1VJEA

Crystal structure of a autoinducer-2 synthesis protein with bound selenomethionine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
148
Chain Sequence
ESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Genomics Approach to the Study of Quorum Sensing: Crystal Structures of Three LuxS Orthologs
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords Autoinducer-2 production protein LuxS
total genus 41
structure length 148
sequence length 149
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1vjeA00
1J98A 1JQWA 1YCLA 1J6WA 1JOEA 5E68A 1VJEA 1INNA 2FQOA 1IE0A 2FQTA 4XCHA 1J6XA 1JVIA 1VH2A 1J6VA 1VGXA
chains in the Genus database with same CATH superfamily
1IW7A 5L46A 3GTQC 3ADAC 3OEPA 2JA5A 4LLGA 2JA5C 3PO2C 3GTQA 4A3CC 4KATA 4GFQA 2V6SA 2NVYK 1C0AA 3CQZK 4WJ4A 1VRQC 2R92K 3HKZD 3TFJA 1TWGK 2NVXA 3FKIK 1AB4A 4A3FC 3GTPK 3I4MK 3TFIA 1TWCC 4OIOA 4KM8A 4PAAA 4A3IC 4AH6A 2WAQD 1F7UA 3GTLA 1TWFK 1WOOA 1I6HC 3L4KA 1R9TA 4BLBA 1ZVUA 1KQ4A 3T01A 1XPPA 4GZYA 4KARA 3GDZA 5IP7K 3PO3C 1SFOK 4BY1C 2YU9C 3HXAA 3M4OC 4P9SA 4ZH4A 4A3BK 4C2MC 3S14K 1J6VA 1VGXA 1USMA 1DCHA 2GSUA 3HOZC 1O26A 1USOA 4KMAA 3SZYA 4C3HK 2O5JA 3S15K 4KASA 4WJ3M 1WQFA 3TFHA 2E2IA 4FZBA 2JA8C 3FKIC 3GIRA 4Y7NC 2E2JC 4MEYA 1VLOA 3GEIA 1TWHA 4X6AK 4LR2A 2E2IC 3S1NC 5CHPA 2JA7A 4GT9A 2P8TA 3GEHA 4LK1A 2GAHC 3IPJA 1I6VA 4LK0A 2E2JK 4G0UA 3PO2K 1XZPB 1Y1VA 4KM9A 3MMLB 4MQ9A 4C45A 3S14C 5IYBC 4BY7K 4J3NA 2ZUFA 1ISEA 1I50C 4QJVB 2FQOA 2Y3PA 3GTMA 3Q3QA 5M3MK 1TWAA 5CJ9A 4A3GC 1EQRA 3LPXA 3GTGC 3NUHA 2PPBA 4A3KC 5TMCA 4GTCA 1I6HK 3GTLC 3SZZA 1I50K 1JQWA 2ZUEA 1DCPA 1K83A 3H3VL 4JK1A 2B63C 1JOEA 4C3IC 4C2MK 2E2HC 2NVQC 2R92C 3AD7C 1O25A 2R93A 4G7HA 4PABA 4Y52K 2W7VA 2A6HA 1TWGA 3AQPA 3BUEA 3JSTA 2D6FC 1GE9A 1Y1VK 1BDFA 5C4JC 5M5WK 2R93C 3EQLA 3S2DK 5IYDK 2NVTC 3CQZA 5EGEA 3V4GA 1O2BA 4GTDA 1YNJA 4BBSC 1HI9A 1TWHK 3G4AA 2KWAA 4OINA 4GTEA 2E2IK 2WB1D 2GAGC 1F93A 1XXBA 2RGRA 2PMZL 4LQYA 5C44K 1BS2A 3CQZC 3T00A 4G0WA 4QIWL 3CAGA 3HOXK 3S16K 1UV7A 4GTBA 3HOZK 4YG2A 3GTMC 4BKWA 3HOYC 4G0VA 4A3FK 3FHZA 3GTPC 3ERED 2R7ZK 3S1MK 5TMFA 3AD9C 5C44C 2E2HA 2CW0A 4P5AA 2E2HK 1O2FB 2NVQK 3WODA 1IQ0A 3QX3A 2JA8K 1J98A 4Y7NK 2B63A 5IOQA 5E68A 4A3GK 1K83C 1XXCA 1B4AA 3S1RC 4Q4ZA 5IORA 3K7AK 1ZYRA 1YX2A 4OIQA 5FJ8K 1TWFA 1PJ5A 1ZXOA 3M4OK 3GTGA 4KAWX 3HOWK 4XLNA 3LAJA 3A8JA 3FKIA 4C3IK 1HQMA 4DDQA 1I50A 3BP3A 2NVYA 1G51A 3N0CA 4A3CK 1DD5A 3A8IA 4AYBL 1Y1VC 2V6UA 3TTGA 1BGWA 2GSNA 4KDDA 1DCOA 3T02A 1F7VA 1SMYA 3OREA 4A3KK 1R9TK 2RH6A 2NVTK 4X6AC 5C4XK 2PA8L 4KMUA 4O2DA 3GTLK 1XZPA 3GTKK 2A6EA 1PJ6A 3S17C 4KMDA 4C3JK 3OPFA 3I4MC 3S1RK 2ZFZA 5IOTA 1R9TC 3LAPA 1EFWA 2R7ZA 1IS1A 1XXAA 2WB1L 3HOXC 3S16C 1IL2A 5IP9C 2XCRB 4KN4A 4KMHA 4A3LK 3RZDK 1INNA 5HL8A 4WILA 5C4JK 2VUMC 4A3MK 4A93K 1EI6A 4XSZA 1IE0A 3HOUK 2JH3A 2EBBA 3S1QC 1K83K 3RZDC 4MEXA 5JFEA 4BBSK 3HKZL 1YNNA 2XCOA 3GTOC 3K7AC 4A3MC 5FLMC 1WSVA 1Y1WA 5C4XC 4A3DC 4LJZA 3S2HK 5IOSA 2CFAA 3HOWC 1TWCA 1L0WA 4Q5SA 4A3JC 2A69A 5C3EK 4NOIA 4QIWD 2NVXC 1YCLA 3N3YA 1PJ7A 3H3VD 4A3DK 1EK8A 1JVIA 3HOVK 4BXXK 3I4NC 3S2HC 1TWCK 3VA7A 5JVOA 1ZQ1C 1TWGC 3GTJK 4FM9A 5C3EC 3RZOK 5M5YK 3GTKC 5EGHA 1X31C 2R92A 2JA7K 3AQOA 1BJTA 4BXXC 1WCMC 4YFNA 3I4NK 4YFXA 2VUMA 2JA6A 3GTMK 3HOYK 1XZQA 2BE5A 4LOWA 3S0XA 4OIRA 3GTQK 3GTGK 3H0GA 3GTJC 3GEEA 5TJ3A 1B4BA 4G7OA 4QJVA 1SFOC 4BY1K 4G7ZA 4A3EK 2R7ZC 2XCQA 1O29A 4KC6A 4A3LC 2WAQL 2FQTA 3H0GK 1TWAC 1VH2A 3M3YC 2VUMK 1O27A 2NVXK 4A3IK 3AH5A 3HOUC 1J6XA 3A8KA 1WIHA 4AYBD 4OIPA 4A3EC 4Y52C 3S1QK 3HOVC 4BBRC 1RU0A 4C3JC 1WQHA 1O24A 3M3YK 2JA5K 3DXJA 5FLMK 3RZOC 2YU9K 2NVYC 4GTFA 2O5IA 2JA7C 1WOPA 1I3QC 2V6TA 1EH1A 1O2AA 2R93K 5IYDC 2PHCB 5M3FK 3AD8C 3L4JA 1TWHC 1ZBSA 2P5MA 3GSIA 2PMZD 2JA6K 1I3QA 1IBAA 1I3QK 1XZQB 1TWFC 1SFOA 3FOFA 3S17K 4KB4A 3G4CA 3GTJA 4ILDA 3H0GC 3PO3K 3S1MC 2JA6C 5IP7C 3S1NK 4A3BC 1VJEA 4XLPA 3GTKA 1WCMK 2YU9A 4KB2A 3GTPA 2PA8D 4BLAA 2Y0SL 4M1XA 4A3JK 5IP9K 1WQGA 3FOEA 4P5BA 2A68A 1WORA 4GTLA 4C3HC 2CFAB 4XCHA 2B63K 2Y0SD 5IYBK 1Y1WK 4BY7C 1WOSA 3BP8C 4A93C 3S15C 1J6WA 5IYCC 1TWAK 1O28A 1V5VA 4KN7A 3GTOK 4YFKA 5M5XK 4RMFA 1F9NA 3N0BA 1WCMA 5D4DA 1Y1WC 2GSOA 1WSRA 3S2DC 4GTAA 3GTOA 4XSXA 4BBRK 5IYCK
chains in the Genus database with same CATH topology
1J98A 1JQWA 1YCLA 1J6WA 1JOEA 5E68A 1VJEA 1INNA 2FQOA 1IE0A 2FQTA 4XCHA 1J6XA 1JVIA 1VH2A 1J6VA 1VGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J98 A;  1JQW A;  1YCL A;  1J6W A;  1JOE A;  5E68 A;  1VJE A;  1INN A;  2FQO A;  1IE0 A;  2FQT A;  4XCH A;  1J6X A;  1JVI A;  1VH2 A;  1J6V A;  1VGX A; 
#chains in the Genus database with same CATH topology
 1IW7 A;  5L46 A;  3GTQ C;  3ADA C;  3OEP A;  2JA5 A;  4LLG A;  2JA5 C;  3PO2 C;  3GTQ A;  4A3C C;  4KAT A;  4GFQ A;  2V6S A;  2NVY K;  1C0A A;  3CQZ K;  4WJ4 A;  1VRQ C;  2R92 K;  3HKZ D;  3TFJ A;  1TWG K;  2NVX A;  3FKI K;  1AB4 A;  4A3F C;  3GTP K;  3I4M K;  3TFI A;  1TWC C;  4OIO A;  4KM8 A;  4PAA A;  4A3I C;  4AH6 A;  2WAQ D;  1F7U A;  3GTL A;  1TWF K;  1WOO A;  1I6H C;  3L4K A;  1R9T A;  4BLB A;  1ZVU A;  1KQ4 A;  3T01 A;  1XPP A;  4GZY A;  4KAR A;  3GDZ A;  5IP7 K;  3PO3 C;  1SFO K;  4BY1 C;  2YU9 C;  3HXA A;  3M4O C;  4P9S A;  4ZH4 A;  4A3B K;  4C2M C;  3S14 K;  1J6V A;  1VGX A;  1USM A;  1DCH A;  2GSU A;  3HOZ C;  1O26 A;  1USO A;  4KMA A;  3SZY A;  4C3H K;  2O5J A;  3S15 K;  4KAS A;  4WJ3 M;  1WQF A;  3TFH A;  2E2I A;  4FZB A;  2JA8 C;  3FKI C;  3GIR A;  4Y7N C;  2E2J C;  4MEY A;  1VLO A;  3GEI A;  1TWH A;  4X6A K;  4LR2 A;  2E2I C;  3S1N C;  5CHP A;  2JA7 A;  4GT9 A;  2P8T A;  3GEH A;  4LK1 A;  2GAH C;  3IPJ A;  1I6V A;  4LK0 A;  2E2J K;  4G0U A;  3PO2 K;  1XZP B;  1Y1V A;  4KM9 A;  3MML B;  4MQ9 A;  4C45 A;  3S14 C;  5IYB C;  4BY7 K;  4J3N A;  2ZUF A;  1ISE A;  1I50 C;  4QJV B;  2FQO A;  2Y3P A;  3GTM A;  3Q3Q A;  5M3M K;  1TWA A;  5CJ9 A;  4A3G C;  1EQR A;  3LPX A;  3GTG C;  3NUH A;  2PPB A;  4A3K C;  5TMC A;  4GTC A;  1I6H K;  3GTL C;  3SZZ A;  1I50 K;  1JQW A;  2ZUE A;  1DCP A;  1K83 A;  3H3V L;  4JK1 A;  2B63 C;  1JOE A;  4C3I C;  4C2M K;  2E2H C;  2NVQ C;  2R92 C;  3AD7 C;  1O25 A;  2R93 A;  4G7H A;  4PAB A;  4Y52 K;  2W7V A;  2A6H A;  1TWG A;  3AQP A;  3BUE A;  3JST A;  2D6F C;  1GE9 A;  1Y1V K;  1BDF A;  5C4J C;  5M5W K;  2R93 C;  3EQL A;  3S2D K;  5IYD K;  2NVT C;  3CQZ A;  5EGE A;  3V4G A;  1O2B A;  4GTD A;  1YNJ A;  4BBS C;  1HI9 A;  1TWH K;  3G4A A;  2KWA A;  4OIN A;  4GTE A;  2E2I K;  2WB1 D;  2GAG C;  1F93 A;  1XXB A;  2RGR A;  2PMZ L;  4LQY A;  5C44 K;  1BS2 A;  3CQZ C;  3T00 A;  4G0W A;  4QIW L;  3CAG A;  3HOX K;  3S16 K;  1UV7 A;  4GTB A;  3HOZ K;  4YG2 A;  3GTM C;  4BKW A;  3HOY C;  4G0V A;  4A3F K;  3FHZ A;  3GTP C;  3ERE D;  2R7Z K;  3S1M K;  5TMF A;  3AD9 C;  5C44 C;  2E2H A;  2CW0 A;  4P5A A;  2E2H K;  1O2F B;  2NVQ K;  3WOD A;  1IQ0 A;  3QX3 A;  2JA8 K;  1J98 A;  4Y7N K;  2B63 A;  5IOQ A;  5E68 A;  4A3G K;  1K83 C;  1XXC A;  1B4A A;  3S1R C;  4Q4Z A;  5IOR A;  3K7A K;  1ZYR A;  1YX2 A;  4OIQ A;  5FJ8 K;  1TWF A;  1PJ5 A;  1ZXO A;  3M4O K;  3GTG A;  4KAW X;  3HOW K;  4XLN A;  3LAJ A;  3A8J A;  3FKI A;  4C3I K;  1HQM A;  4DDQ A;  1I50 A;  3BP3 A;  2NVY A;  1G51 A;  3N0C A;  4A3C K;  1DD5 A;  3A8I A;  4AYB L;  1Y1V C;  2V6U A;  3TTG A;  1BGW A;  2GSN A;  4KDD A;  1DCO A;  3T02 A;  1F7V A;  1SMY A;  3ORE A;  4A3K K;  1R9T K;  2RH6 A;  2NVT K;  4X6A C;  5C4X K;  2PA8 L;  4KMU A;  4O2D A;  3GTL K;  1XZP A;  3GTK K;  2A6E A;  1PJ6 A;  3S17 C;  4KMD A;  4C3J K;  3OPF A;  3I4M C;  3S1R K;  2ZFZ A;  5IOT A;  1R9T C;  3LAP A;  1EFW A;  2R7Z A;  1IS1 A;  1XXA A;  2WB1 L;  3HOX C;  3S16 C;  1IL2 A;  5IP9 C;  2XCR B;  4KN4 A;  4KMH A;  4A3L K;  3RZD K;  1INN A;  5HL8 A;  4WIL A;  5C4J K;  2VUM C;  4A3M K;  4A93 K;  1EI6 A;  4XSZ A;  1IE0 A;  3HOU K;  2JH3 A;  2EBB A;  3S1Q C;  1K83 K;  3RZD C;  4MEX A;  5JFE A;  4BBS K;  3HKZ L;  1YNN A;  2XCO A;  3GTO C;  3K7A C;  4A3M C;  5FLM C;  1WSV A;  1Y1W A;  5C4X C;  4A3D C;  4LJZ A;  3S2H K;  5IOS A;  2CFA A;  3HOW C;  1TWC A;  1L0W A;  4Q5S A;  4A3J C;  2A69 A;  5C3E K;  4NOI A;  4QIW D;  2NVX C;  1YCL A;  3N3Y A;  1PJ7 A;  3H3V D;  4A3D K;  1EK8 A;  1JVI A;  3HOV K;  4BXX K;  3I4N C;  3S2H C;  1TWC K;  3VA7 A;  5JVO A;  1ZQ1 C;  1TWG C;  3GTJ K;  4FM9 A;  5C3E C;  3RZO K;  5M5Y K;  3GTK C;  5EGH A;  1X31 C;  2R92 A;  2JA7 K;  3AQO A;  1BJT A;  4BXX C;  1WCM C;  4YFN A;  3I4N K;  4YFX A;  2VUM A;  2JA6 A;  3GTM K;  3HOY K;  1XZQ A;  2BE5 A;  4LOW A;  3S0X A;  4OIR A;  3GTQ K;  3GTG K;  3H0G A;  3GTJ C;  3GEE A;  5TJ3 A;  1B4B A;  4G7O A;  4QJV A;  1SFO C;  4BY1 K;  4G7Z A;  4A3E K;  2R7Z C;  2XCQ A;  1O29 A;  4KC6 A;  4A3L C;  2WAQ L;  2FQT A;  3H0G K;  1TWA C;  1VH2 A;  3M3Y C;  2VUM K;  1O27 A;  2NVX K;  4A3I K;  3AH5 A;  3HOU C;  1J6X A;  3A8K A;  1WIH A;  4AYB D;  4OIP A;  4A3E C;  4Y52 C;  3S1Q K;  3HOV C;  4BBR C;  1RU0 A;  4C3J C;  1WQH A;  1O24 A;  3M3Y K;  2JA5 K;  3DXJ A;  5FLM K;  3RZO C;  2YU9 K;  2NVY C;  4GTF A;  2O5I A;  2JA7 C;  1WOP A;  1I3Q C;  2V6T A;  1EH1 A;  1O2A A;  2R93 K;  5IYD C;  2PHC B;  5M3F K;  3AD8 C;  3L4J A;  1TWH C;  1ZBS A;  2P5M A;  3GSI A;  2PMZ D;  2JA6 K;  1I3Q A;  1IBA A;  1I3Q K;  1XZQ B;  1TWF C;  1SFO A;  3FOF A;  3S17 K;  4KB4 A;  3G4C A;  3GTJ A;  4ILD A;  3H0G C;  3PO3 K;  3S1M C;  2JA6 C;  5IP7 C;  3S1N K;  4A3B C;  1VJE A;  4XLP A;  3GTK A;  1WCM K;  2YU9 A;  4KB2 A;  3GTP A;  2PA8 D;  4BLA A;  2Y0S L;  4M1X A;  4A3J K;  5IP9 K;  1WQG A;  3FOE A;  4P5B A;  2A68 A;  1WOR A;  4GTL A;  4C3H C;  2CFA B;  4XCH A;  2B63 K;  2Y0S D;  5IYB K;  1Y1W K;  4BY7 C;  1WOS A;  3BP8 C;  4A93 C;  3S15 C;  1J6W A;  5IYC C;  1TWA K;  1O28 A;  1V5V A;  4KN7 A;  3GTO K;  4YFK A;  5M5X K;  4RMF A;  1F9N A;  3N0B A;  1WCM A;  5D4D A;  1Y1W C;  2GSO A;  1WSR A;  3S2D C;  4GTA A;  3GTO A;  4XSX A;  4BBR K;  5IYC K; 
#chains in the Genus database with same CATH homology
 1J98 A;  1JQW A;  1YCL A;  1J6W A;  1JOE A;  5E68 A;  1VJE A;  1INN A;  2FQO A;  1IE0 A;  2FQT A;  4XCH A;  1J6X A;  1JVI A;  1VH2 A;  1J6V A;  1VGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...