1VJEA

Crystal structure of a autoinducer-2 synthesis protein with bound selenomethionine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
148
Chain Sequence
ESFDLDHTKVKAPYVRLAGVKTTPKGDQISKYDLRFLQPNQGAIDPAAIHTLEHLLAGYMRDHLEGVVDVSPMGRTGMYMAVIGEPDEQGVMKAFEAALKDTAGHDQPIPGVSELECGNYRDHDLAAARQHARDVLDQGLKVQETILLMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinducer-2 production protein LuxS
publication title A Structural Genomics Approach to the Study of Quorum Sensing: Crystal Structures of Three LuxS Orthologs
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 41
structure length 148
sequence length 149
chains with identical sequence B
ec nomenclature ec 4.4.1.21: S-ribosylhomocysteine lyase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02664 LuxS S-Ribosylhomocysteinase (LuxS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.80 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 S-ribosylhomocysteinase (LuxS) 1vjeA00
1J6XA 1JOEA 1JVIA 1VGXA 1VH2A 1VJEA 1YCLA 2FQOA 1J6VA 4XCHA 5E68A 1J98A 1IE0A 1J6WA 1JQWA 2FQTA 1INNA
chains in the Genus database with same CATH superfamily
3M4OK 4BY7C 3S15K 3S14K 3G4CA 2R7ZC 1GE9A 4KATA 2JA7C 1XZQB 2D6FC 4C3HK 1WCMC 2RGRA 1I3QA 1RU0A 4A3LC 5L46A 1I3QK 2JA5A 3GTMA 3BUEA 3HKZD 4LQYA 4C45A 1TWHK 2R93A 2JA6K 4A3EC 1JOEA 1YNNA 1IQ0A 5IP7C 4AYBD 1ZVUA 3A8KA 5M3MK 2R92C 3LAPA 3GTKA 1DCOA 2NVXK 1I6HK 2B63C 3BP3A 4A3IK 1K83A 4GTFA 3V4GA 3AD9C 1K83K 4GTEA 4C3JK 3GTKC 3RZOC 2ZFZA 4XSXA 4YFKA 4KN4A 5IYDC 4A3FC 1ISEA 5FLMK 3H3VL 4A3BK 1IW7A 4BLBA 1G51A 2FQOA 5IOQA 3GEHA 5D4DA 2JA8K 2WAQL 5IP9K 4GTDA 3A8IA 1TWFA 4KM9A 1EH1A 1XXAA 1VGXA 4A3CC 1O28A 3WODA 5JFEA 1HI9A 4A3KK 1O26A 3H0GC 2WB1D 5TMCA 4Y7NC 3GSIA 3HOVC 1TWAK 3HOUK 4A3DK 1INNA 2VUMC 2V6UA 5C4JC 4YFXA 3GTGK 4QJVA 1O2AA 5FJ8K 1Y1VC 3AQOA 5M5YK 4P9SA 1ZXOA 4KC6A 4YFNA 1TWCA 5IYBC 2ZUEA 1IE0A 5C4XK 3K7AC 2RH6A 4X6AC 1Y1WA 3HOXK 1XPPA 2YU9A 2O5JA 1BDFA 1J6VA 5M5WK 4GTAA 4BXXC 2E2IA 3S17K 3GTLA 2E2IK 2E2HA 1HQMA 4KMDA 4OINA 2NVQK 1J6WA 1Y1WC 1F7VA 3GTQK 2YU9C 2PMZL 3I4MC 4BY1K 2A69A 3GTPA 3GTPK 4KMHA 3AH5A 4KMAA 1XZPB 4Y52C 1BGWA 1YX2A 1C0AA 5JVOA 3S1RK 1YCLA 2R7ZA 2R7ZK 4KB4A 2JA7A 1ZYRA 2JA7K 1WCMA 3GTOC 5CJ9A 1VLOA 4A3LK 5M3FK 1L0WA 3HOZC 3SZZA 5IYCK 1XZPA 4A3EK 1PJ6A 5IP7K 4G0WA 4M1XA 2JA5K 3TTGA 3PO2C 3S1QC 3GTMK 1IBAA 2R92A 3PO3K 1F93A 4LLGA 2R92K 3NUHA 3S16K 1EFWA 4RMFA 2R93K 2B63A 3I4NC 5TJ3A 5TMFA 3CQZC 1R9TC 1I50A 3M4OC 3S2HC 4GZYA 3S14C 3GEIA 4KM8A 2PPBA 3GTKK 2V6TA 4KASA 1XZQA 4DDQA 4A93C 3RZOK 4OIQA 3M3YK 1XXCA 3S1MC 1IS1A 1USMA 4KAWX 5IOSA 1I50C 1JVIA 4A3GK 5IYDK 2Y0SD 4QIWD 3GIRA 3LAJA 1EI6A 5IOTA 1O2FB 3OREA 1J98A 1TWHC 2JA6C 3OPFA 2PA8D 2GAHC 4PAAA 4OIOA 3L4KA 3FOEA 1AB4A 4C2MK 3H0GA 3MMLB 5CHPA 1WOPA 4KDDA 2CFAB 3HKZL 3CAGA 1I6HC 3SZYA 4WJ4A 2NVYC 2CW0A 1TWFK 2VUMA 5C44C 4AYBL 1PJ7A 3HOYK 3AQPA 4A3MC 1WQHA 1Y1VA 2W7VA 3G4AA 3GTJA 1Y1VK 1B4BA 2KWAA 4KMUA 4OIPA 4A3JC 3T01A 4KB2A 3N0CA 4AH6A 5FLMC 1VJEA 4BXXK 3GTJC 2NVTK 4LJZA 2JA8C 1TWCK 3AD7C 1SFOC 5C3EC 2PHCB 1Y1WK 4BBSK 2YU9K 3N3YA 4O2DA 2P5MA 4GTBA 4P5BA 2Y3PA 1DCHA 1O2BA 2A6HA 3RZDC 3GTLK 2E2HK 5M5XK 4G0VA 4BLAA 2A68A 2BE5A 1XXBA 3S1NK 5HL8A 1TWAC 4Q4ZA 3HOUC 4A3DC 3Q3QA 3LPXA 4LK0A 2JH3A 4G0UA 4LR2A 2E2JK 3GTOA 3GTGC 1F7UA 2WB1L 4BY7K 3GTOK 3ADAC 4ILDA 1UV7A 1WOSA 4OIRA 3FKIC 3HOXC 1WQGA 3OEPA 5IORA 2EBBA 4C3IC 3S2DC 1WCMK 1O24A 1B4AA 3TFHA 3FOFA 1EQRA 1TWGC 3AD8C 1JQWA 3GTQC 3PO2K 1WOOA 3S1QK 2GSUA 4XSZA 4BBRC 1J6XA 3CQZA 1BS2A 1R9TA 3EQLA 3CQZK 3HOWC 1SMYA 1X31C 3S2HK 4P5AA 4XCHA 3N0BA 3S1RC 1VRQC 4A93K 4MQ9A 4KN7A 2B63K 1KQ4A 2XCOA 3S1MK 1WSVA 3S15C 1I50K 3H3VD 2FQTA 4ZH4A 2XCRB 2GSOA 2WAQD 1I6VA 4C3HC 1TWHA 2ZUFA 2E2JC 5IYCC 2JA6A 4BKWA 4A3FK 1I3QC 2JA5C 3GTMC 2GSNA 3PO3C 4Q5SA 4LOWA 4GTLA 2NVXA 3S16C 2R93C 3VA7A 2NVYA 1WQFA 1YNJA 2NVYK 4A3CK 1WORA 5C44K 4G7HA 1IL2A 3H0GK 4A3MK 4Y7NK 4G7ZA 4FM9A 2NVXC 2GAGC 3M3YC 3HOVK 4A3IC 1F9NA 1V5VA 4A3JK 4LK1A 2VUMK 4JK1A 1K83C 4A3GC 4C3JC 1WSRA 5C4JK 3T00A 5EGEA 3L4JA 4QJVB 5E68A 3GTJK 5IYBK 3TFJA 3FHZA 2V6SA 1SFOA 1O25A 3K7AK 2PMZD 4X6AK 2XCQA 1SFOK 4FZBA 4J3NA 5C3EK 4G7OA 4A3BC 3TFIA 3GDZA 5EGHA 2Y0SL 3T02A 4WJ3M 4QIWL 3RZDK 4C2MC 4XLPA 2CFAA 5IP9C 1BJTA 3I4MK 1TWAA 3DXJA 1O29A 3JSTA 1TWFC 2PA8L 1ZQ1C 1DCPA 4GT9A 4A3KC 3HOYC 4Y52K 3QX3A 3GTGA 1USOA 2A6EA 1WIHA 3ERED 4WILA 1DD5A 3GEEA 2O5IA 3FKIA 4PABA 3FKIK 4MEXA 4YG2A 1VH2A 1PJ5A 4MEYA 4C3IK 3S2DK 4GTCA 3HXAA 2NVTC 3IPJA 1ZBSA 5C4XC 1TWGA 1EK8A 1TWCC 3GTQA 1TWGK 4GFQA 4BBSC 3HOZK 3S17C 1O27A 2E2IC 3GTLC 4BBRK 2E2HC 4XLNA 2NVQC 3HOWK 4NOIA 4BY1C 4KARA 3S1NC 3GTPC 2P8TA 3A8JA 3BP8C 3I4NK 3S0XA 1R9TK
chains in the Genus database with same CATH topology
1J6XA 1JOEA 1JVIA 1VGXA 1VH2A 1VJEA 1YCLA 2FQOA 1J6VA 4XCHA 5E68A 1J98A 1IE0A 1J6WA 1JQWA 2FQTA 1INNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6X A;  1JOE A;  1JVI A;  1VGX A;  1VH2 A;  1VJE A;  1YCL A;  2FQO A;  1J6V A;  4XCH A;  5E68 A;  1J98 A;  1IE0 A;  1J6W A;  1JQW A;  2FQT A;  1INN A; 
#chains in the Genus database with same CATH topology
 3M4O K;  4BY7 C;  3S15 K;  3S14 K;  3G4C A;  2R7Z C;  1GE9 A;  4KAT A;  2JA7 C;  1XZQ B;  2D6F C;  4C3H K;  1WCM C;  2RGR A;  1I3Q A;  1RU0 A;  4A3L C;  5L46 A;  1I3Q K;  2JA5 A;  3GTM A;  3BUE A;  3HKZ D;  4LQY A;  4C45 A;  1TWH K;  2R93 A;  2JA6 K;  4A3E C;  1JOE A;  1YNN A;  1IQ0 A;  5IP7 C;  4AYB D;  1ZVU A;  3A8K A;  5M3M K;  2R92 C;  3LAP A;  3GTK A;  1DCO A;  2NVX K;  1I6H K;  2B63 C;  3BP3 A;  4A3I K;  1K83 A;  4GTF A;  3V4G A;  3AD9 C;  1K83 K;  4GTE A;  4C3J K;  3GTK C;  3RZO C;  2ZFZ A;  4XSX A;  4YFK A;  4KN4 A;  5IYD C;  4A3F C;  1ISE A;  5FLM K;  3H3V L;  4A3B K;  1IW7 A;  4BLB A;  1G51 A;  2FQO A;  5IOQ A;  3GEH A;  5D4D A;  2JA8 K;  2WAQ L;  5IP9 K;  4GTD A;  3A8I A;  1TWF A;  4KM9 A;  1EH1 A;  1XXA A;  1VGX A;  4A3C C;  1O28 A;  3WOD A;  5JFE A;  1HI9 A;  4A3K K;  1O26 A;  3H0G C;  2WB1 D;  5TMC A;  4Y7N C;  3GSI A;  3HOV C;  1TWA K;  3HOU K;  4A3D K;  1INN A;  2VUM C;  2V6U A;  5C4J C;  4YFX A;  3GTG K;  4QJV A;  1O2A A;  5FJ8 K;  1Y1V C;  3AQO A;  5M5Y K;  4P9S A;  1ZXO A;  4KC6 A;  4YFN A;  1TWC A;  5IYB C;  2ZUE A;  1IE0 A;  5C4X K;  3K7A C;  2RH6 A;  4X6A C;  1Y1W A;  3HOX K;  1XPP A;  2YU9 A;  2O5J A;  1BDF A;  1J6V A;  5M5W K;  4GTA A;  4BXX C;  2E2I A;  3S17 K;  3GTL A;  2E2I K;  2E2H A;  1HQM A;  4KMD A;  4OIN A;  2NVQ K;  1J6W A;  1Y1W C;  1F7V A;  3GTQ K;  2YU9 C;  2PMZ L;  3I4M C;  4BY1 K;  2A69 A;  3GTP A;  3GTP K;  4KMH A;  3AH5 A;  4KMA A;  1XZP B;  4Y52 C;  1BGW A;  1YX2 A;  1C0A A;  5JVO A;  3S1R K;  1YCL A;  2R7Z A;  2R7Z K;  4KB4 A;  2JA7 A;  1ZYR A;  2JA7 K;  1WCM A;  3GTO C;  5CJ9 A;  1VLO A;  4A3L K;  5M3F K;  1L0W A;  3HOZ C;  3SZZ A;  5IYC K;  1XZP A;  4A3E K;  1PJ6 A;  5IP7 K;  4G0W A;  4M1X A;  2JA5 K;  3TTG A;  3PO2 C;  3S1Q C;  3GTM K;  1IBA A;  2R92 A;  3PO3 K;  1F93 A;  4LLG A;  2R92 K;  3NUH A;  3S16 K;  1EFW A;  4RMF A;  2R93 K;  2B63 A;  3I4N C;  5TJ3 A;  5TMF A;  3CQZ C;  1R9T C;  1I50 A;  3M4O C;  3S2H C;  4GZY A;  3S14 C;  3GEI A;  4KM8 A;  2PPB A;  3GTK K;  2V6T A;  4KAS A;  1XZQ A;  4DDQ A;  4A93 C;  3RZO K;  4OIQ A;  3M3Y K;  1XXC A;  3S1M C;  1IS1 A;  1USM A;  4KAW X;  5IOS A;  1I50 C;  1JVI A;  4A3G K;  5IYD K;  2Y0S D;  4QIW D;  3GIR A;  3LAJ A;  1EI6 A;  5IOT A;  1O2F B;  3ORE A;  1J98 A;  1TWH C;  2JA6 C;  3OPF A;  2PA8 D;  2GAH C;  4PAA A;  4OIO A;  3L4K A;  3FOE A;  1AB4 A;  4C2M K;  3H0G A;  3MML B;  5CHP A;  1WOP A;  4KDD A;  2CFA B;  3HKZ L;  3CAG A;  1I6H C;  3SZY A;  4WJ4 A;  2NVY C;  2CW0 A;  1TWF K;  2VUM A;  5C44 C;  4AYB L;  1PJ7 A;  3HOY K;  3AQP A;  4A3M C;  1WQH A;  1Y1V A;  2W7V A;  3G4A A;  3GTJ A;  1Y1V K;  1B4B A;  2KWA A;  4KMU A;  4OIP A;  4A3J C;  3T01 A;  4KB2 A;  3N0C A;  4AH6 A;  5FLM C;  1VJE A;  4BXX K;  3GTJ C;  2NVT K;  4LJZ A;  2JA8 C;  1TWC K;  3AD7 C;  1SFO C;  5C3E C;  2PHC B;  1Y1W K;  4BBS K;  2YU9 K;  3N3Y A;  4O2D A;  2P5M A;  4GTB A;  4P5B A;  2Y3P A;  1DCH A;  1O2B A;  2A6H A;  3RZD C;  3GTL K;  2E2H K;  5M5X K;  4G0V A;  4BLA A;  2A68 A;  2BE5 A;  1XXB A;  3S1N K;  5HL8 A;  1TWA C;  4Q4Z A;  3HOU C;  4A3D C;  3Q3Q A;  3LPX A;  4LK0 A;  2JH3 A;  4G0U A;  4LR2 A;  2E2J K;  3GTO A;  3GTG C;  1F7U A;  2WB1 L;  4BY7 K;  3GTO K;  3ADA C;  4ILD A;  1UV7 A;  1WOS A;  4OIR A;  3FKI C;  3HOX C;  1WQG A;  3OEP A;  5IOR A;  2EBB A;  4C3I C;  3S2D C;  1WCM K;  1O24 A;  1B4A A;  3TFH A;  3FOF A;  1EQR A;  1TWG C;  3AD8 C;  1JQW A;  3GTQ C;  3PO2 K;  1WOO A;  3S1Q K;  2GSU A;  4XSZ A;  4BBR C;  1J6X A;  3CQZ A;  1BS2 A;  1R9T A;  3EQL A;  3CQZ K;  3HOW C;  1SMY A;  1X31 C;  3S2H K;  4P5A A;  4XCH A;  3N0B A;  3S1R C;  1VRQ C;  4A93 K;  4MQ9 A;  4KN7 A;  2B63 K;  1KQ4 A;  2XCO A;  3S1M K;  1WSV A;  3S15 C;  1I50 K;  3H3V D;  2FQT A;  4ZH4 A;  2XCR B;  2GSO A;  2WAQ D;  1I6V A;  4C3H C;  1TWH A;  2ZUF A;  2E2J C;  5IYC C;  2JA6 A;  4BKW A;  4A3F K;  1I3Q C;  2JA5 C;  3GTM C;  2GSN A;  3PO3 C;  4Q5S A;  4LOW A;  4GTL A;  2NVX A;  3S16 C;  2R93 C;  3VA7 A;  2NVY A;  1WQF A;  1YNJ A;  2NVY K;  4A3C K;  1WOR A;  5C44 K;  4G7H A;  1IL2 A;  3H0G K;  4A3M K;  4Y7N K;  4G7Z A;  4FM9 A;  2NVX C;  2GAG C;  3M3Y C;  3HOV K;  4A3I C;  1F9N A;  1V5V A;  4A3J K;  4LK1 A;  2VUM K;  4JK1 A;  1K83 C;  4A3G C;  4C3J C;  1WSR A;  5C4J K;  3T00 A;  5EGE A;  3L4J A;  4QJV B;  5E68 A;  3GTJ K;  5IYB K;  3TFJ A;  3FHZ A;  2V6S A;  1SFO A;  1O25 A;  3K7A K;  2PMZ D;  4X6A K;  2XCQ A;  1SFO K;  4FZB A;  4J3N A;  5C3E K;  4G7O A;  4A3B C;  3TFI A;  3GDZ A;  5EGH A;  2Y0S L;  3T02 A;  4WJ3 M;  4QIW L;  3RZD K;  4C2M C;  4XLP A;  2CFA A;  5IP9 C;  1BJT A;  3I4M K;  1TWA A;  3DXJ A;  1O29 A;  3JST A;  1TWF C;  2PA8 L;  1ZQ1 C;  1DCP A;  4GT9 A;  4A3K C;  3HOY C;  4Y52 K;  3QX3 A;  3GTG A;  1USO A;  2A6E A;  1WIH A;  3ERE D;  4WIL A;  1DD5 A;  3GEE A;  2O5I A;  3FKI A;  4PAB A;  3FKI K;  4MEX A;  4YG2 A;  1VH2 A;  1PJ5 A;  4MEY A;  4C3I K;  3S2D K;  4GTC A;  3HXA A;  2NVT C;  3IPJ A;  1ZBS A;  5C4X C;  1TWG A;  1EK8 A;  1TWC C;  3GTQ A;  1TWG K;  4GFQ A;  4BBS C;  3HOZ K;  3S17 C;  1O27 A;  2E2I C;  3GTL C;  4BBR K;  2E2H C;  4XLN A;  2NVQ C;  3HOW K;  4NOI A;  4BY1 C;  4KAR A;  3S1N C;  3GTP C;  2P8T A;  3A8J A;  3BP8 C;  3I4N K;  3S0X A;  1R9T K; 
#chains in the Genus database with same CATH homology
 1J6X A;  1JOE A;  1JVI A;  1VGX A;  1VH2 A;  1VJE A;  1YCL A;  2FQO A;  1J6V A;  4XCH A;  5E68 A;  1J98 A;  1IE0 A;  1J6W A;  1JQW A;  2FQT A;  1INN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...