1VJEA

Crystal structure of a autoinducer-2 synthesis protein with bound selenomethionine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
148
Chain Sequence
ESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Genomics Approach to the Study of Quorum Sensing: Crystal Structures of Three LuxS Orthologs
pubmed doi rcsb
molecule keywords Autoinducer-2 production protein LuxS
molecule tags Hydrolase
source organism Deinococcus radiodurans
total genus 41
structure length 148
sequence length 149
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1vjeA00
1J6XA 1VH2A 4XCHA 1JVIA 1VJEA 2FQOA 2FQTA 1J6VA 1INNA 1J98A 1J6WA 1JQWA 1VGXA 1YCLA 1IE0A 5E68A 1JOEA
chains in the Genus database with same CATH superfamily
5IOQA 1O29A 1I6VA 1YNNA 2NVYA 2CFAB 4BLAA 1EQRA 3HOVC 3GTJK 2R7ZC 2R7ZA 1HQMA 3S1MK 3BP3A 3S14C 4YFNA 4A3FC 4BKWA 5IP7C 1B4BA 1I3QC 4X6AC 3A8JA 3MMLB 3HOWC 2WAQD 1B4AA 4KARA 1WSVA 4AH6A 3GTOC 3TFHA 4GZYA 4J3NA 1TWCC 5M5YK 4YG2A 5JVOA 1J6WA 4GTAA 4GTEA 1R9TC 2ZUEA 3GTLA 1R9TA 1F7VA 1XXAA 3TTGA 1O24A 2GAHC 1YNJA 3S0XA 2A6EA 4KMHA 1BGWA 3HOYC 3HOVK 3LAJA 2R7ZK 3PO2C 3GTGA 3CQZC 4AYBD 4PAAA 3CQZA 3S14K 4A3FK 4KB4A 1XZQB 2GSOA 5IP7K 1I3QK 4X6AK 3SZZA 1SFOC 2RGRA 3HOWK 3Q3QA 3EQLA 1BS2A 4LR2A 3T00A 1J6XA 3HOZC 1Y1WC 3HKZD 4KM9A 5EGEA 4A93C 2JA6C 2JA6A 4QJVB 1TWCK 1DCHA 3GSIA 2ZFZA 3HKZL 4BBSC 1VH2A 5M5WK 3H0GC 3N0CA 4C45A 3H0GA 4OINA 1I6HC 2A68A 4A3IC 3S2HC 5C4XC 3N3YA 1R9TK 2A69A 4LK0A 3GIRA 2D6FC 4NOIA 3GTJC 2Y0SD 1DD5A 1JVIA 4LJZA 4G7HA 1TWHA 2Y0SL 4XSZA 1IE0A 2B63A 3CAGA 3GTGK 3CQZK 4KN7A 4GTCA 3OREA 2EBBA 4ZH4A 2JH3A 2WB1L 3BP8C 1VJEA 1SFOK 2XCQA 1IBAA 4BBRC 3GEIA 4G7ZA 1X31C 1O2BA 4A3BK 4O2DA 2O5IA 1O2FB 3HOZK 1JOEA 5TJ3A 3TFJA 1ZVUA 2JA6K 4A93K 1IQ0A 1F7UA 1EK8A 2JA5C 4BBSK 1I6HK 3AQOA 3H0GK 2JA5A 4RMFA 3SZYA 5IYCC 4A3IK 3S2HK 2O5JA 4GFQA 5C4XK 2YU9C 3S17C 5IYDC 2YU9A 1C0AA 2R93A 1ZQ1C 4P9SA 2NVYC 3PO3C 5IOTA 1WOOA 3QX3A 4P5AA 1WCMC 1WCMA 5CJ9A 1PJ6A 1WORA 1YCLA 2B63K 2E2HA 1K83C 1WOPA 1K83A 4GTLA 1O27A 4FZBA 4GT9A 3GTMC 1F93A 3GTMA 5M3MK 5IORA 2WAQL 4DDQA 4XLPA 2E2JC 3G4AA 4XSXA 2JA8C 1WSRA 4BBRK 3FOEA 1IL2A 4C3IC 5L46A 1WQHA 1TWFC 3LPXA 1TWFA 4PABA 3GTPA 2R92C 2R92A 4A3DC 2RH6A 3FHZA 4A3JC 3GTLC 1XZPB 4KC6A 2JA5K 2Y3PA 5IYCK 5HL8A 2PPBA 2YU9K 3S17K 5IYDK 2NVYK 2KWAA 3PO3K 3TFIA 1O28A 1ZBSA 5CHPA 3GTGC 4WJ4A 1WCMK 4WILA 3S1QC 4OIOA 2E2HK 3FKIA 1K83K 1IS1A 4AYBL 3S15C 1ZXOA 5IP9C 4G0UA 3HOUC 4A3BC 3GTMK 2JA7C 2JA7A 1BJTA 1EH1A 1F9NA 2E2JK 2JA8K 5EGHA 3FOFA 4LLGA 2CFAA 2PHCB 4KASA 4C3IK 3S1NC 5E68A 1TWFK 1L0WA 4OIQA 2R92K 4A3DK 2PMZD 4A3JK 3GTLK 3M4OK 3RZOC 1XXCA 3K7AC 2GSNA 2PMZL 1Y1VC 4GTFA 1TWGC 1Y1VA 4Y7NK 1TWGA 2FQTA 4BY7C 1J98A 1TWHC 1GE9A 1O2AA 2B63C 5M5XK 2V6TA 2XCRB 1JQWA 2NVTK 3S1QK 5C44K 4A3EK 1WOSA 1I50C 1I50A 2NVQC 4OIPA 4C3HC 3S15K 1O26A 1VRQC 1XZPA 3GDZA 3N0BA 3A8KA 5IP9K 2A6HA 3HOUK 4XLNA 1WQFA 2V6SA 2JA7K 3HXAA 4YFXA 4BLBA 5TMFA 4G7OA 4KMAA 1KQ4A 3S1NK 3OPFA 4XCHA 3ADAC 3GTQC 5M3FK 3GTQA 1XZQA 4Y52C 2R93C 3RZOK 1ZYRA 3K7AK 4A3MK 2E2IC 2E2IA 4WJ3M 4KAWX 4QIWD 5C4JC 1Y1VK 1TWGK 3OEPA 3S1RC 4BY7K 1ISEA 1TWHK 2E2HC 3T02A 4KMUA 1TWAC 4MEYA 1DCPA 1TWAA 4QJVA 1PJ5A 1AB4A 1I50K 2NVQK 1VGXA 4C3HK 3AH5A 3M3YC 4KMDA 2FQOA 1O25A 4C2MC 4Q4ZA 3S16C 4A3LC 2XCOA 3GTPC 4A3CK 4YFKA 1I3QA 4A3KK 4BXXC 3G4CA 3VA7A 4A3GC 4MQ9A 3M4OC 3WODA 3HOXC 5D4DA 1HI9A 3GTQK 2NVXC 5FJ8K 3RZDC 5C3EC 2NVXA 4LQYA 1RU0A 4KM8A 4Y7NC 1YX2A 1PJ7A 2R93K 4Y52K 3I4NC 4C3JC 3GTOA 2E2IK 4GTBA 1DCOA 3DXJA 5C4JK 1TWCA 4JK1A 3S1RK 3S2DK 2NVTC 5C44C 3FKIC 4GTDA 3L4KA 4A3EC 5IYBC 1TWAK 1EI6A 4G0VA 3GTKC 5FLMC 3GTKA 4KN4A 2P5MA 5TMCA 4KB2A 3AD9C 3AD8C 4ILDA 3M3YK 3ERED 2P8TA 2ZUFA 4Q5SA 4M1XA 4C2MK 3I4MC 3S16K 1USOA 4A3LK 3GTPK 3GEHA 2VUMC 1IW7A 2VUMA 2GSUA 4MEXA 1SFOA 4BXXK 4A3GK 4BY1C 3HOXK 4A3MC 2NVXK 3RZDK 5C3EK 1VLOA 2GAGC 5IOSA 3AQPA 1Y1WA 3I4NK 1XPPA 3GTOK 4C3JK 4LOWA 1J6VA 3FKIK 5IYBK 1EFWA 5JFEA 1SMYA 3GTKK 1XXBA 5FLMK 1V5VA 4LK1A 2V6UA 3GTJA 3H3VD 3T01A 3S1MC 3A8IA 1UV7A 4A3CC 3H3VL 2CW0A 3HOYK 3GEEA 4A3KC 3PO2K 4FM9A 3I4MK 2WB1D 4G0WA 3V4GA 2VUMK 2PA8D 3IPJA 2W7VA 1INNA 4BY1K 3BUEA 2PA8L 1BDFA 1G51A 4KATA 1USMA 3JSTA 3NUHA 2BE5A 4P5BA 3AD7C 3S2DC 1Y1WK 4OIRA 4QIWL 1WIHA 4KDDA 3LAPA 1WQGA 3L4JA
chains in the Genus database with same CATH topology
1J6XA 1VH2A 4XCHA 1JVIA 1VJEA 2FQOA 2FQTA 1J6VA 1INNA 1J98A 1J6WA 1JQWA 1VGXA 1YCLA 1IE0A 5E68A 1JOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6X A;  1VH2 A;  4XCH A;  1JVI A;  1VJE A;  2FQO A;  2FQT A;  1J6V A;  1INN A;  1J98 A;  1J6W A;  1JQW A;  1VGX A;  1YCL A;  1IE0 A;  5E68 A;  1JOE A; 
#chains in the Genus database with same CATH topology
 5IOQ A;  1O29 A;  1I6V A;  1YNN A;  2NVY A;  2CFA B;  4BLA A;  1EQR A;  3HOV C;  3GTJ K;  2R7Z C;  2R7Z A;  1HQM A;  3S1M K;  3BP3 A;  3S14 C;  4YFN A;  4A3F C;  4BKW A;  5IP7 C;  1B4B A;  1I3Q C;  4X6A C;  3A8J A;  3MML B;  3HOW C;  2WAQ D;  1B4A A;  4KAR A;  1WSV A;  4AH6 A;  3GTO C;  3TFH A;  4GZY A;  4J3N A;  1TWC C;  5M5Y K;  4YG2 A;  5JVO A;  1J6W A;  4GTA A;  4GTE A;  1R9T C;  2ZUE A;  3GTL A;  1R9T A;  1F7V A;  1XXA A;  3TTG A;  1O24 A;  2GAH C;  1YNJ A;  3S0X A;  2A6E A;  4KMH A;  1BGW A;  3HOY C;  3HOV K;  3LAJ A;  2R7Z K;  3PO2 C;  3GTG A;  3CQZ C;  4AYB D;  4PAA A;  3CQZ A;  3S14 K;  4A3F K;  4KB4 A;  1XZQ B;  2GSO A;  5IP7 K;  1I3Q K;  4X6A K;  3SZZ A;  1SFO C;  2RGR A;  3HOW K;  3Q3Q A;  3EQL A;  1BS2 A;  4LR2 A;  3T00 A;  1J6X A;  3HOZ C;  1Y1W C;  3HKZ D;  4KM9 A;  5EGE A;  4A93 C;  2JA6 C;  2JA6 A;  4QJV B;  1TWC K;  1DCH A;  3GSI A;  2ZFZ A;  3HKZ L;  4BBS C;  1VH2 A;  5M5W K;  3H0G C;  3N0C A;  4C45 A;  3H0G A;  4OIN A;  1I6H C;  2A68 A;  4A3I C;  3S2H C;  5C4X C;  3N3Y A;  1R9T K;  2A69 A;  4LK0 A;  3GIR A;  2D6F C;  4NOI A;  3GTJ C;  2Y0S D;  1DD5 A;  1JVI A;  4LJZ A;  4G7H A;  1TWH A;  2Y0S L;  4XSZ A;  1IE0 A;  2B63 A;  3CAG A;  3GTG K;  3CQZ K;  4KN7 A;  4GTC A;  3ORE A;  2EBB A;  4ZH4 A;  2JH3 A;  2WB1 L;  3BP8 C;  1VJE A;  1SFO K;  2XCQ A;  1IBA A;  4BBR C;  3GEI A;  4G7Z A;  1X31 C;  1O2B A;  4A3B K;  4O2D A;  2O5I A;  1O2F B;  3HOZ K;  1JOE A;  5TJ3 A;  3TFJ A;  1ZVU A;  2JA6 K;  4A93 K;  1IQ0 A;  1F7U A;  1EK8 A;  2JA5 C;  4BBS K;  1I6H K;  3AQO A;  3H0G K;  2JA5 A;  4RMF A;  3SZY A;  5IYC C;  4A3I K;  3S2H K;  2O5J A;  4GFQ A;  5C4X K;  2YU9 C;  3S17 C;  5IYD C;  2YU9 A;  1C0A A;  2R93 A;  1ZQ1 C;  4P9S A;  2NVY C;  3PO3 C;  5IOT A;  1WOO A;  3QX3 A;  4P5A A;  1WCM C;  1WCM A;  5CJ9 A;  1PJ6 A;  1WOR A;  1YCL A;  2B63 K;  2E2H A;  1K83 C;  1WOP A;  1K83 A;  4GTL A;  1O27 A;  4FZB A;  4GT9 A;  3GTM C;  1F93 A;  3GTM A;  5M3M K;  5IOR A;  2WAQ L;  4DDQ A;  4XLP A;  2E2J C;  3G4A A;  4XSX A;  2JA8 C;  1WSR A;  4BBR K;  3FOE A;  1IL2 A;  4C3I C;  5L46 A;  1WQH A;  1TWF C;  3LPX A;  1TWF A;  4PAB A;  3GTP A;  2R92 C;  2R92 A;  4A3D C;  2RH6 A;  3FHZ A;  4A3J C;  3GTL C;  1XZP B;  4KC6 A;  2JA5 K;  2Y3P A;  5IYC K;  5HL8 A;  2PPB A;  2YU9 K;  3S17 K;  5IYD K;  2NVY K;  2KWA A;  3PO3 K;  3TFI A;  1O28 A;  1ZBS A;  5CHP A;  3GTG C;  4WJ4 A;  1WCM K;  4WIL A;  3S1Q C;  4OIO A;  2E2H K;  3FKI A;  1K83 K;  1IS1 A;  4AYB L;  3S15 C;  1ZXO A;  5IP9 C;  4G0U A;  3HOU C;  4A3B C;  3GTM K;  2JA7 C;  2JA7 A;  1BJT A;  1EH1 A;  1F9N A;  2E2J K;  2JA8 K;  5EGH A;  3FOF A;  4LLG A;  2CFA A;  2PHC B;  4KAS A;  4C3I K;  3S1N C;  5E68 A;  1TWF K;  1L0W A;  4OIQ A;  2R92 K;  4A3D K;  2PMZ D;  4A3J K;  3GTL K;  3M4O K;  3RZO C;  1XXC A;  3K7A C;  2GSN A;  2PMZ L;  1Y1V C;  4GTF A;  1TWG C;  1Y1V A;  4Y7N K;  1TWG A;  2FQT A;  4BY7 C;  1J98 A;  1TWH C;  1GE9 A;  1O2A A;  2B63 C;  5M5X K;  2V6T A;  2XCR B;  1JQW A;  2NVT K;  3S1Q K;  5C44 K;  4A3E K;  1WOS A;  1I50 C;  1I50 A;  2NVQ C;  4OIP A;  4C3H C;  3S15 K;  1O26 A;  1VRQ C;  1XZP A;  3GDZ A;  3N0B A;  3A8K A;  5IP9 K;  2A6H A;  3HOU K;  4XLN A;  1WQF A;  2V6S A;  2JA7 K;  3HXA A;  4YFX A;  4BLB A;  5TMF A;  4G7O A;  4KMA A;  1KQ4 A;  3S1N K;  3OPF A;  4XCH A;  3ADA C;  3GTQ C;  5M3F K;  3GTQ A;  1XZQ A;  4Y52 C;  2R93 C;  3RZO K;  1ZYR A;  3K7A K;  4A3M K;  2E2I C;  2E2I A;  4WJ3 M;  4KAW X;  4QIW D;  5C4J C;  1Y1V K;  1TWG K;  3OEP A;  3S1R C;  4BY7 K;  1ISE A;  1TWH K;  2E2H C;  3T02 A;  4KMU A;  1TWA C;  4MEY A;  1DCP A;  1TWA A;  4QJV A;  1PJ5 A;  1AB4 A;  1I50 K;  2NVQ K;  1VGX A;  4C3H K;  3AH5 A;  3M3Y C;  4KMD A;  2FQO A;  1O25 A;  4C2M C;  4Q4Z A;  3S16 C;  4A3L C;  2XCO A;  3GTP C;  4A3C K;  4YFK A;  1I3Q A;  4A3K K;  4BXX C;  3G4C A;  3VA7 A;  4A3G C;  4MQ9 A;  3M4O C;  3WOD A;  3HOX C;  5D4D A;  1HI9 A;  3GTQ K;  2NVX C;  5FJ8 K;  3RZD C;  5C3E C;  2NVX A;  4LQY A;  1RU0 A;  4KM8 A;  4Y7N C;  1YX2 A;  1PJ7 A;  2R93 K;  4Y52 K;  3I4N C;  4C3J C;  3GTO A;  2E2I K;  4GTB A;  1DCO A;  3DXJ A;  5C4J K;  1TWC A;  4JK1 A;  3S1R K;  3S2D K;  2NVT C;  5C44 C;  3FKI C;  4GTD A;  3L4K A;  4A3E C;  5IYB C;  1TWA K;  1EI6 A;  4G0V A;  3GTK C;  5FLM C;  3GTK A;  4KN4 A;  2P5M A;  5TMC A;  4KB2 A;  3AD9 C;  3AD8 C;  4ILD A;  3M3Y K;  3ERE D;  2P8T A;  2ZUF A;  4Q5S A;  4M1X A;  4C2M K;  3I4M C;  3S16 K;  1USO A;  4A3L K;  3GTP K;  3GEH A;  2VUM C;  1IW7 A;  2VUM A;  2GSU A;  4MEX A;  1SFO A;  4BXX K;  4A3G K;  4BY1 C;  3HOX K;  4A3M C;  2NVX K;  3RZD K;  5C3E K;  1VLO A;  2GAG C;  5IOS A;  3AQP A;  1Y1W A;  3I4N K;  1XPP A;  3GTO K;  4C3J K;  4LOW A;  1J6V A;  3FKI K;  5IYB K;  1EFW A;  5JFE A;  1SMY A;  3GTK K;  1XXB A;  5FLM K;  1V5V A;  4LK1 A;  2V6U A;  3GTJ A;  3H3V D;  3T01 A;  3S1M C;  3A8I A;  1UV7 A;  4A3C C;  3H3V L;  2CW0 A;  3HOY K;  3GEE A;  4A3K C;  3PO2 K;  4FM9 A;  3I4M K;  2WB1 D;  4G0W A;  3V4G A;  2VUM K;  2PA8 D;  3IPJ A;  2W7V A;  1INN A;  4BY1 K;  3BUE A;  2PA8 L;  1BDF A;  1G51 A;  4KAT A;  1USM A;  3JST A;  3NUH A;  2BE5 A;  4P5B A;  3AD7 C;  3S2D C;  1Y1W K;  4OIR A;  4QIW L;  1WIH A;  4KDD A;  3LAP A;  1WQG A;  3L4J A; 
#chains in the Genus database with same CATH homology
 1J6X A;  1VH2 A;  4XCH A;  1JVI A;  1VJE A;  2FQO A;  2FQT A;  1J6V A;  1INN A;  1J98 A;  1J6W A;  1JQW A;  1VGX A;  1YCL A;  1IE0 A;  5E68 A;  1JOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...