1VJIA

Gene product of at1g76680 from arabidopsis thaliana
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
361
structure length
351
Chain Sequence
b'SVPLLTPYKMGRFNLSHRVVLAPLTRQRSYGNVPQPHAAIYYSQRTTPGGFLITEATGVSDTAQGYQDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGKAPISCSDKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYMAESLNKYGILYCHVIEARMHTLMPMRKAFKGTFISAGGFTREDGNEAVSKGRTDLVAYGRWFLANPDLPKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Arabidopsis At1g77680, 12-oxophytodienoate reductase isoform 1.
pubmed doi rcsb
molecule keywords 12-oxophytodienoate reductase (OPR1)
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 126
structure length 351
sequence length 361
ec nomenclature ec 1.3.1.42: 12-oxophytodienoate reductase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1vjiA00
3C3NA 3WJSA 2X2GA 1XUZA 3T55A 3KOFA 1L6SA 3TXVA 4OQVA 1TCDA 4O15A 1FWTA 4EVZA 4ZQMA 1KM4A 1DKWA 4UTUA 5EMUA 3PB0A 5DXXA 4GBUA 3P81A 1QR7A 1YXDA 3LXAA 1LLWA 1W3IA 3HPXA 3BO9A 3NPWA 3SIZA 3N9RA 1X6UA 3KXQA 3W1AA 1ZHAA 3EX3A 4DF2A 2NXIA 4M7SA 4XZ9A 2DZXA 1U5JA 4LU0A 3CM4A 3NQAA 1LBFA 4HPJA 4FIRA 2C13A 3W7PA 2FPVA 1G4SA 2ZBTA 4X22A 1JCMP 2AGKA 5DCEA 3P84A 2YPIA 1W31A 1H1ZA 2Y62A 3QPZA 3QZEA 1H51A 4WQ6A 1N8FA 3W1PA 4EWND 4Z08A 1Q6QA 4WXZA 3NPUA 3A24A 1T8XA 4JTSA 5A5WA 3SJ3A 3S9YA 4GE8A 5AC7A 4K36A 2C18A 3QF0A 3STEA 1WOAA 2ZZ3A 2ATMA 5DCBA 1KFKA 2I1OA 1VCGA 5D30A 4MZ8A 3T78A 1B3OA 3I7QA 3PG8A 3RLVA 3BG5A 1G67A 4OGZA 1Q45A 3DAQA 1SSDA 4RXGA 1HTIA 1SZEA 2B7NA 2TYSA 5LGXA 5AHMA 3ATZA 1QOPA 2JK2A 2NV1A 2Y63A 1Q6RA 3LHZA 2QUTA 3WK3A 1LBLA 3NL6A 1T96A 1F73A 4HNUA 4WY0F 3W76A 2RFGA 2A2IA 4AXKA 3M43A 4WZHA 2DZPA 1H7NA 1AW2A 1GTEA 5KMYA 3BK0A 4D2JA 4MOZA 4EF8A 1W37A 2QCGA 4AWSA 3Q94A 3OA3A 3L2IA 4KWWA 2P0OA 1OFAA 3G8EA 3U6WA 3TCEA 1HL2A 3SGUA 3CPRA 4BWLA 4FB7A 4OE7A 1LYXA 5F4SA 4DEFA 1W8SA 1X1OA 1SQ7A 4R34A 3T44A 4E2DA 4UCGA 2E5DA 2V82A 1Q3NA 4TX9A 2WOQA 3BPWA 1D9EA 1KM0A 3MBDA 2B7QA 3N3MA 3NR0A 3B04A 1W1ZA 2FLIA 4U28A 1SZNA 4UFIA 1M7PA 4HPXA 2ALDA 1VRDA 2YYTA 4DPPA 1G7VA 3QRHA 4JEQA 1OFRA 3W07A 3L0KA 3TSMA 2G95A 4MYXA 1Z48A 2R8WA 3ANYA 1K8ZA 4RV8A 3UNDA 1TPC1 3SR7A 4OBTA 3EXTA 1PVNA 3W7KA 1SO4A 2A5HA 3W7DA 1C8VA 3DZ1A 1XBYA 3PF3A 1AK5A 1KFEA 1JRBA 4FF7A 3B03A 3ZFHA 3IGUA 2QJIA 2ZA3A 4JTJA 4WOQA 1LP6A 4FXRA 3NPVA 3W1NA 4CQAA 4UTJA 1NAL1 4ML9A 1TO3A 2QEZA 3TAKA 1TPVA 2BX7A 4XBKA 2V0TA 1DQWA 3TU9A 1GEQA 1G4PA 3G24A 3S0CA 3W1TA 3IV3A 3PAJA 4M6QA 5FF0A 4UXDA 2QDGA 4MFEA 1W5NA 3EWZA 1GWJA 3C56A 1LRNA 4FIQA 3P5ZA 4LC8A 3CLMA 5KZDA 2R94A 2CLIA 3BLIA 3QQ1A 3STGA 4RX0A 2WV8A 5K9DA 1LM1A 4IPIA 3B06A 1RR2A 1XXXA 4DELA 3LHUA 4MFDA 1KFJA 4LV4A 1PS9A 3O16A 1TTIA 2OT0A 4FNQA 5D03A 1VLIA 4JIQA 2Z6IA 2ZZ4A 2F7FA 5G2WA 2E6DA 3SZ8A 1OFDA 2DORA 3N9SA 4KWVA 4OU1A 3TIMA 4UTHA 3ABOA 1ICQA 1VYSX 3GXPA 4RLIA 5AN7A 2EHHA 3FLUA 2CZEA 3WK0A 3LLDA 5MHBA 3SY5A 1ZNNA 2PRMA 5F1UA 5LKYA 3LRMA 2V81A 5HJLA 1F7BA 1KFLA 2GQAA 4JX4A 3ZR4A 3TAOA 3W70A 1MSSA 2NX3A 4L4MA 2WQPA 2AAMA 2JKEA 2QKFA 1ZCOA 3W2LA 4JX5A 3LTSA 3ELFA 4N9BA 2W0UA 4JYEA 4O17A 1IF2A 3OEXA 3UZJA 3LGEA 3O06A 6TIMA 2OMAA 4Z0SA 4NJGA 2BXVA 2ABAA 3UYCA 3N2XA 3P67A 3QMSA 3MI2A 4IMCA 3KVMA 3G1HA 5E1QA 1OHLA 1G7UA 1ME7A 3YPIA 5CGQA 2C19A 1BKSA 2ATSA 1X8FA 2GUUA 3M5XA 2DZWA 3EWYA 2A6LA 4MLJA 5BNKA 5I3IA 4PC8A 1PV8A 4PTNA 3L5AA 3HG4A 1TPUA 5BRBA 1ZY9A 3ATYA 3CU2A 4JS3A 5D38A 5H2ZA 4UFMA 4A2SA 4FO4A 1XI3A 2CZDA 3NNTA 4AF0B 3P74A 1WAUA 2PRHA 3T7VA 3DBPA 1KLYA 2YW4A 1HO4A 4YCPA 4M6VA 5H91A 5G1TA 4Q33A 4BI5A 1C29A 1H7WA 4JTKA 1RQHA 1VC4A 3NM3A 3MHGA 1YPFA 1GG0A 5FF2A 1UUOA 3RK8A 3CWOX 3KFTA 3UWQA 3NQVA 2FQIA 1JRCA 2C6QA 3P8JA 1QDSA 4WX2A 2YW3A 4AVFA 1DORA 4XTDA 1GVQA 1MEWA 1XCFA 3F4WA 4TMBA 2J9YA 1F2JA 1X1ZA 1EPXA 5FEZA 4N9EA 2FFCA 2DU2A 3VI2A 1LOSA 1UCWA 5DBTA 1SSGA 2GOUA 1D3HA 4NVTA 4IMGA 4ADSA 1OFBA 1Z41A 3LV6A 1RVGA 1OF8A 3I7RA 4YL2A 4OV4A 3B0UX 2VKZG 3G0XA 5HINA 1I2RA 3W7JA 3HG3A 3B4UA 2C15A 1T99A 5LHEA 3G3MA 3UXAA 4YLWA 1VHNA 4BI7A 4MPQA 3SSJA 5U7SA 1JUBA 2FPTA 1K3UA 3HGSA 4BR1A 1KM2A 1A5BA 5L6UA 2V8ZA 1F6PA 1QO2A 4QQ3A 4GNJA 3DFTA 5HWNA 1ZAJA 2VEMA 2JKPA 4O16A 1FY6A 2VFDA 4Z1BA 1RV8A 1TRIA 3P7YA 5CPNA 1SFJA 1UBSA 3P60A 1TTQA 4FHAA 3R5EA 3TE9A 1B57A 3HJZA 4UIOA 5F2MA 5D04C 2Z0IA 3LCHA 2B7OA 5K4XA 3W1XA 1YTDA 4Y90A 3OVQA 2NUYA 4O8RA 1I8JA 2E09A 1SU5A 5CZJA 3BLFA 4CNPA 5SWUA 2VENA 3BW4A 4TMCA 5D32A 3N14A 1A5AA 2C16A 4H6KA 3LXBA 4C1KA 1OX5A 3OG3A 3GXTA 2AQWA 5D2WA 5IBXC 4UFHA 3V75A 1EUAA 4N4QA 2TRSA 4RZ6A 4JTHA 4IMFA 2ZRWA 4O1BA 3M44A 2ISVA 3GDLA 2VOMA 2YZRA 4I7UA 4ZZ9A 2VFIA 3LHWA 1H60A 1P1XA 3UZ5A 2R91A 4IX2A 2ZYFA 2VEIA 1MEHA 3MWAA 4MLRA 1A50A 3L67A 4LUIA 4LS0A 4I9AA 3CB8A 4K7YA 1FDZA 3Q58A 1XBXA 4O28A 2A7NA 4LRSA 1VJIA 4MY1A 4LVBA 4GUHA 1KTNA 3HBLA 1DVJA 2CLLA 4FNTA 4J9JA 5ABTA 4HNVA 2QCMA 1AG1O 1PHQA 1VR6A 4X9SA 3W7RA 7TIMA 1G6CA 2NWSA 1RZMA 3FOKA 2ZZ2A 1VPXA 3MO7A 5CZTA 1EEPA 5FF7A 4LWWA 4JX6A 4AB4A 1H61A 2V2CA 3INPA 4Z1AA 3M5VA 4IQLA 1FDYA 2O7SA 4XTIA 1JUEA 4W9TA 3SI9A 5I3FA 4XBSA 4E2BA 4EF9A 1KM6A 4UTTC 4ZQPA 1XM3A 2X1TA 1YDOA 4K8EA 1IIGA 3RF9A 1JCYA 1O94A 2H8ZA 4M7TA 3NVTA 4I7WA 1OX4A 3W7CA 1LZOA 5C2XA 5HR7A 2RKXA 3M6YA 1KFBA 3IIPA 4CCEA 1OJXA 3TDFA 2HTMA 1IGSA 2Y7DA 2ZTJA 4JIPA 2PURA 1YYAA 3W83A 4JYFA 3FYPA 4HIBA 2YXGA 3AJXA 5LGZA 3QJAA 2WNNA 1KM5A 4AHOA 3HB9A 4JTTA 3LBMA 5FEWA 3W1MA 1SW7A 4N02A 3O6DA 3W1QA 1XL9A 2X30A 2E77A 3USBA 4O14A 3QSRA 1EIXA 4QIUA 4MY8A 2GVLA 3TJLA 3MYOA 4LVGA 4B5NA 3I6RA 1K03A 2V5BA 3W1LA 1KV8A 3FJ6A 2QJHA 1VGAA 4P2VA 1AL7A 3W22A 2RDTA 1P0KA 3A5VA 3DHDA 4UTIA 5LZLA 3TW7A 4C1LA 4JTFA 3ZS4A 1I2PA 4NNBA 1ICSA 5AHLA 1IXPA 3RFAA 4JICA 2Y70A 2JKAA 1A5CA 2HS6A 3FA5A 1KBJA 3NAVA 3DI0A 5L9FA 2OCZA 1K7FA 3HF3A 4KFNA 4DO6A 3CC1A 4UMBA 4ZQNA 3FS2A 4ORIA 3GKFA 3FFSA 4JTEA 1NSJA 1JCNA 2EGZA 4R7JA 3HMJG 3G18A 2HS8A 2JGQA 3W7EA 3GDRA 4LT9A 4DXVA 4MZ1A 1TV8A 3CHVA 4AH7A 4WJEA 3W7QA 4DF0A 4WY0A 4GJ1A 3MJYA 3LCLA 5F4XA 1JQVA 1H50A 1TQJA 1EP1A 4GUJA 1AW1A 3G1FA 3C4UA 1EWDA 5DELA 2HMCA 5F2LA 5TBOA 2E6FA 3MW7A 4DF1A 1L6YA 2GVGA 4FX8A 4AHPA 1AL8A 3W6YA 3GDKA 3PBUA 4Y9AA 3SW6A 1GG1A 3CEUA 5AC6A 4HN4A 1WXJA 3R8RA 5C5YA 2GPTA 3LLFA 4S2BA 1J2WA 2QCDA 1EX5A 4LTSA 3IVTA 1U83A 1FWSA 2RDWA 4ZL1A 4JTUA 4Y96A 3A23A 5D37A 1UUMA 1LBMA 4IXHA 4N2YA 3TFCA 1NF0A 5TQLA 5G5IA 4XKYB 1K7XA 4JXCA 4NX5A 3RLUA 3VFLA 3DU0A 5EKYA 3DFSA 1SW3A 4DO5A 4UMAA 1ICPA 5D2XA 4O50A 2BTMA 3C0JA 3SGZA 5G4EA 4A2RA 1HFBA 2ZZ6A 1OYCA 1PCKA 3I68A 3W85A 1F76A 1XC4A 3LBCA 2D73A 3P8IA 4FX6M 1FUYA 5I3GA 2ZDRA 3MP3A 2G5WA 1AMKA 3LTPA 4UFJA 2Y6ZA 3TNOA 1TTJA 3TA6A 3EXSA 3NM1A 2J6XA 4NNAA 2TSYA 1JVNA 1DQXA 4N9DA 3GYEA 4P61A 4O1CA 4O1AA 4CLMA 2G97A 5IM51 2Z6JA 2CZ5A 1N7KA 3UXDA 4NJJA 5EYWA 5KZMA 2YFOA 3M5ZA 1QCWA 3LXCA 3FKKA 4HKPA 3EB2A 1S5TA 5AC8A 5F2IA 2QF7A 2QCLA 4M5PA 3CIXA 1RPXA 4MKNA 4QSHA 1TRDA 3C8FA 3BV4A 2J27A 3E9AA 5D33A 3RMJA 3Q2DA 2CLMA 1LCOA 3U8GA 3VNDA 3LHYA 1O60A 4IGHA 4RZ4A 4Y6GA 5CZ0A 1KA9F 3OIXA 3OVPA 3BVJA 3R13A 5HUOA 4CNNA 1VZWA 4U4MA 3NL5A 4UR8A 3G8RA 2FJKA 4BWLC 2NXHA 4WOZA 3A9IA 3EX1A 2V5LA 3H54A 5DCDA 2XFWA 2G96A 3C6CA 1DOSA 4E38A 3GK0A 5AOUA 4JY8A 4GWEA 1TMHA 4ZVJA 3OVRA 1PCWA 2B4GA 2WPBA 2I9EA 1QPOA 4NZJA 5LNSA 2TPSA 4TO8A 3NDOA 2WSQA 2X1UA 5LNUA 4ADUA 2EAWA 2GJNA 3G0UA 2YYUA 5LSMA 2H90A 2DZSA 3TSBA 3MI6A 4H3DA 4UTMA 1FCVA 1UJPA 2X1RA 3IGXA 3LHVA 5LNRA 3MI3A 1XBZA 4TIMA 2B0MA 3FEMA 1TPH1 2WJZA 3KVKA 3FJLA 5AFDA 2KZHA 3IRDA 1KV5A 4O57A 5G1YA 1TPB1 1XUUA 5BOOA 4Z1DA 3QMTA 1JCXA 1M7OA 3MYPA 3G1DA 5FI8A 4O10A 4LS1A 1M6JA 4LNYA 3W7LA 3GX9A 1L6WA 2QUVA 1IXQA 2Z2UA 1WX0A 1H1YA 3L21A 4NQ1A 4NXKA 1J4EA 3G1AA 3QH2A 1W0MA 5D02A 3N34A 2X16A 2J88A 1FCUA 3L66A 3KVJA 3FKRA 1QPRA 2Y7FA 1XDLA 2C0AA 3QC3A 1KFCA 3S42A 3PULA 2A7RA 1KM1A 3GR8A 3PS7A 3BW3A 1B4EA 4CQ8A 4UC5A 3LCFA 2OX1A 1GVOA 5K4ZA 1N55A 1DJQA 1H7OA 4PH6A 2WKJA 2XN1A 1VHCA 3JRKA 3TC7A 3VCRA 4MVAA 3TC6A 1ONRA 5FEXA 1OX6A 3LI0A 2E1DA 1W3NA 5D2TA 3M47A 4R33A 3LI1A 1WQ5A 2ZCGA 3EWWA 4POCA 4AMAA 1Q6LA 5EL1A 1JCJA 4ALDA 1F5ZA 4WUIA 3S1WA 3QEZA 1QPQA 1NFBA 1PE1A 2A0NA 4UTWA 1D3GA 3L0GA 4NJKA 4AWUA 5LNVA 3RNDA 3GNNA 1JUKA 1SR9A 2P10A 4LVAA 3STFA 1CI1A 4HNNA 5K7JA 4K8HA 1A53A 1ME8A 2ZRYA 4GUIA 1FCQA 4JTLA 1VCVA 2B7PA 4HNTA 2RDUA 3A21A 3PM6A 4LVFA 5EY5A 5I3KA 3U2OA 5KTLA 1J5TA 4PCFA 5FF3A 1ADOA 4GUGA 3W3OA 3RU6A 1MO0A 1GYLA 1I45A 4EOUA 1TPWA 5A8GA 3WJYA 2WO5A 2C1HA 2DP3A 3E49A 3T4CA 4PA8A 3MHUA 3W7IA 1ZJIA 3VE9A 3GAKA 3HPSA 3NOEA 1S5WA 4XKYA 1K8XA 4UNLA 1K02A 2FB2A 1E51A 2VXNA 3LV5A 2ZZ5A 1MEIA 4NZFA 5DBUA 5CPLA 2ISSA 3PUOA 2I14A 1NVMA 1F05A 1IXOA 1W3TA 3AO0A 3FYOA 3NQDA 3PBWA 1OG0A 1L9WA 3EX2A 2A7PA 6ALDA 2YR1A 3NEVA 1KTBA 3NGJA 3HOJA 2VFFA 3NQ7A 3IIVA 3NG3A 1JULA 1IXNA 1SO3A 3NQMA 3ABSA 3CQ0A 3S1VA 3DFOA 3M0ZA 3OBKA 5C54A 3B0PA 3C61A 3S1XA 3FIGA 1SFLA 2ZRZA 1PHWA 5K9XA 4RKAA 1YXYA 3TX9A 2C3ZA 3IIZA 2ZRVA 1R30A 2CLEA 3C2RA 2NLIA 3O05A 2A21A 3TH6A 1JCLA 3KHJA 4X2RA 2H8XA 1OABA 3W1UA 1G69A 3O8AA 3IVSA 2YFNA 3PC0A 3L65A 1O5KA 3PSVA 5AYYA 4HT3A 5CPMA 3W88A 3DFPA 1VS1A 4NXSA 2QCCA 4TU1A 3A5FA 3MP5A 1ML1A 2ZFAA 5D09A 5HUPA 2H3BA 3IGSA 3PWAA 5KINA 1FWNA 4IWWA 4ICNA 3WJWA 1YTEA 4XWUA 2IQTA 3C2OA 4M19A 1G4TA 3NL3A 3TXZA 1NEYA 3QPYA 1EB3A 3HG5A 1F6KA 5C6MA 1JR1A 2JBMA 3EWXA 1H5YA 1T0OA 2RH9A 3UWVA 5GVJA 4IUOA 1GVRA 4CCDA 3PG9A 3NQ2A 1QO5A 3W7NA 3TMQA 2VFGA 2P1FA 4YMZA 4O4WA 3W2UA 1LOQA 1V7YA 3DXIA 2NX1A 1LLZA 2V9DA 3L5MA 2BLEA 3O1NA 3NQEA 2PE4A 3LX9A 3A22A 3HG2A 3QMRA 4NUWA 3L0NA 1OF6A 3E02A 3O6YX 3OHIA 4ONVA 1FCBA 3TJXA 3TMLA 3O63A 3GAYA 5AYZA 4UMCA 1VYPX 4OHQA 5LHFA 1KW1A 1P4CA 1VH7A 4I7VA 3BLEA 3KVLA 2YX0A 5DY2A 1F74A 1VCFA 4RJEA 4UNKA 4JGDA 1ZFJA 1OVDA 2Y7GA 3LHTA 2Y61A 3QW4B 1ZALA 4JR5A 1W5QA 1PIIA 3NZ1A 1IIHA 2Z1BA 4QNEA 4IPJA 3P5YA 3CTLA 1TQXA 5DY3A 1ALDA 1H7RA 3W2NA 3HPZA 1FXQA 4AF0A 2GJLA 4ZQCA 1GT8A 4UTLA 3IVUA 1TJPA 1SZFA 3QQ0A 1DHPA 3IIXA 4KFOA 3TSDA 5AHEA 3LCXA 2PCQA 4NU7A 2Q3OA 1YPIA 3S5NA 5D05A 4MIMA 4CNOA 4N6FA 2VC6A 3DI1A 3W1RA 4PFMA 2ZA2A 1NF7A 1Q6OA 4LRTA 4O18A 4O12A 1GYNA 2ABBA 1KBIA 4RR4A 5F4WA 4R53A 1EA0A 3W74A 2JGYA 3ABQA 3P82A 3W86A 5HQEA 5EA9A 2NUXA 1OFEA 2E5CA 3L68A 2UV8G 1HG3A 3TKFA 1RQBA 3BG9A 3G3DA 1OK4A 3K30A 3G1SA 3W23A 1WBJA 3VE7A 3KAOA 2VFEA 1EWEA 3N19B 2EF9A 3KRZA 4MYAA 3W7HA 4QM1A 5HWMA 3BW2A 2NX9A 1QNVA 1SUXA 3NO5A 2CLFA 4O11A 4LC6A 3PUDA 4AWTA 4DBDA 3GLCA 1TPDA 3UQNA 1BTMA 4Q4KA 3WK1A 3TUUA 1ZAHA 1WOBA 3TQVA 2XN2A 1QOQA 1R46A 1OYBA 1BWKA 3MMTA 5LNWA 2NUWA 3T40A 1SPQA 1V5XA 4IX0A 5BMWA 1A5SA 3HQ1A 4RZ5A 4ZMGA 3NQ8A 1VQTA 2QUUA 4XQ6A 2O7QA 2E6AA 5AHFA 3GXNA 3M16A 4BF9A 1FDJA 2Q8LA 1VYRA 1H63A 3L9CA 4AEOA 4BK9A 1GVSA 2C14A 2LLEA 3QSTA 3VKJA 1TREA 5CSSA 2E5BA 4ZQRA 1R2SA 3TROA 4DPQA 2QAPA 1EUNA 4ZQOA 2FB3A 4X3ZA 2R14A 3EWBX 1QWGA 1XDMA 3UY8A 1MXSA 1YTKA 4LUJA 4A21A 3V1PA 2BWGA 2WSRA 1S5VA 5C55A 4O52A 5EPDA 4O0ZA 3IIOA 4N9CA 4A22A 3LOTA 5EBUA 4K37A 3NXFA 1OFQA 1TIMA 3M1ZA 3ZWSA 5DXYA 1OFOA 5G2HA 3S1UA 8TIMA 3GVGA 4DBEA 5I3HA 3B05A 3PUEA 1WBHA 3PVFA 4K6AA 4JD4A 5J5DA 3F03K 1UB3A 4O1DA 4ADTA 3S5OA 5FESA 1OYAA 1LDCA 3S8HA 4JDYA 1XFBA 5G4WA 4K7VA 3GZ3A 1GQNA 5CZSA 3W75A 2A1YA 3W72A 3R2GA 2X1SA 1TTPA 5KSWA 2Y88A 2GVJA 2DJLA 4H4IA 4TR9A 3O07A 5BW6A 4A29A 1TYGA 1Y0EA 4NX0A 1EP3A 1YDNA 5AB3A 3UWUA 1YADA 1S3HA 5BMXA 2A6NA 4S1FA 1I4NA 3QW3A 4K39A 3EX4A 4QNWA 5G2IA 3TFXA 4PEKA 2CFFA 5AHNA 3NL2A 3MHFA 4LW7A 3O15A 4FNUA 2YCEA 2J24A 3TQKA 3ZWTA 1MZHA 2DZVA 3GR7A 3WJXA 1TB3A 3THAA 2EKCA 5HWJA 1SO6A 3CIWA 1P0NA 3DKLA 4FX7A 2Q3RA 4JN6A 2A4AA 3I7SA 3NQFA 1BWLA 2WSYA 3H55A 3N73A 1WA3A 4AAJA 4JY9A 3CEPA 4FNRA 4QISA 3I65A 5F2GA 2OZ0A 4RK8A 3C2FA 1BEUA 3TR2A 4UR7A 4Z0JA 3QYQA 5KITA 4L4LA 3E96A 3NQCA 3JR2A 3DH7A 4QITA 4WXYA 2W79A 2CLHA 4IMDA 3DKJA 1CW2A 4UFLA 3GDTA 1VLWA 4JTGA 1W56A 2FDSA 2CWNA 3HGOA 1RD5A 2H3DA 1LTDA 1KM3A 3E0IA 5DLCA 5KZEA 5AHIA 1LOLA 4A3UA 1THFD 2RHGA 3HIJA 3KRUA 4FNSA 2A85A 1DV7A 2H6RA 3QM3A 3W7GA 3UPWA 1SZGA 2Y7EA 5F1VA 3BGJA 3NQGA 4QJ1A 2DZTA 1YDVA 1PL9A 4BFAA 3EX6A 1H7XA 1JJKA 2ZZ1A 5D2YA 1W5MA 1XKYA 3SFKA 1M5WA 3PSWA 1K7EA 2J9XA 3CT7A 3HO8A 2QCFA 3W2JA 4FEZA 3UWWA 3O6CA 1HO1A 1UASA 1I2QA 1OX4B 3ABRA 3LERA 3H53A 4LOCA 3W73A 3KRSA 1FXPA 1EP2A 3GIYA 1TJRA 3W7OA 3EKLA 2TMDA 2PRLA 1WV2A 1GZGA 3TV8A 3UD6A 4FXSA 3GNDA 1W5OA 3G1XA 1O5XA 3LCIA 1DJNA 1GJPA 1SO5A 5CKSA 4YXGA 3S5YA 4KFPA 1LRQA 3DGRA 4O19A 4WD0A 5J5RA 4GUFA 3E12A 1K8YA 3UY7A 3DFQA 3PY2A 4PL2A 2NWRA 3W2KA 3BG3A 3LTYA 1WDWA 2ZZ7A 2VFHA 3W9ZA 1KTCA 4Q32A 3NZRA 4YWIA 2PC4A 1O4UA 3MBFA 1R47A 3M9YA 5CPOA 3WFAA 3IEBA 1O95A 2FPYA 2HSAA 2ZTKA 5U4NA 4GRSA 2QJGA 4UTKA 1OFPA 2OJPA 4O4VA 3SECA 3W84A 2V30A 1C9DA 3MUXA 4Z1CA 5IBXA 2YSWA 2ZRUA 2GQ9A 1LROA 4LV9A 1DL3A 3NYZA 3LM7A 5CG7A 4G1KA 1SW0A 4YCOA 1TPEA 1W54A 3P62A 1GVFA 3R12A 1B4KA 1GOXA 3EKZA 5HNRA 3DENA 2VELA 4CQ9A 1L2UA 1H7PA 3B8DA 5I3JA 1ZENA 1AW5A 1B9BA 1ME9A 4N6EA 3TK7A 4O53A 3STCA 3NPXA 3L5LA 4IMEA 4Y8FA 4AHQA 5K3VA 2CU0A 3G1YA 3C52A 2YDAA 1FWRA 4WY0B 5FEPA 4HHPA 3N2MA 3D0CA 1YXCA 3DFNA 3HGRA 2W6RA 3PBVA 3GKAA 1DBTA 1GPWA 5FF4A 3R89A 1OK6A 1FWWA 1RQEA 3NA8A 2OT1A 3PB2A 1QFEA 1Z42A 3Q37A 2Y85A 3NQ6A 5HULA 3G1VA 3W71A 2YGYA 3LCGA 1R2RA 2WNQA 4XUGA 1FBAA 3M5YA 1W5PA 3UWYA 1I2OA 4MY9A 3S5ZA 4OT7A 2V2DA 2VEKA 3P80A 3M7WA 2QCDB 3WK2A 2E6YA 4UTTA 2DZUA 1I2NA 3UPBA 4GFSA 2NXGA 3M41A 5D2VA 3S6DA 4NT0A 5E0KA 2EPHA 2ZRXA 3W2MA 5K9CA 3EXRA 4N4PA 3THQA 1XBVA 4UTWC 2F84A 3W87A 4K38A 3LCWA 4OWGA 3MP4A 1LRTA 1X7FA 2ZA1A 4PL1A 1GTHA 1G4EA 2QCEA 4RCXA 2CW6A 3BGGA 4HSOA 3JS3A 4MJMA 1FX6A 5K2ZA 1WYIA 4O54A 1LORA 3UWZA 1TV5A 3HGJA 4JNMA 3G22A 2BZNA 4JDBA 2CZFA 1TSIA 4NJHA 2CLKA 1ZAIA 2NV2A 4MUZA 3TW6A 3LB0A 3LRLA 3F1QA 3F4NA 1Z44A 4LY8A 3PR2A 1KLZA 3B0VC 4EIVA 3LRKA 2QAFA 2Y89A 4LVDA 4KKXA 2Q8ZA 4GXMA 4MZYA 3QFEA 1QAPA 5CSRA 4M6PA 4FNPA 2V2HA 4LS2A 3C2VA 2FTPA 5DN1A 2CLOA 2XN0A 3EWUA 2QR6A 2NZLA 3KX6A 4MJZA 3WJZA 3EEGA 2WNZA 4PODA 2J9ZA 4JYDA 4IOTA 4RXFA 4IXXA 4IJBA 2E68A 3G0SA 4O0KA 1H62A 2QDHA 4DO4A 1QPNA 4BI6A 5HMSA 4ORMA 2DJXA 5T26A 4NNCA 3TQ0A 2QCNA 2ISWA 4QAIA 1QMLA 2VEPA 2GQ8A 3GB6A 4CCCA 1JQXA 4UFKA 5AYXA 5TIMA 4O13A 4UUIA 1R2TA 1TPFA 2ZQ0A 1HUVA 5HR6A 4JTIA 2QCHA 1P5BA 3PBYA 4S2CA 4GC4A 1YLVA 3W7MA 3CWNA 3P61A 1TV7A 2FIQA 4OV9A 3LDVA 4E0CA 3C2EA 4DQWA 3BARA 5E93A 4HSNA 3GDMA 3DHFA 4NJIA 1CX9A 1FQ0A 2BSLA
chains in the Genus database with same CATH superfamily
2X2GA 1XUZA 1C90A 3SUVA 2NVAA 5C8BB 1FWTA 4C7GA 4E2OA 1RUSA 1V6UA 1EGZA 4UTUA 5EMUA 3SUTA 1D8WA 3GC4A 3P81A 1QR7A 3URAA 1UH2A 2P3EA 1LLWA 3GTIA 1W3IA 2Y24A 4W4QA 2RUSA 4ECLA 3DEQA 1W3JA 4PMUA 3ITTA 2PWVA 3UWEA 4XZ9A 4LU0A 2QW5A 3OYXA 3CM4A 1T40A 2ZC1A 2XUCA 1E6XM 1G4SA 2ZBTA 1GHRA 3UVAA 1XG4A 4IGNA 4Y9OA 2YPIA 1X7IA 1W31A 2Y62A 4HYRA 1IT0A 4F40A 4WQ6A 3W1PA 5AVNA 1MNSA 3VFCA 4AD3A 3PTDA 1Y5XA 4QG6A 3S9YA 2UBPC 5I5RA 2ZZ3A 2GLKA 1B3OA 3RLVA 3E5PA 3RM4A 1G67A 1Q45A 3DAQA 1Y5WA 1SSDA 1XYAA 4RXGA 3T42A 1SZEA 3NIYA 3EKGA 2JK2A 3QBUA 1R9ZA 4W87A 3S2MA 5D8WA 2NV1A 4A8LA 3FVDA 5IXEA 4I9TA 1QATA 5HMDA 1DIEA 2F6UA 2A2IA 4B16A 3CK5A 4AXKA 3M43A 4WZHA 1GTEA 1AW2A 3UJSA 4MOZA 1W37A 3OA3A 3L2IA 2VZUA 1UKQA 4BWLA 3CIVA 4WGHA 1X1OA 1SQ7A 1S2WA 2YDSA 3EDDA 4JQ3A 4GYJA 7ENLA 2QXWA 2EPOA 4E2DA 4UCGA 2V82A 4TX9A 2PDIA 2WOQA 4GXPA 4N0RA 4NAFA 4X60A 1V3HA 5AECA 2PTDA 4FXJA 2E1WA 3C5QA 4FK9A 5IFPA 1ZP3A 2ALDA 2UWFA 2YYTA 1UWAA 4L61A 3MC5A 1OFRA 4C60A 2E4TA 1UYQA 3GFYA 2R1NA 2ZXQA 3ANYA 3CPUA 1K8ZA 4RV8A 4MWAC 1TPC1 3KRBA 2EBNA 2WKLA 2NT1A 1V0MA 4G9PA 1P6CA 3WBXA 3WELA 3R8GA 4PBEA 2Z4GA 2PDGA 1QNOA 3VZYA 3CO4A 1B9ZA 3CMGA 3LPOA 1W91A 1DWJM 3B8VA 3VDCA 1V6TA 3B03A 2QJIA 1UH4A 4JTJA 1BXNA 1CZ1A 2VTFA 1REQA 3ENLA 1WKFA 2ZWZA 4H2CA 3TAKA 2V3EA 1TPVA 1IT8A 4RE0A 2C71A 1OZQA 1CGYA 2INZA 3TVAA 2V0TA 1DQWA 1GEQA 4PFHA 2VZOA 2JEPA 5E5CA 3W1TA 3IV3A 3C3UA 4MFEA 3PZTA 3EWZA 7REQA 4J1OA 3C86A 5HPOA 1LRNA 2MNRA 5CQ1A 4GPNA 1XYFA 1HIZA 3QQ1A 2ZE0A 5K9DA 2INEA 1C8QA 4DELA 3LHUA 4AEEA 4MFDA 3WEOA 5BU9A 1OIMA 4FNQA 3GWQA 3VIFA 4JIQA 3MS8A 2Z6IA 2ZZ4A 1OFDA 4BJHA 5JVLA 4OU1A 7TAAA 1TMLA 1E0XA 2GWNA 1VYSX 2YBTA 2PC8A 2PA6A 6PTDA 3SY5A 2PLKA 3GH5A 3ES8A 2D2OA 5ENLA 2PRMA 3WUEA 4U31A 1XLLA 3BLOA 5HJLA 4X0VA 3S3GA 3TZNA 4JX4A 4A4AA 4L4MA 4C6JA 3AIQA 4X9YA 3W82A 4DYKA 3CNYA 8XIAA 4XAPA 2D3LA 2QV4A 3WLKX 3ELFA 4MKVA 1IF2A 4AZHA 3ZT7A 3ZJ7A 4RDWA 3LGEA 1B3ZA 1F6YA 4HSHA 2OMAA 1MW2A 1OY0A 3T2OA 2ABAA 2ZUNA 1XSKA 1DJIA 1OHLA 4QLLA 2C19A 1Q6GA 1JPIA 1PX4A 5AYBA 4PC8A 5BRBA 1TJ0A 5D38A 1DXFA 3F4DA 3UBPC 1XI3A 1KD0A 1YPXA 2DZBA 4JOMA 1Z6KA 5BWAA 4M6VA 4OJYA 3SCUA 1FWEC 1H7WA 3EOOA 1A4LA 4JTKA 4Q8VA 3MHGA 3QZ6A 1YPFA 1UUOA 1S1PA 3MMUA 3RK8A 3KFTA 3N2CA 1XW8A 4C1NB 1UWUA 3A47A 3K4WA 4H1ZA 3CZLA 3RO8A 2YKKA 3T0TA 1GORA 2CETA 1DORA 1GQLA 1HKJA 1XCFA 1OB0A 1BYCA 1X1ZA 4N9EA 2DU2A 5DBTA 4RPPA 1D3HA 1HKVA 4IMGA 5HNNA 4V1YA 3HMCA 4LH8A 2ACRA 5T9CE 4F0LA 4GY7A 1A49A 4BS0A 3LV6A 5C2CA 4QGCA 4YL2A 1ADSA 2BOEX 2P8BA 3B0UX 3T2QA 4JIHA 3D47A 3B4UA 1FP9A 3MDWA 3S83A 4YLWA 1MYRA 1DJXA 3N3TA 1JUBA 5U7SA 1DIKA 2FPTA 1E0TA 1K3UA 4HMDA 5L6UA 4LBUA 4LCQA 4HOWA 3N6HA 5HWNA 1O5RA 4PYSA 3VGHA 3AXHA 1FY6A 2HK0A 2YXOA 3P60A 1TWSA 2EPNA 4GBDA 4PGLA 3HJZA 4UIOA 3OP2A 1O66A 4PMRA 2XIMA 5HK4A 5KEZA 3OVQA 2NUYA 4O8RA 4HVXA 1F4HA 1XLJA 3GHRA 4GI9A 2VENA 4CQDA 1A5AA 4I9MA 4H6KA 2W66A 3UZYA 1OX5A 5D2WA 3PZOA 5I09A 1EA9C 3WLMA 2TRSA 5A94A 2ZUVA 3BQ6A 3IUIA 2ZRWA 4O1BA 2GJXA 4B91A 2VOMA 4ZZ9A 3BLDA 4GIAA 2R91A 1SJCA 1GOKA 2VEIA 1JYXA 2GDQA 3L67A 4LUIA 3LA4A 3U4AA 4AVNA 1XBXA 4MB1A 4O28A 2A7NA 4GUHA 4FNTA 4IFKA 2XINA 1YMYA 4X9SA 2QUNA 1G6CA 2NWSA 1LJYA 3NTYA 4H00A 5TNVA 2VQTA 3LZ3A 3FOKA 1UMLA 2FMNA 3P93A 1EEPA 5FF7A 3WQOA 4GMEA 1UKPA 3TONA 4N7QA 3M5VA 3MUY1 3BANA 1JUEA 4DJED 4MUPA 3KS5A 4W9TA 1WZAA 2ZX8A 4GK8A 4S3DA 3QZAA 2R1KA 3AHZA 1KM6A 2UY3A 1XM3A 2X1TA 2X8RA 4W86A 5ECUA 2DUAA 1XP3A 2ONEA 1OX4A 2DIJA 5GJPA 3HV8A 1KFBA 2OB3A 3IIPA 4CCEA 1OJXA 3DG6A 2DDXA 3UZZA 4A8NA 2YL8A 1QHPA 3TTYA 3SQMA 1L6FA 3W00A 3W83A 3DDMA 4HIBA 3VZXA 3AJXA 5LGZA 2WMHA 2IKJA 1KM5A 4LYKA 1B3VA 3HB9A 4JTTA 5FEWA 2DT0A 4ZBCA 4JFTA 2X30A 3UJEA 2VGGA 5M1TA 2PGRA 5E6YA 5B7ZA 1ZJBA 3LU2A 4XD4A 3AROA 1ISXA 5BXPA 4CD8A 3FJ6A 1AL7A 1KC7A 2WHJA 1P0KA 4JCMA 4QP0A 3REQB 3ABZA 3WBYA 1ZLPA 3AXIA 2Y8UA 3TW7A 4JTFA 2Y5JA 2IS7A 3RFAA 4JICA 2HS6A 1KBJA 3NAVA 5L9FA 1X8CA 1HVQA 1CLVA 4FR1A 1XH1A 4DO6A 4TOQA 2YZ5A 1PSCA 3NSMA 3CV2A 1SMAA 1CECA 1XSIA 4JTEA 1NSJA 2PDYA 1JCNA 2EGZA 4QJ5B 4FZIA 4EPEC 2HS8A 3W7EA 3T0CA 9CGTA 3K46A 5GPRA 4MZ1A 4AH7A 3F5JA 4WJEA 5GNYA 3MJYA 1CXLA 1JQVA 4GUJA 1AW1A 3G1FA 5DANA 5F2LA 1ZCCA 2NQ9A 1BKHA 4FX8A 4AHPA 2WHKA 1E15A 4EX4A 4Y9AA 5MF5A 3SW6A 1GG1A 3GVVA 3LEPA 4HN4A 2Z1KA 4HQVA 2GPTA 2BVDA 3LLFA 3WQWA 2O56A 1VJZA 4PTWA 4BKNA 4LUTB 2QMJA 1NY1A 4JTUA 3PZIA 1LBMA 2WZEA 1ZS2A 4S3EA 2YLAA 4MNMA 1FFQA 1E1CB 5I02A 4Z1YA 2J6VA 1ITXA 3OGVA 3VFLA 1E40A 2ZVRA 1SW3A 3BCFA 1J01A 3VNKA 1ICPA 4AWEA 5DMNA 3SGZA 2ZZ6A 1OYCA 3WFZA 1PCKA 1S2UA 3TJIA 3LBCA 3IGHX 3BE7A 4GIYA 1GOOA 3LTPA 1FHUA 3M0HA 3TNOA 3H24A 4QAWA 1ELSA 3NM1A 2J6XA 2TSYA 1RBOB 4XD3A 1WXZA 4O1CA 2ZUWA 2PGEA 4YHEA 2PDWA 2G97A 2G37A 2CZ5A 1N7KA 3E38A 3UXDA 2PDNA 1WDPA 4HK5A 1TJ1A 1QCWA 3LXCA 4HTBA 1GOIA 3A4AA 4HKPA 1A3WA 1S5TA 4PZVA 5F2IA 2QF7A 2JQXA 3KOWA 2J27A 1MQQA 3GG7A 1LCOA 1KB3A 1VBHA 3U8GA 3QGVA 1O60A 5CZ0A 3OVPA 1A47A 4ZGYA 1E0VA 1LT8A 4HZ6A 1FWJC 2DW7A 3CMJA 4UR8A 2NVCA 2YDRA 4BWLC 5D4YA 3A9IA 3EX1A 2WWDA 2VDGA 4HZ8A 3CGTA 3SQLA 4C6NA 3QKZA 3GK0A 3AICA 5AOUA 1Y8BA 3OVRA 1KBKA 2B4GA 3THDA 3UG3A 2TPSA 3UCCA 3T4WA 4NHVA 5AYIA 4HPNA 2QPXA 1YX1A 2WCSA 5CPQA 4E8GA 5CG0A 3KOZA 4UTMA 3MZ2A 1ODUA 4JPGA 5I24A 3GYCA 1EJUC 1UJPA 2X1RA 3R10A 3S9IA 1PB0A 1XBZA 1RXOB 1EJSC 5FSDC 2WJZA 4E2VA 3KVKA 4DAFA 5AFDA 4ZEPA 3AIRA 3KOXA 4O57A 4Z1DA 3QMTA 3G2GA 4P7RA 3C2YA 2QGHA 4PUWA 3O2LA 3AJ7A 4P8UA 3TR9A 3GX9A 4DLMA 1M1BA 1WX0A 1F61A 4NQ1A 5D02A 2E3ZA 3ITGA 2J88A 3PBMA 3Q65A 3WLLA 1KCZA 2D2GA 2Y7FA 4XD5A 3VILA 2ANUA 6REQA 3PULA 1NFPA 4O8AA 4ZXLA 2BS9A 1VHCA 3FAWA 3VOIA 2Z28A 3HFYA 3S6OA 3WLNA 4MVAA 4EAYA 3PZMA 1W3NA 4L5ZA 3LI1A 1WQ5A 2ZCGA 2DSWA 3APTA 3EWWA 4POCA 4AMAA 4IPLA 1QI5A 4QROA 3MZNA 1NFBA 2A0NA 4UTWA 3THUA 3DHUA 3RNDA 4V33A 2HE5A 1TX2A 1CI1A 2D69A 5K7JA 3MMWA 3B8TA 5A6BA 1JPDX 4GUIA 1E4MM 4J3WA 1VCVA 3SCSA 3PM6A 5I3KA 4ERGA 3O7UA 1J5TA 4F2BA 1E9LA 1ADOA 3ZM8A 4ZSUA 4LUTA 3KBMA 4LB3A 3GC5A 1TPWA 3WJYA 5M17A 1XIHA 3AXMA 5XIMA 4HNCA 5M2FX 2VURA 4D8AA 3VIIA 3CQKA 3ZOAA 2AMXA 4XAYA 1K8XA 4UNLA 3DERA 1E1CA 3NXLA 2BHZA 1E51A 1FHDA 3K4DA 1QNPA 3K5XA 5CPLA 3AHYA 1A0EA 4UCFA 6XIAA 4WJXA 2WQDA 1IXOA 3UU0A 1W1TA 4AQLA 2E28A 3A12A 3EX2A 3F2CA 3W29A 1NWUA 1OBAA 3NEVA 1KTBA 3NGJA 1JDFA 2XVNA 3CASA 2ISFA 1W1IE 4MWAD 4NG3A 3CTTA 2ACUA 5XINA 2HVOA 4JNYA 3FGCA 4JFUA 4ZODA 1BLIA 2WYSA 3OBKA 4QBXA 1V0LA 4HHMA 1FTXA 1WKDA 1EO7A 2QIWA 3P0XA 1IR2A 2CLPA 4QG9A 1RCXB 2WC7A 1JCLA 3KZSA 4Z2KA 4X2RA 4AFYA 3O8AA 4NAEA 2PDHA 1DWIM 1UIPA 2WCAA 3FVMA 1O5KA 3UERA 1BVWA 3WIJA 4HOXA 4HA3A 4AZ7A 4AXNA 3SCRA 1VS1A 3KDOA 4TU1A 3MP5A 1ML1A 2BFGA 1Y5VA 1TUXA 4UTFA 3RRAA 4U33A 1IV8A 2HBXA 1MWOA 1YTEA 3C2OA 4M19A 5EMYA 4L9ZA 5CCZA 1FKXA 4LJ3A 5HOSA 1NEYA 4R27A 2PDKA 1F6KA 3QY6A 3EWXA 3N4FA 4K2SA 1H5YA 1GW1A 3HA1A 3VGGA 3VIMA 5GVJA 4GY0A 3VIGA 4IUOA 3OHMB 1UZDA 1JZ7A 5IDIA 3TMQA 4C7FA 3E0VA 3ONCA 3OO2A 1LOQA 2IPFA 2NX1A 2BNJA 3ISIX 1GKPA 3NQEA 2PE4A 1XF0A 1Q8AA 1NJJA 3QMRA 3PBGA 1TUFA 3L0NA 3E02A 1FCBA 5FAGA 3WUFA 1UZ1A 2F2KA 4PB3A 4UMCA 3ME3A 3QHOA 1VYPX 2DW6A 3VX1A 4I7VA 3BLEA 3KVLA 2YX0A 1QXLA 1UWIA 2WSKA 1SYTA 1CTNA 2H9AB 2FKPA 4RJEA 4AD2A 4S3KA 3TA9A 1S5NA 3GBEA 3LMZA 2Y61A 3QW4B 1ZALA 2OOGA 1W5QA 3OLGA 3CYJA 2WSPA 3AMDA 3RPDA 3KDNA 3F2BA 3WNLA 3HPZA 4ZQCA 4GJJA 4LXFA 3IVUA 5DF0A 1TJPA 1DHPA 3TSDA 5AHEA 4QLKA 4NU7A 4MIMA 1U30A 1UBPC 4KERA 3PTQA 2VC6A 2YDQA 4PFMA 2VR2A 4LRTA 2NQ5A 4LANA 2KX9A 4INFA 4GZIA 4R53A 4WRHA 1RK5A 3SIMA 5HQMA 3W74A 4YVPA 3RX4A 3ABQA 3W86A 4W5ZA 5HQEA 1EIBA 4R85A 3GVWA 3VUSA 1TWZA 2UV8G 2P76A 1RQBA 3UR7A 2J7HA 3ZLFA 1W3LA 1GQKA 4B5SA 1OK4A 3VE7A 1PZ2A 1FHVA 3LNMA 4H9XA 1U1JA 2VVSA 3CQIA 1LQAA 3SUSA 1RLCL 1DYSA 3LMYA 2EPMX 4E3VA 3UGVA 1L2QA 2I17A 3K13A 5LIKX 1TPDA 3GLCA 1BTMA 3TUUA 5FJPA 2XN2A 4KCTA 4ZE5A 1BWVA 1K9EA 1BWKA 4DAIA 3MMTA 4MJ2A 3A3WA 4IX0A 4ATWA 2DH2A 1DTUA 4R3UA 3S47A 3ARUA 2VX5A 4ZMGA 2CBJA 4BF9A 1NH6A 1H63A 4OFCA 2AL2A 2MUCA 3KHDA 1UR4A 4HZMA 1EUNA 4TUFA 2W62A 5HQLA 2FB3A 2QLYA 1QWGA 1XD1A 3UY8A 1YTKA 4A21A 2BWGA 2WSRA 4OZOA 3UNTA 3AU6A 2IKHA 4AIUA 3OB8A 1JD7A 3MWCA 4O0ZA 3IIOA 4N9CA 4YWSA 2XGZA 4AD4A 3LOTA 3EPMA 3PN8A 1OFQA 2R82A 3ZWSA 4P7QA 3AC0A 5G2HA 3GVGA 5DFAA 5GNXA 4DBEA 2KAUC 4B4FA 1BXCA 4GY1A 4QHRA 4JD4A 4F2TA 3GM8A 3AYVA 4K1WA 2QVHA 3AQUA 3WQ4A 3F03K 3UXIA 3T09A 3VKBA 3IV8A 4BEQA 1YNPA 5CEWA 2WMGA 3MCMA 1GQNA 2NSOA 5A6TC 4O0QA 4NZ5A 2E0PA 2JALA 4C6LA 3R2GA 5KSWA 4H4IA 2BGSA 4AD5A 3OYZA 4XIAA 4C6QA 1YDNA 5AB3A 1I4NA 4K39A 4QNWA 1UC5A 1AJZA 4PEKA 3RAOA 4YVXA 3ORWA 4FXFA 2G3JA 3MHFA 4F9JA 3GSMA 3O15A 4DM2A 5JH1A 2J24A 3V7PA 3N1AA 4R88A 1SO6A 3VU2A 3PTKA 5D9PA 4JN6A 2A4AA 3E2QA 3NQFA 3N73A 4B3ZA 4L9YA 4JY9A 3CEPA 4FNRA 2QDDA 4M56A 4PUDA 3I65A 3EAUA 1XR2A 3C2FA 1BEUA 4AX6A 2PDCA 1AVAA 4ZA0A 2VYOA 3GUWA 3QHNA 2XGBA 1KCKA 3V36A 2CLHA 4IMDA 4UFLA 1CW2A 2BBFA 1US3A 4DJDA 1FA2A 4XVEA 2Y5SA 1LTDA 2VGBA 4G2DA 5KZEA 1J9YA 4G7EA 1XRFA 1W1A1 4FAMA 3BICA 1E1FA 2E67A 2A85A 2J25A 3GVRA 4DZHA 1SZGA 1TZ9A 3AIVA 1YDVA 2Z1SA 4BFAA 4ZB0A 1H7XA 4HHHA 1UD6A 3PSWA 3HV9A 5EGRA 3HO8A 1O5QA 3SURA 4OKDA 4FEZA 2BDQA 3JVAA 3MO4A 5E6ZA 3VD7A 2OLHA 3ABRA 1VIWA 2SFPA 2VRKA 1E3ZA 3HPFA 1FXPA 1EP2A 4LF1A 1OGSA 2OGYA 1WV2A 1WDSA 1WZMA 3N04A 3GNDA 3GXIA 3G1XA 1GJPA 5CKSA 3NWRA 3S5YA 2OGJA 4DYJA 2ZADA 1J10A 3DFQA 4PL2A 3TTOA 1WDWA 3VIKA 3RMEA 2VC5A 4Q32A 3BLKA 3NZRA 4YWIA 3MBFA 3MKCA 1O7AA 1AFSA 2XH0A 3GTHA 4IH3A 3BL3A 1BQCA 2FPYA 1IEXA 3VABA 2HSAA 3M0MA 2PDUA 2QJGA 4M80A 1OFPA 3W84A 1ZP4A 2V30A 1W1VA 4LV9A 1RA0A 4Q6JA 4Z2IA 4G1KA 2PLCA 3CUJA 3BH4A 3A3XA 3P62A 3VZZA 1YDYA 1B4KA 1EQPA 4Z2GA 4AZ5A 3ALFA 3DENA 1L2UA 3MUIA 1H7PA 2Z2AA 5C71A 3BAWA 1ZENA 4YN5A 1AW5A 1B9BA 1ME9A 3P6LA 4J4KA 4O53A 4P8VA 3STCA 5D9MA 3WNOA 5I77A 1AJ2A 5K3VA 3C52A 3RLHA 2YDAA 1I9CB 1GUVA 2QF8A 2P88A 4KW2A 4A6GA 3RPTA 3D0CA 1YXCA 3DFNA 3OGSA 3WD2A 3NQ6A 1WCGA 2DSUA 3G1VA 3XINA 1S2TA 3LCGA 1R2RA 2WNQA 3I6EA 5I78A 4IIGA 4XUGA 4ZB2A 1ONXA 4OT7A 2J13A 3RITA 3ARVA 3U2ZA 4K1GA 2V2DA 2J47A 4ROPA 1MW3A 3WK2A 3VKCA 1NARA 2E6YA 4UTTA 1M53A 1X96A 1B31A 3PNZA 3M41A 3W6LA 3ABXA 3CZGA 4DNHA 3EXRA 3TOYA 4TXEA 3W02A 1WDQA 4F2UA 2F84A 4UTWC 3WDHA 1BD0A 2POZA 3LCWA 3PNUA 1EJRC 2Y5EA 4OWGA 1X7FA 1GTHA 5XIAA 4Q8UA 4HSOA 3JS3A 3VGEA 2J62A 2IW0A 5DMLA 1UOZA 2XISA 2PPGA 1J18A 3G22A 5FJJA 1D3CA 1TSIA 1R85A 2CLKA 1IEWA 4EAMA 2D2JA 4LY8A 3PR2A 2D0HA 4C6EA 2BHUA 3ARRA 4V1XA 1HGYA 4MZYA 3QFEA 1H0GA 1UG6A 4M6PA 1V77A 4ASTA 3C2VA 1OT2A 3BMVA 3R11A 4HD5A 5A8NA 2UY5A 3KEHA 3EWUA 3GZAA 2QR6A 1A5NC 4JYDA 4IOTA 4RXFA 3V35A 1GQIA 2G4JA 2QDHA 3KW3A 4DO4A 1BVZA 1Z9AA 1QPNA 4IZGA 2WMIA 3VD4A 2I56A 4NNCA 3RO6A 3TQ0A 4GIRA 3EPNA 5C2GA 2OZ8A 1KFWA 3GB6A 1V3KA 4ICCX 4BF7A 5TIMA 2QCHA 4S2CA 2EKGA 4GC4A 1OZMA 2PLJA 3WNKA 1Q6FA 2FIQA 5MKGB 1FHLA 3UP8A 1S5MA 4D1JA 3C2EA 3BARA 5E93A 4KBXA 3GDMA 4QS6A 1OG6A 1UP0A 1XHGA 1L6SA 4JZ5A 1AQMA 4O15A 5FKYA 3W27A 3AIEA 2F8QA 2FZ9A 2XSAA 3PB0A 5TF0A 1CGXA 4JNZA 3QPEA 1AA1B 5EBAA 2OELA 3RM9A 4GNKB 4GKLA 3SJNA 3NPWA 3VMPA 4PTDA 4REQA 3SIZA 3N9RA 5B7YA 1B5TA 3W1AA 1M7XA 4OBSA 1GGOA 1TV2A 2NXIA 4FPSA 1XLKA 3TC3A 4H9MA 2DZXA 3D5HA 3QVQA 1R38A 3SRKA 1LWHA 2OO6A 3RU8X 3UCDA 2FPVA 3VDBA 4JL1A 2YB1A 1JCMP 4GQ0A 4NYYA 3P84A 1W2PA 4MHBA 1N8FA 1MRAA 4R5EA 4EWND 4Z08A 5A5WA 3SJ3A 1YNYA 1US0A 4CEXC 1TWDA 4GGHA 1XYLA 2IQ0A 1WOAA 5BOFA 5DCBA 5D30A 3M0LA 3T78A 1EF2A 3SRHA 3BG5A 4YTRA 1T6MA 1VFFA 4OGZA 3KM8A 3E2VA 1JGIA 1B54A 2QUMA 1V6VA 3BAKA 2AQVA 3SDOA 1FWIC 3U48A 1J6PA 1XQLA 2Q09A 2CBVA 3AFBA 1Q6RA 3EA3A 5JBFA 2XWEA 2B31A 1T96A 1H0IA 6XIMA 3W76A 1TWWA 3USZA 1J5SA 1JDAA 1J2BA 1FWAC 3R7MA 4FLRA 2QCGA 1EPVA 4QFUA 4YHGA 3GD6A 3FEQA 4GZJA 3GG0A 4ZOEA 3U6WA 3CMFA 4FB7A 3QGKC 2C8NA 3AYSA 2G3MA 1LG2A 4XVDA 2E5DA 1Q3NA 2HROA 4IIBA 4ML4A 4PBFA 1K9FA 4FR6A 2GZXA 3N3MA 4U28A 4WSJA 4UFIA 4HPXA 2V5KA 2OPJA 1VRDA 1G7VA 1BXBA 4JEQA 3TSMA 2XFRA 2VCCA 1E1EA 3UNDA 2G0WA 4OBTA 1XIDA 3EXTA 1ZZMA 2GQ3A 4DWSA 1UH3A 3CHDA 3CH0A 5ECVA 3K8KA 1KRMA 1C8VA 3LN3A 2G41A 1IZCA 4DRSA 2VR4A 5A8PA 4PEEA 5E0FA 4KIEA 4A05A 2ZA3A 3CHFA 4PTVA 4WOQA 4FXRA 3AS3A 1J0JA 3NPVA 4P5UA 3W1NA 4JKLA 2FYMA 4CQAA 1NAL1 1M03A 2VEGA 1ZRQA 2AMGA 4XZMX 2BX7A 4F0RA 3KCLA 1JEZA 3PFRA 4GYKA 3VINA 2ZUMA 4QCEA 4XZNX 4LYQA 1G4PA 1TE1A 2OODA 2FGLA 2QJNA 3ARXA 1PTAA 5KZDA 3A64A 4RX0A 3ZMRA 1E6RA 3B0XA 1XXXA 4O1EA 3WQPA 3KE0A 4LV4A 1PS9A 3O16A 1JFXA 3PHAA 2CC0A 3PTMA 5IDZA 3UVIA 3B8SA 3AXXA 4F48A 5G2WA 3SZ8A 4F0SA 1HNYA 3SY1A 1UJQA 3ABOA 1ICQA 1VEPA 5AN7A 5T91A 3GQYA 5MHBA 3RPMA 1JF5A 2I7GA 5ABFA 3WFLA 3ARYA 5H8MA 1W9UA 5F1UA 4H41A 3M0JA 3VIOA 4WKFA 2GQAA 3ZR4A 4I8DA 5DMMA 3TAOA 3L2MA 3UYIA 2NX3A 3MU7A 4A3RA 4GZEA 4UQCA 1PZ0A 1NDZA 2QKFA 1TVPA 1M68A 1UHVA 5JQ9A 4AZCB 1RJRA 5A8OA 4N9BA 4JYEA 5T8GA 3PJXA 4M82A 1R9XA 4Z0SA 1JZ8A 1WUEA 3N2XA 2I16A 5E1QA 4DX3A 1VD6A 1ME7A 5LIUX 1S2AA 3AIUA 1JZ3A 2A6LA 5BNKA 3HJEA 5I3IA 1PV8A 1V02E 3QOKA 3BMWA 2Z26A 1ZY9A 3CU2A 3HM7A 4JS3A 5H2ZA 7CGTA 4UFMA 4FO4A 5EMJA 4Q4SA 4ZFMA 3NNTA 4AF0B 3CL7A 2J7CA 3P74A 1M65A 1J11A 4GYPA 4NZ3A 2PRHA 3T7VA 4ACZB 3HURA 4ZTXA 2QDEA 5G1TA 1C29A 1PJ9A 3WG6A 1Z3NA 1RQHA 1VC4A 4H6RA 4GH3A 1GVEA 4NI8A 4DBUA 2C6QA 1EOKA 3WH9A 4WX2A 3B3DA 4DJDC 4AVFA 1MEWA 4TV5A 4MWAB 3WQGA 1OSEA 5FEZA 1JDCA 1QI4A 2GDUA 2FFCA 3PPHA 4IQJA 1HL8A 1SSGA 2OEJA 3GFZA 3KBSA 4KGLA 4QE4A 3GVQA 1HJWA 3WLQA 1D7KA 4UQDA 2YIHA 3I7RA 5C9RA 2WHMA 1K4GA 3BAYA 3MSYA 2RAGA 5HINA 1I2RA 1MUMA 3W7JA 4AIBA 2D0FA 2C15A 1T99A 2ZX7A 4P7OA 3CAQA 5DEZA 1VHNA 4GGBA 1H49A 4MPQA 4BI7A 3O3RA 5CBIA 4NL1A 1B30A 3WUBA 2V8ZA 4PRWA 1F6PA 3OBEA 1DIDA 4QQ3A 1B1YA 2VI0A 5CSYA 2JKPA 2Z7KA 4Z1BA 1RV8A 3W38A 4X2PA 1UBSA 1TTQA 3R5EA 3MUCA 5D04C 5K4XA 1B3YA 3W1XA 1QRQA 5AY7A 1I8JA 3CQHA 1SU5A 1KGUA 2Z1XA 3BLFA 5IHSA 3BW4A 4TMCA 5D32A 3P3BA 3D3FA 3OG3A 3GXTA 3CUGA 3V75A 1EUAA 4S38A 4N4QA 1CGUA 2ZX9A 1FFRA 1A5LC 5REQA 4R9XA 4JTHA 1VENA 1TWIA 2ISVA 2YZRA 4I7UA 4L1GA 1XLMA 3SY8A 3AMCA 2WCGA 3UXLA 3L4XA 1GVYA 2WZMA 1M41A 2ZYFA 4U5IA 1MEHA 3MWAA 3TZFA 1EQCA 4WDXA 4K7YA 1OGGA 3Q58A 4B90A 2Y1HA 4LRSA 4MY1A 1VJIA 4LVBA 3VA8A 1KTNA 1HKKA 1EDQA 4HNVA 7TIMA 3W7RA 4U10A 1VPXA 2G3IA 2P0IA 4LWWA 4BQ3A 4AB4A 1BGAA 2V2CA 4Z1AA 3RCMA 2DV0A 3S46A 4ENLA 2PF8A 3EDJA 5I3FA 4XBSA 2GSHA 1V3MA 4EF9A 5I07A 2EG8A 4GFIA 4UTTC 2GL5A 3BV7A 2H8ZA 1O94A 3NVTA 1V3IA 2DSZA 5BRQA 3W7CA 4PMQA 1LZOA 1XINA 5HR7A 4AZCA 1IGSA 3RLGA 1X6LA 4U5KA 1CIUA 3O0KA 2ZTJA 3QC0A 1AUSL 3FYPA 4ZOCA 2WNNA 3UR2A 2XIJA 1C91A 3B8WA 1FRBA 1SW7A 3R1ZA 2E77A 3USBA 4EANA 4XV0A 4QIUA 1EOMA 3CZJA 3TJLA 1C7SA 3U0HA 4B5NA 1K03A 5CJMA 1VGAA 4P2VA 3W22A 5EFFA 2RDTA 2ZUUA 3A5VA 3R94A 2O55A 4UTIA 4ZO9A 2OWXA 1I2PA 2X0SA 1IXPA 4HMCA 4D71A 4PSPA 1OC7A 1ISWA 1LL4A 3PZGA 1CCWB 1WZLA 5BXSA 4JTQA 3FS2A 2BXYA 1E0UA 2HWGA 4WIWA 1XYZA 2XHYA 3CHCA 2WPGA 3FFSA 3GKFA 5HANA 4IUGA 1TJ2A 2FHFA 3DGBA 1AQ0A 3GS6A 3VD9A 1CBGA 1F9CA 3GDRA 1ISZA 2F6KA 2QPUA 4OUIA 4YU1A 3T08A 4X61A 4TVUA 1LQ2A 2X09A 4WY0A 1E70M 5F4XA 1QW7A 1TQJA 3WQFA 1HL9A 3N2TA 5DELA 1H09A 1JG9A 3H2EA 2E6FA 3MW7A 3SCWA 1XSJA 1AL8A 3STPA 3R6IA 5HMEA 3VX0A 4HK7A 5AC6A 1WXJA 1MW0A 4S2BA 4NZ1A 1J2WA 3WX7A 4ZL1A 2EG7A 3A23A 1JPKA 1QOXA 4Q8WA 5D37A 1VJSA 3TFCA 1NF0A 5TQLA 4M1RA 3L4WA 1K9DA 2J77A 1K7XA 2I5GA 4NX5A 4CD6A 1V7AA 3DU0A 5GNZA 4DO5A 2XTKA 5D2XA 1KRCC 3C0JA 3WD4A 1HFBA 3OGRA 2XIBA 3W85A 1HP5A 3QLLA 2D73A 1XIBA 4FX6M 3OG2A 4LSBA 2ZDRA 2G5WA 3LNPA 5A6BD 1K77A 1YE4A 3TA6A 1KO0A 3EXSA 1XGDA 4KRZA 2VO5A 3MV01 1UA7A 3W01A 4CLMA 1F4AA 2RGLA 4KWSA 5A2BA 3HQNA 5IM51 2PCEA 4XZLX 3WCZA 3PJWA 2REQA 4HU4A 2WHLA 5EYWA 2PD5A 2WVSA 2YFOA 3ONBA 1J12A 4JHOA 3NSXA 1EL3A 3FKKA 3DG7A 3MJMA 5C9ZA 4IL0A 2QCLA 4M5PA 3HU7A 3CIXA 1RPXA 4IM4A 5I3DA 4IP4A 3UW6A 1F3XA 1T5AA 5EMMA 4HHLA 4XISA 3RMJA 4H7CA 4MB5A 3T0AA 4MNKA 1TMQA 4MJ4A 1UQYA 3VNDA 3LHYA 3KTSA 4RZ4A 3B9DA 1KA9F 4WK9A 3QV7A 2OYKA 3PPGA 2V6AA 3AS0A 3R13A 4U4MA 1JDEA 4Q7IA 2FJKA 2YCLB 2NXHA 4GG9A 1XQKA 2OO0A 1QW9A 3WO8A 4AC1X 3D3AA 2XFWA 2IKIA 1XG3A 4L7ZA 4E38A 2FVKA 4GX8A 4PB5A 4GWEA 1TMHA 3H6OA 3EB4A 3NDOA 4J2MA 4L6DA 2WC3A 5LNUA 4ADUA 3G5EA 5CSUA 2YYUA 2XGIA 5LSMA 3AMGA 4IGMA 1WDRA 3UZXA 3TSBA 4H3DA 1EH9A 3AS2A 3IGXA 3LHVA 3I3BA 4TIMA 2VR5A 2B0MA 1TPH1 4TV6A 3H22A 4DWSC 1KWGA 1GOWA 1H3GA 4WGXA 2ZXBA 1EZWA 1TPB1 4H9TA 4XSMA 5BOOA 1UD3A 2IPWA 3G1DA 4O10A 3I3DA 4GOAA 3WLIA 2QUVA 1J4EA 2YJQA 1XLBA 5A95A 1W0MA 3N34A 4MAZA 3PFMA 2X2YA 3MANA 5H8PA 4ILSA 3S42A 4FALA 4D6IA 1KM1A 1KKOA 3BW3A 7A3HA 4CQ8A 1EXPA 3LCFA 4UC5A 4CUCA 1GVOA 1N55A 1DJQA 4PH6A 1JPMA 3JRKA 2Z27A 3BJSA 3TC7A 4LBRA 3MMDA 2BY1A 3VCRA 1TIWA 5D2TA 4R33A 1YQ2A 3T05A 4K3ZA 4U3AA 1JCJA 2VDIA 4ALDA 1F5ZA 4MDOA 2QHAA 3S1WA 3QEZA 2YL5A 3RN6A 4GVIA 4ZFCA 5CC6A 1D3GA 5LNVA 3GNNA 1C8YA 2HPIA 1K6WA 2FZBA 4K8HA 4UQAA 4FS9A 3UPMA 3SUWA 2OG9A 5M5DA 4YYCA 4JTLA 2B7PA 3A21A 3BCJA 1A80A 1XC6A 3U2OA 3ITLA 4IJRA 4ZCWA 2O4MA 4GUGA 3H26A 4Y8EA 2J7EA 5A8GA 1DTNA 1VEMA 2DP3A 3E49A 5CGMA 4PA8A 3MHUA 3W7IA 3GAKA 1UOKA 3HPSA 3NOEA 3WDJA 3GG8A 3WN6A 5EFDA 3FJ4A 2V63A 2PTZA 1V02A 2HK1A 1K1DA 1MEIA 5DBUA 4FSAA 2JIWA 2QPSA 2I14A 2V3GA 3NZGA 3UGRA 2JE8A 4IIEA 2EJAA 4DHGA 3AO0A 2DUZA 3T07A 1EO5A 1L9WA 3WLOA 2A3EA 1VFTA 3NQ7A 1UROA 3NG3A 3TLLA 1SO3A 1KRAC 3AHXA 3NQMA 5DMYA 3ABSA 3CQ0A 3DFOA 2VWTA 5BCAA 3C61A 3S1XA 3L4ZA 1SFLA 5K9XA 2XVPA 1TELA 4GYPC 3TX9A 4AX7A 2DEPA 2ZRVA 2DPEA 2NLIA 4XKMA 4NAFB 4F0MA 2XWDA 1V3JA 1PAMA 2GVEA 3W37A 3W1UA 3L23A 3IVSA 2YFNA 1R0MA 3PC0A 1HP4A 3R0KA 2W63A 5CPMA 3TYBA 2P50A 2ISDA 3DFPA 4AG0A 2EJ1A 3ZQ9A 2ZFAA 2VWSA 3IGSA 2Y8VA 1JI2A 3ARSA 3RXZA 3HFTA 4KRTA 3WJWA 3E2SA 4XWUA 2YBVA 5TD4A 3NL3A 4P8XA 2CHRA 3RCYA 1NOUA 3WEZA 1JR1A 4S3JA 1Z89A 1T0OA 2RH9A 3KTXA 3AAMA 1WKEA 3NJ3A 3VNYA 1JI1A 4DVOA 1JL8A 4CCDA 1GKQA 4KPLA 1IEIA 4PULA 3CUXA 2R1LA 3NCOA 2WBKA 2A3HA 4K8GA 1V7YA 4QR6A 2VGIA 1LLZA 3A4XA 1EEXA 2OKOA 3BOXA 2BLEA 3VTRA 7REQB 4JQAA 1SJBA 1WE5A 5EB8A 3URQA 3H2FA 4L6OA 3HG2A 1Q13A 1KQYA 4NUWA 4J40A 3OHIA 3TJXA 2UY2A 3O63A 3GAYA 5AYZA 2VRQA 3B0YA 3RR4A 1DXIA 3DC0A 4OHQA 4B3KA 5LHFA 1P4CA 2GSEA 4XAGA 3FA3A 1RJPA 3EOUA 4UNKA 2QJMA 4WCJA 2ZIDA 2WBGA 1JZ6A 1XYMA 4JGDA 1OVDA 2VM8A 3LHTA 3RHGA 3NURA 1GOQA 2YOCA 4JR5A 4CQCA 2E9BA 4QNEA 1NDWA 3F5KA 3P5YA 4M24A 5D8ZA 2Z7GA 3SADA 3QLDA 1ALDA 2D2HA 1FXQA 2GJLA 4BA0A 1J8VA 4UTLA 3PPCA 4H7ZA 4AEFA 3LZ5A 2Q3OA 2OSWA 3DI1A 1E6PA 1HKIA 1YKWA 1QU4A 1Q6OA 1CXKA 2XPKA 4DUOA 1DWHM 4RR4A 3PZQA 3SN1A 1EA0A 2PGFA 4TX8A 2JGYA 4TTUA 5HBFA 3BWWA 5EA9A 2NUXA 1OFEA 2E5CA 1P48A 3AALA 3FA4A 3TKFA 1MXGA 3BG9A 3G3DA 4RUBA 2VZVA 3W23A 1F8MA 4LCSA 1R9YA 3AOFA 1A4MA 3F7JA 2HVMA 1EWEA 3QN3A 2A3CA 3G77A 3KRZA 1JPHA 3TLQA 3W7HA 2P5NA 2VT0A 1GJUA 3VC5A 4AWTA 1K4HA 4PMXA 3MVTA 5FJTA 3PAOA 1ONWA 5FL1A 4ZB5A 1QOQA 2YL9A 4Q8TA 1XICA 2NUWA 1V5XA 3W53A 4UOZA 1A5SA 3EMQA 3NQ8A 3RCNA 2QYGA 3GXNA 3M16A 3IUDA 2Q8LA 4ZR8A 3BJFA 3L9CA 3GNRA 1GVSA 3WKZA 2C1IA 2C14A 2LLEA 1YRRA 3VKJA 2PWDA 4AZIA 1GOMA 1R2SA 4QXIA 4ZO7A 3LY0A 1ECEA 5DT5A 2R14A 3EWBX 3KOYA 1OQFA 4H9YA 1MNZA 1S5VA 4PSRA 1IWPA 1XDJA 4A22A 4AD0A 2Q71A 1OFOA 2J78A 2HJPA 2NW0A 2PDPA 2OXNA 2DT1A 2J8FA 3S5OA 5FESA 3M4HA 3TCSA 2PMQA 1DHKA 4LAMA 3S8HA 1XFBA 5A8MA 3GZ3A 1T8QA 3F2DA 3AIWA 1J0IA 3PZ9A 2BVWA 2Y88A 2Z24A 1UKOA 2DJLA 3WQVA 2V67A 3O07A 4LCRA 2V5JA 1NFGA 1Y0EA 1OEPA 4NX0A 5G1MA 3GO2A 2CYGA 1FWBC 3TFXA 3EX4A 1U1UA 2CFFA 3WY1A 3UJRA 3VNZA 4FNUA 2YCEA 3N4AA 2HV5A 4DXXA 3BUVA 2OYLA 4D6CA 4BY3A 2GJXB 5HJYA 1S1RA 1Z32X 5J04A 4FLSA 3TW9A 3I7SA 4Q4MA 4AAJA 1PDZA 4A3HA 1LF1A 1H2JA 3FN9A 1UD4A 1UWSA 3RUBL 2OZ0A 4RK8A 4G7FA 3SFWA 1E56A 4Z2JA 4UR7A 4Z0JA 3II1A 4AY8A 3SRFA 2VC7A 3NQCA 2I5QA 3TTQA 1E4LA 1XH2A 4IFKB 1RCQA 3S1GA 5EU9A 3GDTA 1VLWA 3IJDA 5CPTA 4PUUA 3DUGA 3UR5A 1RD5A 2H3DA 1KM3A 3E0IA 1B3XA 5DLCA 2RHGA 3EZ4A 1S2VA 2OSYA 4C6CA 2Y7EA 3B9OA 2DZTA 3EX6A 1ZBWA 5D2YA 2F2HA 1K7EA 3CT7A 1UQZA 3W2JA 3GBDA 4CN4A 3O6CA 1BYBA 2XIOA 1OX4B 5C70A 1EKOA 3ARTA 3KRSA 1TJRA 3W7OA 2PRLA 3N2BA 3UD6A 4DZAA 3ANVA 3KL3A 1O5XA 1DJNA 1XIIA 1SO5A 4US5A 1LT7A 1Q4WA 1BRLB 4J28A 3CV7A 1UKSA 3DGRA 4WD0A 4KRUA 4IIFA 4UB9A 2O92A 2NWRA 3W2KA 3BG3A 3LTYA 1JXJA 7XIMA 4H8HA 2PAJA 2PC4A 4NZCA 3WL0A 5CPOA 1PWMA 4F8XA 3IEBA 3FYYA 3W0KA 1O95A 3WDQA 3FNDA 1UWTA 1UR1A 2PBOA 3S2NA 2OJPA 4O4VA 4WKAA 2J66A 2OQLA 1C9DA 3MUXA 4Z1CA 1F3EA 4R9OA 1TPEA 2PODA 1SZRA 3S6TA 4DZIA 3EKZA 3OODA 1SVDA 2VELA 4CQ9A 4BQ2A 3T6CA 5I3JA 3N17A 4E8DA 1V6XA 4C6DA 4N6EA 2YCIX 2W4XA 3NPXA 4IMEA 1H11A 3R0UA 3GRIA 5FAJA 5I79A 2PDJA 1FWRA 1SM9A 3HGRA 5H6HA 3PBVA 2PP1A 3GKAA 3KBVA 1PPIA 1GPWA 3R89A 1OK6A 4J3XA 4ZSTA 1Z42A 3DBNA 3WF4A 1JZ2A 5HULA 2OU4A 3W71A 4K68A 3DESA 2EXOA 1FBAA 1W5PA 3S5ZA 1ZB5A 3P80A 4IIDA 1XRSA 5GJNA 1ZTVA 4CN6A 1FWGC 4O1FA 1CXHA 3S2CA 4PMDA 2PZ0A 1RCOB 3UPBA 1W9VA 3POCA 2XU2A 3Q45A 2J74A 2J8GA 4AMCA 2ZRXA 2HNEA 4A8RA 4N4PA 4HP5A 2ZDSA 1PZ1A 1F3TA 5A2CA 4K38A 4JL2A 1HKWA 4GYFA 4PL1A 5FSEC 2WJFA 2ZOXA 2QCEA 4RCXA 2CW6A 1FH8A 1FX6A 4O54A 4B3LA 3UWZA 1J0YA 1KCXA 4CEUC 3TW6A 3LB0A 1XFCA 3RGTA 3QOMA 3F1QA 3ZLHA 1KLZA 4DUWA 5FJUA 4Q3MA 3B0VC 3WF2A 1FWCC 3LRKA 2Y89A 3WLRA 2WANA 4GXMA 4OUEA 3GC2A 1BTCA 3K1DA 4FNPA 4CNSA 4YYFA 5DN1A 1IYXA 5HNUA 3KX6A 4MJZA 3WJZA 3EEGA 9XIMA 1VFOA 2CCRA 2WNZA 2ZE3A 4C65A 3QYSA 4F4RA 1ADDA 2E68A 3G0SA 4GACA 1H62A 3C8NA 3B8UA 3GFXA 3KCOA 5T26A 3VVGA 1GONA 3RG6A 3VMOA 4CCCA 4UFKA 5HR6A 3NOYA 3CJPA 3W7MA 1PDYA 3MY9A 1TV7A 3P61A 4RDYA 3EGJA 4OV9A 5CXPA 4DQWA 3APYA 1V4YA 3AS1A 3M0KA 4LAOA 4HSNA 3DHFA 1CX9A 1FQ0A 3AMLA 2F9RA 3C3NA 2VVNA 3KWXA 3KOFA 1TCDA 3KUMA 4EVZA 1MDLA 4GHRA 4LYRA 1HJUA 1BRLA 3ICJA 4GBUA 3TJ4A 1YXDA 3B9EA 4ZXOA 2FZMA 3O0FA 3BO9A 4C5ZA 2F38A 1JAEA 2R1MA 3EX3A 4YNGA 2P53A 4DF2A 5AC4A 1K70A 3NQAA 1LBFA 1KGWA 4HPJA 3W7PA 1SFSA 1FH9A 4NRSA 2VC9A 4X22A 2XIQA 4ZE4A 3N9KA 5DCEA 3WBAA 1H1ZA 2UY4A 3QPZA 1ITCA 4JKKA 3FXGA 2DZAA 3NPUA 3A24A 1T8XA 6REQB 2C18A 3QF0A 4KMQA 3STEA 4J7RA 4AD1A 2I1OA 1VCGA 3DN5A 4GVFA 4MZ8A 3I7QA 2OZTA 3PG8A 4V28A 1DEDA 4M8UA 3D6NA 1KXVA 3KWSA 5AHMA 3OZMA 1VFUA 4P7LA 4C6KA 5ABGA 1NDYA 3IUHA 5AC5A 2YLLA 3DYOA 1PX8A 1J0KA 5JU6A 2QUTA 1LBLA 3NL6A 2PTXA 5CLWA 4HNUA 2RFGA 2ZUSA 3CYVA 4B9YA 4EKJA 1PZ3A 4MADA 4D2JA 1TX0A 4EF8A 4NY2A 1L8NA 2EPLX 4AIEA 4KWWA 2XM1A 1F8IA 3TCEA 4OE7A 4KGJA 3EBVA 1KRBC 4DEFA 1RJQA 3T44A 1KKRA 1EBHA 4KF1A 1L8PA 1D9EA 1KM0A 3MBDA 2IKGA 2VP8A 3B04A 3MTWA 2FLIA 3VNMA 5A6KA 2OLAA 4Q6XA 3V4BA 3H4GA 4DPPA 2CEQA 1IE7C 1UP3A 2G95A 3N18A 3P0WA 4MYXA 2R8WA 3D46A 3MUZ1 3SR7A 1EJWC 1K6AA 3RR1A 1SO4A 3W7KA 2A5HA 3W7DA 3FSUA 3DZ1A 3FGCB 3PF3A 1IGWA 4PMVA 1AK5A 3VKDA 1KFEA 3E1F1 1JRBA 2YB4A 3CS2A 4KEVA 2XSBA 2W9MA 3HQOA 4AW7A 3ZFHA 4NP7A 2X05A 4D6DA 1T41A 1J6OA 1EC9A 4UTJA 3CZEA 3GHSA 3U7BA 3VD5A 3LK6A 1TO3A 2IPGA 2QEZA 2HEJA 4MTVA 3EDEA 3BAXA 4JTRA 1XLHA 4NAEB 1OCBA 8CGTA 1HJXA 2WNWA 3TU9A 2FGZA 3H70A 3PK7A 4D6FA 3EMCA 3G24A 3S0CA 3PAJA 3KBJA 3UETA 2QDGA 3BSHA 1EJVC 3A9BA 1I6NA 4FIQA 4LC8A 3CLMA 3T8LA 1W3HA 2CLIA 4Q4RA 4IISA 2WV8A 1LM1A 4IPIA 3MQTA 3B06A 1RR2A 2FZ8A 1V6WA 1I0DA 1KFJA 3WNNA 5D03A 1VLIA 1EHNA 2F7FA 4JCLA 4DJFD 3M0YA 4KWVA 4UTHA 4RLIA 2EHHA 3FLUA 1SJDA 2CZEA 4Y2WA 3WK0A 1QASA 1ZNNA 1A5MC 3MPGA 2BG5A 1W3KA 3N13A 4DBSA 3SSZA 1TVLA 3VXGA 1XRTA 4CKQA 3POHA 1CENA 1F7BA 3IK2A 3M0IA 3W70A 4H9VA 1MSSA 1LWIA 4OOUA 2JKEA 2HXUA 3BSMA 5KZ6A 1ZCOA 4G5DA 2EPKX 1RHCA 3W2LA 3LTSA 4O17A 1LLOA 3QR1A 4HZ7A 4PE8A 3ITYA 3OEXA 3UZJA 3SO7A 1NQ6A 6TIMA 2D24A 1EX1A 1HZYA 3NEHA 2BXVA 3UYCA 2I5IA 3MI2A 1EXBA 3UG5A 4IMCA 3KVMA 5CGQA 1BKSA 3URBA 4FLOA 2VEFA 3R25A 4ZENA 4A35A 2CHNA 4IP7A 4PTNA 1VRXA 3L5AA 3ATYA 1E43A 4PBGA 4A2SA 4C6BA 4LF2A 4HPHA 2CZDA 5C9UA 1KLYA 3EEZA 3BZGA 4DI8A 3DIPA 4J3SA 1BF6A 1DJGA 3U3HA 2O0TA 1PKYA 4BI5A 2QULA 3DC8A 4RE3A 3NM3A 4PTXA 2Q8XA 3VKAA 1GG0A 1DJZA 2DFAA 4P7NA 5FF2A 2Z25A 3CWOX 4L9XA 2GOKA 1CT5A 1JRCA 5I2UA 1U2YA 3P8JA 1W8GA 2VQUA 2WZHA 1H4PA 3F4WA 4G6CA 3H7RA 4TMBA 4TX6A 1IWBA 1F2JA 4W93A 1PYMA 3VI2A 1UCWA 4HYVA 1QWKA 4NVTA 4ADSA 1OFBA 1Z41A 3EMZA 4H9UA 1RVGA 1BHGA 1E6SM 4OV4A 1XGEA 2VKZG 2R1PA 4C6MA 3UZWA 4F3HA 1O6IA 2C1GA 3HG3A 1MQRA 1QBBA 4OECA 5BXTA 5LHEA 3L4TA 3G3MA 3FDGA 3SSJA 2AKZA 5DT7A 2GFTA 3HGSA 3ARZA 1KM2A 4TVCA 1Q4NX 4AYSA 1QO2A 4GNJA 3DFTA 5E9AA 3W6MA 1ZAJA 4O16A 4XK2A 5I03A 2AL2B 2VD9A 1TRIA 5CPNA 1SFJA 2WB5A 4FF5A 3BOLA 3TWAA 2QNEA 4E4UA 4LAKA 1EYEA 1MXDA 5F2MA 3LCHA 2B7OA 1YTDA 4TTGA 2YBUA 2E09A 5C9XA 1F07A 1UWRA 1EDTA 4CNPA 5FCZA 4HCDA 4EXBA 5SWUA 2QT3A 4M81A 3N14A 4CN1A 3E3HA 3VOHA 1XLIA 3LXBA 4C1KA 1GK8A 3WH8A 4UFHA 5FOOA 1DPMA 1W2VA 3A4JA 4RZ6A 2IPJA 4GCAA 3M44A 3GDLA 3SBFA 1ZJHA 2VFIA 1H60A 2FHCA 3UZ5A 4IX2A 1QHOA 1ZJAA 4PCSA 4MLRA 1A50A 1QHZA 4Q8PA 2CHOA 4LS0A 3TYDA 3CB8A 1FDZA 3N12A 2C7FA 3W4RA 4JQ4A 4WKHA 1ZUAX 1EJTC 3FJNA 3R0DA 2CLLA 3BCDA 4J9JA 4AIOA 1GEHA 2QCMA 1V03A 4B2DA 1VR6A 3ZSTA 3OOQA 3NQBA 1RZMA 3NFUA 4KEMA 4LUSA 4JX6A 3INPA 4QE1A 3OQEA 3KBWA 1FDYA 2O7SA 4XTIA 1Q63A 4R7WA 4WLCA 2GUBA 4X0NA 4HN8A 2YCJA 3WH5A 2OVLA 4E2BA 1AQFA 1YDOA 3TNBA 1IIGA 4KCUA 4D6EA 4M7TA 4I7WA 4C6IA 3QFWA 5HMFA 2XM2A 2RKXA 3M6YA 5BZAA 3TDFA 3E2RA 4MPKA 3WUGA 4JIEA 4IJCA 3OZPA 1PTDA 2CESA 4JIPA 2PURA 4Q4QA 1YYAA 4Q4OA 4JYFA 1EC8A 5AKQA 1VEOA 2YXGA 4U3CA 5FJOA 3E74A 2AQOA 3WQ6A 1QPKA 1UIOA 3PUGA 4AHOA 3OTRA 4KCWA 3W1QA 3WMSA 4G7EB 1XL9A 3QSRA 1EIXA 4L4PA 4MY8A 3MYOA 4LVGA 3ZO9A 2V5BA 3W1LA 2QJHA 5IRPA 4D8ZA 2AKMA 3DHDA 5HDRA 5LZLA 5AZ1A 3RX2A 4C1LA 3IANA 2DIKA 4NNBA 3GG1A 2PDFA 2JKAA 3PZNA 3DI0A 1Q7QA 2OCZA 5HPCA 3M07A 1OC6A 4UNIA 4KFNA 4UMBA 1I1XA 1B90A 2TAAA 5E9XA 3ANUA 1W9PA 4GVHA 3N25A 3WBWA 1ZSXA 1P43A 1IWAA 2VCAA 1JNDA 4R7JA 2XVKA 1OIFA 4AZ6A 5IOBA 1O12A 4CD5A 5BRPA 4LT9A 4DXVA 3N29A 4OOZA 3K1GA 3CHVA 3W7QA 3A4WA 4Q22A 4DF0A 4GJ1A 3LCLA 4I9JA 3RILA 1JXKA 3GHTA 1EWDA 5TBOA 4PCTA 2PF0A 2WVVB 4DF1A 1L6YA 2GVGA 4EK7A 3MSDA 3NZQA 3PBUA 1V8EA 4CU6A 3NO3A 3CEUA 3R8RA 2WC4A 1NQKA 1QNSA 2QCDA 1EX5A 4LTSA 4W8LA 3DCPA 1FWSA 2RDWA 1C8XA 2WVTA 3I4KA 4BZYA 1UUMA 5A6AA 3WMCA 2FTWA 1UZ4A 4C90A 4JXCA 3FHAA 4AC7C 4PUMA 3RLUA 3DFSA 1SJAA 2V38A 4UMAA 1UR8A 4G8TA 1JAKA 3VYLA 4AZGA 2BTMA 1X6NA 3UT0A 5G4EA 4ATLA 1QK2A 2WK2A 2YA0A 3T0DA 2PUZA 1F76A 1LUCA 5I3GA 1W32A 3MP3A 2GVYA 2PWGA 3MUAA 2Y6ZA 1UR9A 1TTJA 5CGTA 3QTPA 4C7DA 4NNAA 1VFLA 1JVNA 4L1WA 1DJYA 4O1AA 3N4EA 4CU8A 3ERPA 4WJ8A 1KR1A 4P8WA 2Z6JA 1ITUA 3R79A 5HATA 4NJJA 1PKMA 2AGTA 3FXYA 3KLLA 4Q8OA 1G5AA 3EB2A 5AC8A 3L4YA 1JCTA 3RDKA 3TOPA 4MKNA 4W7UA 2I9UA 4GCXA 1TRDA 2GK1A 3CV1A 4UOJA 3E9AA 1UC4A 1XRVA 4WDUA 5LIXX 1N82A 3AISA 3E0WA 4Y6GA 4QTGA 2HXTA 4FOKA 2W5FA 3TYZA 4FMVA 5HUOA 4J27A 5T9BG 1VZWA 3BSGA 1KXHA 3BMXA 1Q65A 3VDAA 1IR1A 2V5LA 5HXMA 2BOGX 4WSKA 1Q85A 5DCDA 3QV8A 1DOSA 5LIYX 2XDFA 2CNCA 3KL5A 1PO9A 5A2AA 3AYTA 1PCWA 2BV9A 2WPBA 2I9EA 1QPOA 4TO8A 5AZ0A 7ODCA 2WSQA 2X1UA 4A3QA 3G0UA 2PU0A 1UR3M 1K9TA 4PUJA 3CPGA 4HMNA 2H90A 3MI6A 3AHVA 4W8AA 1FCVA 2WMIB 3H7VA