1VJGA

Crystal structure of a gdsl-like lipase (alr1529) from nostoc sp. pcc 7120 at 2.01 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
201
structure length
201
Chain Sequence
SKTQIRICFVGDSFVNGTGDPECLGWTGRVCVNANKKGYDVTYYNLGIRRDTSSDIAKRWLQEVSLRLHKEYNSLVVFSFGLNDTTLENGKPRVSIAETIKNTREILTQAKKLYPVLMISPAPYIEQQDPGRRRRTIDLSQQLALVCQDLDVPYLDVFPLLEKPSVWLHEAKANDGVHPQAGGYTEFARIVENWDAWLNWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative lipase from the G-D-S-L family from Nostoc sp. at 2.01 A resolution
rcsb
source organism Nostoc sp.
molecule tags Hydrolase
molecule keywords putative lipase from the G-D-S-L family
total genus 73
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2004-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1vjgA00
2O14A 2WAAA 4XVHA 4S1PA 2W9XA 1DEXA 4H08A 4JGGA 1YZFA 4JHLA 5JD3A 3DC7A 1V2GA 3DT6A 5A4AA 1JRLA 2HSJA 1DEOA 3W7VA 3MILA 4HYQA 1PP4A 1BWPA 1IVNA 4RSHA 4RW0A 5B5SA 1VJGA 1J00A 1ESDA 4M8KA 3C1UA 1U8UA 4IYJA 1FXWF 3DT9A 3RJTA 3DCIA 1FXWA 3HP4A 1VYHA 4JJ4A 4K3UA 1Z8HA 2Q0QA 1BWQA 2Q0SA 1ESEA 4PPYA 4JJ6A 3BZWA 4JKOA 3PT5A 4NRDA 4OAPA 4Q9AA 5HOEA 4TX1A 2VPTA 4HF7A 4I8IA 4OAOA 1ESCA 3DT8A 5BN1A 4Q7QA 1BWRA 4K7JA 3SLRA 5CD9A 4LHSA 1K7CA 3KVNA 3P94A 3U37A 1WABA 2WABA 2WAOA 4K40A 1ES9A 2APJA 4DEVA 3SKVA 1ZMBA 4K9SA
chains in the Genus database with same CATH superfamily
4URXR 2CUKA 3LZ6A 1V8FA 1V25A 3EJWA 2QXYA 2EX4A 5FTKA 1ICEA 1N5MA 4FWIB 2XE8A 1A9QA 3C15C 3DHNA 2QMHA 3SZLA 5KTYA 2JLQA 1S9DA 1UMCB 4CKCA 3EIFA 4RBNA 4Y6GB 2Y0PA 5LMUB 3KR1A 2M1XA 3O4VA 4DWVA 2A0YA 3MRSA 4HSEA 4I9FA 1Q12A 3KSRA 4MRSA 4E5PA 4ZI7B 3ZCTA 2E5FA 2OCXA 2IHUA 3FFBA 1P73A 4P84A 4PIMA 4R1NA 5CA1B 1LRJA 2CF6A 3HUUA 1MOPA 3ZE1B 4EAAA 3MCVA 5BP7A 4W5RA 3DE0X 1P7PA 4L5BA 2W2PA 3FCXA 3H2YA 3QLUC 1Y7LA 2MHCA 4DMFA 2X5NA 3GMTA 4PLFA 4KJXA 5IBRA 5GMOA 3QJYA 3W7VA 2PH3A 5CFLA 4GS5A 1Y5RA 3TBHA 5K6AA 3BFJA 1OZGA 4DUYB 4U3JB 2GSDA 1IVNA 1TIKA 2DLDA 2ZTMA 3EA4A 3IUNA 5M2QA 3F7NA 1HE1C 2XECA 3AFOA 4NENB 4TV9A 1YQEA 2FFJA 1LBQA 3FI0A 3GBVA 3R9IA 5A04A 5LFAA 1L4UA 2FN9A 1OU4A 2PLRA 3ET5A 5DHAA 5AM1A 1QIHA 1YB6A 1ULHA 4OHOA 3SNKA 4ACAA 1K3FA 2VBIA 2WIJA 4PAWA 5ETJA 3GLFE 4EVQA 4WKBA 3CX6A 5JOQA 3LGAA 3NTXA 3QBDA 1WCV1 3G0CA 2NAFA 3E4CA 3FPJA 3LV8A 4WT7A 4QXAA 3TSCA 1JR3D 1GOTA 4D79A 2DR2A 1ZXXA 1FSPA 1TJ3A 4UQOA 2AG6A 3TB6A 3FYTA 3VVCA 2C8LA 2CD7A 4CV2A 5C7YA 1N0VC 3ODPA 4B1FA 3LQ1A 1FIUA 2XCLA 1E61A 1QGUB 3QUBA 1CUBA 2VSFA 1JAIA 2B8JA 5J2UA 1RRFA 1WV0A 3INGA 3JAKA 4K5QA 2QN3A 4UCQA 1JQKA 3AIKA 4P35A 4RLSA 4WASA 2DY0A 2YOFA 3H2ZA 4BHTA 1BVHA 3QPBA 4W4TA 5JQWA 4MVCA 3V9AA 5ICEA 1NN3A 4HB4A 3QRWA 3JZIA 1YGPA 2C5AA 1JAYA 2CFOA 2ASEA 2OGZA 3EY9A 4WSOA 4FXOA 2P0AA 3F6PA 4JA2A 2X1HA 4M38A 3ESXA 4IS3A 3HO1A 2OKGA 2Q4RA 5CM8B 1V7CA 1IDOA 3HJHA 3QOWA 4KITB 3Q3HA 2A3RA 4BO5A 1HE8B 3L9XA 4ZDWA 2WHYA 4UOQA 2OHHA 4ENWA 5KJFA 2HFJA 1OW3B 2QTNA 4NL4H 2J3JA 4FN5A 2GM5A 3GIDA 1WXIA 2FWNA 1PIWA 4L4UA 3FIUA 4ANFA 5IXYA 2PT9A 4X5OA 4EO9A 1QLHA 3EBPA 2OO5A 3K2BA 1K7CA 2PWBA 2GKOA 4MR8A 2R751 3EYWA 4UNIA 2HQ1A 1W25A 4TV8A 4LCBA 4H1UA 1J0AA 3O7MA 4PG4A 4RTSA 1BEZA 4PR3A 1ZGHA 4ZO7A 4UPEA 3INYA 1VXOA 3UEOA 2BCJQ 1XHLA 2JBHA 1X19A 3E9MA 2NIPA 3GWZA 3H9QA 4MUEA 1SBYA 1DO2A 4PE5B 1IN7A 4FFVA 2XE4A 3A11A 4MGIR 4MUGA 4RF3A 4CM8B 3Q8LA 5E2AA 5ENDA 1A9PA 1E3LA 3VO9A 3VJKA 4KVFA 3WNBA 2Z3WA 4D4JA 5C51B 4TS1A 1QCYA 3KKPA 1XXHB 2CB0A 5IWCA 1GAEO 4K03A 1U0OC 1R88A 4QPDA 4Z1MD 1EXMA 5EGSA 1LNZA 6REQA 1GZSA 3LHDA 4HLNA 4U7WA 3GK3A 5DGHA 4W6QA 2CY0A 1DJNA 5LPNA 4EPVA 4DIMA 1FPMA 1STOA 2HI0A 4ZVVA 1ULTA 1B93A 2ZRJA 3BL8A 3PNLA 4FJ1A 4IG4A 4F38A 4DIKA 2GERA 1T35A 1XRQA 2VIIA 4D2IA 3NVKI 3DCYA 3NHUA 3AJRA 3ASUA 2XUPA 5FI5A 3ENWA 6YASA 4DN6A 1IB6A 2NZYA 3O1JC 1Y48E 3OO1A 1OFVA 2AI2A 2WIAA 1RP7A 3LGSA 4K1XA 3X2SA 4YUYA 3L3BA 2DOKA 4DA6A 5JNVA 4IFBA 5IJ9A 3BN3A 4QPNA 1X2EA 1R8JA 1KXZA 2O7NA 1YQDA 1TK3A 4KRGA 2WVAA 4TRMA 2JI4A 1KK0A 4R9NA 2BPOA 1DTWA 5DK4A 5GY7A 2EC5A 3TJRA 1KI7A 3G2OA 1NGSA 2HK9A 5K3FA 3W6PA 3ZI7A 4EB6A 3U0BA 4KI7A 3ZXXA 3OQPA 4UASA 3LCJA 3P4UA 4OATA 2GKGA 5GOZA 5HA5A 2UU9B 1KY4A 1MKYA 1H5QA 2RONA 3ZHOA 5KO2A 4AJJA 1JJFA 3K73O 2I7TA 1VJ5A 4IQ0A 5JVDB 3A3NA 2JFVA 4RVSA 4TTIA 5B3JC 1FXWA 4RDXA 3K70C 1QUFA 3DUFB 3IRUA 3CR7A 1ZLXA 4OHKA 4BZWA 4JP1A 3MUEA 3F71A 4JT9A 4UD2A 3WYDA 2VTDA 1C1YA 4Y98A 5LYYA 1NVKA 4GU5A 3TSWA 5LQKA 1RZRA 2HO5A 2VOEA 1Z38A 3N2IA 4UTVA 1GCUA 2CZCA 3O91A 2IIPA 3TG2A 2YVUA 3IPCA 3SHTA 1BX3A 2AMFA 5C5EA 4Z4FA 2GTPA 5DNCA 1ZUHA 3IP6A 1GRCA 2PKYX 4II7A 3DOEA 4NAUA 1G5TA 2P9HA 1BMQA 3NAGA 3L8CA 2NTVA 1BCRB 4MINA 4OQQA 1UIMA 2HF8A 2MR5A 5ADVA 3O8DA 3F0TA 1UM9A 1HNZB 3KQVA 1Y1QA 3TPZA 1G63A 1TRKA 3BPSA 4X9XA 4CXMA 3LZCA 3TXXA 3LT1A 5IH7A 2B7LA 1KJIA 4ILEA 3LA6A 4NZPA 5HF5A 4BFYA 5F7OA 1SBHA 4DRXA 1JSZA 2XUGA 1P74A 1KFKB 1UJ4A 2B4KA 1K7EB 5IWAB 1MT3A 1HQDA 1V0JA 1Z5PA 3L0ZA 3A70A 2FRVA 3LUPA 4HH0A 4P4TA 1M8PA 4XPIB 4LS3A 1W44A 2ID7A 4Y2RA 3HLTA 1O6GA 1PLKA 4LSGA 2VL7A 5PGMA 2VQDA 3SC2B 5EJ5A 1Q0TA 1K8RA 1W1WA 1VJRA 3B85A 1SCJA 5KZMB 1SCDA 2VJPA 4EFLA 4OFXA 2H4XA 4ESHA 2ZIZA 1PJZA 3C3DA 2HBZA 1AA9A 1OI2A 2IU4A 1VKJA 3I4CA 1ZCJA 1O89A 1XZIA 1AC5A 2IIQA 2C78A 2Y71A 4KQEA 3SHFA 4MDEA 2SBTA 2R6R1 1T9HA 2WHRA 5GPBA 1EM8B 1LLQA 1FOEB 2YN2A 3I37X 3LM8A 4OGFA 4OP2A 5KB3A 5LZ8A 2VTBB 4AI6A 4QFMA 3O03A 1VG0B 5BORA 1NPTO 3ZDYB 1CDOA 5KNCH 3FOWA 2QW1A 2HNKA 2FHSA 3FHOA 5KC9A 4MDFA 4BNFA 1QO0A 3FOAA 3GFPA 1DL5A 3FI9A 3RIYA 2BFPA 2DTDA 4U7DA 1K88A 4DAOA 2NVOA 4NJOA 3JCZA 3INNA 1E2UA 2P3QA 4LTMA 4MI3A 4EENA 5DN9A 5EXDA 1H0SA 2X1LA 3T0FA 4MA4A 4UAUA 4CGZA 2P4SA 3JD0A 2Q5OA 4MP3A 2RAUA 3BMXA 2O52A 1D04A 4BMOB 3NBKA 1DBSA 1PR4A 4XDGA 4YRPA 3ORHA 5FWDA 4D80A 5JNRA 5GJBA 2WU4A 4QATA 4ZTBA 4AL4A 4EMBA 4XWKA 3FRHA 1JEEA 1U7HA 2QT0A 3FMFA 1ODTC 1YAHA 5KSYA 2NP7A 3EZLA 4ENVA 3NIBA 5EHGA 3RVPA 1U9IC 2IZ7A 2DH6A 2Q8PA 4MV8A 3STUA 4H0FA 4HEA6 3AYZB 1I01A 2DKFA 1GQYA 1MRSA 3RWMB 4YAIA 1NLMA 2XBUA 3OE7D 3ZTWA 2G9UA 3T3OA 3L8MA 1GL7A 1OF1A 5JZSA 4JX8A 1SOAA 1BDJA 1X8LA 2Y6UA 3CIOA 1TT5B 2EQBA 4H15A 4EBFA 4D9MA 1T8YA 1NVAA 1OREA 2Z1NA 2PQ6A 4QVKA 2BISA 2CDAA 3FOBA 5KPDA 3TW4A 1MAHA 4W82A 1Q77A 2H85A 2V7VA 4CTMA 4MUKA 4QUEA 1PO7A 3OCZA 1XQXA 5CB4A 2B6NA 1IMJA 1SXJC 3AR2A 4G5QA 4NE9A 4ZCTA 2GBLC 4F84A 5JAMA 3ELBA 2OHIA 4S3MA 1AQJA 5HOEA 3HA5A 3L1VA 2V0GA 2QSUA 2Q2NA 3NT4A 5TJHA 3W5HA 2AF3C 3H8JA 4W9RA 3WHKA 5JH7F 3PI7A 2JD0A 3MA0A 3SQNA 4CQLA 4IQFA 1B8OA 1BGWA 1XEWX 3JTMA 4CFZA 1E3MA 3V7UA 4AQDA 1MW8X 2J6CA 3IS3A 3SP1A 4IIVA 3ZZMA 2ZBVA 3RWBA 1LPBB 5HKOA 3P9YA 1X9HA 3C8HA 1AUOA 3RCBA 3TLKA 3IDZA 3UV6A 4R71A 4QGAA 4GOND 4MKXA 1V6AA 1LTHR 4XPZA 3WTCA 1PYOA 1VA4A 3JD4A 1N8NA 1DIOB 2CXNA 2PH1A 3BIFA 1DAIA 2H9AA 3ZWPA 1ZD3A 4O4IA 2QD4A 2V6MA 1C3OA 2ZVPX 3QPVA 4MCAA 5KYYA 1FL9A 1HTWA 2X86A 3DV0B 3IBTA 2XAUA 3KQMA 4KRXA 4KXLA 4RLFA 5FBZA 4NBWA 2A1TR 4G8JA 4N5IX 4Q93A 3LXMA 1U7DA 5THXA 4MHOA 3RJZA 5KSOA 3RSZA 3TI9A 4EHNA 5BPFA 4U2CA 3ZKWB 4QU5A 3JVDA 3NBFA 3OBIA 2BFCB 4B79A 1FZQA 3FPBA 1MG0A 3OX1A 4H6VA 3H99A 3MIZA 1YD7A 2ISSD 3M6XA 3AKZA 3H2KA 1W0KD 3BREA 5KWIA 1UDXA 1FYXA 2XZDA 3CO5A 1U0EA 3HP1A 1QYIA 2J3EA 1N9GB 1SWVA 2VDVE 2WNHA 3I76A 3QU2A 1KI4A 4IUCS 2ZCVA 4LHVA 5IVIA 2C42A 3O2SB 1KE2A 421PA 2BDUA 2Y93A 4CF4A 1WR8A 3K1ZA 4K9MA 1P31A 4CM9D 2P68A 2ZB7A 1KDYA 1D3AA 2I2WA 3DBIA 4PWZA 3CVWA 2EZ9A 3ZIAA 2JAPA 3VR5D 1WDLA 5I4KA 4NCBA 2GQ0A 2VNIA 5DIZA 3DL2A 4TGLA 4DJFC 1T5TA 4M98A 1C0PA 1W8IA 3PA6A 2MSDB 4AX4A 4Z4CA 3HYTA 1JQEA 3OCVA 3V1UA 4OXXA 5ER9A 4UNNA 5KDDA 2MSNA 3FFWA 4P5PA 2C4KA 4IL5A 4ZHQA 1LGYA 3TKAA 4WEQA 1M2WA 1PSDA 2B21A 2XYRA 3C3KA 3I8OA 4JHXA 5HFAA 1RZ3A 2QGFA 4FYJA 4G0QA 4PGAA 5A71A 1FU7A 1VM6A 4Q02A 4TZ0A 3U6BA 2OAEA 4TRJA 3WG9A 3I4LA 3CEJA 4XWGA 1J56A 3R7BA 1FFXA 1CJCA 2LVBA 3QEMA 5FPPA 1WB5A 3AIOA 2G9VA 3AFNA 5J4YA 4OMDA 3P9IA 1SVUA 4PQRA 1RJDA 2EBFX 2G71A 3GZNA 3MQFA 4BJ1A 3J80A 1PNVA 2JIQA 3BT7A 1P0CA 1M76A 1M73E 2WWRA 4B33A 5REQB 1MB0A 3RV3A 1GTG1 2F67A 4C78A 4DWOA 5A0TA 3L84A 5D6OA 1DRJA 2PX8A 3OZRA 5HF6A 2OVBA 4NABA 3Q0IA 4K9LA 4UXHA 1L8XA 1UPUA 2VBGA 4R8MA 5DMHA 5L3RA 1Z16A 3V2IA 4KXFB 4W1PA 3GBPA 1II8B 2FCRA 5LZ4A 1SOVA 3L8EA 3WWCA 6GPBA 5IAAA 1YDFA 2A5YB 1IQ0A 1O9GA 3IRVA 3CX4A 2ONJA 1E8NA 3LH5A 2Q5JA 1OX4A 1MRZA 2HRZA 2X8AA 3KV3O 4G9EA 3RVRA 1N2GA 4DYHA 5B2EA 5F9MA 2UZ4A 1I7DA 5L95A 4JGBA 1XU4A 2GA8A 2JASA 3R3XA 3H2SA 3TE6A 4EH1A 4OX9B 1Y4UA 1CB7A 1QAQA 1JNYA 3P0FA 1XD8A 4ZOCA 5ALRA 5KYWA 1DSSG 1E1QD 1QOQB 4RSGA 4EMUA 1EK6A 3A6FA 5DLYA 4QM6A 2FKNA 4IS2A 2YRFA 1QHSA 1M33A 1VB5A 5FUWA 4KO1S 3AONB 4ZQIA 1QO7A 2BFBA 2VT6A 1Y33E 3DOUA 1U28C 3P2IA 4GW3A 5CH5A 1E96A 2Y4OA 2VNAA 1GA6A 5K3DA 2P35A 2B4YA 2YXEA 4Q4LA 4ZGWA 2G70A 4GGPA 1DOHA 1QVRA 1AH2A 5BVGB 2FEAA 3LTNC 2YZ2A 4ZI2A 3B12A 4N3AA 4XW2A 3PC8A 4X00A 1E9CA 4B5LA 2M6LA 5EEGA 4O8CA 5JV5A 3L4JA 4YCCA 2BM0A 2AZMA 1KI9A 4OH1A 4AM8A 3WKCA 3FIJA 2W70A 2C7OA 5AJYA 2EYQA 4NPCA 2GEBA 3Q7TA 5FTWA 1OKKA 3M7IA 4LV5B 3F74A 4NHEA 4FTWA 1EK2A 1PG5A 3AX6A 4RDHA 1TD9A 2M2IA 3G5UA 1UDAA 3OJOA 5CH3A 1X7GA 3HN6A 4I6JA 4I36A 1ZI9A 4TVKA 3KWFA 1W4AA 2VWPA 4WHMA 5C18A 2BGIA 2JF0A 4HS4A 4KMSA 4MWZA 5H3HA 5BSUA 3OO0A 2C4MA 2ZS7A 4O4IF 1VJDA 5F5XA 1JE1A 1DV1A 1ZQ1A 4GD3Q 1XMJA 4QNNA 1Z8DA 1K8QA 1XR3A 2XE6A 5FPQA 4XJTA 4INOA 4YCBA 1A5BB 2VSQA 4JGGA 4MJXA 4BLOA 3EUWA 4C7KA 2GM4A 4HYEA 2ZDHA 4J03A 4JBLA 4M46A 4Y0AA 1P44A 4RNDB 1D9ZA 4BTVA 3F4BA 2CNOA 4TT8A 3OQNA 5FUBA 4RH0A 2O8CB 4TTVA 2BSQA 1Z5ZA 2FQYA 2V7GA 4N5HX 2Z8ZA 2QN9A 3MJ4A 4C0QC 4FD2A 2R6AA 4JUAA 1VZ2A 4NG5A 4B46A 3JSAA 4HWTA 3ZV3A 2VSNA 3BIOA 5CNIA 5AW6A 2J6IA 5IM5A 4ARIA 3SHOA 1QHYA 4JDUA 4YV2A 5JE8A 3ZWCA 2IODA 4LXGA 3PLAE 3IVMA 4HD8A 5F12A 5TR9A 3IP7A 5IKXA 2XXJA 2EFEB 3DFFA 1ODSA 4EJSC 2RGYA 5F35A 2ZBFA 3G17A 2JFUA 3N70A 1J06A 2SICE 5K0TA 1SU6A 3WGTA 1QU3A 3A27A 2GMWA 3Q10A 3KJEA 1E6MA 1MB2A 2YQ4A 3K1AB 4RORA 1WXEA 1ZK2A 2GHIA 2YN4A 3IFSA 3IOCA 1RC0A 1B6SA 3DNFA 5LUBA 2H29A 4UD6A 3VAZA 3MWDB 3KXIA 2P2YA 1JQ3A 4UEOA 1J5XA 4GMFA 3RC3A 4I5EA 4AECA 4DWWA 4HRAA 2UVPA 3ISVA 4S1TA 3OZDA 3HXMA 4CIWA 3OT1B 4FGUA 1X6VA 2O3TA 3NAZA 1DOZA 5E9JA 3C6BA 3K30A 2AJCA 1YB2A 1WTCA 2P9FA 3EXIA 1E3TA 3UT6A 1ZU5A 2ZIAA 2HRCA 1U99A 3DH0A 2XWJI 4UDNA 3SZGA 1D2NA 1ZNZA 4NYJQ 4P86A 3BZBA 1NJGA 5SV2A 4J4TA 5FWYB 3ZI4A 3HVRA 1R4NB 3IQIX 2FLVA 1AHHA 1G21E 3D3WA 1C2YA 5C1BA 1I2CA 2AZTA 4IDAA 3RRZA 4X62B 4YO7A 4BGIA 3ICPA 5KVSA 4P7KA 1FYWA 1X1RA 2GDZA 5A3VA 5TS3A 4LQCA 1P9RA 2AOWA 4US1R 2GS9A 2X14A 1GVNB 1XG5A 3H42B 4JT8A 3Q3IA 4UEKA 1PVOA 4KFRA 4R05A 4C2TA 3Q2IA 1JHVA 3QWBA 4PG5A 5EGNA 5TGZA 1K27A 4QDJA 4P08A 5ERXA 2NT4A 2WJYA 4RZHA 1DWQA 2HF7A 1H8EA 5GAJA 4YRDA 4ZD6A 4AMZA 2TMDA 4HDRB 8ATCA 1WHTB 4R83A 3S1AA 1N2CA 3IV9A 5TV2A 3DPSA 5HOQA 2YZ7A 2W98A 4MKRA 1EWVA 4PV7A 3RABA 3ONDA 4L6CA 1UPXA 3AVQA 4TKUA 2ZM5A 3K6SA 2J7PA 1NPDA 3ZH2A 1QLWA 4C7VA 1Q21A 1W94A 3QITA 1F9AA 1JXMA 5CVEA 2DAPA 3WDKA 4X60A 2DC1A 4PU0A 5EJ8A 3JAWA 4E2XA 4YRZA 3T1TA 1LTKA 4N48A 4D3YA 4H18A 3O8QB 4X1OA 4FLEA 5E1MA 1BA3A 1QGZA 3V42A 3QY9A 3KEMA 3GLIE 1PTJC 3CZCA 5AW5A 2QVCA 2F3PA 3L6DA 4LZZA 2RH5A 1WUYA 2HO4A 1E3EA 2OCDA 4D43A 4UTOA 2SHKA 4LVCA 4I9HA 4U9HS 1THTA 1A7JA 4PPQA 4IH4A 3STXA 2Q9AA 3U1VA 4UHFA 1F5SA 1ONPA 1YKSA 2WQZA 3TW0A 1L4YA 3NIDB 2AFIA 5FWNA 2YFKA 5MDHA 5MGBA 2A14A 3SLGA 2ZRAA 1HE2A 3K09C 4MVJA 2LBPA 1GPBA 2C8JA 1VI2A 3AI3A 2YDXA 2G1AA 2SCUA 3AR7A 1E3WA 3NORA 2O07A 1ORWA 3FSRA 3RDPA 3EHDA 2RGGA 3CF0A 3KE8A 3OM1A 3WJ1A 3CWCA 4HC4A 2LKCA 1WPXA 3O8OB 3QNUA 2IZOA 2AMJA 3HS3A 5DYIA 5EZSA 4Z2AA 3V1NA 1BRMA 1MQ9A 7ABPA 2P5TB 2V65A 4QO7A 1BOFA 3M4ZA 3OFKA 4JUFA 4NV0A 2C97A 3EEYA 2NT3A 4KKXB 1MF7A 3JD1A 3PYXA 3BGWA 3N05A 2RAVA 4YMIA 5JCOA 1MZVA 3ETEA 1U5BB 3L18A 3RSGA 1Q3TA 3DDHA 2XIJA 3IHWA 2VTVA 3O4JA 4P4SA 4A10A 4CCYB 1E1RA 4NQRA 3VU9A 1Y34E 1N77A 3LGXA 3OLWA 2WKRA 1MG5A 3O84A 3A8TA 4J0DA 4X63A 4F4DA 3B6MA 2C7QA 5E4YA 5JXWA 2E48A 2Z57A 1JV2B 3U4DA 3UCXA 2ET6A 1PJTA 1AV6A 2QAGA 2H54A 2XUKA 2EIHA 3VISA 1NXOA 2VSYA 2NU9A 1PL7A 2RGDA 4Y6PA 2G9ZA 1H9CA 5C0OE 2O1EA 1A4UA 1IJEA 4NZYA 4R41A 5A6VA 1M5RA 5BSVA 3YASA 3QFRA 3HTXA 4B0PA 3IHLA 1RXUA 2CB9A 2IYEA 4RAQA 5J23A 1KTVA 3HK2A 3OPQA 3BH6A 2RBKA 3HJNA 1YJQA 2Z4SA 3PGMA 4YASA 4E7PA 3KUXA 3REGA 3LCRA 1YQQA 4IKEA 3GFSA 4O4LA 4B4WA 1MOZA 1J0XO 1Z4KA 2BGGA 3PQFA 4G81A 2KSQA 1BFUA 3TW6A 4M36A 4RL6A 5B4VA 2NG1A 3DFKA 4AJEA 1ZN7A 3BXPA 3NNNA 3MG9A 1WL8A 3O8NA 3O93A 2IYTA 5EJIA 2PYZA 2QT9A 4M60A 4JIMA 2O6HA 1T2DA 4U7PB 1F0YA 5AI8A 4HNUA 5CVTA 2VTKA 5GZ1A 1IOVA 4ARSA 4MV1A 3CPHA 1YRLA 3FKJA 2YX1A 4QTTB 1AKEA 3FFXA 3E3MA 3V34A 5B3KA 3VDRA 1P8AA 4QYIA 3RTGA 3WLQA 5CD9A 4DLWA 1NUHA 1ZINA 1J0EA 5I4BA 4NCAA 4KU4A 2IS6A 3PGA1 5H3CA 3BMNB 1IL0A 4L74A 3LLUA 4OQLA 1V4VA 3OTGA 1QFMA 4Q05A 4Y2XA 4BBPA 4EG3A 4HQFA 3MINA 4RK7A 5FWYA 4FFLA 5BYBA 2ZUUA 3LO5A 3WP1B 5DCYA 3RF6A 1Z37A 3C1AA 4BO3A 5C35A 1OZAA 4H4CA 3KSUA 5I5GA 4XUDA 1REQA 1GXSA 1W46A 4AO7A 3COVA 3CRZA 3GMSA 4I6GA 4YAUA 1DC6A 2BR4A 2J3IA 2DBVO 4X1KA 5T41A 4BLWA 4FFWA 4QICA 1RADA 2WJ3A 3I0ZA 4ALIA 3CT6A 1UH5A 3O8CA 3CA8A 3ZDEA 4KXNA 3SQWA 1GNQA 2GB4A 1KI3A 2W6IA 3P5BA 3JYPA 1D6JA 3JYOA 2QGZA 5IDXA 2QWXA 3RU2A 2L42A 4JVLA 2AOXA 5F2EA 2IPOA 4WFJA 3DVRX 3BERA 1UXHA 2DM6A 4JB2A 5K0CA 5IUKC 1BN7A 1ZMTA 4YDQA 1ZVQA 4OREX 3C5VA 2PUTA 3F5SA 4Y2GA 1PKEA 3DBVO 5JCXA 1P5ZB 4IIJA 1R12A 2R0QC 1A71A 2YV3A 3ZNNA 1C9MA 1UMDA 2D59A 2JLZA 4KAXA 4PY2A 2ZSUA 3BJRA 1UBNA 1CUDA 2F9LA 4M55A 3V7YA 2W2XA 3VR3A 4QXOA 2JFQA 5AJWA 2QRKA 1XA4A 3OIDA 4JUDX 4F7DA 1J5EB 2BFNA 1IVYA 1P1RA 2CLSA 2Z2JA 3ASZA 2WUVA 1VLMA 1J8VA 3NHLA 3L77A 3QTLA 3D3QA 1BN6A 1LI4A 4BN5A 4RTJA 4D26A 3TF5A 2CXXA 2R4QA 4OHZA 1G5PA 4RSHA 3ZX5A 1UCFA 1KMIY 2XNDD 3GX1A 3ELDA 5C8ZA 1A96A 1A8UA 4RF5A 4C07A 4JI5B 4G67A 3KQSA 4K6KA 4RM3A 1YS9A 1LTQA 4RHUA 1UINA 3G0HA 5T4HA 1BD3A 3RUDA 2ONYA 3KOXA 5DOZA 3KBOA 4D1YA 1EFVA 4PCLA 4XRRA 3GD7A 4J1TC 4LCEA 4TWZA 2GM3A 4FGLA 1IQRA 2QI9C 3U4IA 3UAWA 3TAHA 2HMWA 5HIJA 2WK1A 3Q7SA 1AK1A 4GWGA 5TNXA 1V1MA 4ERXA 1PV2A 1ZHFA 4FHDA 5DHRA 4ARZB 3DLBA 1GLVA 1OVGA 1Y9EA 3B38A 4ZEWA 3V46A 3D6HA 8ABPA 3G0BA 1WB4A 5TMBA 2FPXA 4D8WA 3NUGA 4TN5A 2V7BA 1UKAA 2CDBA 2PRKA 1CF2O 2VDMB 4N41A 2G6BA 2FPGA 2PDAA 3LIPA 1T5SA 3ABIA 4JJFA 5EC8A 4OIFA 1P2TA 4JIGA 4ID9A 5EQFA 1RTKA 1XZHA 2OB2A 4MQEA 4E5DA 1Z7BA 2X13A 3CURA 2XRZA 3NNSA 2Z8YA 1RLTA 3O8LA 1R0KA 5G1OA 3RKUA 2PGDA 1DCMA 5EIWA 3G88A 1WS6A 2F3TA 5CIWA 1KK3A 4YHHB 3H1TA 5K9ZA 2RKWA 3BRCA 5IBCA 3C2QA 5TQVA 3EDCA 1D1QA 2XJ9A 4MIEA 3I2FA 1V45E 1L7RA 3KVVA 1Q6YA 3COJA 1W581 2CXQA 4O5AA 2AC2A 3WYCA 3WOHA 1GAJA 3B1KA 5IKMA 1KP9A 4PZYA 4TTRA 2FGJA 5BXYA 4FFNA 1VCIA 1DIBA 1E18A 2H7YA 2WJJA 4DLVA 1M83A 1MC8A 2IA5A 1XEAA 1A8HA 3AEYA 3V9PA 4H4DA 5JCJD 1Q1NA 1ODFA 8GPBA 1E2LA 2FF7A 2I2CA 3N6RA 5EKUA 2ID8A 5J9FA 4O4JB 3ILHA 3AT1A 1K8XB 4QD3A 2W4MA 2ZGVA 2BEJA 2BGUA 4YXWD 2VNHA 4DIUA 5K99A 3S8EA 1WBDA 1COWD 3VOSA 2Q99A 1Z22A 4NCIA 1FPQA 4H3VA 3QLVA 4MRMB 1OGJA 4EITA 1NYLA 1SK8A 2IS1A 1H23A 4GDMA 1T9GS 1H2YA 4L16A 4BEJA 3ZOKA 3BXZA 1ZM9A 4DDUA 4P4GA 3QE4A 3OPYB 1L4EA 3BD7A 3KTAA 2NO0A 1NMEA 1NVFA 1M1YA 1VHTA 2SKDA 4GBJA 3E48A 2BHTA 4RIHA 2A1UA 3QU9A 2A86A 4HJRA 4AF6A 4YV0A 2IOHA 3BK2A 2R1ZA 3B6IA 2O3SA 5EY5B 3W1VA 5L8VA 5D51S 4MYDA 3L0PA 1P9OA 1WPRA 3Q3CA 4CLDA 2QYSA 4FD3A 4BFLA 5LDDC 1P0PA 2NTEA 2WU0A 5HZKA 3E22B 4PAGA 4DUPA 3SS9X 3W4IA 2VK1A 3ETNA 2FE4A 3WFZA 2Z3VA 3GG9A 3IEPA 3R0XA 1XVTA 4TL7A 4E94A 1KKMA 5AFSA 2Y4NA 1FJ2A 2ZE6A 2ZTUA 4BJ6A 5IK2A 4ZYYA 3QFCA 4MVWA 4JUIA 3GEHA 1DXYA 3ZW7A 2X4DA 2YXDA 1QZXA 3JQAB 1EFDN 1QE0A 4JLOA 1SXJB 3OZXA 3NC4A 2Q50A 4IYJA 1ECJA 2AG5A 1MAWA 2PZGA 1UOPA 5I9TA 1RI5A 4LZNA 4S24A 4E33A 5ULLA 2JFZA 3C7DB 1K7YA 4XCQA 3RYHA 4DC0A 2BE7A 2DCUA 2OWDA 5A7FA 4EGCB 5ESRA 5HBGA 4ND2A 1GLNA 1S02A 3D6UA 5UKDA 1T3ZA 4FFRA 1HDZA 5JTUA 2JLYA 1OWNA 4FKMA 3DYIA 1TCVA 4TWJA 4EFDA 5A5GA 5EJ2A 1IJBA 4JZKA 3EPLA 1VA5A 1MC1A 1WCIA 1RYMA 1ZL0A 2P4UA 4IO1A 4JYCA 4P3NA 4N0MA 5CX1B 1B0UA 2W90A 2DEUA 1Y63A 5AJVB 3RFUA 2XSZA 3OU2A 1FFWA 2O57A 3GDFA 4X85A 1P5RA 3BWYA 5DYYA 5G53C 4PYIA 1IXKA 2JI6A 1J8FA 5KQLA 3DD5A 1SKYE 5KTKA 1ZCFA 2BV3A 4XKJA 1P2SA 4WY2A 1DKUA 2IYQA 2VDKB 3GGCA 3BWVA 5GGYA 4HRVA 1S7GA 1PQYA 3E2PA 3FDIA 1K5DA 3M1YA 3VYTB 1NW9B 5JD5A 4PQYA 3BTSA 1Z25A 2QNBA 4URFA 3ZWOA 4DV4B 3V7NA 2QY6A 1FU4A 4H7DA 3ZY3A 2IXAA 4L5YA 2QTBA 2PZEA 2ZJ4A 3UK7A 1AQNA 1TTTA 4QE3A 2VN8A 4QPCA 2YWBA 4NY1A 2ZZNA 3EZGA 3PNPA 4JT2A 3RG8A 1I32A 1QB7A 3BXHA 5AT1A 1I6KA 3OCJA 4NMMA 4V1CB 1C0EA 4MW0A 7REQB 2UUBB 4EG6A 1DAOA 1C3LA 2YHAA 1OBVA 1U7OA 4FLFA 4D9IA 4QWWA 2OXIA 3KUCA 4K1LA 3IEXA 1G21B 4OMCA 1ISSA 4BVKA 5KQRA 3ZD6A 2P65A 1X70A 3LUKA 1PFKA 4ETMA 2MDTA 1PK7A 1MGOA 4B6SA 2OR3A 4KQHA 1V11A 3GOQA 2NAPA 1FVHA 3DCNA 4HS9A 4IDHA 4PC2A 3ON5A 1KAEA 4D9GA 1D7AA 2X2PA 4I1PA 2RHJA 4V3BA 1IY2A 2GZDA 2Y3IA 1Q50A 3LBAA 1EJ0A 2E87A 4RUKA 3VH2A 7MDHA 3FTFA 4MULA 4F2WA 3QYJA 2IPXA 3QX3A 1DQSA 3D6VA 4X94A 2I76A 3C4VA 3OCYA 4F5WA 5AJZA 3ZWQA 2A9PA 821PA 4B9EA 5TDHA 2YOHA 3IO5A 2E0IA 1R5OA 4RCVA 4Z53A 5E6SA 3UUFA 4PZAA 2JIDA 1JDNA 1YZ3A 2GEFA 4BY9E 3KB1A 2J9XB 2O3JA 3GUZA 3RSOA 2C54A 1P6XA 3A1SA 1MNQA 4BO6A 3D2CA 4Y1RA 4WUVA 3UYKA 4EY8A 2C2BA 4FR0A 4EWLA 5FO0A 2ZUSA 3C7KA 3SKXA 3DEJA 3ZS9A 3IKTA 2PUCA 3N2EA 5JXGA 5EUBA 1CUWA 4AW9A 1DQZA 1QQTA 3EXHA 4DANA 1AKTA 1MJGA 4FMCB 3UWOA 4PG7A 1P19A 1MO3A 2GF0A 2KHZA 1EVLA 2VJMB 2X19A 3GVPA 3K7EA 3EXEB 2XEXA 4LF9B 1DE0A 2PZLA 4JFRA 3UAVA 2FXIA 2YL2A 4OM7A 1A7KA 5LQMA 4XYLA 2Q5CA 2R5FA 2ZJ3A 4WFKA 1XDBA 4G8CA 3QG5A 4XB6B 2FN8A 3E1SA 3OU6A 3L1JA 2JGDB 2UZIR 5IAEA 4NECA 1FXWF 3MJSA 3N2LA 4MI9A 3SVTA 4LJ9A 2GR9A 3CZMA 4LKOA 2JLRA 2CK3D 4DIBA 4UZFA 1HEUA 3SYNA 1G0NA 2VG8A 2VJLA 1ZFNA 2QZJA 4U2DA 4BL5A 2DCMA 3SM9A 2PH5A 1VQ1A 5D6NA 2E89A 2BFDB 3DAHA 1WZUA 1UXIA 4B2PA 3NJRA 2ZVJA 3F47A 5LP6F 4X3PA 3ZE8A 5I45A 4HMQA 3PZRA 2PT7A 4X61A 2GBCA 2H1RA 1U9JA 2QTFA 4HJXA 3UUGA 4EPRA 3QMMA 4EW1A 1XALA 1GT6A 5KWVA 1CIJA 4QUJA 1I2BA 2LW7A 2DTEA 2ZRGA 5EIOA 2O0MA 1DKPA 1D2CA 3OOYA 3P2KA 4LDJA 3H5LA 4XIIA 5CLGA 3FDFA 1G16A 1NDQA 5BOVA 4CMEC 2B20A 3IR7A 3W6ZA 1BCSB 2V96A 2Z9CA 3D4IA 4WX2B 5K8VA 1YONA 2XB2A 1NVXQ 5KVVA 3H8WA 1SA0A 4NV3A 2ZSAA 2PK3A 3AEUB 4RK0A 4OAOA 2DBQA 4F3KA 4AJ1A 3A06A 2WZCA 1IY9A 4IM7A 3KT3A 3P9XA 2K6GA 4B31A 4KHZA 3KQTA 4KQXA 1PNTA 4IJ6A 2WJZB 4GF5A 4MLZA 2XLCA 4WW0A 3ZVLA 1G8MA 3AIMA 2Y1WA 4TWIA 1I4LD 2QJTA 1XBTA 3M9LA 3OQ1A 4W1QA 3AUXA 4D9EA 1XHEA 5AVWA 5U9CA 4IWXA 3CUVA 1GPNA 1JSRA 2CKMA 3DYVA 3UOAB 3ADCA 3BICA 2XCSB 1RXWA 4L5CA 4Z4IA 4AXBA 2C99A 5J3JA 3DTYA 4HX5A 4L0CA 5TEVA 1X14A 3J81A 1LQ2A 2DR3A 4HZIA 4BBZA 2AOUA 3CONA 1L1FA 3U2QA 2C94A 4FMPA 2DBRA 1DG3A 3COSA 2HTEA 4HZUA 4IHKA 4BN0A 2IY8A 4BX0A 5HKKD 1ZHHA 5KU1A 4JXXA 3AY3A 4INZA 2QAGC 4WXRA 4AUMA 5KQPA 3K5PA 2E5LB 4YJGB 2G67A 1Z82A 4LJ7A 3RVKA 4O4JF 1GRRA 1KRWA 2GWHA 3FPFA 1TCUA 4P58A 3DFMA 5D5PA 4OGWA 4R1UA 1JFFB 1WMBA 2H7VA 4Y6SA 3OQMA 3AXSA 3E5MA 2UXDB 1ULZA 2W93A 1BO6A 5LOVB 3M6FA 3FE2A 3A37A 1UK6A 4FBGA 4I46A 1YQWA 4AWAA 3ZGZA 4M1KA 1F0PA 2YH2A 3M81A 4J0CA 1TCCA 2XT6A 1B4DA 3EN0A 4U2EA 5A4AA 4NIMA 2QTMA 2DU8A 1T36B 3UC5A 5CB4B 5KKCA 2I8LA 4JSYA 1SRRA 5FL3A 2G5PA 5G4KA 1KMCA 1Z9BA 2VDPB 5K1ZA 2JAWA 4L3OA 5KQMA 5BN3A 2ORVA 5CPBA 5CXSA 4URHA 5A05A 4GZMA 5HZHA 1XZ8A 2W6JA 1JIJA 1I13A 3H84A 1QGAA 2VSXA 4C7BA 5BXQC 1C3VA 3BWCA 2YN0A 4B3IA 4ND3A 1TKBA 5F1OA 5C4MA 1XQWA 1RT9A 3GT4A 3N0XA 1Z06A 2JI8A 5LL6P 4PFJA 1J7JA 4KR6A 1SWWA 5E6RA 3DCIA 3X1ZA 4DE5A 4WLFA 3WGQA 4WVLA 1U04A 3LA8A 4PTYA 2D1FA 3E9EA 2V74B 3ZDRA 2AD5A 3EIQA 5HQTA 2PYDA 4BEWA 5I7SA 3J7AC 1ONNA 3RU3A 5ILOA 4XSHA 3UHOA 3KYCB 3MMPA 4HXGA 1EX7A 3UGKA 3KDPA 4AN4A 2YV5A 3TBKA 4JXJA 1Z7GA 2KQUA 4G0YA 1PTJA 2DUWA 4TLAA 3SBOA 1Y1PA 2PUJA 3MMXA 5F5NA 5T4BA 4HGPA 3F5DA 3UC9A 3IEMA 4W8OA 2FR0A 3GFGA 5CXUA 1S2IA 4NKRA 2AF4C 3VPGA 3HKDA 5G1NA 4C0JA 2ZM6B 5GOTA 3CVYA 3IQXA 2JGKA 3NOQA 3JX9A 3QXHA 2YMMA 3X1DA 1ISRA 2HBYA 4XWWA 2JIPA 3RAPR 2PNJA 4KFTA 4MQ5A 4G0VA 1CW2B 4TQ9A 5DMXA 2OO5C 3TLZA 3HXQA 5K4HA 3TMYA 5BUSA 1XKQA 3TFWA 4WBNB 1A50B 1FDUA 3RYIB 3TK1A 1F1BA 1N5RA 4ZT4A 1KI6B 3OFJA 4FYVA 3P0HA 3GZ4A 1V5FA 2E49A 3DZBA 4JDPA 3GC6A 5ED0A 2PH7A 4KQ9A 2QVZX 5KSWB 3KQPA 2FZEA 3NVAA 4YCDA 2FPKA 4JL5A 1EFUA 3ZDFA 4AP9A 2UDPA 2XHEA 2EF0A 1FVXA 1M6WA 1AKVA 2BGJA 2KB0A 2XUQA 3FZYA 3H2BA 1IZ9A 2WAOA 5DXJA 1W4CA 1YQGA 1JJBA 1T8PA 4PWYA 1YQTA 1LC3A 2DKOA 4OXNA 2GZSA 2J1LA 1FYVA 2XUAA 3SPXA 5NULA 3OLVA 3MT0A 1OLXA 1M0EA 2ZE7A 1VE9A 5IF3A 2FFHA 1HFWA 2RH8A 1PS0A 4K26A 2NNWB 3NBQA 3R5JA 1NXQA 2OO3A 2XD4A 4KQ6A 4J2OA 3VR2A 2X9LA 1LI5A 2GF2A 4YACA 2NUPA 1E77A 1KVSA 2NZUG 3A26A 1RMQA 1WDTA 1S6YA 2FB9A 1D4OA 3DXFA 3KE9A 1M0SA 3VPAA 3MPOA 4GUDA 4L75A 1YL5A 5FPHA 4LXQA 3R7DA 4YIHA 1KEKA 1CQPA 2W8BB 1KJ8A 1NC1A 3G8BA 3NNDA 2QN7A 3LDUA 4J07A 2H4ZA 1Y7TA 2VNSA 3NDJA 1TKCA 2Q6OA 3F67A 4P31A 4DSUA 3LUAA 4R6WA 1ODLA 1U3WA 2F8MA 2XOKD 5DHFA 2FZWA 1OA1A 3B78A 4A2WA 2WQ6A 2WKPA 3PR3A 3UHFA 5DYNA 2JD2A 1LDMA 2XYVA 3NTVA 3NTOA 1ZK3A 4A0SA 1CXZA 1C4WA 1V47A 3T1OA 1HL7A 3DC7A 3K0HA 3PDWA 4XE5A 2N46A 4DWJA 4F8YA 2C2KA 1HSOA 1KC3A 3O2NA 4X6LA 3C16C 3W77A 4BRSA 4DREA 4V03A 1T4CB 3GVCA 3JVUA 1XQ6A 5FAXA 3UT5A 4OQXA 5BYAA 1IG3A 5IFLA 1Z63A 1MRNA 1C7EA 3QKUA 5A3QA 1VHWA 2OV6A 3FGOA 5EQJB 3ZVNA 3THWB 4KRYA 2PUVA 3IMEA 3TQSA 3CVOA 3D6NB 4DOMA 4HUQB 5KQSA 4G63A 3VUEA 1QRTA 1H1TA 4JL6A 2DYKA 1NBIA 4RK5A 3UGJA 1AUXA 2QD1A 3MTBA 4N39A 3WB2A 3EMVA 1E0DA 3LFHA 3MJHA 1EYZA 4WFQA 3RRBA 3ZC3A 1B8VA 2N9UA 3JY6A 4HDKB 4WBSA 3UJ9A 3LUHA 1JVBA 5I4CA 2VHEA 1TM1E 2FF5A 2I54A 3GT0A 3M3DA 1PU2A 2L69A 4ODIA 2BUBA 2ZIXB 3W0LB 2VQ6A 3PX3A 3RHZA 2QR3A 3O8BA 4UXJA 1QOPB 3GP3A 4NMHA 4BNDB 3G8DA 1UAGA 3RYCB 1EWKA 1FLNA 4PGHA 3K8YA 3UXEA 2B2XA 4KOAA 3OKPA 4WY5A 4Y0VA 2XWQA 3TZKA 3W9SA 2WTUA 4NNJA 4BTLA 5B57C 2MOKA 4AY2A 5KHAA 5DM60 8MHTA 4CMCA 1XYVA 4BWYA 5FOQA 2DTXA 4LSMA 1L5GB 3ZQJA 5FBKA 2H59A 3WMEA 2R1TB 3GGGA 2F3RA 1Z8FA 2Y8EA 4E22A 1U7PA 2WJVA 1HG1A 1T3SA 4XCVA 2CVHA 2ZI4A 3RB8A 1N2HA 4PAOA 4DT1A 2PQ0A 5IAKA 1SVMA 1B3BA 1E9AA 1N5KA 1WCWA 2XLBA 3KLPX 2BUAA 4MEAA 2IOQA 5ITSA 4M0FA 4CE6A 2Y0CA 5E7JA 3GGSA 1GUZA 2I7CA 1XJ0A 3NPAA 1V16B 5H81A 4KN9S 4TMFA 5ALOA 2Y1OA 3EVFA 3GLHB 1ZUNB 5JAIA 1C7JA 2LIPA 4WNYA 4G4IA 2I4NA 4YMLA 2Z43A 3DP7A 1QFXA 2F59A 3GI1A 2IITA 5GM1A 5SY4A 3RSCA 3REFA 1AT1A 1X9IA 3FUXA 1Z5GA 3NHWA 3NPMA 1CQIA 2R3SA 3KSMA 1MFPA 3HA3A 4JENA 5D3MA 2C84A 1F5NA 4B84A 3RBVA 3WO1A 4EUFA 2EW2A 1SHZA 3DMYA 4LHXA 3LHKA 4JLNA 3UKDA 1FQOA 1E79D 1KAMA 1FNSA 1OXTA 2I03A 2JHAA 4JOSA 4LI0A 5AP9A 3S4YA 3U1TA 5HDQA 3RTDA 4IVPA 5I9NA 3AVTA 4PPGA 4I3GA 3WQHA 2AN3A 5E9AA 2MSLA 3V2UA 3A3OA 2DPXA 4LOKA 4XVHA 3I9V6 4B3DA 2Z09A 4RVCA 4E3ZA 4F1KA 4FONA 1E4EB 2F1HA 3CRNA 2Z08A 3AR5A 1DAEA 3RVDA 5GZ3A 2Q5HA 3C7AA 2JRLA 3DXYA 3NGMA 1ZA1A 2JH9A 2X7HA 2YICA 5K01A 4WRRA 2ZYDA 5CDFA 5CBPB 4AAYA 2B98A 2YWDA 2E9SA 3A3PA 2C98A 3ZY5A 4DGQA 2W48A 2VQFB 2ZYSA 3CZRA 4ZJYA 4JI0B 3LT2A 1LF5A 1M34E 4OLAA 3ZXSA 4RANA 1HEYA 4BNIA 1ZD1A 1F14A 4B75A 4MLCA 5DEOA 1EESA 3M3PA 4JQZA 3SS7X 5F1PA 2BSAA 4WI1A 1OVMA 3N2KB 5ES3A 5EZYA 1J00A 2W22A 1WV1A 2AQHA 3FMIA 5FH9A 2YWEA 2BMJA 1T8RA 3NM4A 2PGJA 3HB1A 4RPGA 5EE3A 4AT1A 3FPKA 4CWAA 3K8OE 4H0NA 4GIBA 4LY0A 4E51A 2QW0X 3FVTA 1N4DA 5ELXA 2C9OA 1BHSA 3D5QA 2BDTA 4TYNA 2OD2A 2PZJA 3PENA 4CBVA 5FUQA 4QX6A 2P9TA 3LECA 1E3JA 2QBYB 1SD5A 2VJBA 1T5HX 3H65A 2HIHA 2YJNA 2ZBUA 4LE2A 2XCRB 1FBTA 4YTEA 3AUKA 4A73A 1GKLA 3E9RA 1W52X 2WYIA 4NU5A 1QKIA 1C3XA 3AETB 3DJFA 5KNDH 4ECEA 1KO1A 1KQPA 1FFYA 3QVSA 5HBRA 2I3AA 4HH1A 3R0QA 4AWBA 3L07A 1CY2A 2FP3A 4JNKA 1L7NA 2HLDA 1ZR2A 1D09A 3LVQE 2PTHA 4WZAA 4R1PA 3RTEA 1ADGA 3ABSB 3FOCA 3JYHA 4YQFA 4DCGA 2SKCA 5FPSA 1U80A 1GM5A 1GG5A 2D2XA 4JI7B 1EVZA 1V1RA 3IOBA 1POXA 2WFZA 4X90A 3N7UA 2EOAA 4KSBA 5A7HA 3VR6A 1SZPA 3F49S 4F6RA 1WY7A 1T5LA 2OESA 2P3SA 3P32A 1W85B 1GPUA 1YVPA 2YYZA 3ETGA 1MT0A 3L7OA 4WUTA 2JFNA 5BYJA 3WNZA 5TARA 1L7DA 1T29A 2XNJA 5SZJA 1JJIA 1J09A 1Z39A 1N1GA 3C70A 3CCFA 3FMOB 3U44A 4UC0A 1IU9A 3AEKA 5CP8A 2WAYA 3WS7A 4AJPA 3ASVA 2MMCA 2V7UA 4WXHA 1JQAA 1R6VA 1SD2A 2GFIA 2N1MA 1ZOLA 2UKDA 2R6DA 2X1MA 2IHJA 2YWJA 3FLAA 1TEXA 4GLJA 1L7PA 5LP6A 3WGJA 2FQWA 2ZCUA 2I3DA 1UOQA 1WHSA 2FNAA 2GK6A 3PC3A 3WNCA 4B17A 4DQDA 1BA2A 3W8DA 1GGVA 3VPCA 3WWPA 1JLRA 4CZ2A 1XMVA 1IIRA 4ERNA 5G2OA 3I04M 1NF8A 4XD7D 3MF4A 1TO2E 1I1OA 1ZGBA 3BGOS 1XNGA 2REOA 3PJEA 1L5RA 1TFRA 3IBCA 4EUKA 3LNTA 1ML3A 1W9MA 4Y2SA 1IUOA 1YA4A 2TSYB 2JJMA 2HT6A 3A2LA 3JALA 4LJSA 4WK6A 3I6IA 5L4LA 1SUWA 2WV9A 4H7EA 4MIOA 2EU8A 1Y3IA 1GNSA 1S4MA 1IPEA 1SB8A 2H2FA 3OEHA 2C03A 5AK6A 4BFSA 1PG2A 2C9ZA 3W3ZB 2BTEA 1NM5A 3DEFA 3JQDA 3KQLA 2CHGA 1FTYA 3LLMA 3MWGA 1GP2A 4L6AA 5EZ5A 1XCGB 4AJIA 4HWGA 1EQ2A 4Q3BA 5JMOA 4CODB 3BMOB 4Z0NA 4YPFA 4OJTA 3HPRA 1GIAA 3A9VA 1W88A 3FNIA 4WN9A 3NX4A 3BRSA 1IZ8A 5D7BA 3H8SA 1ST2A 2CXRA 3LPMA 4IEFB 4QUDA 5FR2A 4DUGD 5IUJC 1RMYA 3EGDA 4CRWB 4RTQA 1J7KA 1P2UA 3R09A 4DQLA 1UT8A 3UK2A 1Y3CE 1AB6A 1VL6A 2JA2A 3ECAA 3IAAA 3R3YA 4JMPA 4P38A 1YR3A 4UU8A 1LJ8A 2KS6A 3Q85A 1KJJA 5CXXA 1QC5B 4IV0A 5IMBA 4C2AA 1NE7A 3E82A 3P5SA 5L3SB 3EA5A 1SKYB 2FK8A 2C7VA 3IBYA 5C8VA 3AF5A 3SE0A 1B8NA 4N7MA 4ZEOA 3DSRA 2IS2A 4Y2UA 1YVRA 1QM5A 3MTDA 3OZWA 4DR1B 1E89A 1ZNXA 2OWEA 3FCSB 4PPFA 4C3ZA 2ZJYA 1H0KA 3R74A 4F9GA 4ZI7A 2M9MA 1E3QA 4PX9A 3VO1A 3ZU2A 5EUMA 4RELA 2WFLB 2JARA 4DEYA 5LMNB 1U3TA 4LJ6A 1YB7A 2DQZA 5AUPB 4PYQA 1XNRB 4D56A 1NP3A 2I65A 2GT1A 2B3DA 3EVNA 1V8PA 1ZN9A 5EIXA 3ACBA 1MENA 4G9BA 4H7FA 1O9HA 3W2EA 1Y4SA 4J3NA 2AT1A 1B16A 3ROEA 4QELA 4PZLA 3BB3A 1EWYA 2P6MA 4KZPA 4C0LA 2QMQA 3H97A 4P0TA 3A1FA 2R5WA 4OYHA 5C5CA 4INJA 4GI3A 3VSBA 4NENA 1FUEA 4TV9B 2XWSA 4ARBA 1JALA 1OZ0A 1KBQA 4KPUB 4X97A 2IYZA 5AIBA 2WT8A 1YR9A 4C4OA 3UG7A 1O54A 1TK2A 5LC1A 1WXQA 2GK3A 4EHDA 4YUAA 3PQEA 3HWSA 4FZJA 1C41A 1SC6A 2IV7A 2BFEB 5AVQA 5F9HA 4Q15A 2IP1A 4BYGA 2BI4A 3Q7EA 4ER7A 3X3HA 1USKA 4KN6A 1EXVA 4H16A 4HGOA 2VP2A 4X45A 4CM7A 3JR7A 4Q6WA 2YW2A 1TXGA 1XD9A 1XCLA 3RREA 4BB6A 2ZYRA 1TECE 1U28A 3VAYA 2IRWA 3LDAA 1QGUA 4QRHA 1Y9JA 5ITVA 3LO8A 3KQUA 1CR0A 3JZMA 1VI5A 5THKA 4RPHA 5J2UB 3JAKB 4L95C 3NBXX 3NONA 4G4JA 1XZCA 4X8MA 3ZHTA 3Q7IA 5DNYB 3G13A 5JS8A 2VJYA 4IFEA 1OJ7A 2C4NA 2QPTA 3NTLA 4J0EA 1N75A 2NSHA 1OPXA 1RIFA 2CLFB 1E9FA 5F2NA 4AUKA 3NDRA 2PSHA 4POAA 2PV0A 3OECA 3V8PA 5HF8A 4WJKB 2POQX 4RLQA 4MQMA 2NPFA 2DB3A 4IDQA 2RHHA 4KB5A 2O3UA 4R1SA 2QRLA 2FTKE 2BEUA 4P4NA 1DAKA 2VYND 4GBED 4MP8A 4EEKA 1RHMA 4I7EA 5AMXA 3ICVA 4BJ3A 4U7FA 2K7FA 1EX6A 2IBSA 1MV5A 2H65A 2IV2X 5A2GA 3AFGA 3KELA 1MO2A 3O26A 2Q07A 1EDEA 4FHEA 1FFHA 4KDRA 2OV3A 3B7PA 4CMAA 4WOCA 3WK4A 3FXAA 3B8HA 4D57A 4V38A 1T0HB 2FX3A 5BRJA 2ZUVA 5JDCC 1UBTS 4D7AA 2GXSA 1X1QA 3GJ3A 4RKYA 1XTIA 1LCIA 1T6NA 4IXTA 1G3UA 5AKYA 2C58A 2DECA 3I28A 2FDXA 1UBJS 3KFXA 2ZPTX 1XXHA 3Q8WA 2V55B 4PC7A 2WZDA 2ZANA 3AY7A 1SVKA 3HHPA 2J32A 1OI7A 2ZB3A 4DL9A 1XEXA 1NASA 2IYAA 4X1YA 5ADUS 3LRXA 3AI2A 4HNAA 4ZV7A 3CB2A 3DKPA 2LDXA 3PGVA 1A98A 1GQSA 1R9MA 3HKBA 2E4XA 3IUYA 4Y2HA 3U81A 2R8EA 1NOIA 3RVMA 3CVXA 5EJEA 4MK4A 4ZOBA 3PKZA 5MGNA 1KMQA 1TGVA 1K7SN 2IU3A 3OJFA 1NP6A 5YASA 4TMWA 4EA7A 3VHLB 3CLTC 2VK2A 1QLJA 4O5OA 3D8NA 3AUAA 4ABYA 3HCCA 4D0RA 3AI1A 5JALA 3IPAA 4DIEA 4LIPD 2QD5A 4O33A 2BEKA 3ITEA 2VQEB 3CKLA 1GSOA 5HK9A 5JJCA 1NKSA 2YY5A 5J5CA 3T9AA 3DMRA 2OCAA 3LI2A 1G4AE 3RUCA 3PWKA 5DWVA 1T2NA 2FK7A 1JVNA 2ZQZA 4IIEA 3UWKA 2R6CA 5EKDA 2QTRA 2YJ3A 4B4KA 3AF6A 4XFKA 1EK1A 3OCUA 3UOGA 5AVTA 4EYEA 2OXCA 3ZCUA 3QE0A 4RVHA 4JWTA 3OTWA 5DHQA 3GUVA 3KWMA 2IF2A 2ZB2A 4B32A 3RHFA 1W0CA 1PAUA 3WYAA 1AHNA 1MD9A 5FUXA 3GUYA 3MLAA 3NJ4A 1MA3A 1GVHA 3R8FA 2L18A 4IIDA 4M7OA 3D4NA 4OEHA 4QSMA 1YIOA 5ALDA 4LHYA 1OLUA 5FUVA 4FNOA 1YMUA 5I7AA 4BLSA 1P4JA 2JIRA 4NBNA 5JDIA 3U60B 4HVAA 1VDZA 2HA6A 3DS8A 3UPDA 2OBNA 1ZAKA 4L2IA 5F3WB 3I01M 4FHGA 2IGBA 4QBHA 1LFDB 1GPH1 3QKIA 4CT5A 5DNDA 2FDCA 2O06A 5DU2A 1ZRMA 2HU2A 2Z6AA 3GRAA 1KYXA 1LZLA 1SVLA 4I6EA 1D6NA 3UH0A 3WVNA 1T9DA 3EULA 1CZHA 1H65A 1M8JA 1WDWB 5JQGA 1BNCA 3EEQA 2J9FB 4AC9A 3P45A 3VR3D 2OVFA 5LMZA 1DC3A 4IZHA 4IJWA 4NCKA 3A4YA 2ODEA 2P4HX 2YFYA 3QVLA 4G0WA 3AB3A 3FYUB 2QLJA 4BB0A 1GU7A 2VUUA 5FLKA 1GPDG 3UMVA 1RYEA 4PLYA 2HWWA 3C6XA 3JQBA 4O2RA 1RS0A 1AX9A 1V3UA 5JSHA 1L1RA 4JEIA 4A2QA 3UNXA 2B78A 1PT6A 3QA3E 4PLCA 4EFKA 4KNVA 4LF6B 1CR4A 2F7SA 3GDOA 4NBUA 1WZNA 2QS9A 2W2QA 4GX0A 2WA1A 5HXAA 2EW1A 5IYZF 3K9NA 5EXEA 4M8NE 5DYWA 5DEIA 3WNDA 3F6CA 2WPDD 3OQIB 4DDMA 1U1IA 4Z1OA 3VZBA 3WRXC 4ILKA 2J3DA 3M6AA 3ZTYA 2FUG6 4F0JA 3C6QA 3G3EA 4RTPA 1UJ5A 4E13A 2ZBEA 1UKZA 2H4YA 3NIFB 4NU8X 2W2MA 3F2VA 2C20A 1T1JA 5EUQB 1H8HA 1R8YA 3M4JA 1DXQA 2Q4TA 4L4ZA 5A6SB 3VBCA 1TU4A 1O6BA 3TZEA 5KEIA 3OQHA 3QOFA 2G1PA 4QJ5A 3MUFA 2Q6TA 4QA9A 4DBLE 3VVMA 4GX5A 3M49A 3W8NA 4BNTA 1T3TA 1Z2AA 5DLEA 4BQRA 1EMDA 4Z54A 4K28A 4PYRA 1JTFA 2BMAA 3TGLA 4EJ0A 2Z8XA 4NFLA 3DW1X 4MAFA 1IM5A 3FSGD 1V8BA 3RWOA 4BO4A 1ZJWA 2ERYA 2R97A 4A0QA 2HHCA 2NV6A 3CRVA 1E7RA 3THSA 2L2QA 2PKEA 3TMAA 3K05A 4G86A 4YT8A 3A6PC 2XB4A 2I1LA 1E59A 3DLTA 1ZOOA 2JVKA 4EI2A 5EHQA 3AVOA 3NVDA 3T9FA 5FTLA 4WNIA 1MLDA 2Y6VA 3NOVA 4BUZA 2Z58A 5K8UA 1VB3A 1JG6A 1L8OA 1NQ5A 1U4SA 5EXSA 1XK7A 3COPA 3BTOA 4TX1A 4D9KA 4YMSA 1WPGA 1NLZA 1N7HA 2H2HA 2C77A 2K2WA 3GLIB 4PSKA 1SXGA 1UC9A 2GI4A 1EUCB 3O21A 4M22A 4A5SA 3A6JA 1JIIA 1BQ3A 1OFHA 1IHYA 1RD4A 4KSCA 3KTFA 2MJLA 1VKRA 5HIMA 4P2GA 2RHBA 3CVVA 5LZ2A 4G36A 4DCOA 5IHXA 2OBXA 3HVIA 3WWEA 3RYFB 3TRKA 4UM8B 3N9IA 1NWCA 3BWBA 3ND7A 3UUWA 2FW7A 4MRPA 1JBQA 3AJAA 2GJAA 2CDRA 3R3WA 1O08A 3D4PA 4G09A 4KX5A 1OH8A 4B3JA 1QO9A 2GZMA 3ET4A 3FCYA 3H4IA 4IVRA 4F4HA 2V6IA 2WDZA 2A94A 5TRTA 1CRPA 4BNUA 1NW5A 3ZIDA 4PSVA 2AFRA 4HPXB 1OWMA 4LY3A 3A9UA 4PS0A 4QOJA 5C8YF 4L7VA 1QQ7A 2HYDA 4CM4B 3EIOA 2PGNA 4B4OA 2EGGA 5BSKA 1QH0A 3GQBA 3ED5A 2JGIA 1EFRD 1EXNA 2OBYA 4PX2A 2O14A 4GLFA 1BOOA 1FFGA 4U63A 5E1BA 2R7MA 3AR9A 3V55A 3QBEA 1RBZA 1TEZA 3R24A 1DZ3A 4E5KA 4F2DA 4ZV4A 2GPYA 5FRDA 2J9ZB 4R01A 5JJ5A 2XEDA 2DBYA 3A05A 3DWFA 3HPQA 2WM9B 4LKRA 3CZ9A 3KJHA 3VU1A 2E4YA 1XQVA 1VSQA 2OP0A 2C3PA 5K4AA 1N57A 4B6JA 4E4RA 1KAOA 2OO7A 3EGVA 1MH9A 3EF0A 4QUBA 4ZO4A 2P9BA 3OICA 3ICEA 1ENZA 1VL8A 3CF2A 3JW8A 2CFCA 2CSUA 3IJRA 1YIDA 4QXPA 4Y2JA 4YAJA 5F5LA 5HQ3A 5LB2A 4XASA 2ZI7A 5KYYB 2PBLA 5FL7D 1ECPA 2H1OA 2JA1A 3WQSB 2D2FA 2QUIA 2IYFA 5I9IA 3WMGA 2UYOA 4LN1A 1H9AA 2XV1A 5ECDA 1ESDA 1E69A 2FFRA 3RT7A 3SJZA 3WKDA 3OHPA 1PBTA 2VSOA 4IH9A 4DQ0A 3SQXA 3A6LA 5FULA 3L4BA 1ZEJA 2GNOA 1Y8RA 3DHEA 2FR8A 1H3FA 2GCEA 2J9GA 3C14C 4N8SA 4EJSB 2O0KA 5A02A 4QZVA 3V7WA 3WYBA 1Z4IA 3L7IA 1UXJA 2W37A 4KMMA 4JP8A 3M6MD 3K5IA 3PKIA 4YK7A 5FV7A 1E2JA 3EF3A 3R3UA 1VYHA 1N3LA 1VYVA 4XVRA 3QY0A 5EYPB 2H4HA 1CY8A 2CEKA 3O94A 4X41A 1PWHA 4A8TA 4UQLA 2P0YA 2BUCA 4B2LA 3D7KA 3TLEA 4OLBA 5B1EA 4Z8YA 4CMGA 2PX3A 3NKFA 3E7XA 1RDFA 1VE5A 3O31A 1GZ7A 3MGCA 4MR9A 4G3XA 3NHPA 4UHJA 4F3NA 4NQZA 4X66B 3IC5A 1J21A 1UKYA 3K2QA 2ZBDA 2QG6A 3R3VA 3IKVA 4UM9B 2JIOA 1QYVA 4BLTA 5AVRA 4MV3A 4ZHQB 1R0RE 3ILYA 4RK1A 1HYQA 1KMNA 3IIEA 3IEVA 2CVZA 3RC7A 4JI4B 4LXTA 1B15A 4XFDA 2A33A 2ZITA 3ND6A 3FJOA 3RAGA 2D0IA 3WRWA 1SG6A 2Q6VA 1FFXB 3QEMB 5DI3B 4U8HA 1DBVO 1L5QA 1Y3FE 3GZNB 1GUAA 3GLVA 4HQLA 1XVUA 4I9NA 4K87A 3KZCA 4Q24A 5JD6A 1XVVA 2XQVA 3EQ7A 4NWIA 4QPJC 5REQA 2RHDA 4F4IA 2WSYB 2QL5A 4EW3A 3KG2A 4R5HA 4OI1A 5FNVB 3THYA 1EFAA 4Q9NA 3ZR4B 5AK4A 2WM8A 3CUWA 5LQRA 1KYYA 1N33B 3DZJA 3BJIC 5I7RA 1X7ZA 3P1JA 4A82A 1EKXA 1BH6A 3FJYA 1XPOA 1OR8A 4BLVA 2GM9A 3H04A 4BFXA 3D7LA 4TXNA 5DP1A 1EA5A 1G9TA 5B3AA 2O8EA 5KCMA 4LC9A 1S3SA 3QV2A 2RGCA 1ILEA 2J6HA 1SXQA 3VC3A 3G2LA 5AJHA 1CQJA 2H31A 4NZ9A 4TKLA 5KBYA 4WV3A 4KR3A 5KX5B 1L7MA 3S40A 1J8QA 2X8BA 1GGHA 1U2SA 1N7JA 3EIXA 4Z6KA 4YJ3F 2JAQA 1ZNYA 2GJKA 2WIBA 1NLFA 1UK7A 2MYNA 2YTZA 2ZULA 2XT9A 6PFKA 3HBAA 1RM5A 1M67A 2EIXA 2QTVA 3QKRA 4ZVSA 3GGJA 3TN7A 3LOUA 4KMRA 2X8JB 3HXKA 4QLOA 1ZIPA 3ICOA 3IQGX 3IUMA 4JYAB 1NBMD 1PE0A 5CT9A 3V4RA 2HLPA 3FETA 2B4AA 4EG4A 4I8DA 5L3QA 2OQRA 2W11A 3OM9A 2FW1A 4QQNA 3N7AA 4XM2A 3TLAA 1CUGA 2EKBA 3KVRA 1NMYA 4K6GA 1FY2A 1T24A 2VLIA 4QU8A 4UVIA 5HZMA 4TT3D 4EVIA 4S04A 1KOLA 2A6PA 5K45A 2AXQA 1NY5A 1CF9A 1N1EA 4LZWA 2XNHA 3NEYA 4RJJA 1NFQA 1H66A 1BGVA 1UC4B 1WZEA 3CZQA 3F6YA 2P9CA 3MTGA 4WA8A 1DKMA 3IJ5A 2RCNA 1WKBA 3SJ7A 1VI6A 2WMNB 4DXHA 4H4EA 1G60A 1Z29A 1J5PA 4CLEA 1BJTA 1G291 1GUFA 5IM4A 1NM5C 2FSPA 1XYYA 4DM3A 1QAMA 1MDBA 3HL4A 3WFIA 5EXPA 4YT4A 1HY3A 2XGOA 5DGDA 2FEWB 2BJHA 4NDZA 3ZDAA 2XGGA 1LWNA 2A9RA 4FYXA 3RW9A 1K3UB 1PFGA 1ZK4A 3N76A 3DEAA 1R2QA 2GILA 5DM1A 5AXBA 2GHTA 2IEDA 1IPHA 4RULA 2HT1A 4JBHA 3A9WA 3D6FA 4AP5A 5A3JA 4O6VA 3WLOA 2Y92A 2GAAA 5CCDA 4CW7A 1E6CA 2CV0A 3B70A 1NYTA 3H1GA 4FHCA 2FJUA 5CB8A 3RC1A 1N7IA 4C3UA 1DKNA 3CVJA 4AQ7A 1Z0DA 1PGJA 1UJ6A 3EC1A 3M8KA 2AFVA 3VC2A 3FZGA 3BL5A 2PKRA 1G20E 1L8LA 2N0SA 3PXGA 5EJ9A 3WV5A 4GO1A 4OCZA 1PT7A 1MTZA 1P3Y1 4AJOA 1KDPA 2Y1CA 3GT7A 1HOXA 1GDTA 5IT4A 1WBJB 4RTNA 2A0WA 3GZJA 5CLFA 1DJPA 2ZAGA 1JW9B 1ZEMA 3FY4A 4IEEA 4NYMR 1JSLA 2FVYA 4ROTA 1PZFA 4KMOA 4FS8A 4O4LF 2QUZA 1LVUA 2DLCX 4LHZA 1O1YA 2H2AA 2ZJ6A 3RH0A 3THXB 3TD6A 1V7PC 3HP7A 3NTQA 1VMDA 2C4WA 4LYHA 4NV1A 4IGKA 1V7QA 3OT1A 1U0FA 3CEHA 1KA9H 5JROA 4BQEA 4RMGA 1DQNA 3B1VA 6CHYA 3EGXA 2JIZA 3SXUB 3EXIB 1V37A 3KUDA 1RYBA 1Q44A 2DPLA 2N1BA 2UYYA 3NEAA 2BMDA 4E88A 3R20A 3FPGA 3AB7A 1S2GA 1FX0A 2X5JO 4PYKA 3TQFA 4LYFA 1JZQA 3W5VA 4ZZ3A 1Z6GA 5H4HA 3IKJA 5FFFA 5FWXA 4OFBA 4RL4A 3D3WB 1TUEA 1AMUA 4P7JA 4G5HA 1TGYA 1WWKA 3AM5A 3T1NA 3LBFA 3R6LA 4FX2A 1WSAA 4UBKA 2YKGA 1FTSA 1ICIA 3K9BA 3L0OA 4Y9UA 4FILA 1N0UA 3PGKA 3MNFA 3ZGNA 4IDFA 1QE5A 3KVOA 1OT3A 1CZRA 2CFRA 1MDFA 3NHJA 2GLUA 2OECA 2YRWA 5CT6A 3KXPA 5CTJA 1LQTA 2R6JA 4YDRA 4FP9A 3L7AA 4EG1A 2QDXA 2QVLA 3R7WB 3RJMA 2X0JA 1NDHA 2XJ4A 1BKDR 5FXMA 1SXJD 1CZLA 1WHTA 4TTSA 1Q7EA 1N2CB 3S1AB 3TZ6A 1V5GA 4C0WA 3U7JA 1O5TA 1IXRC 4M7PA 1CBUA 2BEVA 3R3HA 4HNVA 3TFOA 2AUNA 3K9WA 3UAOA 3ANYB 1FSFA 3QX7A 3ZK7A 5CG1A 3SZOA 5IFKA 1VCMA 3E53A 3EBLA 3USCS 2GSWA 4UMEA 3W06A 3HDQA 4MUJA 3A4VA 2QAIA 4OI2A 1W30A 5CLHA 1LLUA 2PNFA 1WY5A 5AVOA 1AIPA 2EWVA 3MS4A 1WW8A 1W93A 2E1PA 3B2QA 4G37A 1YACA 3AQ4A 2PS1A 5BO5A 3QVXA 4FNGA 3SZMA 3R75A 2RAFA 2IEBA 3N2NA 3DT9A 1XO1A 3F46A 2P79A 3MD0A 5LNK6 1C8BA 2YVQA 2GBPA 3BRQA 1GGJA 4NONA 3QXGA 2AFIB 2QM8A 4AJLA 4YT2A 4AJKA 3UATA 5I51A 4KDEA 2FX2A 3BXXA 3RT9A 4K3UA 2R65A 4YMTA 3BYZA 2VT7A 5BV7A 1KOJA 1U90A 3C8ZA 3SX2A 1VGQA 4Q4AA 1E3WB 3IP3A 2PSFA 1CF4A 3AXTA 3KB8A 4LOHA 4X91A 4UAVA 1EE9A 3OEWA 2OA0A 3F2IA 2YNMC 5JFGA 4PGFA 4TQGA 1ACJA 3QNMA 2WHPA 3GJZA 3C3YA 5DXAA 4GX1A 5CFPA 1AA6A 1RHQA 2FMFA 3ZN2A 3T5AA 3ADBA 2XUJA 4TL9A 2QTWB 1F3OA 3W5DA 1WB9A 2GD6A 2GBFA 1SJ9A 2A7XA 3CV3A 4IHJB 4PXYA 4RYDA 2J31A 1XWFA 2RGUA 4GHWA 2XQGA 1W35A 2VDWB 3MJEA 1FNCA 4B6RA 1LPSA 4R7TA 3NBMA 5F4ZA 4UVGA 3IUPA 5CNJA 1GAQA 4RNCA 5ALHA 1T5OA 3ESQA 2FP4B 2PEZA 4M4SA 1Y6JA 3T5TA 1LK0A 2F00A 3PR2B 4PNZA 4MITA 5FFMA 4AS3A 4AMYA 4EX7A 3PDIA 3M3HA 1AKWA 1NR5A 1ZVMA 2OLEA 3WI7A 4ZDIA 1PZHA 2ASVA 1YZYA 4QBKA 2A5LA 3F7MA 2VQ3A 3DOHA 1K5GA 5E7QA 3TL3A 1DKLA 2MINA 3FVWA 3F9RA 4K6MA 1XDUA 4EDHA 1IBMB 1N78A 3JQGA 1VHJA 1NW8A 2YBDA 3ECSA 1Q0HA 4V0RA 3H1PA 2ICAA 3E9ZA 2C2ZA 4BMZA 4BE7B 3DUWA 3ZWWA 3K0SA 2OBBA 4TKVB 3S8MA 4PC3A 4TZ6A 1YUBA 2X2EA 1JKMA 1WDKA 2PWZA 5CLJA 2DQ4A 2LD4A 1YUNA 4NH0A 1Y8QA 3N8KA 5BMVF 1I10A 4PW0A 3CNLA 5SZHB 3IEUA 1YRWA 1Y6QA 1TVEA 1NATA 1RE0A 5GWXA 4MLPA 4XIYA 4DTCA 6ADHA 1CJBA 2RK3A 4AMGA 4E4TA 4KAJA 1JDBC 4R8VA 5KQGA 2Q0XA 4P98A 1GCAA 4QQFA 1VIMA 2LNDA 3AHEA 4N0DA 4RVOA 4UBLA 1AQ6A 1O6FA 1QR2A 5LDHA 2WWYA 1LNQA 4ALJA 3UVEA 4DAEA 1LWOA 2B4RO 4F5EA 3FBTA 4AU1A 2GN2A 2A5JA 3NFYA 2XNCA 3JQ9A 3M2TA 3O4HA 4CFSA 5K3EA 1NVVR 2AG8A 5EKSA 3TD9A 4YJKA 1X13A 5K3OA 4F56A 1MX5A 1YNOA 4YCLA 2ECFA 1LDYA 5J2TB 3GA5A 4WD3A 1O94C 4S05A 1EFPB 5IG2A 1J9EA 4KR7A 1XXLA 2HX1A 3VH4A 5BQ3A 1BXGA 2XMBA 4BNKA 2XUDA 2C59A 1U8YA 3HJFA 2RHCA 4BMCA 5IXJA 4YGYA 3W34A 3AVVA 1PWZA 4HUJA 2HAEA 3HY3A 5CDSA 3I9NA 3O9MA 3B1XA 4KLAA 4HDSB 3TCNA 2GPTA 4JU8A 5LN1A 4ZVQA 2BFWA 1R6XA 4LNUA 3H18A 3MSCA 1SBIA 4MKIA 1SHJA 3WGGA 4Z7NB 5A9RA 3SFVA 4D96A 3I3OA 3PUWA 1XQ9A 3JYQA 3HKCA 3LJKA 1LLCA 3IAXA 4ZREA 5IEBA 1NUUA 1H05A 2OQIA 2IH5A 3N07A 4OQFA 3D3JA 2W5UA 3I6YA 4QGGA 4FZ3A 2WSLA 2QAJA 3BZWA 4H3SA 4Q4DA 3T7RA 3AK4A 1C7RA 2FJPA 1MEOA 3G0OA 3SOZA 1XJWA 3CUUA 1UBUS 1WB6A 1ZGCA 5DI9A 4JLJA 5F77A 1EJBA 4F93B 3D31A 2POCA 5ICFA 2JLVA 1L4KA 1J9GA 1NULA 3AZQA 5FA8A 4K2HA 5DBGA 3BH7A 2HMSA 3E7FA 4A2PA 2R8RA 1JWBB 5AI4A 2JJ2D 2WHQA 2ZK7A 4QUGA 1IONA 1C5KA 1CV2A 4H3KB 4Y9TA 4KCGA 4QXRA 3UHPA 4ZDJA 4D6YA 1BYIA 3IT0A 4LV8B 3UWDA 3D7RA 1LX7A 1GGMA 1TMYA 3ZBPA 4U6SA 3FYSA 3NFRA 2DH5A 5ALVA 3VKFA 1Q22A 1NRJB 2JZNA 4DUZB 2VNJA 2JFFA 2II6A 2OL4A 3GEDA 4JQSA 5DX1A 3JWHA 1DIAA 5IC6A 3JQ8A 3JVVA 1OROA 3I32A 2B8WA 2FWMX 3EW9A 1PJAA 3C3JA 2QRHA 4ZVPA 3ZDQA 4EKEA 5CDGA 3OZIA 1T4GA 1W8DA 2ZBPA 3LW7A 4KIUA 4RMNA 4J0JA 1NN1A 5JSKA 2YXBA 4QULA 3CLRC 5C81A 4GPD1 5IF9A 1CUVA 2JGMA 1TAQA 1G6Q1 5DO9A 2JLCA 3KJNA 4MYCA 4BZPA 2I3GA 5E1DA 2Y1LA 3LPLA 4QHTA 2QL9A 2JDIA 4AURA 3LQKA 5B2FA 3WK7A 1ZD9A 1E9RA 1WXHA 1A9RA 1NRWA 1PX2A 3GLGA 3EDYA 1GDDA 2DWOA 4NPHA 4Z9AA 3GJ7A 1H2ZA 2QRUA 3FYHA 3KETA 4DLZA 1YZFA 1USUA 3TKLA 4BNYA 1UKBA 2OLKA 1X1BA 4JHLA 1XD2A 1VPTA 4A1FA 5HKLA 2GK4A 2UUAB 3IA2A 4OQDA 1P33A 3EXG2 1QO0D 3LWNA 3P2EA 4J6FA 4YJFA 3N8IA 1NW7A 3TNJA 1UQUA 3H75A 1O0CA 1CHNA 5DTEA 4V24A 1TL7C 4ZVRA 3AP3A 3ZJYA 1L5FA 2WP0A 4BN4A 2NWQA 1QPZA 1PK8A 4B3RB 1E5QA 5K0NA 5C32A 1Z5NA 2QIPA 3A2KA 2QVYX 3PYLA 1KSJA 5K8IA 1Q7RA 1DQYA 1E7YA 4C0SA 1WKVA 2I6TA 4LNHA 1EGVB 4KYVA 2G9RA 3VV2A 4DVGA 4EYSA 5DM70 1U2DC 1U65A 1MAUA 1J2UA 2AN4A 3PHLA 4KXXA 4OLHA 5FJJA 5T57A 4C06A 3FZQA 5LYJB 1JWLA 2GNAA 3BFKA 2QQ0A 1XB2A 4I2NA 4JSRA 4KQ2A 5TVKA 3QF7A 3QJ5A 2X6TA 4A8HA 5F98A 4MRMA 2QD2A 1RJGA 4A3SA 2AV6A 4I99A 4LNAA 4ZMBA 1RC1A 3PEFA 2HHJA 4A92A 3C3BA 1ADYA 4R5MA 4GBMA 2HCRA 1BDMA 4HQRA 1CFZA 1UPBA 3K35A 1F8GA 1NT4A 5GONB 4OK3A 2NYRA 2WBLC 3N28A 4KH1A 4P6VF 2CLIB 2G7MC 1OBFO 5FLEX 3OPYA 1KY2A 1TDJA 3SBXA 2E4ZA 2GEDA 1DG1G 4C0XA 2XVXA 1CRWG 5AW2A 4M1ZA 4C6SA 1R4MA 1BWSA 3N6XA 4MPPA 5LZ5A 3VZRA 4DQVA 1LPPA 3MRTA 1EFTA 3ILXA 2Q2QA 5AUOB 4IOLA 2OFXA 3FHTA 5G02A 3VKGA 1YI1A 3J7TA 1IG0A 2D1SA 3DF9A 2Q9CA 1DCKA 1NOKA 4AVYA 2YJTD 4HRXA 4B80A 2ZRIA 3CUKA 4IV5A 4XJSA 3RVQA 3B51X 3TUZC 5KTOA 1WPQA 2VPTA 1F2TB 4RVGA 4CR6A 3RUIA 1R6TA 2BYTA 3OJ0A 4JFAA 1XKTA 2CDNA 4XLTA 3EXG1 1EFKA 3PV0A 5B36A 4TQAA 1ZUWA 1DZIA 2EFJA 4MVYA 3RGWS 2VBFA 5IJWA 2W2KB 4IHJF 2H3EA 4C30A 4AMBA 2RHOA 3MS2A 4Q82A 5JBIA 3WAKA 1X77A 4XYEA 1RQPA 2RHWA 4WKOA 2XAAA 2VPIA 1A4XA 3ILSA 4MB0A 5AI5A 1NJ2A 1JBKA 3PFWO 1PW5A 1U7UA 3GLTA 1AD2A 1M2VA 4KIFA 1X0XA 2BDEA 2VHCA 5DULA 3VM6A 5KWSA 3DR3A 1YZQA 3LT5A 1K0UA 2AR0A 1ZGJA 1QX4A 3LPDA 3O90A 5KVAA 2C5SA 3AJDA 1ONBA 2DSNA 1PS9A 2V7XA 2F2TA 4Q9DA 3IELA 1JSCA 1K3TA 3LOQA 2GXAA 3WGUA 4GT1A 2GDJA 1HK7A 4ZEVA 3EZ6A 3D81A 3JV7A 2H2GA 1IC6A 1WULS 1QPGA 4YDSA 3CLVA 3U62A 6NULA 1Z74A 2HA4A 1GGNA 1PQWA 3AM1A 1XK6A 3NUZA 2O5RA 3LY9A 2HSEA 2JLSA 2CL6X 2X9VA 2VYVD 5DCLA 3QKTA 1GSAA 1K8YB 4FHZA 1RWVA 2XVMA 3V3TA 4V1CA 4OG2A 3HDYA 4R84A 5I7UA 1SC3A 2E55A 2H1WA 3UFBA 1UWCA 3ILVA 5GVSA 2YXNA 3CNQS 2P5YA 2EJCA 1DWUA 2WRZA 3ODGA 5FCDA 3SYRA 1O95D 2QX6A 3DMGA 3HY4A 2P1DA 1NLUA 2VDLB 3PPXA 4CDRA 4HAYA 1YA8A 3FWYA 1Y6RA 3COWA 3MAAC 1RCFA 3H9GA 1IN4A 1V11B 3K5HA 1Z3CA 4MDHA 4MMYB 1PFYA 4IIFA 1PHRA 2YUIA 3OTIA 3SNHA 1H3NA 4UZEA 2ZAOA 3IUBA 4KFCA 1CUJA 2PUWA 1UPFA 3PNYA 4GGMX 2J48A 2JC3A 4R3WA 3KKEA 4OXIA 3ZDXB 1TW2A 5HM8A 5JYEA 1WP9A 3DOOA 4LEIA 4DBZA 3O6VA 5DM0A 3GLSA 5E38A 3FNHA 5LZ7A 1ADCA 1TX4B 1PDWA 1RXIA 4YYZA 3DEKA 3EG9B 3OMXA 2PG3A 4LXHA 1PQ4A 3W8RA 3WNQA 4LBZA 3QKSA 3M2PA 5J1SB 3QGMA 2FOLA 1TJNA 1RW4A 2P30A 3FSEA 3DV2A 3IP5A 2AR9A 1NHGA 3IXQA 5DISB 4JZYA 4LWQA 2DP4E 3RRYA 2YHSA 2G77B 3K8QA 1MVLA 3IIJA 4I50B 3U3XA 1XTUA 1X92A 1RRMA 3MQ4A 1X8KA 1WOYA 2VP6A 2LWIA 4WOPA 3I1JA 4DG9A 1D4ZA 3M0EA 4OAPA 1WG8A 3T0IA 3ZLUA 2ORYA 3EXEA 3M5DA 1PWEA 3T52A 4FFBA 4V0NA 4KACA 1CULC 2CZQA 4WXPA 2GCOA 1E7SA 2FRXA 1DRVA 2YDYA 1I4DD 4UBOA 4I5IA 2ZYVX 4JB0A 1HQYE 4KE9A 2XMDA 2ZETA 4R8LA 5LB4A 5CNMA 3RSLA 1U81A 2B6HA 1IULA 2WU8A 4XVQA 5AW8A 4CR7A 5TGTA 1QH1B 3TDNA 2XY4A 1BXZA 4M8IA 1BHQ1 4MVJP 4FR5A 2QRMA 2ZJ5A 2VBCA 4MV0A 4WZBA 1Y8ZA 5JSFA 3E8XA 4GOKA 4D6PA 4C6TA 2FFQA 4B0OA 1YJXA 5LQUA 2WTEA 3HR8A 4WK0B 4A03A 3GHHA 1DB3A 5KYVA 5JWOA 2WTMA 4ZI5A 3UBMA 1US8A 2W71A 2HF2A 3D2BA 3X0DA 2QEQA 4BNLA 2AEJA 2O8FB 3C48A 4Y7CA 3GPCA 1WEKA 4N0QA 4XJXA 4A8PA 3B3GA 2APJA 1G7SA 1HMPA 5HMLA 1I5OA 3C6YA 3V7FA 1AM4D 2PRIA 3KOMA 3EDRA 5KDLA 2Y77A 2C9MA 2RBEA 4UXIA 5IZ4A 2CEAA 3L7YA 5JYCA 2DXIA 3QBTA 2NZVG 3QV1A 5JEDA 3GD5A 2A0UA 5GM2A 3HADA 3ANTA 1EFLA 3D7SA 2R9VA 4PO1A 4Q9AA 3VNAA 5IANA 5BNTA 3CKKA 1B00A 4UFOA 1UZNA 4ZRDA 5K2OA 1BCSA 2ETVA 2I9KA 3AY6A 2GEUA 1QYWA 2P8JA 1UZLA 3AEUA 3HJTA 3NHYA 3V8BA 2WF8A 1KOGA 4IGFA 3GHYA 3MB5A 1M8GA 4KUGA 4N12A 3U5TA 4HADA 5F1YA 4PGGA 2C9YA 3CPSA 2D5LA 1ZIOA 3N0TA 4CG2A 4O1MA 5DF1A 3RBZA 3FKSA 1QJCA 1F6DA 1QTNA 2W6PA 4OJQA 2ATEA 2XH8A 4N5LA 2JK1A 4OXRA 5H9VA 4R9RA 2I1WA 1X8JA 2ILTA 2AN1A 3K31A