA 3M3YK 1I6VA 3JSTA 2NVQK 4P5BA 2GAGC 5IYCK 2NVXC 1VLOA 1BS2A 4GTFA 3BUEA 4YFKA 4AYBD 3A8KA 3HKZL 4BLAA 5C3EK 1UV7A 3DXJA 2NVYC 3GTPC 5IOTA 2ZUFA 1TWGA 2GSNA 1XZQA 5M5XK 2V6UA 3GEHA 4KC6A 3GTQC 2W7VA 3GTMC 3FHZA 4ZH4A 1O27A 2R7ZC 1TWAK 3S16K 3HOXC 1I3QK 5CJ9A 2E2IC 2JA5C 1DD5A 5CHPA 2NVTC 5L46A 3S0XA 2Y3PA 2PMZL 1F7VA 4GTLA 3H3VD 5IOQA 4PAAA 3ADAC 2RGRA 1VH2A 3I4NC 2A68A 1XPPA 4GTAA 1C0AA 4A93C 2YU9K 2R92K 3S15C 4A3GC 5M5WK 5IP7C 4DDQA 3T00A 3S1QK 3LAPA 1YNNA 1TWCC 3I4NK 3MMLB 2JA6C 4PABA 2R93A 3GTPA 4FZBA 3M4OC 1TWGC 1O29A 3T02A 4KM9A 4LLGA 4G7HA 4P9SA 4NOIA 1JQWA 1TWHC 1XXCA 3GTQK 4KB2A 4A3FC 1I50K 3FKIK 4A3MK 5C44K 1PJ7A 5IYBC 2XCOA 3HOZC 2JH3A 1IQ0A 2XCRB 1ZVUA 1Y1VC 3SZYA 4BXXC 1R9TA 2E2HA 5M3FK 4Q4ZA 1WSVA 4KN4A 4A3MC 5IYBK 3GTGA 3HOZK 5IYDK 4A3CK 3GTMK 3NUHA 4C3HK 3CQZA 1TWCA 1DCPA 1Y1WK 2E2JK 4G0WA 4G7ZA 3HOYC 2JA6A 3GEEA 2VUMK 3FOEA 1XZPB 3GTOK 4A3LC 3S2HK 1JOEA 1TWFK 5TMFA 3SZZA 3I4MK 3S1NC 5TJ3A 2CFAB 1EH1A 1HQMA 3S2DK 4XLNA 3PO3K 1K83A 4A3DC 4KB4A 2PA8L 1SFOA 4KDDA 4GTEA 1TWHA 4BKWA 4BBRK 3H0GK 4AH6A 3GTJA 2Y0SD 4A3EC 3S1MC 4P5AA 2YU9C 1G51A 1IL2A 2R92C 4X6AK 4A3GK 1USOA 1J6XA 1ISEA 1Y1VA 4C3JK 3HOWK 3AD8C 3TFHA 2E2HC 1ZBSA 4KMAA 3GTKC 3OREA 2E2IK 3AQPA 1J6WA 2CW0A 2NVXA 4A3IK 1O2AA 3N3YA 4G0VA 3HOWC 3CQZC 1PJ5A 1WIHA 5IYCC 2WB1L 1BGWA 2GSUA 4LQYA 2B63K 1BDFA 4BY7K 4A93K 1J6VA 2PHCB 3GIRA 2NVYK 4FM9A 2P5MA 5IORA 3S1NK 1SFOC 2R7ZA
chains in the Genus database with same CATH topology
1INNA 1J6XA 5E68A 1VGXA 1J6VA 1IE0A 1VH2A 1J98A 2FQTA 1JQWA 1JOEA 1YCLA 4XCHA 1JVIA 1J6WA 1VJEA 2FQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1INN A;  1J6X A;  5E68 A;  1VGX A;  1J6V A;  1IE0 A;  1VH2 A;  1J98 A;  2FQT A;  1JQW A;  1JOE A;  1YCL A;  4XCH A;  1JVI A;  1J6W A;  1VJE A;  2FQO A; 
#chains in the Genus database with same CATH topology
 1DCO A;  4GZY A;  2JA5 A;  1O25 A;  1WCM A;  3S14 C;  5IYD C;  5C4X C;  4XSX A;  4A3E K;  1X31 C;  4G7O A;  2JA7 A;  1IS1 A;  4BY1 K;  1HI9 A;  3GTK A;  1YX2 A;  1XZQ B;  1TWA A;  1I3Q A;  5HL8 A;  1EI6 A;  4KMU A;  2JA8 K;  2XCQ A;  5FLM K;  5IP9 K;  1F93 A;  3TTG A;  1ZQ1 C;  4BXX K;  5C4J K;  1RU0 A;  4BY1 C;  4OIR A;  1YCL A;  1XZP A;  4RMF A;  3HKZ D;  2R93 C;  3S1Q C;  4WJ3 M;  4MEY A;  2GAH C;  4A3J K;  2ZFZ A;  3BP3 A;  3CAG A;  4ILD A;  3QX3 A;  4YG2 A;  1XXA A;  4J3N A;  3S1M K;  4KMH A;  3A8J A;  1USM A;  4KAW X;  1TWG K;  3IPJ A;  3GTL K;  1EFW A;  3GDZ A;  3T01 A;  3I4M C;  4XSZ A;  3L4J A;  1WCM C;  1Y1W C;  4GT9 A;  3HOY K;  4A3L K;  1GE9 A;  1WOS A;  2Y0S L;  1TWF C;  3TFI A;  1BJT A;  1VJE A;  2FQO A;  3FKI C;  3ERE D;  4BBS K;  2CFA A;  3G4C A;  1B4B A;  3S14 K;  5C4X K;  4Q5S A;  1I50 A;  4A3K C;  3M3Y C;  4Y52 K;  3GTG C;  1IW7 A;  1JVI A;  1F7U A;  1WQF A;  1WOR A;  2JA8 C;  2D6F C;  4C45 A;  2NVT K;  5FLM C;  4KM8 A;  4KAT A;  2PPB A;  4YFX A;  3S1R C;  4XLP A;  2V6T A;  1B4A A;  4A3F K;  1EK8 A;  3WOD A;  5C44 C;  3GTG K;  2WAQ D;  2E2J C;  4A3B K;  3S17 K;  3RZO C;  3N0B A;  3PO2 K;  3CQZ K;  5EGE A;  1XXB A;  1IE0 A;  1I6H K;  5EGH A;  4C3I C;  2V6S A;  4QJV B;  1O28 A;  1KQ4 A;  3S2D C;  1VRQ C;  4A3D K;  1INN A;  3M4O K;  2YU9 A;  4OIQ A;  2R92 A;  2GSO A;  4WIL A;  4KAR A;  5IP9 C;  3S16 C;  1V5V A;  3FKI A;  1WQG A;  3G4A A;  1I6H C;  3N0C A;  1TWH K;  4C3I K;  1AB4 A;  3K7A K;  2VUM C;  4C2M K;  3GTO C;  4C3J C;  3HXA A;  2O5I A;  2R93 K;  3EQL A;  1J98 A;  1DCH A;  1I50 C;  5M3M K;  4LR2 A;  1L0W A;  3RZD C;  3LPX A;  3HOU K;  3VA7 A;  4A3I C;  1VGX A;  4KN7 A;  3GTQ A;  3GTM A;  3AD7 C;  3HOX K;  2P8T A;  1TWC K;  5FJ8 K;  4QIW D;  3A8I A;  3GEI A;  1PJ6 A;  5D4D A;  4GTD A;  2B63 C;  2NVQ C;  3OEP A;  3OPF A;  4A3B C;  2FQT A;  1R9T K;  2EBB A;  5IOS A;  3PO2 C;  4KMD A;  4A3J C;  3V4G A;  2WAQ L;  2KWA A;  3L4K A;  1SFO K;  4O2D A;  3Q3Q A;  4M1X A;  3GTJ K;  3GTP K;  3PO3 C;  4OIP A;  2JA7 C;  3BP8 C;  3GTL C;  4BLB A;  2R7Z K;  2BE5 A;  1O24 A;  2JA6 K;  1TWA C;  3GTO A;  2VUM A;  1I3Q C;  4KAS A;  3AD9 C;  2JA5 K;  1O2B A;  4X6A C;  3LAJ A;  3K7A C;  3RZO K;  4BBS C;  4MEX A;  2ZUE A;  5JVO A;  4OIO A;  4OIN A;  4JK1 A;  5M5Y K;  1WOO A;  2A69 A;  3H0G A;  2WB1 D;  2E2H K;  4LK1 A;  4GFQ A;  2B63 A;  1Y1V K;  1EQR A;  3AQO A;  4Y52 C;  3H3V L;  4MQ9 A;  3S15 K;  1SMY A;  1WQH A;  5IP7 K;  4C2M C;  4BY7 C;  4WJ4 A;  3AH5 A;  4AYB L;  1R9T C;  4GTC A;  1ZYR A;  3S17 C;  1Y1W A;  4GTB A;  4A3C C;  1TWF A;  3HOV C;  3S1R K;  5C4J C;  5TMC A;  3GTL A;  5C3E C;  1O2F B;  5JFE A;  4XCH A;  3S2H C;  4LK0 A;  1K83 K;  3GTK K;  4QJV A;  2PA8 D;  3TFJ A;  2A6E A;  2NVY A;  3HOV K;  4YFN A;  4A3K K;  1YNJ A;  3GSI A;  4LJZ A;  4G0U A;  2PMZ D;  4BBR C;  1WOP A;  4Y7N C;  3H0G C;  1K83 C;  1F9N A;  3FOF A;  1ZXO A;  2A6H A;  1WCM K;  5E68 A;  1O26 A;  1IBA A;  2RH6 A;  3GTJ C;  2E2I A;  2JA7 K;  4LOW A;  4QIW L;  3HOU C;  2NVX K;  4Y7N K;  3RZD K;  1WSR A;  4C3H C;  2O5J A;  3M3Y K;  1I6V A;  3JST A;  2NVQ K;  4P5B A;  2GAG C;  5IYC K;  2NVX C;  1VLO A;  1BS2 A;  4GTF A;  3BUE A;  4YFK A;  4AYB D;  3A8K A;  3HKZ L;  4BLA A;  5C3E K;  1UV7 A;  3DXJ A;  2NVY C;  3GTP C;  5IOT A;  2ZUF A;  1TWG A;  2GSN A;  1XZQ A;  5M5X K;  2V6U A;  3GEH A;  4KC6 A;  3GTQ C;  2W7V A;  3GTM C;  3FHZ A;  4ZH4 A;  1O27 A;  2R7Z C;  1TWA K;  3S16 K;  3HOX C;  1I3Q K;  5CJ9 A;  2E2I C;  2JA5 C;  1DD5 A;  5CHP A;  2NVT C;  5L46 A;  3S0X A;  2Y3P A;  2PMZ L;  1F7V A;  4GTL A;  3H3V D;  5IOQ A;  4PAA A;  3ADA C;  2RGR A;  1VH2 A;  3I4N C;  2A68 A;  1XPP A;  4GTA A;  1C0A A;  4A93 C;  2YU9 K;  2R92 K;  3S15 C;  4A3G C;  5M5W K;  5IP7 C;  4DDQ A;  3T00 A;  3S1Q K;  3LAP A;  1YNN A;  1TWC C;  3I4N K;  3MML B;  2JA6 C;  4PAB A;  2R93 A;  3GTP A;  4FZB A;  3M4O C;  1TWG C;  1O29 A;  3T02 A;  4KM9 A;  4LLG A;  4G7H A;  4P9S A;  4NOI A;  1JQW A;  1TWH C;  1XXC A;  3GTQ K;  4KB2 A;  4A3F C;  1I50 K;  3FKI K;  4A3M K;  5C44 K;  1PJ7 A;  5IYB C;  2XCO A;  3HOZ C;  2JH3 A;  1IQ0 A;  2XCR B;  1ZVU A;  1Y1V C;  3SZY A;  4BXX C;  1R9T A;  2E2H A;  5M3F K;  4Q4Z A;  1WSV A;  4KN4 A;  4A3M C;  5IYB K;  3GTG A;  3HOZ K;  5IYD K;  4A3C K;  3GTM K;  3NUH A;  4C3H K;  3CQZ A;  1TWC A;  1DCP A;  1Y1W K;  2E2J K;  4G0W A;  4G7Z A;  3HOY C;  2JA6 A;  3GEE A;  2VUM K;  3FOE A;  1XZP B;  3GTO K;  4A3L C;  3S2H K;  1JOE A;  1TWF K;  5TMF A;  3SZZ A;  3I4M K;  3S1N C;  5TJ3 A;  2CFA B;  1EH1 A;  1HQM A;  3S2D K;  4XLN A;  3PO3 K;  1K83 A;  4A3D C;  4KB4 A;  2PA8 L;  1SFO A;  4KDD A;  4GTE A;  1TWH A;  4BKW A;  4BBR K;  3H0G K;  4AH6 A;  3GTJ A;  2Y0S D;  4A3E C;  3S1M C;  4P5A A;  2YU9 C;  1G51 A;  1IL2 A;  2R92 C;  4X6A K;  4A3G K;  1USO A;  1J6X A;  1ISE A;  1Y1V A;  4C3J K;  3HOW K;  3AD8 C;  3TFH A;  2E2H C;  1ZBS A;  4KMA A;  3GTK C;  3ORE A;  2E2I K;  3AQP A;  1J6W A;  2CW0 A;  2NVX A;  4A3I K;  1O2A A;  3N3Y A;  4G0V A;  3HOW C;  3CQZ C;  1PJ5 A;  1WIH A;  5IYC C;  2WB1 L;  1BGW A;  2GSU A;  4LQY A;  2B63 K;  1BDF A;  4BY7 K;  4A93 K;  1J6V A;  2PHC B;  3GIR A;  2NVY K;  4FM9 A;  2P5M A;  5IOR A;  3S1N K;  1SFO C;  2R7Z A; 
#chains in the Genus database with same CATH homology
 1INN A;  1J6X A;  5E68 A;  1VGX A;  1J6V A;  1IE0 A;  1VH2 A;  1J98 A;  2FQT A;  1JQW A;  1JOE A;  1YCL A;  4XCH A;  1JVI A;  1J6W A;  1VJE A;  2FQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...