1VJIA

Gene product of at1g76680 from arabidopsis thaliana
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
361
structure length
351
Chain Sequence
SVPLLTPYKMGRFNLSHRVVLAPLTRQRSYGNVPQPHAAIYYSQRTTPGGFLITEATGVSDTAQGYQDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGKAPISCSDKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYMAESLNKYGILYCHVIEARMHTLMPMRKAFKGTFISAGGFTREDGNEAVSKGRTDLVAYGRWFLANPDLPKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12-oxophytodienoate reductase (OPR1)
publication title X-ray structure of Arabidopsis At1g77680, 12-oxophytodienoate reductase isoform 1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 126
structure length 351
sequence length 361
ec nomenclature ec 1.3.1.42: 12-oxophytodienoate reductase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1vjiA00
4NZFA 1IXQA 2TPSA 2Y62A 4AH7A 1ZAJA 1AK5A 1T96A 3I65A 2J9YA 3E0IA 4NJIA 4CNPA 4RR4A 4AHQA 3NOEA 3W7LA 1WV2A 3TROA 5CSSA 5LGZA 3QM3A 2RDTA 2ZZ2A 4JYFA 4O0ZA 3B05A 3IIZA 3FJ6A 4K7VA 3LTYA 5TBOA 2FFCA 4YCPA 4MLRA 1TJPA 2DZVA 1J5TA 2VFHA 3IIOA 3M1ZA 5D30A 1TPWA 4J9JA 1A5BA 3TMLA 1MEIA 1W5QA 1W5OA 1Z41A 3MWAA 1D9EA 4KFOA 2QUUA 3QW4B 1TPEA 2VELA 2CLHA 1P0KA 5I3IA 1EX5A 3L0NA 1W1ZA 3EKZA 1IIGA 2HMCA 3W83A 1ZJIA 3L0KA 3TK7A 2P10A 1GTEA 1HUVA 4AAJA 3F03K 1EP1A 6ALDA 4JTLA 2ZBTA 5MHBA 3ANYA 2VFEA 4NXSA 4O1AA 4WUIA 2EKCA 3RNDA 1OFDA 4E0CA 4IUOA 3TJXA 3C52A 5EPDA 4ZQRA 3HG3A 4HNUA 1O4UA 2YXGA 3DENA 5D04C 2A21A 2XFWA 2WO5A 5K9DA 4X2RA 1QFEA 2FB2A 3HPXA 4H4IA 5HR6A 1ML1A 1LOSA 1LOQA 2BXVA 4Z0SA 3LRLA 4QITA 1TV8A 3DXIA 5I3FA 2QCGA 2KZHA 3FYOA 3DU0A 1G4TA 4MIMA 4O17A 3KRZA 3HO8A 5I3GA 3WK3A 2BX7A 2J88A 1ME9A 2ZZ4A 4UTTC 4LOCA 5C54A 1IGSA 4UFKA 2V8ZA 5EYWA 5TIMA 2Z1BA 1O94A 3LCWA 3MBFA 3QMTA 5F2GA 4M19A 2PRHA 2E6AA 4UFJA 1H7OA 3P74A 3B04A 3ELFA 4O19A 2V9DA 1LLZA 2NXHA 4I9AA 2CLOA 4PH6A 5FI8A 4RZ5A 2ZA2A 2AQWA 5DLCA 3S5YA 3ABRA 4K7YA 1TPB1 5HMSA 3TUUA 5D2YA 4JY8A 2YPIA 2PCQA 4UTUA 3W73A 1YPIA 3S1VA 3SIZA 3AJXA 3EX1A 2JKEA 2PRLA 1WXJA 1WOAA 2E5DA 4M5PA 3MHUA 5CPNA 2Y70A 3K30A 1EP3A 1TTIA 4O52A 3E9AA 3LXBA 1OFOA 3GNDA 4WY0F 2J24A 1YPFA 3CT7A 1GOXA 5EY5A 3PWAA 5IM51 3LI0A 3N2MA 3HBLA 4ZQPA 1SO3A 4ICNA 3CTLA 3MP3A 3DI0A 4ZVJA 1DV7A 2GOUA 3E49A 3A24A 3C2FA 2I1OA 3M0ZA 4MZ8A 1FCBA 4LVFA 3GK0A 1PIIA 4MVAA 2WJZA 1VCGA 1YDVA 2DP3A 3P60A 1ICPA 3C2VA 3TSMA 4YXGA 3AO0A 3PUOA 4QM1A 3M5VA 1KM0A 5AYYA 1PHQA 1H7NA 3W7GA 4C1KA 2Z0IA 3N9RA 3DBPA 1OFPA 4ZMGA 1F76A 3GYEA 4UR8A 4WJEA 4N02A 1Q6LA 2ATMA 1TPH1 1H51A 3W9ZA 1R30A 2V81A 4Y6GA 2Y7FA 3IEBA 1ICSA 1ZFJA 3TAOA 3SECA 5CG7A 3VI2A 1TCDA 4EOUA 4NNAA 1XBVA 3QMRA 3W1RA 4M7TA 2WNQA 1VRDA 2YSWA 3MBDA 5DCDA 1YDOA 5C6MA 3U2OA 3W71A 2NZLA 5D2VA 4CNNA 1GQNA 1X1OA 1H62A 5DCEA 4XQ6A 3N3MA 3UPBA 3MI6A 1TTQA 3KRUA 1FX6A 2DZUA 5LHFA 1SSGA 4MFEA 1KV5A 3Q58A 1QPQA 1DHPA 3FEMA 3UD6A 5KZMA 3BGJA 1L2UA 2QCDA 5AHMA 4EIVA 3TJLA 5F2LA 3HPZA 3RLVA 3TA6A 1B4EA 5K9XA 3THQA 4MKNA 3NPWA 4JTTA 3W88A 4WOZA 1QCWA 1VYSX 3SW6A 3EWXA 4IXHA 4AMAA 2DU2A 3ATYA 1W5PA 3MMTA 1OX4B 4O54A 4N9DA 5CZJA 3L21A 2V5BA 2NX9A 4POCA 3DFTA 2YYUA 3EWZA 4UTJA 4CQ9A 5ABTA 1KM1A 3MHGA 3PAJA 1RR2A 4UMAA 4I7VA 1ZAHA 3RU6A 4JTUA 3S0CA 3M5XA 1G4SA 4HSNA 4R53A 1ZNNA 2GQ8A 1XBYA 4MUZA 5I3HA 3FS2A 3W2UA 3GR8A 3C2OA 3DHFA 4XZ9A 3R13A 3TFCA 2RKXA 4M6PA 1WYIA 1AW1A 1K8YA 4JR5A 4NNBA 5K7JA 1ALDA 4PEKA 1GT8A 1JULA 3DFSA 3TH6A 2E6FA 2V30A 1QOPA 2VEKA 2X1TA 5CSRA 3GVGA 3I7QA 4M7SA 5AC7A 1KFKA 2Y6ZA 1FDJA 5LKYA 3QZEA 2WSYA 1ONRA 4MYXA 3GDLA 2DJLA 2WSRA 1DBTA 5H2ZA 5FF4A 3G8EA 2Y85A 5HINA 3S1UA 4UTWC 4H3DA 4L4LA 1NSJA 2WSQA 4FO4A 4O1BA 4N9CA 1GVQA 3NQAA 5FF7A 3A9IA 4I7WA 1VH7A 3H53A 2CZFA 1K3UA 3M16A 4YCOA 2E68A 2CZ5A 3EWBX 3M44A 3LM7A 1FQ0A 1DJQA 1B3OA 3BG9A 1VZWA 5I3KA 2EPHA 4QJ1A 1ICQA 1RZMA 3FKKA 4TR9A 2A7RA 4WX2A 4HPJA 4EF8A 4FX7A 3W87A 2OMAA 4LS2A 3TXVA 5FEXA 3NDOA 1QO5A 5KZDA 5LSMA 2YGYA 3IGXA 1R46A 4XBSA 3KVMA 1YXYA 4U4MA 5AHEA 3UY7A 3GLCA 1AG1O 4UTMA 4KWWA 2ZRUA 1G67A 3TX9A 2NX3A 4ZQOA 1JJKA 4TO8A 3S5ZA 4JX5A 4OGZA 3DI1A 1SZFA 1T99A 4MZYA 5CKSA 3W1QA 2FB3A 3CQ0A 3P7YA 1QNVA 2V2HA 1Q6RA 3MYPA 2ZA3A 2FIQA 1OJXA 4LU0A 4PCFA 1SR9A 1B9BA 1R47A 3LRKA 4O57A 3Q37A 4GXMA 2Y88A 2ZTKA 1KW1A 2BZNA 2W79A 5G2IA 5CZSA 3W84A 1P5BA 4LC6A 4JX6A 3W70A 5AOUA 5U4NA 4IMDA 3P82A 1WA3A 4MYAA 3TMQA 1F6KA 4HSOA 1F5ZA 3N19B 5LNWA 3NQ7A 1GG1A 1L6WA 3O15A 1RPXA 3T44A 1LBFA 2GJLA 1KFJA 1EA0A 4BK9A 3VE9A 1W3NA 4AEOA 4CNOA 1YTDA 3CM4A 3LHTA 3B0PA 1VYPX 4TIMA 3PULA 3IV3A 3UYCA 1S5WA 5F2IA 1TREA 3C2RA 5HJLA 3ATZA 3L5MA 4AWTA 1SW3A 3LCGA 4UTIA 3S5NA 1W56A 3I6RA 1Z44A 5CPLA 5IBXC 1LBMA 4IX0A 2WNZA 1JRBA 3W7HA 2VEMA 1OK6A 3C6CA 1TPVA 1RQBA 4MY1A 2X16A 4LV9A 1MEHA 3LHUA 4FNQA 1JUBA 4GUIA 2A0NA 1PS9A 1SW7A 3NYZA 1YXDA 3P62A 1ZAIA 4OT7A 4OE7A 3NM1A 3TFXA 3W7CA 3MUXA 3QSRA 1X1ZA 2JGYA 3W7NA 3MP4A 1Q3NA 4PA8A 1OX6A 2RDWA 1XKYA 1YDNA 3HB9A 5D02A 4FXRA 3WJWA 5H91A 2OJPA 1P1XA 1WDWA 5G1TA 2B7NA 3EX4A 1VHCA 2A7NA 3STFA 3BG5A 4RZ4A 1ME7A 1UB3A 4NX0A 3W22A 4Y90A 3CIWA 1CX9A 1QR7A 4CCEA 4K38A 1PVNA 2DZSA 2WV8A 3T4CA 3G1HA 3DFQA 3UWUA 4DBEA 2B7PA 2WPBA 2FQIA 3RF9A 5L6UA 3G1XA 4O28A 2Z6JA 3B0UX 1JCYA 1Q45A 3NVTA 1GYLA 2DJXA 1TPUA 2X1UA 3LTPA 2C18A 1TPFA 1K7EA 1D3HA 3G3MA 2YW4A 2Q8ZA 4C1LA 3LERA 2H8ZA 4P61A 1F6PA 1H50A 3LHWA 2A6NA 1NEYA 4B5NA 1SO6A 3LI1A 2ZRWA 3KVKA 1TQJA 4OU1A 3LB0A 1XBZA 3KFTA 2E6DA 4MFDA 3P67A 1MZHA 3GXTA 5D03A 3GKFA 5EKYA 4DXVA 1TTPA 3G22A 4RXFA 1LM1A 3DKJA 2EAWA 2VFFA 1F74A 5KZEA 3IIPA 4JNMA 4HPXA 4JTGA 1HG3A 4QQ3A 1F7BA 2QJGA 4D2JA 4FNTA 4RZ6A 3TC6A 2HS6A 2ISSA 3HOJA 4RXGA 3ZWSA 4Z1AA 4DBDA 5KSWA 3WJYA 2NX1A 1VCVA 4LVAA 1LDCA 4NQ1A 4BI6A 4DO5A 1P0NA 4HKPA 3LBMA 3BG3A 3B03A 2GQ9A 4GUHA 1KV8A 4PL1A 3GNNA 4BWLC 3I68A 2OZ0A 4UCGA 1A50A 4NJGA 1FUYA 2ZQ0A 4Q32A 5G4WA 4Y8FA 1EWEA 1VJIA 3PB0A 4LVDA 5AHLA 2J6XA 1FWNA 5G2WA 1FWRA 2QDGA 4XTDA 2QCLA 4K36A 5C2XA 4QNWA 3OHIA 4UUIA 4JY9A 3DHDA 5C55A 4UTTA 3NG3A 3O1NA 3O06A 1FCUA 1G6CA 3IVUA 1IXPA 1QO2A 3TNOA 1H61A 1KTBA 1C29A 3SGUA 3T40A 4JTEA 2XN0A 3G3DA 3TDFA 2OT0A 5A8GA 1VGAA 5HQEA 1KBJA 2YYTA 3LX9A 1LBLA 1W5NA 1XL9A 3OVPA 2Y61A 1FY6A 3S8HA 4Q33A 4Y9AA 3T7VA 5L9FA 2P1FA 3DAQA 5G2HA 4GNJA 4N6EA 1RQHA 1ZCOA 4WOQA 1UCWA 2ZZ7A 1SO4A 3PVFA 1OHLA 4LVGA 3V1PA 3PR2A 5HULA 4N9EA 2ZRZA 1FWTA 4RLIA 3G1SA 3HGOA 3QMSA 5DBUA 2R94A 3N14A 3M5YA 2NV2A 2C15A 1OFEA 3G0XA 3EXRA 1HO4A 3R89A 3PBUA 2V5LA 3BLFA 3G1FA 1I2PA 4FEZA 4UFLA 1IF2A 1FWSA 3GDTA 3DZ1A 2R91A 1N7KA 1BKSA 2E77A 4WY0A 1JCNA 2H8XA 3PSVA 3W2NA 1ZENA 3NXFA 3FIGA 3LOTA 1N55A 4WXZA 1KM6A 1H7XA 2H3BA 2Z2UA 4GUFA 5D37A 1BWLA 3B4UA 1LP6A 4IQLA 3TSDA 1W3TA 2HTMA 2Y89A 3YPIA 1IXOA 1I2QA 4M6QA 3W1MA 4HNNA 3S9YA 5FF3A 3KVLA 4GFSA 4OWGA 3BW3A 3KOFA 1DJNA 1YTKA 4UFMA 4QNEA 1PE1A 4BI7A 3FYPA 1WBJA 2A4AA 2FPVA 2VEIA 4FNRA 1TB3A 1W37A 2CU0A 3L9CA 3W75A 3M7WA 1K7FA 3UY8A 3O6YX 4NXKA 3KAOA 3PUDA 5CPMA 1H1ZA 3UNDA 3HQ1A 3NL3A 3PBWA 4Z1CA 2TRSA 2NUYA 4P2VA 3HPSA 3TIMA 3W7QA 1TTJA 5F1UA 1UUOA 1SUXA 3R12A 3GAKA 5K4XA 3Q2DA 3THAA 1XFBA 2NUXA 2G97A 1TRDA 3L2IA 1IIHA 1UBSA 1VR6A 4A22A 1OF6A 1H63A 3LXCA 5HR7A 3HGJA 1XM3A 2CZEA 4PTNA 4OHQA 5F1VA 3MO7A 5DCBA 4ZZ9A 2B7OA 2QAPA 4JYEA 4NNCA 5BMXA 1GTHA 1H7RA 3HF3A 4O8RA 4BI5A 1FCVA 1GJPA 2EGZA 2QCNA 3NPVA 4YWIA 4UIOA 4MZ1A 5F2MA 1UJPA 4LUJA 1JUEA 1QWGA 4O18A 2WNNA 3DFOA 4MPQA 4NUWA 4JD4A 4DO4A 4NT0A 3VNDA 4IPJA 1L6YA 1M7OA 2NWSA 4XUGA 2ZZ5A 2W6RA 2YFOA 4O16A 3QQ1A 4JTSA 2X2GA 3R8RA 3IVSA 1JCJA 4XBKA 1V5XA 1AW5A 2ZRVA 3P5ZA 3GDRA 4NJJA 1F2JA 2V2DA 5HWJA 2GPTA 1VC4A 2YFNA 3NAVA 3UPWA 4UXDA 3DFPA 3UQNA 2G95A 3HJZA 3TW6A 3CEUA 1LORA 4O50A 4ADTA 2NUWA 4AVFA 4AXKA 3LCLA 4XKYA 5I3JA 4LRTA 5SWUA 1PCWA 5D2XA 1X7FA 4DO6A 4O4VA 4UTWA 3IIXA 3LLFA 1A5SA 2E6YA 3QSTA 5LGXA 3MJYA 3EKLA 4GUGA 4A21A 1KTNA 3LHVA 4KKXA 4LS0A 5DXXA 5KTLA 1LZOA 2X1RA 3NQDA 4GUJA 1VPXA 2VOMA 1NAL1 2RFGA 4IMCA 1TYGA 3UXAA 3T55A 3H55A 2YCEA 1BTMA 5K9CA 2BSLA 1TJRA 4LV4A 3S6DA 5D09A 4UR7A 3M9YA 3STGA 2C1HA 1SO5A 1D3GA 4TU1A 2WKJA 4LY8A 4NX5A 3LCHA 2RH9A 4G1KA 2QDHA 3QFEA 3W1NA 3MI3A 3QJAA 3TV8A 2PRMA 1AL8A 1HL2A 4LTSA 5FESA 4NJKA 1TSIA 3W7DA 4IX2A 4WXYA 3PBVA 1H5YA 3E96A 3W7KA 3NEVA 2IQTA 2NV1A 4IXXA 4HNTA 1DQXA 3DH7A 1UUMA 3F4NA 3U6WA 1BEUA 1JVNA 3L67A 4ML9A 5DXYA 1MSSA 3W2LA 3G1VA 3CU2A 3LGEA 1F73A 1W54A 3ABQA 1QOQA 1R2SA 3WFAA 1OYAA 4DEFA 3W1AA 4E2DA 1XBXA 1OX5A 4FNSA 2QCHA 4TMCA 1DORA 4QSHA 4UNLA 3WK0A 3W7PA 2G5WA 4UMBA 4BF9A 1XC4A 2GVJA 3U8GA 1W8SA 2ABAA 3TAKA 2ZTJA 1FBAA 4AF0A 1IXNA 3CLMA 1Z48A 3QC3A 4IWWA 1SQ7A 1KFCA 1OABA 3W23A 5F4XA 2B4GA 4LUIA 3EEGA 3TKFA 5HWNA 4NU7A 2J9XA 3QRHA 2P0OA 4RV8A 2FTPA 4IMEA 2TMDA 3W1XA 2EF9A 2C13A 3CWNA 1NFBA 2X1SA 4RCXA 3SFKA 4AHPA 3NQMA 5IBXA 5BOOA 3LRMA 3N2XA 1XDLA 4LW7A 1W5MA 1KM3A 4O0KA 4JDYA 5J5DA 2DZWA 4ZQCA 1MEWA 1UASA 1S3HA 4YMZA 3FLUA 3RMJA 2AAMA 3W76A 1OFBA 2A2IA 3L66A 1MXSA 4EWND 2DZTA 1YXCA 4JXCA 4MJMA 3MW7A 4QIUA 2AGKA 2C0AA 3NL2A 2QCMA 3A22A 3O6DA 5GVJA 3G1YA 1PL9A 2A6LA 1B57A 3PS7A 4IGHA 3SSJA 3UZJA 4DQWA 3C56A 1G7VA 5DBTA 1LOLA 1H60A 4PFMA 3P8JA 3W7IA 1KLYA 2OX1A 2VENA 4MJZA 1M5WA 3IIVA 1G4PA 2FLIA 3SR7A 3GB6A 3STEA 1J2WA 3CIXA 4H6KA 4Y96A 1B4KA 3W7RA 3EWWA 5EBUA 1KTCA 4WZHA 2TYSA 1WOBA 2V82A 3A23A 3W7EA 3OEXA 3MI2A 3VE7A 4MY9A 3KXQA 1P4CA 1K7XA 1L6SA 5FF0A 1XI3A 4QAIA 4BR1A 1EP2A 1AW2A 1V7YA 4JTFA 4HIBA 3W2MA 4N9BA 2UV8G 2X30A 1JR1A 4ORIA 2FDSA 4WQ6A 2XN1A 2E5CA 1JUKA 3C61A 3I7RA 3IVTA 4M6VA 3BLIA 2Y63A 5T26A 3PF3A 1KBIA 2HSAA 3FOKA 1G69A 5D38A 3C8FA 3D0CA 3KVJA 2DZXA 2ZDRA 2J9ZA 3QYQA 2GUUA 5KMYA 2VFDA 3A21A 3LCIA 1AL7A 1W3IA 4JDBA 1LRTA 3GAYA 1W0MA 4K8EA 3MYOA 3F4WA 1KFLA 3W2KA 5J5RA 4CLMA 4GE8A 3TE9A 1J4EA 2PC4A 3PG8A 4R7JA 1R2RA 2BLEA 4ZQMA 2CLMA 4FXSA 4MY8A 2CLEA 5F4SA 1A5CA 1FDYA 2V2CA 4KFPA 3ZS4A 4FX8A 3ABSA 2TSYA 2HS8A 1JCXA 2OCZA 4EF9A 4UTLA 5EA9A 4JGDA 4O15A 1I8JA 1PHWA 1DVJA 2F84A 4BWLA 3LLDA 5LNVA 2H6RA 3OG3A 3W86A 3W85A 3CPRA 4Q4KA 2RHGA 1XDMA 4ZL1A 3S42A 3HIJA 2QCCA 3RK8A 4HN4A 3NQEA 3IRDA 5FEWA 5E0KA 1VLWA 3LHZA 4FX6M 1NF7A 3RLUA 3GXNA 3R5EA 4GBUA 1FCQA 3P5YA 1OF8A 2DORA 1OG0A 2QUTA 3CC1A 3TW7A 3CEPA 2C3ZA 4ORMA 3DKLA 2EHHA 3BW2A 3EWYA 2CLIA 1EUNA 5D05A 4FF7A 1A53A 3NQ8A 3UZ5A 2R8WA 4IPIA 1NVMA 3NL5A 2B0MA 4DF1A 3O63A 4PODA 4GRSA 2QAFA 2E1DA 1Z42A 2GVLA 4AHOA 1CW2A 2ZFAA 4TMBA 2Y7GA 3PBYA 3MHFA 3M5ZA 4DPQA 2ISWA 3NGJA 4MLJA 1H7WA 3O05A 1DL3A 3A5VA 3LV5A 5K4ZA 3NNTA 1XUUA 3NQ2A 5FEZA 5FF2A 1KM4A 3WJZA 3L5AA 1THFD 4GWEA 4AWSA 3G0UA 1SU5A 3SJ3A 3NQFA 4JX4A 2R14A 4LRSA 3SI9A 3F1QA 2YW3A 1ADOA 3UWQA 1E51A 3QW3A 3W6YA 3W1LA 1VCFA 4DPPA 4KWVA 1GWJA 4A29A 3NQGA 3UWYA 1SZGA 2I9EA 2LLEA 5D2TA 4AB4A 5HWMA 1HFBA 2JKAA 3EXSA 4LC8A 5AHIA 4HHPA 4YLWA 4JEQA 1JCLA 1ZY9A 4FIQA 2A7PA 3OVRA 2NXIA 5HNRA 2CLKA 4I7UA 1QPNA 1DKWA 3TSBA 2ZZ3A 1M7PA 3OVQA 4DF0A 2WOQA 2WQPA 1OFRA 1U83A 4ALDA 3NR0A 4WD0A 4BFAA 1ZHAA 3GDKA 3HG4A 5KINA 1I4NA 3GR7A 3M41A 4O14A 1LCOA 2QJIA 2QUVA 1C8VA 2GJNA 4UTKA 3GKAA 3LHYA 2CW6A 3PUEA 3WK1A 5D2WA 4A3UA 2NXGA 2FPTA 3LV6A 1KFEA 4K8HA 4N4PA 1Y0EA 3B06A 3KHJA 1S5TA 4Z0JA 5CGQA 4ONVA 4N4QA 1YTEA 2CWNA 4ADUA 5LNUA 2E5BA 1LYXA 2VXNA 3EX2A 5DY3A 1NF0A 1TIMA 4O12A 4A2RA 2ZZ6A 1G7UA 3BK0A 3M43A 2RDUA 3GIYA 1H7PA 5D32A 1JCMP 4O13A 1EUAA 4UFIA 2NWRA 1WAUA 3NQVA 3QH2A 2ZYFA 2Q3RA 1KFBA 3G24A 2ZCGA 1DOSA 4TX9A 3A5FA 4LS1A 1X6UA 4UTHA 1EWDA 3ZFHA 3P8IA 4R33A 3DGRA 2C16A 2ZZ1A 3UWWA 4A2SA 3CB8A 3Q94A 4IMGA 1FDZA 2H90A 3UWZA 1BWKA 1O5XA 3W1TA 3BV4A 1Q6OA 1W31A 3O8AA 1OX4A 1TV5A 1OVDA 5AB3A 1XUZA 5AC8A 5BMWA 5K2ZA 3W7JA 1SW0A 3FJLA 3EWUA 3HG2A 2BWGA 3MP5A 5G5IA 1HTIA 3GXPA 3NZ1A 5DN1A 1VS1A 3S5OA 3W07A 4WY0B 4S1FA 4CQAA 3P84A 3QPZA 5HUOA 3NQ6A 3JRKA 5CZTA 2YZRA 3NQCA 1FXPA 3LTSA 4PL2A 2QF7A 3N73A 4E38A 3JS3A 4UC5A 3W1PA 3TQ0A 1A5AA 3EXTA 1TPDA 3W7MA 1G4EA 3S1WA 3TR2A 1QPOA 2F7FA 2G96A 3DFNA 1Q6QA 3BARA 2Q8LA 4N2YA 3ZR4A 2A85A 1RQEA 4FB7A 1VHNA 4O1CA 4CCCA 4U28A 4GJ1A 1KA9F 1ZALA 3C2EA 4ZQNA 5G1YA 2H3DA 4LVBA 3STCA 2QEZA 5AHFA 1KLZA 4DELA 2V0TA 3NA8A 2Q3OA 1QAPA 2CFFA 4O1DA 4YL2A 4FHAA 2Y7EA 4HNVA 3M6YA 4UFHA 3G0SA 1OFQA 2Z6IA 2ZRYA 3ABOA 3VFLA 3BPWA 4RK8A 1GEQA 3V75A 1K8XA 3W1UA 1CI1A 3VCRA 1RV8A 3BW4A 5AN7A 4JTHA 4JIQA 3KX6A 4Z1DA 5LNRA 2O7QA 4Z1BA 4CCDA 2JKPA 3R2GA 4IJBA 3I7SA 4HT3A 3NPXA 1O60A 1GPWA 2YR1A 4LWWA 3B0VC 1TPC1 4QISA 5KITA 5EMUA 2GQAA 2W0UA 2ALDA 4JN6A 2XN2A 2QCDB 2DZPA 5EL1A 3BO9A 4S2BA 3HG5A 4R34A 1QMLA 1TMHA 1I2RA 1LROA 1T0OA 1O5KA 1GZGA 4GC4A 1KM2A 3T78A 3O07A 1VYRA 3LDVA 1SFJA 3SY5A 3VKJA 4XTIA 2FPYA 3TU9A 2JGQA 3OA3A 3P80A 5C5YA 3G18A 3USBA 5AHNA 2QR6A 3PB2A 4LNYA 1TO3A 3P61A 2I14A 3BGGA 3HMJG 2JBMA 4L4MA 1GG0A 3G1AA 2PURA 2YX0A 1LRQA 3W3OA 2ISVA 3TXZA 4MOZA 1EPXA 4XKYB 4CQ8A 3QF0A 4OV4A 5AC6A 1SPQA 3S1XA 3IGSA 1YLVA 1N8FA 3TC7A 4X22A 1L9WA 5LNSA 1KM5A 2VKZG 3N9SA 1WX0A 3GX9A 4RKAA 1R2TA 3L0GA 4O11A 3W2JA 3C3NA 3ZWTA 1TRIA 2NLIA 1QDSA 2J27A 3EX3A 3HGSA 8TIMA 3BLEA 2Y7DA 1GVFA 5E93A 1JRCA 3SZ8A 4JTJA 4N6FA 2E09A 2PE4A 2QJHA 1O95A 3O6CA 4XWUA 1SSDA 5BNKA 5AYZA 1I2NA 4JS3A 5LZLA 1MO0A 2YDAA 3NPUA 3CHVA 5F4WA 1I2OA 2VFGA 3M47A 1JQVA 1YYAA 7TIMA 1GYNA 1LLWA 3PC0A 3WJXA 2ZRXA 3FFSA 5AYXA 2C19A 3O16A 4EVZA 3CWOX 3LCXA 1S5VA 1K02A 1JQXA 1PV8A 5D33A 3SGZA 1RD5A 3B8DA 4IMFA 4UNKA 5FEPA 2ZA1A 4O53A 3JR2A 3INPA 2VEPA 3W74A 3LCFA 5DELA 3PG9A 1U5JA 1OK4A 4PC8A 3PSWA 4KFNA 3NO5A 4JTKA 2BTMA 4NZJA 1H1YA 3GZ3A 4OQVA 3RFAA 1XXXA 1ME8A 4JICA 1OYBA 4O4WA 4X9SA 3WJSA 4RJEA 3NM3A 2VC6A 2CZDA 1SFLA 3GDMA 4X3ZA 2D73A 1TV7A 3PM6A 5K3VA 3L65A 1EIXA 2ABBA 5TQLA 3NL6A 3LXAA 1VLIA 2CLLA 5G4EA 5DY2A 3FKRA 5E1QA 2CLFA 2B7QA 4AF0B 1I45A 1TQXA 1VQTA 4JTIA 2GVGA 3WK2A 3OIXA 3IGUA 3BVJA 1F05A 4UMCA 2QCEA 4DF2A 1AMKA 3LBCA 4OV9A 4JYDA 3HGRA 1OYCA 4JIPA 4FIRA 1SZNA 5A5WA 3TCEA 1RVGA 2FJKA 3TQKA 2VFIA 3QQ0A 4AWUA 3G8RA 1M6JA 4NVTA 1K03A 1WBHA 3N34A 1GVSA 3W7OA 6TIMA 1T8XA 4K37A 3H54A 1X8FA 3TQVA 1OFAA 4S2CA 3OBKA 3P81A 5BW6A 1C9DA 1HO1A 3E02A 4W9TA 1K8ZA 2JK2A 5LHEA 3NZRA 2A1YA 5U7SA 2C6QA 4ADSA 1EEPA 3C0JA 5CPOA 1FXQA 2QKFA 5HUPA 1LTDA 1GVOA 1SZEA 4FNUA 4K6AA 4E2BA 4FNPA 1XCFA 2O7SA 3E12A 3C4UA 5CZ0A 3EX6A 4Z08A 4IOTA 3L68A 3W72A 3UXDA 3L5LA 3QPYA 3QEZA 2ATSA 4K39A 4LT9A 5BRBA 2OT1A 1WQ5A 3PY2A 1LRNA 4OBTA 3FA5A 5AFDA 3EB2A 2QCFA 4NJHA 1YADA 3KRSA 1GVRA 1EB3A 2A5HA 4O10A 4RX0A 3UWVA 2C14A 3G1DA 1DQWA 1FWWA 1QPRA 1PCKA
chains in the Genus database with same CATH superfamily
5A8MA 4DLFA 1T96A 1B5TA 3O0FA 4RR4A 3M7SA 2OB3A 1UKSA 3NOEA 1KQZA 4Y9NA 5CSSA 3URAA 5LGZA 3JVAA 3WMCA 4O0ZA 1B31A 4KCTA 4K7VA 3LTYA 4YYFA 1E6XM 4L9XA 3VGHA 2GK1B 3EMZA 3LN3A 3A64A 1EHNA 3TMLA 3KE0A 3DESA 3MWAA 1JF5A 3QW4B 1TPEA 5HNTA 1WDPA 2MNRA 1W6TA 3SO7A 4PMUA 3L0NA 1V02A 4UQAA 1W1ZA 2FGLA 1IIGA 3W83A 2F9RA 1Y5XA 1YQ2A 2WMIA 3NFUA 1GZ1A 2VD8A 1AUSL 1EYEA 1VPYA 3GIQA 3ECQA 4S38A 1V51A 4V27A 4E0CA 4JIIX 2J8FA 3TJXA 2VVNA 3H4GA 2XFWA 2WO5A 1UWIA 4H4IA 2P8BA 3SIMA 3WNKA 2HVMA 3LRLA 1FWFC 1E4LA 1B3YA 1EKOA 2PBGA 1BQCA 3HTWA 2QCGA 4C6LA 1W9VA 4MIMA 3FN9A 3T0CA 5CSUA 2ZZ4A 1Q6FA 1IGSA 1QHZA 2VNCA 5TIMA 3LCWA 3MBFA 1J01A 5BOEA 3NZQA 1QI0A 2E6AA 4C90A 2WCSA 4J3WA 3OTRA 3QR0A 2NXHA 3BCDA 5C0QA 2AL2A 2XGIA 1XG3A 3M0LA 2AQWA 1S46A 4HK5A 5FJRA 3TEVA 3APYA 4LAMA 4E5TA 5MKGA 1TPB1 5CEWA 2XGBA 4RDYA 3TUUA 6XIMA 3GVRA 2CBVA 2PCQA 3W73A 1UHVA 1IEVA 3EX1A 2JKEA 1WXJA 1WOAA 1OFOA 2VRQA 3V0TA 1MWOA 3HBLA 4ZSTA 3MV01 1RBOB 3GH4A 2JIWA 4D6EA 3M0ZA 8XIMA 5CH9A 3N4EA 3T42A 1MRAA 3VIJA 4ZB2A 3WLNA 1PIIA 2R1MA 1VCGA 1XHGA 2DP3A 1ICPA 3P60A 4Q4OA 1W3KA 4C91A 3C2VA 2J8TA 2PDHA 3PUOA 1Q13A 3ITLA 3WF1A 4YVXA 2Z0IA 3ZQ9A 3V16A 3H7UA 1E6QM 2OWWA 3GYEA 4UR8A 4N02A 4AW7A 1V6XA 4OOZA 1JGIA 2NSXA 3IEBA 1ZFJA 3SECA 1BKHA 4PEEA 3QFWA 4IF2A 3IARA 1OGSA 4PMZA 3N9KA 1LG2A 5LIUX 2P76A 1YPXA 3K1GA 2YSWA 3VZZA 3VOIA 4GX8A 4J3XA 4H6EA 4ATWA 2DZAA 5LA2A 1TTQA 4AZ7A 2DZUA 1EFZA 4ES4A 2CHNA 4H83A 3MUIA 3S1GA 2DSZA 2PDFA 3TQPA 3WF3A 3KL5A 3BZJA 1SGJA 3LPGA 2V3DA 1K77A 2ACSA 5F2LA 3PFRA 1UOKA 4EAYA 2OVLA 3EDKA 1VYSX 4WOZA 4FSAA 4IXHA 2DU2A 1RSCA 1W5PA 1OX4B 3L21A 5BRQA 1BYDA 2E9LA 4POCA 1E1CB 5ABTA 5H8MA 3MHGA 3RLHA 3BWWA 2E28A 4BQ4A 3GG1A 1HGWA 1JZ3A 3OLGA 3M5XA 4HSNA 4R53A 2IXVA 2GQ8A 2F6UA 1XBYA 4MUZA 1VKFA 3B4YA 3W2UA 2NW0A 1TUXA 3C2OA 3DHFA 1J2BA 2PB1A 4XZ9A 3SCPA 1XSKA 3TFCA 2RKXA 4R9XA 4R5EA 4QEHA 4HA0A 5A6AA 1AW1A 1A5MC 4JR5A 2FH6A 1XIDA 1UIPA 1UR0A 4PEKA 2GVYA 1SFSA 2HISA 1VJSA 4WKHA 4ZA0A 3TH6A 2VEKA 5CC6A 3I7QA 2PDUA 4M7SA 3GVVA 5T8GA 1LWJA 3O3RA 2OO6A 3XINA 2Y5EA 2WSRA 5FF4A 3S1UA 3GH5A 2D24A 1FFRA 4UTWC 4H3DA 3H2CA 1MNZA 1R38A 2YL5A 2RAGA 3BOLA 5FF7A 3NQAA 4I7WA 1VH7A 2PEVA 4CD6A 4PCSA 2CZFA 4S3EA 1K3UA 3AHXA 3BAKA 3LM7A 1A3XA 4IJCA 3C86A 1RZMA 4C1NA 1BPLB 4EF8A 2XIBA 4FX7A 2V5DA 4OOUA 1JPHA 1UH3A 1KC7A 5KZDA 1QO5A 3HM7A 2XU2A 2YGYA 1R46A 3BLPX 4XBSA 3KVMA 4KBXA 4XO7A 2VC9A 3AAMA 1GNXA 4JCLA 3FSUA 1AG1O 4MDOA 2ZRUA 2NX3A 1S3TC 2BHZA 2VC7A 3QQWA 4H6QA 3A3WA 4U2ZA 4MZYA 1W91A 1ISYA 1F4HA 3CK5A 5CKSA 1SM9A 2Z28A 4QHRA 1QBAA 4AU0A 2FIQA 4GZEA 1SR9A 1B9BA 3KP1A 4HYVA 5CSYA 3CL8A 2Y88A 1PZ2A 2ZTKA 3H24A 1KW1A 2BZNA 3BV7A 2GSEA 3W84A 1P5BA 4JX6A 4BHYA 1POKA 5BWFA 4QROA 4IMDA 3P82A 1JD9A 1F3WA 2Q71A 4CN6A 4RW5A 1JYXA 1RA5A 2Q6ZA 4RNHA 1GG1A 3O15A 3O2LA 1AH3A 1LBFA 1KFJA 2G37A 4BK9A 3VE9A 1CENA 3I3DA 4X0NA 1N8WA 3S2MA 3AXXA 3EOLA 3LHTA 3B0PA 3PJUA 2BOGX 2VR2A 1TREA 3C2RA 1OINA 3AMCA 4UTIA 3S5NA 3I6RA 1Z44A 5IFTA 2CBIA 1Q63A 3HPFA 2WNZA 5DO8A 3MSGA 1D2KA 1J5SA 4YPJA 1TPVA 2X16A 1MEHA 4CEUC 4FNQA 3GXIA 2GOKA 1SJCA 3P62A 3QGAC 3H2NA 1XRTA 3LENA 4EXBA 3QSRA 1X1ZA 3WLTA 4REQB 3MP4A 3W7NA 1EJUC 2HWGA 1IQ8A 1Q3NA 3AS1A 5BZAA 1R3TA 1YDNA 1NDYA 1RY8A 4GY1A 3FDGA 3ABXA 1P1XA 2OZ3A 3MUAA 4RZ4A 1NFPA 1EJVC 1RALA 4NX0A 3W22A 3B0XA 2DZSA 4Q7BA 3NUKA 3G1HA 1WO2A 3DFQA 3ZJKA 4DBEA 2WJFA 2WPBA 1DIKA 4CD7A 1AZ1A 2YL9A 1V79A 3LQGA 1JCYA 3THCA 1Q4NX 3NVTA 1GYLA 3RJXA 3ZLFA 2BHUA 1CTNA 2OU4A 1C8YA 4G7FA 1BD0A 4I3GA 1D3HA 3G3MA 4GYKA 1F6PA 1XLCA 3LHWA 4D8AA 4F2BA 4WVXA 4B5NA 1JEZA 7ENLA 2ZDSA 3CMJA 4WJ8A 3RCNA 4AD0A 2E6DA 2BP1A 2GUYA 3G22A 1JZ5A 7TAAA 1KXVA 2Y5JA 2VFFA 2O9RA 1F74A 3PWIA 2Y4SA 3IJLA 1W2VA 1TA3A 1HKVA 4QQ3A 4B15A 1QU4A 3EGJA 4D2JA 3CAWA 2DFAA 1JZ7A 5D8WA 4CNUA 2HS6A 5H8PA 4B3ZA 4MG4A 3AXMA 3W4RA 5KSWA 3ZT6A 4G6CA 1T6MA 1VCVA 4L5ZA 1JXKA 3R6IA 2GWNA 4I9TA 4NQ1A 2BVTA 1B0IA 1P0NA 4YS1A 4HKPA 3LBMA 1V6UA 3W25A 2J7DA 1G1YA 2O4MA 1C3FA 2XJ7A 3M0HA 1TR1A 3S4TA 2WQDA 2YOCA 2OZ0A 4UCGA 2OOFA 1CNVA 1A50A 4NJGA 5G4WA 2DSWA 3EMCA 4LVDA 2I57A 5G2WA 4TTUA 3HFTA 5C2XA 1CCWB 3OHIA 4UUIA 4JY9A 1DJIA 3DHDA 2NT1A 3CS2A 1E4IA 2QUMA 1FCUA 1Q6GA 1E6RA 1KR1A 2CWXA 3RXZA 3TNOA 1ZU8A 2PWFA 5BXSA 4XD4A 1GKQA 1KTBA 1HIZA 4M56A 4JTEA 4LCQA 4Z2IA 3G3DA 1DXIA 3BTNA 4LY4A 3ARTA 1CXLA 3UA3A 5HPOA 3CMFA 4EK7A 1B3ZA 4KRUA 4XVEA 1HP5A 1XL9A 4PUJA 3SQMA 3OVPA 5CAHA 1FY6A 1X39A 4Q33A 4Y9AA 5L9FA 1ZJBA 3DAQA 2JEQA 2GSHA 4GNJA 1RQHA 1Q8AA 1ZCOA 4AZHA 3F2DA 3WQFA 3FXYA 3QGKC 1JI1A 4N9EA 1PX4A 2H9AA 3CASA 3QY6A 3KP0A 2R82A 3PZIA 2JF6A 4JKMA 2C15A 3TA9A 1HO4A 4DZAA 3W81A 1MDRA 1FWSA 3SFWA 1UW9A 4AYSA 1N7KA 3WENA 4QTGA 3PSVA 3TN5A 4JFVA 3I6TA 3LOTA 1RUSA 2VZSA 4FF5A 4JL1A 2H3BA 4EPBC 4WR3A 4WDTA 3B4UA 1LP6A 3TSDA 2CCRA 3SQSA 5JBFA 3W1MA 3KVLA 1WAWA 3GNXA 3XISA 1DJNA 2CETA 4UFMA 4QNEA 1UP3A 2FPVA 5CBBA 1LWHA 4FNRA 3UG4A 3L4ZA 4IL0A 3QV7A 4YTTA 1VIZA 4J35A 4E8GA 3UY8A 4DBSA 4L56A 1UA7A 1H1ZA 3NL3A 2HBVA 3PBWA 2BOFX 4P2VA 3CHFA 4MKVA 3TIMA 1TTJA 4JQ3A 2XWDA 1EZ2A 1RJQA 5F1UA 1UUOA 3D3FA 3UR5A 1E4MM 3CQKA 2QPXA 2G97A 3KBMA 3SM0A 3L2IA 3H6OA 1IIHA 1UBSA 3VNKA 4AC7C 4JPGA 3LXCA 5HR7A 2EQDA 5H8UA 2Z27A 5F1VA 5DCBA 2X1IA 4H41A 4ZZ9A 3BAIA 2PPGA 5BMXA 2HPMA 4L64A 2JE8A 2GSJA 4UIOA 4WIWA 4MZ1A 3T2PA 5F2MA 1UJPA 4MGGA 2WBGA 3USZA 4H7CA 5C8BB 4MPQA 3AUOA 3TZNA 3S83A 3LSBA 1JYWA 3VNDA 4UWMA 1M7OA 2BGQA 3E5BA 1BXNA 4XUGA 3U4AA 3WLKX 5EMYA 1MW1A 3R1ZA 3UR7A 2OELA 1W1IE 1J0YA 4U5IA 3GG8A 4UB9A 3GHUA 1R9YA 3T2QA 3GDRA 2ZUWA 3CH9A 1PWLA 3M0MA 4K2SA 3UPWA 1BHGA 3DFPA 3CEUA 3SGGA 2ZXQA 4AVFA 2WSPA 4XKYA 2YA0A 2EBNA 4O4VA 1TCMA 2QPSA 1A5SA 2DIKA 4A21A 3ZZ1A 2BNJA 2E8YA 1G01A 3V0SA 4D6CA 3NQDA 4GUJA 1PUDA 1VPXA 1KXTA 1NAL1 1V0NA 3CL6A 3WBYA 3G6LA 5K9CA 1JAKA 5D09A 3T1GA 2WLYA 3STGA 1SYTA 2P3ZA 1SO5A 2GJXA 1I0DA 4W7UA 1JI2A 4XX6A 1P48A 4O1FA 2VT0A 3F2BA 2DV0A 2PRMA 1HL2A 4IUGA 1GW9A 4JHZA 4GXWA 1MRQA 4I8DA 2OPJA 4IXXA 4F2TA 3E5PA 5CGTA 4HNTA 1DQXA 1UUMA 3F4NA 4GMEA 1BEUA 4ML9A 1MSSA 3G1VA 3LGEA 1KKRA 2V63A 1R2SA 1DJGA 3WFAA 4DEFA 4C60A 4GCXA 4US5A 3RCYA 1G0CA 5D9PA 2QCHA 4UCFA 3VNYA 5JQ9A 3R10A 1XLMA 4QSHA 3WK0A 3U8GA 4J3UA 3H21A 2QUNA 4GQRA 4IWWA 1SQ7A 1OABA 3MCNA 5F4XA 2B4GA 3DOPA 3CUIA 4IMEA 2TMDA 3IJIA 2C13A 4RCXA 4AHPA 2ZE0A 5IBXA 1YE6A 4IQDA 5BOOA 3N2XA 4LW7A 1P43A 3PJWA 4EWJA 3WZ0E 3IRSA 4JDYA 2D2GA 3H2OA 1VBRA 1CB2A 2AAMA 3KTCA 4A35A 1GKPA 3IAPA 1AJZA 1JG9A 2QCMA 3G1YA 2PC8A 1PL9A 1B57A 3N15A 4DM2A 4TUFA 5JH1A 1WKDA 3GBEA 1E9YB 1G7VA 1H60A 4PFMA 1KGUA 3CV1A 1CGTA 3SR7A 1XX1A 5I23A 4ATDA 5LXEA 2E4TA 2J77A 2BXYA 1TWDA 3CYJA 2BXZA 1NOFA 3A23A 1OGBA 1PTDA 4G56A 4FMVA 1P4CA 1RBLA 3BOXA 4QDWA 3GY1A 2VURA 3AMKA 2XVKA 3DYPA 1ECEA 1IEQA 4JTFA 4EP8C 1IE7C 4ORIA 4TX6A 4XZLX 2FDSA 4M8UA 3DIPA 3C61A 2QXWA 3VAVA 3BLIA 4LAUA 1HT6A 4JTDA 1KBIA 2XFYA 3FOKA 1WKFA 4AD5A 4EX4A 1V6YA 3D0CA 3QYQA 2Z2BA 9XIAA 1J6OA 1GZJA 3GTNA 1R87A 1LRTA 5HK4A 2R24A 4BZYA 5C2CA 1RBAA 1KCXA 2I7GA 3BDKA 5JIPA 4DWDA 1LWIA 5J5RA 1EJRC 4DJEA 4CLMA 4C6BA 2WYSA 2GDUA 1MXDA 1Q7QA 2PC4A 3EPNA 3W82A 4FXSA 4IG2B 1FDYA 4XZHA 1EJWC 1XGDA 4FX8A 3ABSA 1PO9A 4UTLA 5EA9A 1CB7B 1JL8A 3MDWA 4BWLA 3AICA 4CNSA 3DHPA 5E6YA 2Y8UA 4TX8A 3MSRA 4GO9A 3S3GA 5D8ZA 3DERA 3S42A 4U10A 3RK8A 1N8IA 1XIHA 5FEWA 3H12A 3PTQA 4FX6M 1R3VA 3H26A 3V36A 3VIMA 1FCQA 3CHCA 1OADA 4UZSA 4PZVA 2DORA 3TOYA 3VNIA 1X38A 4EKJA 4ORMA 2CLIA 1U1JA 1EUNA 2WMKA 1YNYA 4JAWA 2PDKA 2Q8XA 3UZ5A 3EB4A 3SCQA 3O63A 4PODA 5A8QA 3LPPA 1CW2A 4GJJA 1CEOA 2BMBA 3NGJA 3H2MA 2F61A 2VX5A 5K4ZA 4P7OA 1XUUA 1ITXA 2BVDA 3V1HA 1UJQA 5A69A 3EOUA 1THFD 4AWSA 1Q5MA 2PWHA 4LB4A 4JX4A 4AIEA 3VGEA 3UWQA 1GHRA 1ZGDA 2I9EA 2LLEA 2QDDA 1HFBA 3EXSA 4LC8A 4AD2A 4AZBA 1CIUA 3WQPA 8CGTA 4F9JA 2WB5A 4PSPA 1QT1A 2A7PA 1UZDA 1PBGA 3KCJA 4DXXA 2E9BA 4B16A 2ZX7A 4RV3A 2WQPA 1OFRA 4ALDA 3NR0A 1ZHAA 3KOWA 5KINA 4F40A 1E1FA 3GR7A 1H2JA 4NI8A 1UP2A 4CEXC 1XGZA 4UTKA 3SQLA 3VDHA 2NXGA 3LV6A 2WC7A 3GDBA 1Y0EA 3B06A 4N4QA 1YTEA 4IGMA 5LNUA 2E5BA 2VXNA 3EX2A 3GG7A 1NF0A 3KEHA 3Q4DA 2HEJA 3BK0A 3UCCA 1OIFA 2Z7KA 4XG1A 4H1ZA 5JIWA 1OD0A 4GG9A 2NWRA 2PU0A 1WAUA 2GLKA 3QH2A 2ZYFA 4P8UA 3CUXA 2Q3RA 2ZCGA 4BQ5A 1JPDX 1LT8A 4TX9A 3A5FA 1X6UA 1EWDA 3ZFHA 4F0SA 1X6NA 3N18A 2ZZ1A 3UWWA 2OEKA 3VD4A 4IMGA 4DZHA 3M4HA 5I2UA 1OX4A 1PX3A 1EDQA 1OVDA 1E1CA 1XUZA 3KW3A 5AC8A 3ITTA 3GD6A 2ZVRA 1FWBC 5I03A 5K2ZA 3WFZA 3W7JA 3HG2A 3MP5A 2BWGA 3L4WA 4PMQA 1Y8BA 4U33A 3NVDA 3KDOA 5HUOA 3VC5A 4F8XA 1XLIA 3CZKA 3T8QA 2OZTA 1SFTA 2PP1A 3VC6A 5E5CA 2WNWA 3N73A 4E38A 3JS3A 4UC5A 4HNLA 3FA3A 3P6LA 4W93A 4BEQA 1A5AA 3VTRA 1TPDA 3GE7A 1HJWA 4PUDA 1KRCC 5EB8A 1UUQA 3FK4A 5XIAA 1VHNA 4PTWA 4U28A 3AXKA 2DIJA 3CQJA 3SCTA 5G1YA 3STCA 3JW7A 1UWUA 4YL2A 3BJTA 2WMJA 3G0SA 3BXWA 1NTHA 2Z6IA 2ZRYA 3U9IA 1GEQA 4CU6A 4JTRA 3VCRA 3AIBA 1WNOA 3BW4A 2G50A 2PTDA 2VGIA 4IZGA 5C9XA 2YCLB 4RE4A 4PUEA 2WW5A 1MQPA 3R2GA 3WEOA 4IJBA 3I7SA 1OCNA 3NPXA 1O60A 1K6WA 1UQYA 3OIHA 1EC9A 3ERPA 1YNQA 3B0VC 4GO8A 1ZP4A 5HNUA 4C6KA 3BJFA 3BSGA 5KITA 2V3EA 4NF7A 4ML4A 1XRFA 4JN7A 1OC5A 4JN6A 2DZPA 3BO9A 3GNPA 4UQEA 1RHCA 1BYBA 4S3BA 2OZ8A 1TMHA 4L6HA 1T0OA 1GZGA 1OCBA 2R1KA 1VYRA 4Q4RA 3VKJA 4XTIA 1ZZMA 1I75A 1W3HA 1NWUA 2QR6A 2BASA 1TO3A 3P61A 3BGGA 2EEXA 4FZIA 4L4MA 3QR3A 2XZ9A 2XH7A 1GG0A 3G1AA 1DJZA 3BMXA 3VGFA 2F2KA 2ISVA 4Q8NA 3MMWA 1EPXA 3OO2A 2WM1A 1HJXA 3QF0A 3FJNA 1YRRA 1HKJA 2PGWA 5AC6A 2HRWA 3NTYA 4DZIA 3F4DA 3IGSA 3TC7A 4QGCA 1TE6A 2DH2A 4IIEA 4RKAA 3TJIA 1MUMA 2NLIA 1QDSA 1XYLA 3HGSA 5JXQA 2Y7DA 3RLGA 2F8QA 4XZBA 2VC5A 3FXGA 3GM8A 4N6FA 2E09A 2VRKA 3N6QA 3O6CA 1O95A 1O66A 3LUTA 4DWSC 4P7RA 3E6EA 2V68A 4J7RA 4Q6XA 4JS3A 1MO0A 3NPUA 1I2OA 3MA8A 1EEXA 1NWTA 2YBUA 3EA1A 1GYNA 1QK2A 2ZXDA 4V2XA 3FFSA 5AYXA 2C19A 4REQA 3CWOX 5IDZA 4HPGA 3CPGA 3AJ7A 1K02A 1XICA 2F2HA 4JQ1A 1TWWA 3W28A 4GJIA 2VEPA 4ZTXA 3FW6A 5DELA 4PC8A 3HJEA 3WBWA 2C1IA 4X2PA 1TWIA 4KFNA 3ZR5A 2BTMA 4NZJA 1XRSA 3RFAA 1BQGA 4JICA 4H00A 2ZUNA 4O4WA 4JIRA 3EZ4A 2VC6A 4KCVA 2D73A 2W91A 4ZO9A 4FOKA 4KEZA 2GQ3A 1VLIA 1EDGA 2PDWA 1EC7A 4BQ2A 3H22A 5ENLA 4AF0B 1VJZA 1TQXA 2Z26A 4AZ6A 4AMCA 4DO7A 1P6BA 3OIXA 5A2AA 1RK5A 3BVJA 1SJDA 3CUJA 3ENLA 1SMDA 1GQJA 2FMNA 3LBCA 2RGMA 1G9HA 1JZ4A 3ID7A 4DZ5A 3GS6A 1JFHA 3G77A 3DBNA 4AWUA 3G8RA 4PMJA 4D6JA 1T8XA 4K37A 1X8FA 1OFAA 3FV9A 5EMMA 2P5NA 3P81A 4H8HA 1HO1A 3E02A 2A1YA 5U7SA 4IQEA 4GD0A 3C0JA 2MANA 3AXHA 5HUPA 1LTDA 4KGJA 1GVOA 2VR4A 1SZEA 4FNUA 4K6AA 4E2BA 2PP0A 4XD5A 2O7SA 3N2BA 3E12A 4D1JA 3PZUA 1E6SM 4MJ2A 1R8LA 2R1LA 3L68A 3NQBA 3W72A 4B5UA 7PTDA 3L7RA 3QEZA 1NH6A 2AMGA 3RU8X 1QNQA 3EB2A 4BY3A 1Q6CA 2QCFA 5ABGA 3OBEA 3CZGA 1GVRA 5A6SA 4L1WA 1AA1B 2J74A 2XIQA 4O10A 4IFKB 4MB5A 3UWVA 2GJRA 3OA5A 1SJBA 2CERA 3WDRA 3LLXA 2WHMA 4MF4A 1IXQA 3QPEA 2TPSA 4F48A 1AK5A 3I65A 2YA2A 4IIGA 1XV8A 2J9YA 2QMJA 4CNPA 3VK5A 1T40A 4PTDA 3NSNA 5RUBA 2ACRA 4HHHA 1HQTA 3WF2A 5FA5A 2ZZ2A 3ICJA 4WKFA 1XWYA 1JFXA 4AXNA 1A80A 3MUY1 1F8IA 1GQIA 3UXLA 1UIOA 4QS5A 2EG6A 1KRBC 1MEIA 3QOMA 2PTXA 1D9EA 4KFOA 2QUUA 2VELA 3EMQA 1EBHA 1P0KA 2P3EA 3OBAA 5I3IA 3WBAA 4H9UA 2OWXA 3TN6A 3H4WA 3NWRA 2HMCA 2CC0A 3NOYA 4D6FA 3MKVA 3F03K 1EP1A 4JFTA 3WQWA 8A3HA 4A3HA 2EKCA 3D5HA 2ZX9A 5EPDA 4HNUA 4Q8PA 1CXIA 3SAZA 5D04C 1R7OA 4O8AA 3FVDA 1JAEA 4EACA 1ML1A 4FLSA 1LOQA 2BXVA 3PZNA 3FNDA 3UVAA 3KL0A 4QITA 1ZBCA 1TV8A 5I09A 3DXIA 3LQLA 4KT2A 1I1XA 1OWQA 1K9DA 3B0YA 4QJ4B 1UKTA 1H3GA 5JU6A 3WUBA 3FGCB 3KRZA 3HO8A 3WK3A 2BX7A 2J88A 1ME9A 2VCAA 4FPSA 4UTTC 4L4OA 3MTWA 4QXIA 2C8NA 5EYWA 2Z1BA 1O94A 1JF6A 3TC3A 1J18A 2X7WA 4M19A 2PRHA 3VOFA 4LNCA 4B5SA 1M65A 1NJJA 2EKGA 5I79A 2TODA 3B04A 2NLYA 4O19A 1LLZA 2QIWA 1QNSA 4PH6A 1A5LC 4LYPA 1ADDA 4RZ5A 4MPKA 3SSZA 2I5IA 3ABRA 3S9ZA 3O6AA 4K7YA 5HMSA 5D2YA 4US6A 3RMEA 3UCDA 3H8AA 2YPIA 3EKGA 4WKAA 2QV5A 3CUGA 4A05A 5A8PA 3S1VA 4E3VA 1AH0A 4M5PA 2O9TA 1TTIA 3GNDA 4WY0F 3K1DA 4XZWA 1X6LA 5IM51 5I24A 3MC5A 3N2MA 3MY9A 2R9RA 1SO3A 4ICNA 3CTLA 1EA9C 3FJ4A 3MP3A 3DI0A 3SN1A 3A24A 2GFTA 5CAKA 4UBPC 4MZ8A 1FCBA 4DJDC 4KGLA 2PGFA 4GY7A 1PHQA 5HBFA 4CQCA 3DBPA 4J28A 4JTQA 3WQVA 2PLCA 4WJEA 1PJ9A 4PR4A 1R30A 3AHZA 2RJGA 3TLQA 5CLTA 2QIIA 4KEVA 1TCDA 4NNAA 1QOXA 1T41A 3QMRA 4AD3A 2O55A 4GGHA 2WWCA 1E15A 2WNQA 5M1TA 2PDLA 5C6MA 3LS9A 5A6BA 2PMQA 5D2VA 3J7HA 1GQNA 1H62A 4HZ6A 3UPBA 1TMLA 3AYSA 1FX6A 3QLLA 4Q8VA 5REQB 5LHFA 3WCZA 4MFEA 4PMDA 3FEMA 4OBRA 1P0DA 5KZMA 2OKOA 1GOOA 4W8AA 4U3CA 1H4PA 4QR6A 4Z17A 4AD4A 3BURA 3AROA 2ZUTA 3NPWA 5EGRA 1QCWA 3SW6A 4NAEB 2XWEA 3VXGA 3MMTA 4O54A 2WC4A 1IT8A 4N9DA 5CZJA 2V5BA 1PEZA 2NX9A 3EWZA 1GEHA 5CQ1A 3E2RA 4Z2KA 5B7ZA 4UMAA 1ZAHA 4G1NA 2BBFA 3S0CA 1ZNNA 3OW1A 4PCNA 5I3HA 3MU7A 2O92A 3B8TA 3KBWA 2NQZA 3MO4A 1WYIA 1PZ0A 4AC1X 3WYZA 1K8YA 4NNBA 4C6PA 1REQB 3EDDA 3SBFA 2E3ZA 4Q8QA 3DFSA 1OM0A 2E6FA 3I3BA 2VZOA 3BICA 1NDVA 3GVGA 3DFYA 5C9RA 1KFKA 2Y6ZA 1J0IA 4GBDA 3VIIA 2O0TA 3QZEA 3URBA 4MYXA 3GDLA 1VFOA 3EBVA 5H2ZA 1CGXA 3SUUA 3G8EA 2Y85A 1TJ1A 3NSXA 2QNEA 1ESWA 4L4LA 1VD6A 4KPLA 3N25A 2WSQA 2Z1WA 4FO4A 2AMXA 1DP0A 1E0UA 2QF8A 1ZBWA 3UBPC 1TVPA 3M16A 1QBBA 2E68A 2CZ5A 3M44A 3V0UA 4HOXA 3BG9A 4XAPA 2EPHA 2FHBA 1L2QA 4HPJA 4A8RA 3EPMA 3W87A 2OMAA 3LMZA 4LS2A 5LSMA 3EOEA 3UVIA 4DM1A 3IGXA 4Z2JA 3O7UA 2YCKX 2VGGA 2CLPA 3HPAA 3M0YA 5AHEA 4UTMA 3GLCA 1GOIA 3FYYA 4KWWA 1OT1A 3RIKA 1G67A 1UWSA 1O6IA 3DI1A 3RO6A 2A3AA 4ZO6A 2VZUA 3CQ0A 3MYPA 1NELA 3WF0A 1R47A 1A5UA 4G5DA 4GXMA 1TELA 1KWKA 5DRCA 1ZRQA 1EIBA 2XVNA 4LC6A 4JN8A 3UG5A 4WDUA 1JDAA 3UJFA 3TMQA 3VCNA 3LU2A 2PDXA 1V3HA 1L6WA 2PFHA 2GJLA 3TTEA 4GYPC 1E5JA 3C0QA 2G3FA 1RJRA 8XIAA 2P50A 3K13A 4YTQA 1YTDA 3LK6A 4TIMA 3KDNA 3PULA 4GIRA 2ZUSA 5AVNA 3WH6A 4BJHA 3OLDA 5MF5A 1SW3A 5CJNA 5F7UA 5HXMA 4H9ZA 3CUHA 4U31A 4G8TA 3R94A 6A3HA 2XH4A 3SN4A 1JRBA 3OU8A 1OK6A 1IHIA 3GTIA 1CGVA 5FACA 1W1TA 3WUEA 4MY1A 4ROPA 4GUIA 1JZ6A 1YXDA 4HNOA 4OT7A 3NM1A 3M0VA 2YZ5A 2PWUA 4NZ1A 3BLDA 3B97A 3MUXA 4XUYA 2FGZA 1V3LA 1FP8A 3ONBA 1QPKA 1WB0A 2DVXA 4PA8A 1OX6A 2Q01A 2RDWA 1XKYA 4FP1A 1DTNA 2GL5A 1WDWA 2DH3A 5G1TA 1GKRA 1LL6A 4CGTA 1BSLA 3QVQA 5I7GA 4PBFA 1NFGA 1V03A 3WDHA 1VHCA 3FDKA 1ME7A 2VUYA 1DIDA 4XAFA 1PVNA 4HSHA 1E3XA 1EJTC 3IANA 1DPMA 4R88A 1T8QA 3WLIA 2J79A 3G1XA 3SADA 1DQUA 2OYMA 2CKRA 4O28A 5HMDA 3B0UX 4PUMA 4XD6A 4HCHA 1Q45A 3WLSA 4HPHA 3LTPA 1TPUA 1W17A 5A8NA 5EBAA 5JUVA 1VIWA 4XK2A 3TTSA 1JDDA 1UH2A 4L7ZA 4FLQA 1K7EA 2YW4A 2Q8ZA 4QS6A 5ABFB 1IEXA 3ZO9A 4P61A 1H50A 3HURA 3QV6A 3MWCA 1NEYA 4ATLA 5XINA 2OGJA 1J96A 3PPCA 2R1NA 4Q3MA 4QJ5B 3LB0A 3KFTA 4MFDA 4UQDA 1P1MA 3P67A 2V69A 4XZNX 1MZHA 2R6OA 4K1WA 3UERA 1MDLA 4H9XA 4NL1A 5KZEA 4HPXA 4JTGA 1ECQA 4AD1A 2YL8A 3R0KA 4YTSA 5IXEA 3TC6A 1VBUA 2ISSA 2ALRA 4RXGA 1E6NA 4H9VA 1UG6A 2NX1A 3CHEA 4LVAA 4Z2GA 3H2EA 1LDCA 3SCRA 3MZ2A 1XSIA 4D71A 2VCCA 5H1WA 2X09A 3BG3A 4MWAD 1J79A 1TG7A 4F0MA 1RLDA 4PL1A 3GNNA 4U3AA 3I68A 1FUYA 4TOQA 2ZQ0A 4Q32A 4Y8FA 1EWEA 2J25A 3BL3A 3CTTA 3PB0A 5AHLA 4UQCA 5DMLA 2QDGA 2QCLA 4K36A 4H01A 3BMWA 3TVAA 1H1NA 1EHAA 1IXPA 2Y8KA 3SEPA 4LBRA 1C29A 2AGTA 3SGUA 2HZGA 2XN0A 4FR6A 1VGAA 1K4HA 1X7IA 4HJFA 5HQEA 1KBJA 3ZLGA 1GHSA 1E0TA 3LX9A 1DJHA 4KEMA 2Y61A 2Z1VA 3WUFA 4QLKA 1SO4A 3PVFA 1OHLA 3V1PA 3UZWA 3PR2A 4C6FA 5G1MA 3VDBA 1K9FA 4HOWA 4RLIA 3HGOA 3CL7A 5DBUA 3N14A 2NV2A 2CXGA 3UETA 1AQFA 1OFEA 1JD7A 1GVIA 4K3ZA 3R89A 1R3YA 1J0ZA 3PNZA 4XSMA 2WCAA 4J3TA 4UFLA 1H11A 3OHMB 1R7AA 4FR1A 3GDTA 1VF8A 2R91A 2FVLA 4MWAB 2FTYA 4QDPA 3CAQA 2H8XA 3W2NA 1ZENA 3NXFA 3FIGA 1FWAC 1N55A 4WXZA 4AYGA 1BWLA 4IQLA 4MKSA 2HTMA 2Y89A 3YPIA 2J7GA 3WFLA 1PKNA 4GFSA 4OWGA 4S3GA 2WPGA 5A2CA 3KOFA 3LG3A 3R43A 1XLGA 1YTKA 1PE1A 3FYPA 1WBJA 2A4AA 2VEIA 2PF8A 4UQBA 3T0AA 1W37A 4JIHA 4RNJA 3W75A 5FL0A 2D2HA 1K7FA 3KAOA 5BYWA 3A47A 5CPMA 1CLKA 1F3TA 1IT7A 2KX9A 3PWGA 3GAKA 1XFBA 4Z1YA 3LA4A 2VD9A 5KZ6A 3DEQA 2RJHA 1VR6A 4A22A 3ARZA 3AWNA 1H63A 2J4GA 4IFOA 1XIJA 5CJMA 3MCOA 4PTNA 5TAOA 1K4GA 1JIBA 4C65A 3B9DA 2PWGA 3AHTA 1QVBA 2YCLA 1GTHA 4B91A 4O8RA 4E8CA 1UPPA 1GJPA 2EGZA 1VENA 1PKMA 4AX7A 1CXEA 1KD0A 1W3LA 3BLKA 2WMHA 4ZO7A 3WD3A 2CKSA 4O18A 2VM8A 3DFOA 2IPGA 4NUWA 1VB9A 4NT0A 4ZXOA 4HYRA 2NQHA 3GRIA 1SMAA 2NWSA 2FZDA 1ZBKA 3COTA 2WWDA 2EPLX 2W6RA 1E55A 4HMEA 4O16A 2OXNA 5CPSA 4ZCWA 2X2GA 1NP2A 5AVHA 1V5XA 1A5NC 3HFYA 3WLRA 4HA3A 3PPHA 3ARUA 5AYIA 3TNBA 2ON3A 3P5ZA 1F3XA 3PZOA 1FWDC 2GPTA 3P14A 3TYAA 1XLJA 4ZGYA 3UQNA 2G95A 3HJZA 1LORA 4O50A 1E6ZA 4ADTA 4ILSA 2NUWA 3WH8A 1ONEA 4PUWA 5IDIA 4MTVA 1X7FA 3H2FA 1VBJA 2XGZA 4C6EA 5LGXA 3ZVHB 1FTXA 2PTYA 3KHDA 4R7OA 1AJ0A 1HL8A 4KKXA 4D72A 3TTYA 5DXXA 4GC3A 2X1RA 1TYGA 2BSLA 1TJRA 4F0KA 4LAZA 1H0GA 4JFSA 4UR7A 1HJUA 2C1HA 2WKJA 3GIPA 3MANA 1XYBA 3PPFA 1QJWA 3IJ6A 2PLKA 1E1EA 3HMCA 3OYXA 5FESA 4NJKA 5C71A 3WEZA 3W7DA 4HHLA 2AQVA 1H5YA 2PTZA 2IQTA 2NV1A 2SFPA 1P7TA 2DGAA 3E0VA 3U6WA 2OG9A 1JVNA 3CU2A 1F73A 4KQNA 4PUUA 3ABQA 1QOQA 4NG3A 1MW2A 1OYAA 2HQAA 1XBXA 2PZNA 3OP2A 4FNSA 3GXMA 4LAOA 1DORA 2G5WA 4BF9A 3PP7A 1XC4A 2VQUA 4WGHA 4DAFA 5DFAA 2ABAA 3TAKA 2ZTJA 4AF0A 5C9WA 3QY8A 2V3FA 1KFCA 2ZXBA 4C7FA 1HKIA 4S3AA 4LUIA 3EEGA 3TKFA 3WMSA 2EJAA 4PRWA 1HKKA 4AQLA 3QRHA 1NWSA 3AXIA 5C2GA 4JTCA 4JKLA 1M01A 2IKJA 2CITA 3SRHA 1W5MA 1KM3A 5J5DA 4ZQCA 1XLFA 3UF9A 2EXOA 1S39A 3WNNA 4HMNA 3FLUA 2PUZA 5A8OA 3RITA 3AALA 2A2IA 3L66A 3EOOA 1MXSA 2GYIA 2DZTA 2GWGA 4MJMA 3MW7A 3R0UA 1XKJA 3HA1A 1S2TA 1XDJA 2A6LA 3WLPA 1TWSA 3SSJA 1AODA 3UG3A 3UZJA 1S2AA 4QBXA 3WQGA 2VOTA 4PBEA 2OX1A 2VENA 4LH8A 4MJZA 1G4PA 2FLIA 4J2MA 1J2WA 1B4KA 1F61A 4IFKA 1M3UA 2BV9A 3IJ7A 5EBUA 3GW0A 3QY7A 2V82A 3MI2A 4MY9A 3LNPA 4MUPA 2VGFA 3WD1A 4DUOA 2RDXA 3WELA 1S2CA 3VKKA 1VFFA 4HIBA 2X30A 2ZUUA 2WHKA 2HNHA 3I7RA 2NSOA 4M6VA 2YJQA 1BWVA 3DC0A 3ZYZA 1GORA 1KGWA 2G3MA 3PF3A 4GKLA 5D38A 3KBVA 1B54A 4J27A 2VYOA 2IKGA 3OB8A 4GQBA 3WX7A 3UJ2A 3N1AA 4B90A 2DZXA 2ZDRA 3K2GA 5KMYA 4OFCA 3WSUA 1AL7A 3ABZA 3ARSA 1SVDA 1FKWA 3GAYA 2QHAA 4PMRA 2D2JA 3F4WA 1FRBA 3PNUA 2YA1A 2CHRA 3APGA 2Q02A 3AU2A 2PDGA 4GE8A 4B5WA 1J4EA 3A9BA 4FK9A 1YX1A 3B3DA 3PG8A 3UZZA 3MMUA 4R7JA 1R2RA 2C71A 3E3HA 3SN0A 4ZQMA 2CLMA 5F4SA 1A5CA 3ZS4A 4W85A 3G5EA 5H6HA 2OCZA 4EF9A 4JGDA 1CXKA 2PDNA 1I8JA 1PHWA 1YKWA 2F84A 4UOJA 4PMYA 4NZ5A 4HHMA 1XDMA 4ZL1A 5C70A 5JVLA 1ZJAA 3CT2A 2QCCA 3H7VA 4HN4A 3NQEA 3R8GA 5A6TC 1XGEA 4LYRA 4CNTA 1LL4A 4M3PA 1P0EA 2ZX8A 4DXKA 1W2PA 3GXNA 3RLUA 3R5EA 3RX3A 4GBUA 3FGCA 3TLLA 4J3VA 2UY2A 3T08A 1F3EA 3A4XA 1US2A 1TV3A 2QUTA 1QHOA 1V6VA 3N4AA 1XIFA 4QCEA 4FF7A 4YJ5A 2R8WA 4IPIA 1V77A 3ITCA 1NVMA 2B0MA 3RCMA 1Z42A 4V1XA 4TMBA 3OGVA 4FALA 1K9EA 1O5RA 3VX0A 3MHFA 4DPQA 2ISWA 3DX5A 3O05A 1DL3A 1ITUA 1OEPA 2JFEX 4E3TA 5FEZA 1W9XA 5FF2A 4NI3A 3K4AA 1JGMA 1KM4A 3VIPA 4IIHA 4XISA 2A3LA 3G0UA 3NQFA 3VU2A 3F1QA 2YW3A 3QW3A 3W6YA 1NARA 4JFWA 1UR3M 1T5AA 2OODA 4AIUA 5D2TA 4KETA 4AB4A 2HVNA 4YNGA 5LA1A 2DVTA 3PK7A 4A3YA 3MT1A 1LG1A 4JEQA 4M80A 2XTKA 1ZY9A 3W26A 1QPNA 3LZ5A 2PGRA 1M7PA 3WLOA 3OVQA 3KLLA 3WL0A 3RX4A 4ZB0A 4BFAA 2WMIB 4GI8A 1L8NA 4P8WA 3ITXA 2PDJA 3Q67A 1KBLA 4O14A 2OR2A 3EEZA 5CJ5A 1NDWA 3W29A 3QHOA 3PUEA 3WK1A 3MKCA 4IIBA 3KHJA 3POHA 4L9ZA 4PRTA 5CGQA 2XH0A 4ADUA 1LYXA 3AYTA 1Q4WA 2ZZ6A 1G7UA 4D6DA 3FHQA 1ZS2A 4FAMA 3GIYA 1H7PA 1JCMP 5REQA 3UP8A 1JDEA 3NQVA 5CCZA 2DDXA 1J0HA 1IWAA 3LBOA 1DOSA 2OKTA 4KS0A 2BB0A 4A2SA 5LIYX 4GIEA 3ARVA 5HPCA 3RJYA 2OLHA 4JQ2A 3M46A 4NAEA 3R8HA 3UWZA 1O5XA 1GGOA 3THUA 1W31A 1ODUA 4BEUA 2WANA 5EMLA 4ZOEA 2J66A 2YBTA 3W38A 1H5VA 4KW2A 5KEZA 1IEIA 1XIEA 3FJLA 4OECA 4QQUA 3EWUA 2ASHA 1AH4A 3NZ1A 2E67A 2OOGA 2PD9A 3I3EA 1VS1A 4ZE4A 3S5OA 3W07A 3ARRA 1I0BA 3P84A 3CWHA 3JRKA 3EA2A 5CZTA 4NSBA 3VIKA 1KCZA 2QF7A 4QFUA 5LIXX 2W61A 3W1PA 3M0XA 5A94A 3GNOA 4QG9A 3EXTA 4MNKA 3C3UA 3EA3A 1G4EA 3H23A 1XJBA 1XYZA 3LMYA 3U2EA 3RPMA 2Q8LA 2A85A 4O1CA 4CCCA 3WQEA 3C2EA 4ZQNA 5GJMA 4WSJA 1IYXA 3OQ8A 3V5CA 3N6HA 2CFFA 4O1DA 4HNVA 3FHAA 3M6YA 4W84A 3LEPA 2F6KA 3OLEA 3LSCA 3CV6A 3ABOA 4W4QA 1AQMA 4GNKB 3U7BA 1TX2A 2Y8VA 2DIEA 3DUGA 1Y7VA 1BXCA 5AN7A 1E56A 3GXFA 2IKHA 1NDZA 4LX4A 4CCDA 5BRPA 3OVGA 1L6FA 2JKPA 4CCZA 3ZT7A 1DWAM 3E38A 3N12A 4HT3A 4TV5A 1R3SA 4XVDA 3UCQA 1GPWA 4LWWA 4DI9A 3ARPA 1TPC1 2MUCA 2CEQA 2DT3A 2W0UA 9XIMA 2WVSA 2XN2A 4GHRA 2XVLA 3C5QA 4R34A 1QMLA 3N6JA 1BVNP 2EG7A 4H2CA 1V3KA 3LDVA 1GVYA 1SFJA 1IZJA 2G3IA 1WZMA 3QOKA 4KF1A 4ROQA 5HA7A 1QUMA 3AZRA 3USBA 1FWIC 2QULA 2WZIA 3SCNA 2JBMA 4AVOA 3FAXA 4GI4A 3TXZA 4MOZA 2ANUA 2XPKA 1LUCA 4NZ3A 3E0LA 3PN8A 3POCA 3S1XA 4BS0A 1UZ1A 5LNSA 1V7AA 2VKZG 5HMFA 1E0WA 4FXJA 1ZB5A 5IOBA 1RA0A 4A6GA 5A6KA 1TRIA 1AD4A 4TQTA 2J27A 3EX3A 1RCQA 2YCIX 1W9PA 1GQLA 3S6OA 1JRCA 3SZ8A 4JTJA 4F0RA 6XIAA 5BNKA 3IJ8A 1I2NA 2YDAA 4XD3A 4Y9OA 4N0RA 2VFGA 5CGMA 1Z89A 1YYAA 3UJEA 7TIMA 3BAWA 9RUBA 3W53A 2B81A 3WJXA 2ZRXA 3JZEA 4EVZA 3G1RA 3LCXA 1S5VA 1OZMA 4B4HA 1JQXA 4RPQA 1RD5A 4IMFA 5FEPA 4WCJA 1R3RA 4L4PA 3JR2A 3INPA 3RPTA 3W74A 1DEDA 1U5JA 1OK4A 3C0SA 4H7VA 4M1BA 1DWIM 1H1YA 1ME8A 3R4IA 1Z3NA 4X9SA 2PBOA 3PM6A 1QNOA 3WLLA 4JZ5A 3L65A 1UWAA 3KLKA 3R58A 3LXAA 3FKRA 5HMEA 5E1QA 2CLFA 1WDDA 1F4AA 1VQTA 1GJUA 1KQYA 5ABFA 3IGUA 5G4HC 1F05A 3CZJA 1AMKA 3GFYA 2CESA 1OYCA 5FSEC 4HB7A 1UBPC 2FJKA 3EDJA 2XSAA 2YB1A 4NY2A 1K03A 1WBHA 3VM7A 1GVSA 1TKKA 1EZWA 1EQPA 3BMVA 5HOSA 3TQVA 4S2CA 2DQWA 5T9BG 3CO4A 3WQCA 2YXXA 2W63A 3PBGA 1FHUA 2INEA 3N29A 4XO6A 3WL1A 5LHEA 3NZRA 2C6QA 3BAJA 2FH8A 2FJUB 1FWEC 4FXFA 3SB0A 2QKFA 2QT3A 3RR1A 4DJFA 1CLXA 4JTAA 4DVOA 1VFSA 1A0EA 3C4UA 2D69A 5AZ0A 4Z08A 4YU1A 1XIBA 2BY2A 2ATSA 4K39A 4W89A 1MI3A 3V18A 4R85A 2OT1A 4OBTA 3FA5A 2O4QA 5ABHA 2XSBA 1OB0A 1YADA 4E4FA 1QW9A 4PFHA 3DG7A 3KRSA 5T91A 4LANA 2P8CA 2DUXA 3K4DA 3G1DA 1BYAA 5E0CA 1QNPA 2PDPA 1PYMA 1QPRA 4NZFA 4R9OA 3RM8A 2OQLA 2Y62A 2C7FA 4AH7A 1CWYA 3JZUA 4LXFA 1XLDA 3E0IA 1E3ZA 4JQAA 5BU9A 2YIHA 3QM3A 4MB3A 1DIEA 1NOWA 3B05A 4U5KA 3OPSA 4GH1A 5TBOA 3KOYA 4MLRA 1ADSA 1J5TA 3M1ZA 4FLOA 5D30A 1Y65A 5I78A 1CLVA 2GGEA 4J9JA 4PTMA 1A5BA 5GNYA 1W5QA 5BXTA 3RGTA 2CLHA 4PB5A 1EPVA 3L4YA 1EX5A 2VWSA 2X42A 3EKZA 3W01A 5EU9A 5DT7A 2QJJA 3R79A 2AAAA 3S2LA 1GTEA 3TYBA 4JTLA 5MHBA 4MWAA 2E25A 1E71M 4NXSA 4O1AA 6TAAA 3MB9A 3RNDA 4GI6A 4LCSA 2W92A 3TTOA 1Z9AA 4WSHA 1RH9A 4F9DA 3C52A 3HG3A 2A21A 3M0IA 3PZVA 1L0PA 3U0HA 5K9DA 1M7JA 2FB2A 3PJTA 4WJXA 4PUKA 1LOSA 5FOOA 1M1BA 3TN4A 1RY0A 5FSDC 4D6HA 1TV2A 1BG9A 1VFTA 1XCWA 3AIEA 4Z0SA 2VX7A 4V1YA 4RE2A 5XIMA 3P2VA 3DU0A 4XIAA 4XAGA 3UJSA 4AVNA 3KUMA 4YTRA 4KIEA 3N17A 3KZSA 5EMJA 1K1DA 4MAZA 2V8ZA 3QMTA 5F2GA 1H7OA 3P74A 3QZ6A 1XINA 3RX2A 4PUNA 3BQ6A 2V9DA 4C7GA 4I9AA 2CLOA 3PHAA 1ELSA 1U5HA 4NRRA 5DLCA 3S5YA 4DYJA 2GVEA 5IHRA 4JY8A 4H2HA 4L6DA 2UY5A 2PF0A 4UTUA 1XLAA 1YPIA 3NO3A 4WLCA 2PRLA 3IUHA 3BLOA 2E5DA 2Y70A 2CXEA 3K30A 4O52A 3E9AA 3LXBA 1AJ2A 4V15A 5CC3A 2IMRA 5AKQA 1GOXA 1US0A 5EY5A 4B5VA 3EOSA 4ZQPA 4MNLA 3F4VA 4AFYA 2NT0A 4DYKA 3WQOA 1A0DA 2GOUA 3WLMA 3C2FA 3QKZA 3MSYA 3L4UA 4MVAA 3GTXA 1A5KC 2ICSA 3ALGA 3AO0A 3VDAA 3GXDA 4C1KA 4GQQA 3GU1A 3N9RA 5FJIA 2A3CA 1OFPA 4ZMGA 1CXFA 2ZUVA 1Q6LA 1H51A 2PDCA 2V81A 1RD6A 4Y6GA 2Y7FA 1IT0A 1ICSA 4AIOA 1M04A 4IP5A 4EOUA 1XBVA 3GFXA 4DUXA 5A6BD 3ZVHA 4QG6A 5E9AA 5JBDA 1VRDA 2AKMA 4GYFA 3MBDA 3D3AA 5DCDA 4GVHA 4RDVA 2Z00A 4Q4PA 4YVPA 4XQ6A 3N3MA 1DWJM 2QVNA 1DIOA 1SSGA 4W5UA 1YMYA 1KV5A 4WGXA 3Q58A 4KMQA 1DHPA 1QI5A 1S5MA 3BSMA 3BGJA 1L2UA 2QCDA 5CPTA 1AZ2A 3N13A 3RLVA 4AZ5A 3UXKA 5K9XA 2BS9A 5E6ZA 1XYFA 3THQA 3QV9A 4NASA 4MKNA 2O9OA 4Z2LA 5A95A 3EWXA 1M53A 4AMAA 4GLEA 3ATYA 2WXDM 3CUFA 3BAXA 3CB3A 5CPQA 5AY7A 2YYUA 2XH2A 2DUAA 2WCGA 3GC5A 3U2CA 4D8ZA 2WKGA 3PAJA 1PXGA 4Y2WA 4XSLA 4I7VA 3RU6A 4JTUA 2DVUA 3JU2A 3TYCA 1G4SA 4G9PA 2QGHA 4TXEA 3WBEA 3FS2A 1KKOA 1QXLA 2XVGA 3WEMA 2QZRA 4MHBA 4IPNB 4CD5A 2BOEX 1ALDA 2Y2WA 3IK4A 1XLKA 1JULA 2J7BA 1QOPA 2X1TA 5CSRA 2VEFA 1UKPA 1L6GA 1ISZA 1SJAA 4X9YA 4RDZA 3RN6A 1CYGA 5LKYA 1ONRA 2YKKA 4HBKA 2DJLA 2UBPC 4L65A 5HINA 3BOFA 5M3WA 4QJ3B 1NSJA 1O7AA 4HPNA 1XPYA 1VEOA 1GVQA 1TZ9A 5CZKA 3A9IA 3VABA 1PB0A 3H53A 4GACA 1EYWA 4YCOA 3EWBX 1FQ0A 1BAGA 4EPDC 1VZWA 4QJ1A 2UY4A 2OTDA 4WX2A 2YB4A 5FEXA 3NDOA 4CD8A 4JHMA 4B2DD 4UZUA 2DSKA 3EAUA 4DB7A 3UYIA 3UY7A 4ZQOA 1JJKA 4OGZA 1UD4A 1T99A 4ZOAA 1QNVA 1OGGA 1Q6RA 1B30A 3VD5A 3PFMA 1MFUA 3DGBA 3TYDA 4O57A 3Q37A 3BANA 4ACZB 1JDCA 3BLLA 3W70A 3UZYA 2DSVA 3LPFA 5AOUA 3F5KA 5U4NA 1C8QA 2NVAA 4MYAA 1F6KA 1US3A 1A0CA 3N19B 3NQ7A 4XIMA 1BYCA 1XSJA 3MMDA 1XR2A 3IJDA 4AEOA 4CNOA 1VYPX 2D3NA 3IV3A 3UYCA 1S5WA 5F2IA 3A12A 3KM8A 5FAGA 5HJLA 3ATZA 1XW8A 1BG4A 4AWTA 3LCGA 4J4KA 2ZUMA 3BZGA 5IBXC 1LBMA 3ES8A 4IX0A 4DN1A 4BF5A 5AECA 3BCFA 5D9OA 3CPUA 2VEMA 4LBSA 3C6CA 3OG2A 1GQKA 1V6TA 4LV9A 2JEPA 2I56A 1JUBA 2A0NA 5LIWX 1PS9A 3IUDA 3PAOA 1DYSA 1ZAIA 1BRLB 1EQCA 4OE7A 3TFXA 2DT1A 4LB3A 2PDIA 1XP3A 2PP3A 1ZJHA 2WLZA 4HVXA 2FVMA 3DECA 3D6NA 3F5LA 1LT7A 3TYEA 1KB3A 1BGGA 3DHUA 3RRAA 3SJNA 5H91A 2OJPA 3ZXWA 5I3DA 4DUVA 3QZAA 3EX4A 2A7NA 1UB3A 3WLJA 1DE6A 3UESA 1AQ0A 1O1HA 2X0HA 3T4CA 2VX6A 3TCSA 2GK1A 3UWUA 1C90A 1FHDA 2OFJA 2W4XA 3SUTA 2FQIA 5L6UA 2DJXA 3CZEA 4QLJA 2QPUA 3UGVA 1NQKA 3LERA 4E4UA 2H8ZA 1E4NA 2G4JA 2A6NA 3RPDA 2FMOA 2QLYA 3LI1A 5DRIA 3KVKA 1TQJA 3KWXA 4OU1A 3IK2A 5LIKX 1XBZA 1EOMA 5D03A 4W88A 2X2YA 2Q09A 4DXVA 2XIMA 4RXFA 2XDFA 2EAWA 2VRJA 3IIPA 4JNMA 2W3ZA 1E43A 1P6WA 3V3WA 4DJEC 4E2OA 4RZ6A 4I5XA 3HOJA 1WPCA 2IKIA 3WJYA 4D1IA 4Y7EA 3XIMA 3B03A 3BH4A 4BWLC 1CPUA 3VD9A 3IJQA 5M17A 3SUVA 1VEPA 5T9CE 3FA4A 4Z42C 1FWNA 3WNLA 3DDMA 4GPNA 4K8GA 4F4RA 4XTDA 2VWTA 4QNWA 5C55A 3ANUA 3O1NA 2A79A 3ZJ8A 3IVUA 3RM9A 2ADAA 4IT1A 3T40A 1OC7A 3TDFA 2OT0A 5A8GA 3QYSA 2G8ZA 4JCMA 4Q8UA 2YYTA 2FFIA 2NV9A 1W5NA 4UR9A 1G5AA 3CUZA 4PMNA 2P88A 4WOQA 1B1YA 1UCWA 2ZZ7A 5CBIA 3VO0A 2ZRZA 1BVZA 1VFMA 3QMSA 5M5DA 2R94A 3M5YA 1MUCA 3EXRA 1EDTA 4PN2A 2V5LA 5LA0A 2W5FA 1I2PA 4LUYA 3S6TA 4DRSA 3ORWA 1IF2A 2DEPA 1BKSA 2YBVA 1VRXA 1AVAA 1JCNA 2XINA 2PDBA 1X96A 3TWBA 3AQUA 2WBKA 2VQTA 3AYRA 3U7VA 4GUFA 3T4WA 2XG9A 3SCOA 3V5FA 1W3TA 5GPRA 3LD5A 2HK0A 2B31A 1S2WA 4GA8A 4LAKA 4TVUA 4F3HA 3S9YA 1B3XA 3E2SA 4IFRA 4A8IA 1IR2A 4LUTB 2E8ZA 4MB1A 2YDRA 3M7WA 1UWRA 3B8WA 1JDFA 1IWBA 1MFVA 4JOMA 3HQ1A 4Z1CA 2TRSA 4X60A 3HPSA 3G6MA 2QVHA 1SUXA 1XH1A 1QI3A 3S47A 1S2UA 2NUXA 1TRDA 4QP0A 3LNMA 3SURA 3HGJA 3U4FA 1XM3A 1TE1A 4OHQA 2B7OA 4H9YA 4R27A 3WNPA 1XYMA 1JYVA 4ERIA 4M51A 4BI5A 3BJSA 3NPVA 4B5TA 1ZP3A 1VBGA 1CGWA 3KOZA 2IS7A 1TR9A 4Y8EA 2GGGA 1JUEA 3UR8A 2WNNA 3MVIA 1AFSA 3SDOA 4JD4A 5GNXA 4DO4A 3ZR6A 1IEWA 5TD4A 4QLLA 4ICCX 4IMAA 1Z32X 2W67A 1F8MA 4HCDA 1SZRA 2ZZ5A 2YFOA 4HA4A 3DN5A 3RRXA 5I07A 1WKYA 1JCJA 3IVSA 4XBKA 3EDEA 2F6XA 4GABA 1M68A 2G3NA 4FOJA 1DWHM 1EL3A 4NJJA 3UXIA 6REQB 2V2DA 1VC4A 2VMFA 3GTHA 3CBWA 4HK6A 3B9NA 2AQOA 2ZIDA 4KCWA 4EPEC 3VVGA 4HJWA 2ZE3A 1Q7ZA 1HP4A 1PCWA 4DO6A 5HNNA 4UTWA 3IIXA 3LLFA 2E6YA 3QSTA 3MJYA 3ITYA 2FZBA 4GUGA 3E74A