1VJIA

Gene product of at1g76680 from arabidopsis thaliana
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
361
structure length
351
Chain Sequence
SVPLLTPYKMGRFNLSHRVVLAPLTRQRSYGNVPQPHAAIYYSQRTTPGGFLITEATGVSDTAQGYQDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGKAPISCSDKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYMAESLNKYGILYCHVIEARMHTLMPMRKAFKGTFISAGGFTREDGNEAVSKGRTDLVAYGRWFLANPDLPKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12-oxophytodienoate reductase (OPR1)
publication title X-ray structure of Arabidopsis At1g77680, 12-oxophytodienoate reductase isoform 1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Plant protein
total genus 126
structure length 351
sequence length 361
ec nomenclature ec 1.3.1.42: 12-oxophytodienoate reductase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1vjiA00
4AF0B 4N9BA 2ZTKA 3NDOA 2J24A 3CC1A 2C1HA 3TQVA 2WNQA 4K36A 3N34A 3NR0A 1W3TA 1KBIA 3MHUA 1QOQA 3TK7A 3H53A 5FF0A 1ME8A 2X1UA 3GNDA 2GOUA 1IXOA 4TX9A 4YWIA 5DCBA 4LW7A 1H60A 4UTJA 4X9SA 5FI8A 2ABAA 1TIMA 4PC8A 4QNEA 4U4MA 3P67A 4JDBA 3SIZA 3ELFA 1W5OA 5HJLA 1N7KA 2Y70A 3S5ZA 1QO5A 2NUXA 1EPXA 3DI0A 4RZ6A 4R7JA 1L9WA 4FNPA 2GVGA 1K3UA 2YYTA 3G1HA 4O4WA 3HGOA 1KTBA 3TW7A 2Y62A 1SQ7A 2QUVA 3PSWA 4MLRA 4M6VA 5EA9A 3CPRA 2C0AA 2ZRWA 1TSIA 1LBLA 4FXRA 3SGZA 5D09A 1K7FA 3TIMA 4LY8A 2QAFA 4ZQCA 1OK6A 2NWRA 3F03K 3D0CA 1WOAA 4LOCA 3PUOA 3MJYA 3LCLA 2FFCA 2HSAA 1KFLA 1WA3A 5HWMA 4TU1A 3IRDA 2VENA 3P8JA 5DY2A 3VNDA 3VE9A 3GZ3A 2YSWA 5D38A 4DF1A 3HGJA 3NL3A 1TO3A 1SO3A 4EF9A 1MSSA 4FO4A 1FWRA 3RFAA 1YXYA 1WV2A 2WSRA 1IXNA 1QNVA 2CZ5A 1DJNA 1DORA 3W7QA 3ZWTA 2CZDA 2DZTA 1TYGA 3MI6A 1TTIA 4RXFA 3W3OA 4FX7A 4E0CA 3N3MA 1ALDA 3BW2A 4ZQOA 4JY9A 1YADA 2OCZA 3PF3A 5IM51 4MKNA 1GVOA 1JCJA 4KFPA 1JUEA 4JTEA 2H3DA 5LZLA 1MZHA 2C3ZA 3O07A 3TA6A 1FCBA 1TPVA 2JK2A 2A5HA 3T55A 5KZMA 3QQ0A 3B03A 1DL3A 4DPQA 2C14A 3PWAA 4C1LA 3W7JA 3GK0A 4WXZA 3TROA 2BLEA 3NQ6A 4N6EA 3P5YA 4TMBA 1SZNA 3IEBA 3AO0A 1DV7A 5LKYA 1W8SA 2X30A 3CQ0A 4M5PA 3SJ3A 2OJPA 3EXRA 3R8RA 1T8XA 2E5BA 4ZL1A 3NA8A 4OV4A 3TDFA 4OV9A 2A1YA 5CZJA 3EXSA 4AF0A 4WUIA 5AHNA 1N55A 1NVMA 3JR2A 2JKEA 3PVFA 1RR2A 1TREA 2I1OA 2WQPA 3MP3A 3PC0A 2E5CA 3NM1A 3NQ7A 2PE4A 2X1RA 1FXQA 3ZFHA 2E1DA 3KOFA 1LRNA 3DFSA 1X7FA 4LWWA 4Y8FA 1O4UA 3MUXA 1G4PA 1MXSA 5FF2A 1AL7A 1RZMA 2CLMA 2CLFA 3P7YA 4O19A 4BWLA 4JTKA 5LGXA 4POCA 2YCEA 3IGXA 3W1UA 5A5WA 4LTSA 1XUZA 4JIQA 2QCMA 1TPEA 3LBCA 3LB0A 3W74A 4JYDA 5FEPA 4AH7A 1RV8A 1SZFA 3IIVA 1QFEA 4O16A 2NX1A 1CX9A 3TSBA 1W1ZA 1OHLA 3OVPA 4ZQNA 3BLFA 4HPJA 1C29A 1AW1A 4PA8A 2WO5A 1P1XA 2QDGA 3TKFA 1I2PA 1M6JA 3RNDA 1X6UA 4CQAA 1KM0A 4MZYA 1GT8A 3HJZA 2WPBA 1PHQA 4JX5A 4O4VA 2TSYA 1TTQA 3B0VC 3W2MA 4A22A 3ABQA 1THFD 4N02A 3N2MA 3FFSA 4OQVA 4AVFA 2Z6JA 1PS9A 2NXIA 4GUJA 4MYAA 1H1YA 4NXKA 4MFEA 4DPPA 2V82A 2NX9A 2ZRVA 4RZ5A 3M47A 2QCFA 5LHEA 4HN4A 2VOMA 4YMZA 1H51A 4N9DA 3L0NA 4K7VA 4MZ8A 3GDMA 5K3VA 4LS2A 4LRSA 4L4LA 5EMUA 4GUGA 3HO8A 3S6DA 1JCLA 4I7WA 2AQWA 2QUTA 1OF8A 1N8FA 4OBTA 1XDMA 3M41A 1TPH1 4GNJA 4CQ8A 3UWZA 4O28A 3KVLA 1OFPA 4IJBA 1U83A 2ZZ3A 2FIQA 4MY1A 2QCGA 4WXYA 3LXAA 3TAKA 1XBYA 4PODA 2YPIA 4JTSA 5FEZA 2RDUA 3W7OA 5DBTA 3DFQA 3W7RA 2DZVA 4UFKA 4EVZA 2ZRUA 4XKYB 1JQVA 1OFBA 1KV5A 4J9JA 2FJKA 5AC7A 4QISA 2JBMA 4LS0A 2RFGA 1TTPA 3GNNA 5K9DA 1RQBA 4W9TA 3BG9A 1QPNA 3MYOA 1TTJA 3NO5A 3TR2A 3M5XA 4Q32A 1GVQA 3QEZA 1JCNA 1XC4A 2CLOA 3NPUA 3I7QA 4FF7A 2O7QA 1OVDA 1UBSA 3MI3A 4OE7A 2I9EA 3R2GA 1HL2A 1EB3A 4BI6A 1LBFA 4DF0A 2BSLA 2F84A 4LC8A 3DFTA 5HULA 4BK9A 4IMCA 4GUIA 4DELA 2C6QA 1GG1A 4LVAA 1K7EA 1WBJA 3EKLA 4X2RA 4FIQA 1IIGA 1GG0A 3BLIA 3UY7A 1ZJIA 4NXSA 2FB2A 3FS2A 3EX6A 3O6DA 1VC4A 5AFDA 4O12A 3BW4A 3LLDA 2C16A 3E49A 2ZA1A 4AAJA 2ISWA 2TPSA 2NLIA 3EXTA 1R47A 3TC6A 1F7BA 3IIPA 2X2GA 4FHAA 3EWBX 4M6QA 3QSTA 1SW7A 1DKWA 1RVGA 4MY8A 4JN6A 4UR8A 3CLMA 4WJEA 3NQEA 3OVQA 2HTMA 2VEMA 4NX5A 1R2TA 1NAL1 5LNSA 1F6KA 2H8ZA 3FYOA 3QH2A 1KFBA 4FNUA 1T99A 5G4EA 1K03A 3EB2A 3V75A 2FQIA 2PRHA 2Y7EA 3PBWA 5G2HA 5DY3A 5BOOA 4BI7A 1Q6LA 2C15A 4LVFA 5AC8A 2R8WA 5D05A 1PHWA 1XI3A 3KRUA 1S5WA 5TIMA 3HMJG 1EWDA 3HBLA 1JUBA 3FA5A 5J5RA 1YTDA 4IX2A 1P4CA 4Z0JA 1YPFA 1OFEA 2TYSA 3M5ZA 1U5JA 4YLWA 2YDAA 1H7XA 5AHMA 3LCHA 5AC6A 3CTLA 3TJXA 2EHHA 5CPMA 2BX7A 3B05A 4UTWA 2X1TA 4JXCA 1TPUA 1G7VA 4NJHA 1BWLA 3B4UA 3S1UA 2QCNA 1QMLA 4EF8A 4O14A 3G24A 2Z0IA 5SWUA 2RDWA 1SUXA 2V81A 3LCIA 5D30A 3ANYA 4XBSA 3OA3A 4NZJA 1FCQA 1FCVA 3LHWA 2AAMA 2E5DA 1NEYA 4UC5A 3DFOA 4UCGA 1VLIA 3NZ1A 4AWTA 1HG3A 3SW6A 1XL9A 4O54A 3B0UX 1KM6A 2D73A 2ZQ0A 1KTNA 2E09A 3V1PA 4JTTA 4JNMA 5C2XA 1AW2A 4RK8A 4P2VA 3H55A 1C8VA 1JVNA 1H63A 3CEPA 3KRZA 4KFOA 5FESA 2A6NA 4EOUA 3O06A 3UWVA 5CSSA 3THQA 5G2WA 4UTMA 4JTLA 2W0UA 3O8AA 3TMQA 1QAPA 1LZOA 3W84A 1OF6A 3HQ1A 4X22A 1W3IA 1KW1A 1SU5A 2G96A 3LTPA 3GDKA 3GDTA 1TQXA 2VFEA 3KXQA 4AHOA 1WDWA 4LU0A 1C9DA 3W1LA 1LTDA 2A2IA 4OGZA 1G4TA 4NX0A 3BVJA 1DJQA 3UD6A 4ADSA 3PUEA 1OX6A 1LRTA 3RLUA 3W1RA 3ATZA 1NF0A 1SFJA 4FEZA 1FDYA 3NPWA 1LCOA 5DBUA 2ATSA 4K37A 1QPOA 3VCRA 2QDHA 4RX0A 2YW4A 4H3DA 3QJAA 3FKKA 5F4WA 4HKPA 3LXCA 3TAOA 3PBVA 4K8EA 1AW5A 3S5NA 5DXYA 2Y7GA 3EEGA 4Y9AA 3G1AA 1TPFA 5AHEA 2WNNA 1O95A 1HO4A 4GE8A 3BGGA 1I2OA 4TR9A 4B5NA 3CIWA 1K8ZA 4BFAA 1FX6A 3L21A 2B7QA 1UUMA 1D9EA 3UWWA 1UCWA 3P5ZA 3WJXA 3DFPA 1P0KA 5EPDA 1CI1A 1XCFA 4JYFA 4M6PA 3C3NA 3UY8A 1ML1A 1FBAA 2PRLA 4N2YA 1TPDA 5DELA 2QJIA 3S1XA 1VS1A 3L2IA 1QCWA 3ZWSA 2VKZG 3FJ6A 4QITA 1PV8A 1EP3A 5F4XA 1XXXA 1KBJA 1IXPA 1ZENA 4IOTA 4MJZA 4MJMA 2Q8LA 2E68A 3DI1A 4OT7A 2P0OA 4Z08A 2EAWA 4PL2A 4NQ1A 2VEKA 3NQAA 4CLMA 1GWJA 1ZY9A 1H61A 1A5SA 1A5AA 3NYZA 4CCCA 3M7WA 4O1CA 1W31A 5I3JA 3M5YA 3Q37A 4HPXA 3TUUA 3P80A 4UNLA 4LT9A 1UASA 5HWNA 2NV1A 4O0KA 1J5TA 2NXGA 2ZZ5A 2Q8ZA 3ZR4A 2KZHA 3WJWA 1OYAA 3DHDA 3LHYA 5I3IA 3W22A 3W2NA 5C6MA 2CZEA 1IIHA 3S8HA 5DN1A 4KKXA 1I4NA 3B06A 3LRKA 3TNOA 4JS3A 4E2DA 3W70A 4JICA 3MW7A 3M16A 4LC6A 3KFTA 4R53A 3O1NA 3U2OA 3N14A 3R12A 1YXDA 2G97A 3RLVA 2ZZ2A 1QPQA 2ZRZA 2ZDRA 3GIYA 3TXVA 3W73A 3O16A 3GXNA 1OYBA 4WZHA 1HTIA 2V2DA 5KTLA 3CWNA 3G3MA 1EUAA 5G2IA 2XN0A 3I68A 1DBTA 2PC4A 3QZEA 3OG3A 2ZZ1A 3W72A 2YX0A 3NNTA 4Z1AA 3GXPA 2NV2A 3MMTA 4WY0F 4HNTA 4GXMA 2YGYA 3UWYA 4HNVA 2WSQA 1GTHA 1KFKA 1NFBA 1ZALA 2DU2A 3BLEA 1YDOA 1GVSA 3TH6A 5L9FA 3NQ8A 1ME9A 3TFCA 3R5EA 3LOTA 1OX4A 4UR7A 3L9CA 3G0SA 3BG5A 3NVTA 4XZ9A 3W86A 4DBEA 5F2GA 3LRLA 1ZFJA 4KFNA 3N73A 2VFFA 3Q2DA 5U4NA 3EX4A 4MYXA 1LOQA 5D2XA 3TU9A 1M7PA 2Z2UA 5CZSA 5HUPA 1D3GA 3M5VA 5MHBA 4DO5A 3TE9A 3QC3A 4IMEA 3PBYA 1DOSA 4JY8A 5F1VA 4MVAA 3T4CA 2O7SA 3GR7A 3T44A 3VI2A 1VJIA 3G3DA 3T78A 3BV4A 4GUFA 1JRBA 2UV8G 3T7VA 1XBVA 2EKCA 5D02A 1SZEA 5EY5A 2XN1A 4HSNA 5D32A 3A22A 3C8FA 4XWUA 3W87A 3P74A 2J9ZA 2JKPA 2J6XA 5K2ZA 3LHTA 3GB6A 4PFMA 4QQ3A 2NUWA 2I14A 3N19B 5D2YA 2PRMA 4ZZ9A 3N9SA 1MEIA 2IQTA 3HG2A 4LV4A 2GUUA 3BG3A 4UFLA 4M7TA 1H7NA 1MO0A 3IVUA 3C6CA 3HB9A 4IXHA 3HPXA 3NQCA 4HT3A 1T0OA 2QUUA 2YXGA 3PG9A 1H7WA 3U8GA 2ISSA 2RHGA 3CB8A 2Z1BA 1ZHAA 3F4WA 5KZDA 2DZSA 3UWQA 5LNVA 4Y96A 2NUYA 3JRKA 1EIXA 2DZPA 1PVNA 4WY0A 1TPC1 4K6AA 1O94A 1Y0EA 4PEKA 1WYIA 5TQLA 2A7NA 2GPTA 4UTHA 3RF9A 1B57A 1I2RA 1SW3A 1GVRA 4K7YA 2QCDB 5F4SA 4CNNA 4JGDA 1R46A 3QW4B 3G8EA 3L68A 1I8JA 3LHUA 3W7LA 3W1NA 3A5VA 2Y61A 3L5MA 4QM1A 3C4UA 3P84A 3LTYA 3KVJA 4UTKA 4Z1BA 3G1FA 5LNRA 4Z0SA 2E6YA 2YR1A 4RZ4A 1LP6A 1W5PA 3WJSA 3G0UA 2BZNA 1T96A 3THAA 5AYZA 1JUKA 2J27A 3SGUA 2H6RA 4ML9A 3QYQA 2YFNA 4FNQA 1E51A 4JX4A 5LHFA 1GEQA 3LM7A 3KX6A 2OMAA 2CU0A 3IIXA 5E0KA 3PG8A 1R30A 4WX2A 1P0NA 1UUOA 4FX8A 4RXGA 1OYCA 3NQDA 2JGYA 4ZQRA 2NX3A 3VFLA 3PY2A 2WSYA 4UNKA 2J9XA 2YYUA 3INPA 3C56A 5D04C 5IBXC 4G1KA 3NXFA 2TMDA 1FQ0A 1L6YA 3M0ZA 3N9RA 1SO5A 1FWNA 3E12A 2FPTA 2CFFA 3SSJA 1H7PA 3O6CA 3OHIA 4IGHA 4NUWA 3W88A 2Z6IA 1A5BA 2QCHA 5F2IA 5DXXA 5FF7A 2DORA 1KM1A 5LNWA 1DHPA 3W1QA 2G5WA 1F6PA 4QIUA 1GJPA 3NL2A 3SFKA 4UTUA 1LRQA 1VQTA 3B04A 3LI0A 4K38A 2RH9A 4JEQA 1H1ZA 1G4SA 3SZ8A 3UXDA 4O0ZA 2Y63A 1YDNA 5FF3A 3LV6A 3DH7A 4N9CA 4AXKA 4DO6A 3E96A 3O6YX 3W7CA 3W7HA 2QCLA 3NQ2A 1ME7A 4JYEA 3U6WA 5CG7A 4TMCA 3W7NA 3P60A 3C2OA 2VXNA 3P81A 4JTUA 4DBDA 1XBZA 1K7XA 2EPHA 2V9DA 3IVTA 1O5XA 5HR7A 5AB3A 3CIXA 3LDVA 1F76A 3O63A 3OVRA 5D2TA 2ZYFA 2LLEA 3EX2A 5KZEA 2V8ZA 3L67A 3S5OA 2ALDA 1J4EA 2FLIA 1HUVA 2QCDA 1FY6A 1OABA 1YTKA 2C13A 4RR4A 1FWTA 1W0MA 4JTFA 2WV8A 1AL8A 3UXAA 1TPB1 1P5BA 1F73A 4LNYA 4FNSA 2BWGA 5K9XA 4M7SA 6TIMA 3PBUA 3M9YA 1J2WA 3QPYA 4NJKA 3LRMA 1YPIA 2QF7A 3LTSA 3BK0A 3GVGA 3IVSA 1GVFA 1JULA 3STCA 4NJIA 4UMAA 2DZUA 1PE1A 2ZZ7A 1W5QA 1SZGA 3M6YA 4IMGA 3CEUA 3C2FA 3LBMA 2GQAA 3OBKA 4RV8A 3HIJA 3SI9A 1BEUA 4ZMGA 4HSOA 3CU2A 4R33A 2B7NA 4UFIA 3W23A 3W7DA 3MWAA 2CLEA 3PS7A 3GAYA 3TCEA 1FDJA 1KM2A 3W1PA 1B4EA 2ZZ4A 7TIMA 1OFRA 3M43A 3EKZA 4AWSA 3SECA 5E1QA 4FX6M 3GKFA 4PCFA 1QOPA 3S1VA 3QSRA 4A29A 1W3NA 3IV3A 2A6LA 2JGQA 1X8FA 3PSVA 1A53A 3DKJA 3S0CA 2G95A 2H8XA 4IWWA 3NL5A 2XN2A 2XFWA 4YCPA 5CPNA 2FPVA 1QWGA 2QJHA 1PCWA 2GJNA 4QAIA 3O05A 3TSDA 3WJZA 1GTEA 3PM6A 3ABRA 4LVBA 4JR5A 4AHPA 2R91A 1W5MA 1KFEA 4UIOA 5CPLA 3PUDA 2OT0A 4XUGA 3USBA 4XTIA 4UTTC 4O15A 4FIRA 3HOJA 5BMWA 3B0PA 4GFSA 2DZWA 1IF2A 5CPOA 2P10A 3DU0A 3MYPA 4WQ6A 1TQJA 5KINA 3HGSA 4WOQA 3QM3A 3STFA 1WXJA 4Z1CA 1L6WA 1G4EA 4LVGA 2Y89A 3IIOA 1TV5A 1X1ZA 2HS6A 5DLCA 3QW3A 4MPQA 1FWSA 1VHNA 3NG3A 2VFGA 3C2RA 3LCFA 1LORA 4H6KA 4E38A 4HNUA 1Z44A 2VFDA 4ZQMA 3E0IA 1H62A 2CLKA 2X1SA 4JX6A 1IXQA 1Z48A 3UNDA 4TIMA 5FF4A 3QFEA 3OIXA 1KFCA 4JTHA 3F1QA 4RCXA 3FYPA 1A50A 3W75A 3CT7A 1Q45A 1VZWA 4HHPA 2V2CA 1VYSX 2ZA2A 4R34A 3UQNA 5D2VA 1VYRA 1OX4B 4D2JA 1GOXA 4DEFA 3HPZA 3NM3A 2WOQA 4CQ9A 1XDLA 3GLCA 2DZXA 5C5YA 5K4XA 4BR1A 1YTEA 4ADUA 4JD4A 1JQXA 3PULA 2E6AA 4ZQPA 4MFDA 5HQEA 1OFAA 2A7RA 3W83A 5EKYA 2VEIA 1LBMA 3KRSA 4WOZA 4FNRA 3PR2A 3MBFA 3E02A 1YXCA 1DVJA 3RU6A 4LRTA 4UFHA 3GDRA 1YYAA 1TRIA 2BTMA 3MBDA 3C2EA 4UMBA 3C61A 1KM3A 4S2CA 3MP4A 3UPBA 1Z41A 4KWWA 4O18A 5GVJA 3MHGA 1LOSA 4XQ6A 4QJ1A 3STEA 4OWGA 4YXGA 5AHLA 3GAKA 3IGUA 4O8RA 4DQWA 3DZ1A 3DKLA 3NOEA 3TX9A 4ORIA 3W7EA 1AMKA 1OG0A 1H7OA 1S5TA 2GVJA 5D2WA 1F05A 4P61A 1JCXA 1W5NA 4IXXA 4Q4KA 5AYYA 3UZJA 5CZTA 1Q3NA 1HFBA 1Q6QA 4PH6A 2YZRA 3P8IA 3TC7A 4I7VA 4MIMA 1LM1A 1TPWA 1W56A 1F2JA 1RPXA 4PTNA 3TV8A 3HG3A 4WY0B 3UYCA 4Y6GA 3S5YA 4MLJA 3ZS4A 1LOLA 4NT0A 4A2RA 2ZBTA 3G0XA 4LUIA 5KMYA 5BRBA 2YW3A 2CLHA 3NQMA 4LVDA 5C55A 4JIPA 4RLIA 4ALDA 2ATMA 5HUOA 3GDLA 5HWJA 4ADTA 3C2VA 4JDYA 1B4KA 4ZVJA 3MI2A 1O60A 4JTIA 2JKAA 3A23A 3LHZA 4Z1DA 1ZCOA 3HG4A 4NNBA 3NPXA 3HG5A 3M1ZA 3GXTA 1KV8A 3HPSA 1YLVA 3NAVA 4AEOA 1I2QA 4M19A 2Q3RA 3R89A 2WNZA 3W7PA 1OK4A 1MEWA 2FPYA 3S42A 1TB3A 4O1BA 1I2NA 1ZAHA 1VCFA 3PAJA 5I3FA 5DCEA 2QKFA 2X16A 4XBKA 3LLFA 5U7SA 3G1DA 1TJPA 3FKRA 5D03A 4FXSA 3O15A 3G22A 3LCGA 3LV5A 3TQKA 3UZ5A 1SO4A 1LYXA 4IX0A 2QCEA 3G8RA 4PL1A 2V30A 1S3HA 4S2BA 2A7PA 4IQLA 1UJPA 4QNWA 1VGAA 2R14A 1R2RA 4FNTA 3DAQA 4BI5A 1QPRA 1RQEA 1PL9A 1Q6RA 2EF9A 5G4WA 1RQHA 2E77A 2VC6A 1NF7A 3W1MA 1JJKA 2A21A 2V2HA 3OEXA 3W07A 5EYWA 3FJLA 3QMTA 3ABSA 4OU1A 5T26A 2H3BA 3NEVA 5K9CA 4UTLA 3UWUA 4QSHA 4N4QA 3A9IA 3PB2A 2QEZA 5EL1A 3DBPA 4O10A 2NXHA 1OFQA 1VH7A 4GBUA 3TQ0A 2OZ0A 3B8DA 4EIVA 5ABTA 1BKSA 3QF0A 4IMFA 4I7UA 4L4MA 5L6UA 4DF2A 1G67A 3G1YA 1WAUA 2QR6A 2B0MA 3I7RA 5HINA 4UFMA 4IUOA 3NGJA 1SO6A 2NZLA 3NZRA 4UUIA 3C52A 3KAOA 4ICNA 3TSMA 6ALDA 5LNUA 1VPXA 1KFJA 2DJXA 3BO9A 1IGSA 4BWLC 4O11A 4O13A 4UMCA 2EGZA 3BARA 5LGZA 3W2LA 4ONVA 3LCWA 1G7UA 4BF9A 3RMJA 3K30A 1K8YA 2J88A 1EP1A 4AB4A 1H7RA 1XFBA 3QRHA 3W7KA 2TRSA 3MO7A 5I3KA 2AGKA 1CW2A 3BW3A 3W1TA 4A3UA 5BNKA 1WOBA 2GQ9A 4YCOA 5HNRA 1EA0A 1VR6A 4A21A 4MY9A 3CM4A 2ZTJA 4GJ1A 1KLZA 4NJJA 3NPVA 3YPIA 2B7PA 3T40A 3STGA 5LSMA 1ZAIA 4LV9A 3I7SA 3TMLA 1XKYA 2PURA 4O50A 4HNNA 5FEXA 1G6CA 3F4NA 1S5VA 4EWND 1EP2A 3FEMA 3VKJA 3KVKA 3A5FA 1EX5A 5TBOA 5F2LA 1SSGA 1F5ZA 1I45A 1VCVA 3GR8A 1KA9F 4X3ZA 2GJLA 1OJXA 2CZFA 3P82A 2GQ8A 4MOZA 1KTCA 1XUUA 5KSWA 2W79A 5IBXA 2YFOA 4LS1A 2FTPA 2E6DA 1XBXA 4UXDA 1W37A 4CCEA 1LROA 3CWOX 1RD5A 2RDTA 3FIGA 1OX5A 2QAPA 1FXPA 1GQNA 2DP3A 4O17A 2CW6A 3L66A 1PIIA 1M7OA 4CCDA 2HMCA 4C1KA 2ZRXA 5HR6A 4O1DA 1W54A 3W71A 2ZCGA 5CKSA 2Y88A 1VCGA 5C54A 3EWYA 2R94A 1H5YA 3P61A 1VLWA 2W6RA 8TIMA 4E2BA 1UB3A 1PCKA 5BW6A 1SW0A 3AJXA 1G69A 3NQVA 3HF3A 4NU7A 3GX9A 1JCYA 1V5XA 1DQXA 5J5DA 3JS3A 3L0GA 4CNOA 3SY5A 1SFLA 1WBHA 3QPZA 3C0JA 4A2SA 4K39A 1R2SA 1L6SA 3DXIA 1TMHA 3MHFA 2OX1A 1Q6OA 3I6RA 4UFJA 3SR7A 1AK5A 1TJRA 1TV7A 1D3HA 3N2XA 4NVTA 4GUHA 3W7IA 3W2KA 3L5AA 1LLZA 5DCDA 1FCUA 3P62A 3KVMA 3G1XA 4XTDA 3TJLA 4JTGA 4HIBA 4O52A 3BPWA 4CNPA 1GYNA 1ZNNA 1VYPX 1M5WA 4JTJA 1JRCA 2WKJA 1KLYA 3FLUA 3QQ1A 3LXBA 1EWEA 1ICQA 4AMAA 1KM4A 5H2ZA 1B3OA 1L2UA 3I65A 1EUNA 4KWVA 2CLLA 5K7JA 3DENA 1FDZA 3WK2A 1LLWA 3GKAA 2VFIA 1FUYA 4LUJA 3TXZA 1V7YA 4O57A 1NSJA 3LI1A 2VFHA 3EWZA 2FDSA 2Q3OA 4N4PA 1SPQA 4IMDA 1VRDA 5G5IA 1ADOA 3LHVA 2V5LA 4MUZA 3EWWA 3EX3A 3GYEA 3NQGA 1ONRA 2B7OA 3MP5A 3IGSA 4O1AA 4ORMA 3G18A 2V5BA 3ATYA 3W1AA 1TRDA 2A0NA 2ZZ6A 3WFAA 4DO4A 4I9AA 2H90A 3IIZA 5H91A 3FOKA 5F1UA 5KITA 3S9YA 3W7GA 4WD0A 3RK8A 2BXVA 2ZFAA 3VE7A 5AN7A 3EWXA 3WK0A 3UPWA 3Q58A 2V0TA 5HMSA 4UTIA 1JCMP 1SR9A 5BMXA 1ICSA 3EX1A 4IPJA 4OHQA 2NWSA 4Q33A 5G1YA 4AWUA 3A21A 3L5LA 3G1VA 2QJGA 3W6YA 3LGEA 1LDCA 4AHQA 5AYXA 1ZAJA 3TFXA 3BGJA 2CLIA 2CWNA 2VEPA 3G1SA 4UTWC 3LERA 3W1XA 3NL6A 4H4IA 4Y90A 1K8XA 3WK1A 4UTTA 1B9BA 3M44A 4NJGA 3LX9A 4RKAA 1XM3A 4NNAA 3W85A 4XKYA 2E6FA 1OFOA 1GYLA 1JR1A 3QMRA 4GRSA 1TCDA 2C19A 4DXVA 1BTMA 1QDSA 1Z42A 3R13A 1K02A 5EBUA 1QR7A 5D37A 3ABOA 4IPIA 3WK3A 2OT1A 1VHCA 4YL2A 3W2UA 1TV8A 4U28A 3DGRA 5AOUA 5AHIA 4NZFA 4GWEA 2HS8A 3WJYA 2Y6ZA 5I3GA 3CHVA 1WX0A 5CSRA 2Y85A 3W76A 1H50A 3TW6A 5F2MA 1HO1A 1O5KA 1YDVA 4RJEA 4N9EA 3H54A 3E9AA 1KM5A 3W9ZA 2Y7FA 3PB0A 1X1OA 2ZA3A 2J9YA 2GVLA 2P1FA 5CZ0A 5I3HA 2B4GA 4NNCA 3DFNA 4S1FA 3QMSA 3HGRA 3Q94A 2ISVA 3S1WA 3W2JA 4MZ1A 2FB3A 1EEPA 4O53A 2QCCA 1DQWA 2PCQA 1MEHA 1A5CA 5G1TA 4N6FA 4FB7A 4K8HA 1AG1O 3L65A 5FEWA 1OFDA 2ZRYA 2C18A 3KHJA 3EWUA 1GPWA 2F7FA 2A85A 5A8GA 2A4AA 1GZGA 5D33A 5K4ZA 1F74A 3LCXA 5E93A 1ICPA 3A24A 1BWKA 1SSDA 5CGQA 3L0KA 3NQFA 4GC4A 3DHFA 2RKXA 1QO2A 1FWWA 5AHFA 2Y7DA 2ABBA 4TO8A 2WJZA 2VELA 2DJLA 3W7MA 1WQ5A
chains in the Genus database with same CATH superfamily
4AF0B 2Z24A 2J24A 3MVTA 3TK7A 1OC7A 3IAQA 4CN4A 4GJIA 2W92A 1NWRA 1H60A 4UTJA 2YDSA 1MFUA 2AOSA 4Q4PA 4QAWA 5A6LA 5BWFA 4DAFA 3DC8A 2NUXA 5AC4A 1AH4A 4QDMA 4AIUA 3DI0A 5I09A 1RLCL 2GVGA 4US5D 2JE8A 2YYTA 4W8BA 3VXGA 3HGOA 4PTXA 2Y62A 1HW6A 4MM1A 1IEXA 3VNZA 1SJBA 2Z2AA 2WZMA 2AKMA 3WLRA 2C0AA 3LEPA 3BJFA 2DH2A 4S3GA 1K7FA 2YDRA 4GYPA 2PI6A 2QAFA 4QEHA 2PCEA 2HISA 1MVYA 1WA3A 1DJYA 3SO7A 4PFHA 3P8JA 5DY2A 3VNDA 3VE9A 3PBGA 1XH1A 3HV9A 2G3FA 3HGJA 3O0FA 4MWAB 2A3AA 3TWBA 4H01A 4PTMA 2DSVA 1TO3A 2Y5EA 3CTTA 1FWRA 1YXYA 2WSRA 3LUTA 3SQMA 1DORA 1TYGA 1XYZA 2DIEA 4L9XA 3BW2A 4JY9A 4WIWA 1PKMA 3OA5A 4DJED 2PDHA 2PP0A 4K8GA 1JCJA 1E1FA 1EZWA 4DYKA 2H3DA 1MZHA 2EJAA 5C8BB 1FCBA 2IPWA 5KZMA 1DL3A 1S2CA 2C14A 4C1LA 4M51A 4PBEA 3GK0A 4WXZA 3WUGA 2WSKA 4TTGA 2BLEA 4TMBA 2F6UA 3IEBA 3VPLA 1W8SA 2V5KA 3SJ3A 3EXRA 4F40A 1DQUA 1EJWC 2E5BA 3SURA 2A1YA 1QI5A 3EXSA 3S1GA 5IDZA 3CMGA 1NVMA 4JAWA 1W3KA 3JR2A 1RR2A 4MSSA 2I1OA 2BVTA 5GNYA 2R24A 2NQJA 2PE4A 3LMZA 3MMWA 3AAMA 4H8HA 1O12A 4ZR8A 1X7FA 2QYGA 3KCOA 4BWLA 2CLFA 3BURA 3WMLA 4POCA 2YCEA 4JBRA 5A5WA 1XUZA 2J7FA 2VGGA 3CPUA 3UA3A 3GFXA 4ZB2A 1E6QM 3LBCA 3TEVA 1UR8A 3W74A 1RV8A 1Z89A 5JH1A 2NX1A 4YVPA 1CX9A 3TSBA 4D6FA 1OHLA 4HPJA 1D3CA 4PA8A 1XCXA 3SN4A 3G5EA 1KBLA 4H7CA 1KM0A 3AHXA 3HJZA 2WPBA 3ZJ8A 2GUBA 1PHQA 1QHZA 2FDMA 4Q4OA 3PTKA 3IJ8A 4O4VA 1TTQA 4A22A 5AZ1A 4N02A 3KW3A 3N2MA 3ABZA 1HP4A 4AVFA 4YHEA 3CV1A 1H1YA 1TX0A 3V0SA 4FMVA 1ZSXA 3WF3A 5A8PA 4TX8A 3M47A 2QCFA 5LHEA 4WJ8A 4HN4A 3AHVA 4YMZA 3WD2A 3GDMA 4EWJA 3S6DA 1KXQA 1DWIM 4OBTA 1ZLPA 3T0CA 1RBLA 4P8UA 1N2VA 3OLEA 2FIQA 1B31A 1UOZA 3H23A 3REQA 3OHMB 4PODA 3UG5A 2GK1B 3AS3A 3WF2A 3W7OA 5DBTA 2G0WA 2V3FA 3RLHA 2FJKA 5AC7A 5CC7A 4HD5A 2ZVIA 1WKDA 3NVDA 4DNHA 4M80A 2JBMA 2YJQA 2BGNE 1TTPA 3GNNA 4W7VA 1MDRA 4E5TA 1RQBA 4BF5A 4TVCA 3BG9A 1QPNA 4XVEA 4KCVA 1TTJA 3IJQA 3M5XA 1AJ2A 2HNEA 2REQA 1XC4A 4ACZA 2CLOA 5A95A 1OVDA 4KCWA 1J10A 1HL2A 2NQLA 1LBFA 2BSLA 3BJSA 2DH3A 4MPKA 4OOUA 4GUIA 4S3FA 2IW0A 2C6QA 2Z2BA 1GG0A 3QLLA 3EDDA 3OW1A 4CGTA 1ZBVA 2FB2A 3FS2A 5AFDA 2YCIX 1TELA 3LLXA 4GBDA 3APTA 2VNCA 4B4FA 1WZLA 2E67A 4GVFA 1NFGA 4PUKA 1D7FA 3PHAA 1AZ1A 1O1HA 3DN5A 2X2GA 4NZCA 3BLDA 3QSTA 1BXNA 1UIPA 4JN6A 3COTA 3NQEA 4LEQA 5LNSA 3VM7A 2WHMA 4FNUA 1T99A 4NASA 1KGWA 5BOOA 2XINA 2ZE0A 1GW1A 3BICA 2C15A 3B8TA 1S2TA 1XI3A 2DW7A 3HBLA 3FA5A 3VZXA 3UBPC 1P4CA 1UD8A 1U5JA 2YDAA 1MW0A 1H7XA 5AHMA 2ZX6A 2EHHA 4UTWA 4JXCA 1G7VA 3ARSA 4NJHA 3ZYZA 4CN6A 5KETA 1M41A 5CGTA 5ECUA 2Z0IA 5SWUA 1T8QA 5EMKA 2G4FA 1DYSA 1SUXA 3LCIA 1VFOA 3WYZA 3MUCA 1WKEA 4H1ZA 3AROA 2AAMA 2E5DA 4GG9A 4ROQA 1ZJAA 4JFSA 1KM6A 4GINA 3V0UA 2E09A 2W61A 3BH4A 3UYIA 3G6LA 4P2VA 3IUDA 1C8VA 3H2EA 4MGGA 2A6NA 4EOUA 1W9DM 5CSSA 3THQA 2W0UA 1W32A 5FA5A 3H2OA 4H8NA 1LZOA 3W84A 4B5TA 4X22A 2GJXA 6A3HA 3SCOA 4AVOA 4ENLA 2PEVA 1E4NA 2O9PA 1FKXA 3SJNA 2VX4A 3CMJA 4AHOA 1HZYA 1LTDA 1H5VA 3RAOA 1G4TA 2WW5A 1K70A 1KXTA 3UD6A 4ADSA 5HANA 4QE1A 3ATZA 3VDHA 1NF0A 4GVHA 4XAPA 4PUDA 2ATSA 1XQKA 4K37A 1QPOA 4RX0A 3QJAA 5F4WA 4EXBA 3KUMA 4HKPA 3W01A 3TAOA 1R38A 3GG0A 4G1NA 2VC5A 2Y7GA 4J27A 2WMKA 2W3ZA 4QCEA 3U7VA 4AY1A 5AHEA 4QEEA 2DQWA 5BWAA 4ZGYA 3IACA 4U2YA 2PB1A 1BAGA 3CIWA 1KCKA 1UUMA 3UETA 3P5ZA 3EDFA 5C7VA 1YBQB 3ARUA 3UY8A 1AD4A 3ZT6A 1ML1A 3UR7A 2PLJA 1A4MA 2QJIA 4D8AA 4I8DA 4YVXA 5DMLA 3CQHA 3GBEA 3IJLA 3FJ6A 4QITA 1EP3A 1FWJC 2F2HA 4QFUA 3U3HA 1ZENA 2NQ9A 3AXXA 4PZVA 3WFZA 2E68A 3DI1A 4Z08A 4L1XA 1EF3A 5G4HC 4BCEA 2C1IA 1ZY9A 5BXSA 5E0CA 4PMZA 3PJWA 3PJXA 4HPXA 3P80A 3W81A 4PMXA 5HWNA 2EKGA 4O0KA 3SIMA 2BHUA 4WEVX 1XD1A 2I17A 3CS2A 2Q8ZA 4H6RA 3WJWA 1OYAA 3BTNA 3LHYA 4A8NA 1KC7A 2E8ZA 4KKXA 4MWAD 3LRKA 2BASA 3GXMA 4Z2KA 3TNOA 6REQB 1M9HA 2E4TA 3W70A 4P8XA 3U4FA 4A6GA 3M16A 1JL8A 3KFTA 4R53A 3O1NA 3U2OA 3WQWA 4F0KA 1A0DA 2GJPA 4TX6A 5CPQA 2I56A 1US3A 2X1IA 3TXVA 1OYBA 4HCLA 1Y5VA 2V2DA 3CWNA 1FWGC 1JPIA 5HNUA 3QV9A 5G2IA 2XN0A 1DBTA 2PC4A 2PDWA 4PRTA 3W72A 4C6NA 3VNIA 4Z1AA 2NV2A 2CIPA 3P0WA 3RO6A 4G7EB 3UWYA 2VWTA 2WSQA 1ZRQA 2BXZA 1KFKA 2YXOA 3AWNA 1ONWA 1QW8A 1YDOA 1GVSA 3TH6A 3I10A 1MXGA 5BROA 4FALA 5L9FA 3KOWA 3NWRA 2WHKA 2EPMX 4X0NA 1OX4A 4D9PA 2IQ0A 4XZ9A 1ZJBA 5F2GA 4PN2A 1YE4A 4W84A 3VD3A 4KFNA 3Q2DA 3P93A 1RK5A 4IG2A 1R3SA 1C92A 5HUPA 1D3GA 2BOEX 3WBXA 1IR1A 4JY8A 4Y7EA 4S3DA 2EG7A 2O7SA 1VJIA 3T78A 3NZPA 4GUFA 1R85A 3WKZA 1AA1B 5EY5A 3VOGA 3S6TA 3KS6A 1E4MM 2JKPA 2J6XA 1BPLB 1Q13A 1A5NC 4PFMA 3QHOA 2I14A 4HMCA 4WKFA 3N9SA 1MEIA 2FZ8A 2GUUA 3WLMA 2PDPA 2ZOXA 4JOMA 1H7NA 3IVUA 1DPMA 3II1A 4JKLA 1SZRA 2X7VA 3HPXA 4KCTA 1T0OA 3BLKA 2MNRA 3PPHA 3GTNA 4HCDA 4XUYA 4YVVA 2DZSA 4Y96A 4DJDA 4PRRA 1DIEA 2OSXA 2DZPA 3R11A 2XVGA 1TPC1 1O94A 3T09A 5J04A 1WYIA 2ZWYA 1B57A 1SW3A 4PMOA 3EOOA 2D0GA 4PMVA 3QW4B 4XAGA 4E6MA 1XLJA 2DY3A 3WQVA 3W1NA 4KEVA 4I9JA 1LT8A 2P0IA 3P84A 4L9ZA 1S2WA 3NOYA 4BQ2A 4JQ4A 5LNRA 3N29A 1W9XA 4M82A 2PDMA 4DZIA 2V69A 2YR1A 4RZ4A 1YHTA 2F61A 4W5ZA 3GH5A 3OGVA 3AYVA 1ZUAX 5AYZA 9CGTA 2GLKA 3VIJA 3QYQA 2YFNA 4IQJA 1E51A 2ODOA 1QHOA 4C1NB 2OMAA 3FGCA 5C9ZA 3WD4A 3S5SA 1P0NA 4RXGA 3H4WA 1HP5A 3NQDA 4E2OA 2JGYA 3RJXA 1Q7QA 4PCSA 2P88A 1QPKA 3C56A 5D04C 3HA1A 1V3MA 4JFUA 3B4YA 5AVNA 4E8DA 2SFPA 4RW3A 3OHIA 3F5LA 4IGHA 3GG8A 3VD7A 1XIBA 1DWGM 5DXXA 5FF7A 2DORA 1H41A 4QRNA 1CXHA 2PODA 5HAOA 3ZT5A 3NL2A 4UTUA 2BB0A 3H70A 3TN4A 2BDQA 2PPGA 2E28A 3ZLFA 1XIIA 1G4SA 3T8QA 4Z1YA 2V3EA 2XH4A 1PXGA 4ZENA 3PP7A 4LAKA 3DH7A 4N9CA 1NFPA 3E96A 3O6YX 5JMUA 3AIRA 4JYEA 2IKHA 4NI8A 3CHFA 1MWOA 2Z1KA 1KO0A 2EG8A 4GXWA 4B3KA 1TX2A 1GQJA 2GVEA 3TONA 1ZP4A 3CIXA 1F76A 4IL2A 2LLEA 4QSFA 5KZEA 3CUXA 3WQEA 2V8ZA 3FVDA 1E40A 1XQLA 4XV0A 1HUVA 2QCDA 2ISDA 1FWTA 1W0MA 2WV8A 2NV9A 3UXAA 4QDPA 4ATWA 4LNYA 4FLRA 2QGYA 8XIMA 3U5UA 3QPYA 3O0KA 2HCVA 2O4MA 4H7ZA 1Y7VA 5A6MA 3BK0A 1GVFA 2E1WA 2PF8A 4JIEA 1A0CA 3C2FA 4IUGA 2IPFA 1L6FA 4DJFD 3OBKA 2E3ZA 4RV8A 3HIJA 3SI9A 3QGKC 3LZ3A 2AGTA 1BEUA 2FZNA 1I75A 1Y5WA 3W7DA 3W02A 3SUTA 4AISA 1AD1A 3W1PA 1B4EA 1MUWA 2XIQA 3BAJA 1P6CA 4QG8A 4UOJA 2BP1A 2XZ9A 4HB7A 3SECA 1E73M 1KRBC 3GC5A 1LG2A 2AAAA 4WLCA 2OSYA 3MKKA 1XLDA 1G1YA 3IV3A 3WQPA 4JN8A 1X8FA 1K4GA 3DKJA 3QY7A 5A8QA 2XN2A 2XFWA 3STPA 1D8CA 1ODZA 3ZVIA 2GJNA 4QAIA 3O05A 4MAZA 4ERAA 2D2JA 3WJZA 1GTEA 1BLIA 1MRAA 3ABRA 2GGEA 1JZ4A 5CPLA 2DSZA 1X98A 3PUDA 1ODUA 2I57A 4UTTC 3HOJA 7REQA 3B0PA 5GJPA 2DSKA 2DZWA 1TV2A 4RDWA 3SCTA 3L4ZA 3E2QA 3OVGA 4GY7A 3DIPA 1G94A 1TJ0A 4LVGA 3AIVA 3KRBA 4LYQA 3H2AA 3AS0A 2HS6A 3GH7A 3S2NA 1TWDA 4BA0A 1FWSA 1GOWA 2QV5A 4N0RA 5CC3A 3ARWA 2FMOA 3LCFA 1LORA 2PBOA 1Z44A 2VFDA 1HNYA 3VOIA 1H62A 1E15A 2CLKA 3OZOA 1A47A 3HU7A 3A64A 4JX6A 3CQIA 3UNDA 4TIMA 3OIXA 1YNPA 4JTHA 2VEFA 1A5UA 1A50A 3RM9A 2ESCA 4M29A 1UKOA 2OR2A 3CT7A 3W24A 1VYSX 2Z25A 1CLVA 5D2VA 4PMQA 3R94A 3AFBA 4C5ZA 3GTFA 4CQ9A 1WKYA 1XDLA 5K4XA 1HJVA 4BR1A 5TNVA 4YTUA 1CIUA 4JD4A 2E6AA 3HQPA 1OFAA 3W83A 4YN5A 5LIYX 3GG1A 2QF8A 4Z42C 3RX4A 3MBFA 3E02A 1WUEA 3RU6A 4LRTA 1E56A 4UFHA 3GDRA 1TRIA 1YIXA 3MBDA 5BU6A 4UMBA 3QKEA 4KWSA 1ZS2A 3S3GA 4O18A 4W7WA 5DRCA 2WHJA 4OWGA 3JZUA 4XD6A 1FH8A 1F07A 4JHMA 4UZSA 3LPOA 2Q8XA 3UNTA 3DKLA 4ORIA 3GTXA 1OG0A 2GVJA 2WYSA 3MQTA 3AIUA 1NDWA 3ID7A 1W5NA 3EOUA 3UZJA 1HFBA 1Q6QA 4PH6A 2YZRA 3P8IA 4DZHA 2CLPA 2ZKMX 7CGTA 5I3DA 4PTNA 2WM1A 4Y6GA 1P7TB 4MNMA 1JPKA 2VRKA 1QK0A 1UWTA 4TV5A 1J11A 3VMNA 3IJIA 5KMYA 2GZXA 1UR1A 4XZIA 2YBTA 4LVDA 1L8NA 3M0HA 4JIPA 3RCMA 3WLQA 4RLIA 2ATMA 3TQPA 5HUOA 3FXGA 4Q8UA 5HWJA 1GOQA 1OD8A 3C2VA 4ZVJA 1B4KA 4ADTA 4EXQA 2W5FA 1QWKA 3TP4A 3A23A 3LHZA 3NPXA 1AFSA 3GUGA 3NAVA 2ZX8A 3RIKA 2Q3RA 4NL1A 1OK4A 3S42A 1ONEA 1ZAHA 4DUVA 1PZ2A 2WZEA 3PAJA 4L64A 1UP0A 3A9BA 1UWSA 1GOMA 1EC9A 2QDDA 3T6CA 3UP8A 1ISVA 2X2YA 1FH9A 3UZ5A 2QCEA 4PL1A 2V30A 3CZGA 2A7PA 1VGAA 1YQ2A 1WDSA 1V0LA 4G8TA 3EPMA 5G4WA 1V4YA 1SYTA 4DI9A 1KCZA 3TWAA 1ZBWA 1SJAA 2V2HA 3OEXA 4MADA 5EYWA 5A69A 3WUEA 3SRKA 4C6CA 5K9CA 3I4EA 2XVLA 1KXVA 4PMNA 1RBOB 3UCDA 1PJ9A 2QS8A 2R1NA 2OG9A 1DXFA 4DAIA 3E6EA 3N4EA 1G67A 3G1YA 2PTYA 3KOXA 2B0MA 2HDJA 1RLDA 4B2DA 4P7QA 4UFMA 1SO6A 3P3BA 3C52A 5IHRA 4Y2WA 1FWBC 3KAOA 3TSMA 1ISYA 5M1TA 3R25A 1VFLA 2Z7GA 2ZX7A 2EGZA 3BARA 5LGZA 3UEQA 3LCWA 1G7UA 4BF9A 1JDFA 3QRHA 3W7KA 2TRSA 3VIKA 3R43A 1UA3A 4A3UA 2QVNA 3V1HA 1WOBA 3ARYA 1VR6A 4A21A 1T41A 4MY9A 1L6GA 1KLZA 3NPVA 4US5A 1AQFA 3K8MA 3R0DA 2PURA 4GCAA 3VOHA 1S5VA 4IPNB 4EWND 3A5FA 5TBOA 1V77A 3CZLA 1F5ZA 5CQ1A 1CGWA 3ZR5A 1UBPC 3V36A 2GQ8A 4ZB0A 4MOZA 1KTCA 1XUUA 2RGLA 7ODCA 4Q3MA 5IBXA 4LS1A 1EYWA 2XH2A 5A6KA 3ZVHB 2OU4A 1RD5A 4OBSA 3FIGA 1GQNA 3HPAA 2OEMA 1M7OA 2ISFA 4CCDA 1JFHA 2ZRXA 4FLSA 3KZPA 1W54A 8XIAA 1VCGA 1C8XA 3EWYA 1CCWB 5I06A 3VKCA 3P61A 3ZR6A 4RDYA 8TIMA 2PC8A 3WLLA 1UB3A 1PCKA 2ZICA 6ENLA 4QE5A 1T7LA 2ZWZA 2J13A 1X8CA 4DJEA 1G69A 1L0PA 3NQVA 3GSMA 4CNTA 4NU7A 2WCGA 3GX9A 2I9UA 4DI8A 1BYCA 3JS3A 1XC6A 3ITLA 3SY5A 1WBHA 2BY0A 2HNHA 1QASA 3MHFA 2OX1A 2VMFA 4AIEA 1O66A 2ICSA 1Q6OA 1VPYA 2WVTA 4JN7A 3OZPA 3EAUA 1WZKA 1XPGA 3U9IA 4HMDA 2XG9A 2O55A 4GUHA 4GX8A 5DCDA 3TJLA 3HZ3A 3SADA 2OKTA 1GYNA 5BOEA 3AMDA 1VYPX 1M68A 1RCOB 1HJQA 3K13A 4IGSA 1JRCA 5JVLA 1KLYA 3FLUA 3LXBA 2UY5A 2OLAA 1GVIA 5H2ZA 1L2UA 2Y24A 1CDGA 2CLLA 3PPCA 1HJWA 2O9OA 3GKAA 5I77A 3IPWA 1OT2A 3EDEA 1HKJA 1E6NA 2CYGA 4E8CA 2Q3OA 4N4PA 5IDIA 1Q8AA 1K9FA 1EJXC 1XRSA 4IMDA 1E0UA 4KPLA 3GXDA 3ME3A 4AD1A 3W6MA 1E4LA 1VEMA 2A0NA 3P2VA 4AG0A 4JKMA 2OYMA 1EBGA 3W38A 3VD5A 3W7GA 3QXBA 1XRFA 4QQUA 3SN1A 5AYBA 3UPWA 5HMSA 3CT2A 1JCMP 5HBFA 4OHQA 1R5YA 2ZADA 5G1YA 4AWUA 1H11A 2WZHA 4ZE4A 3L5LA 2PDCA 2W67A 1RCQA 2J62A 2WHLA 5HMEA 2AL2A 2QUNA 1PX8A 3U0HA 1J12A 3A4AA 2CWNA 3KL0A 3NZGA 5BRPA 3B9EA 4FR1A 1K8XA 4JQ1A 5IFPA 3WNOA 1VFFA 3M44A 3OGRA 4D71A 3PTDA 4IQEA 4NNAA 3W85A 4BZYA 4XKYA 1OFOA 1OSEA 1XV8A 1TCDA 3WQOA 1A5OC 4XSLA 1Z42A 1QR7A 3B9NA 3IUHA 2ADAA 1HX0A 1H0IA 1UJQA 3WLNA 1XLCA 3W2UA 1W8GA 4U28A 4Y9PA 3DGRA 5AOUA 5AHIA 2HS8A 4OZOA 3WJYA 4JIIX 5I3GA 3CHVA 1H50A 5GNZA 3L4TA 3TN5A 4V28A 4DX3A 4AYSA 1Y5XA 3E9AA 4JPGA 4Q4SA 1V0NA 2ZA3A 3DG3A 1F61A 2P1FA 2OODA 5I3HA 2BVDA 3LD5A 4NNCA 1XYBA 3DFNA 4S1FA 3QMSA 2ZUNA 4CCZA 1XISA 3E3HA 3UERA 3WD3A 2ZC1A 2QUMA 2ISVA 3G2GA 1R3QA 1EEPA 1U5HA 2Y5SA 1DQWA 1Q6FA 2V38A 2Y1HA 2RAGA 2DVUA 5G1TA 1W9UA 4WDUA 1PDZA 3GD6A 2W63A 1CLXA 3PZGA 1F3TA 4A8RA 1UHVA 2NSOA 3BMVA 1LQ0A 4RW5A 2WVVA 3AXHA 4V33A 1UZ4A 3A13A 4H83A 4XAFA 5E93A 1AODA 4LBRA 1SSDA 4NRRA 1SFSA 5REQB 3DHFA 2RKXA 4BY3A 3W28A 2E40A 2VQTA 1FWWA 5AHFA 1EJ7L 2WJZA 4XZMX 3W7MA 1WQ5A 4CN1A 2ZTKA 3CC1A 2C1HA 2PWDA 2XVPA 4K36A 3N34A 4LUSB 3NR0A 4LUTB 3RG6A 1ME8A 3TJIA 3SY8A 4YU1A 2ABAA 4L1GA 1TIMA 1H0GA 1OEPA 5XINA 3BSMA 4OVXA 3M46A 2ZXBA 4QNEA 2NSXA 3EGJA 1XLGA 1UR4A 1U33A 4JDBA 3SIZA 3RXZA 5M03A 4YYCA 3LA4A 4WCJA 1N7KA 1QO5A 4AIBA 4R7JA 5D8ZA 2W9MA 2JF7A 3I6TA 2HXUA 2W62A 4XSMA 2PU0A 1KTBA 3TW7A 1SQ7A 2WAGA 4Q7BA 3S2LA 4J3UA 1ZU8A 4TVDA 2VD8A 4MLRA 4AY7A 1DIKA 1XIMA 2GGIA 2ZRWA 1TSIA 3DGBA 3CHCA 5MF5A 2AQVA 4FXRA 1WO2A 1VBUA 5D09A 1ZZMA 3BLOA 2OZTA 3HM7A 3KBJA 4RE2A 3THCA 3TIMA 1ZCCA 4LY8A 3PWGA 4GIRA 5LIKX 1OK6A 2ANUA 3LCLA 2HSAA 2IXVA 4RDZA 1EO7A 3WDHA 4FI4A 4NAEB 3DOPA 2EG6A 3GZ3A 4K1GA 2YSWA 4D6GA 3MPGA 3QC0A 4FP1A 3MC5A 4RDVA 1MSSA 1WV2A 3W7QA 1QNVA 1DJNA 3ZWTA 4K3ZA 3W3OA 2GGJA 5JIPA 4IIFA 3N3MA 1ALDA 4ZSUA 2F6KA 3QR1A 4A35A 4G2DA 1YADA 1EYEA 2D24A 5HA7A 1TG7A 3GRIA 3OU8A 1TPVA 2JK2A 2A5HA 4GGBA 3MUY1 3T55A 2INEA 7XIMA 3B03A 2BOGX 1BF6A 3PWAA 1E43A 2J75A 4GQBA 4H9TA 1QJWA 3P5YA 4OKDA 3L23A 3AO0A 3J7HA 2ZDSA 2OJPA 2VURA 3NA8A 4OV4A 3DYOA 4CD4A 4JFVA 4XD4A 4WUIA 4AF0A 4MMWA 1E0WA 3PVFA 1TREA 3MP3A 2E5CA 3NM1A 3NQ7A 4DWSC 2MANA 3WF4A 3IK2A 2BY3A 3EPOA 2OO0A 1LRNA 3DFSA 7PTDA 3UJFA 1MXSA 2CLMA 3TYUA 3I3BA 3IGXA 3KL5A 3W1UA 4I3GA 3F4CA 1AVAA 2QCMA 1ECEA 3H4XA 1LL4A 1OWQA 4DWDA 4GVGA 5FEPA 3S6OA 3KP0A 4Q6XA 4C6DA 1SZFA 1QFEA 4R3UA 3H21A 1BKHA 4JQ3A 3GHTA 3GM8A 3OVPA 3BLFA 2YCLA 1C29A 1AW1A 4TTUA 2DZAA 3BMXA 3TKFA 1I2PA 5FAJA 1UQYA 3CYJA 4Q8VA 2PDNA 2PTWA 2JEQA 4REQB 2OQLA 2PWUA 2TSYA 4N42A 2YA0A 5FACA 1EHAA 4QHRA 3FFSA 1LJYA 4GUJA 5T9CE 4MYAA 1A4LA 1M3UA 1RJPA 5ABFB 4PCPA 4BF7A 4RZ5A 1J0YA 4GI6A 3FSUA 5EBAA 4K1WA 1UW9A 2VOMA 1QK2A 2J66A 4I90A 4LEFA 1SFTA 1UC5A 5EMUA 3HO8A 1JCLA 4I7WA 2AQWA 1XDMA 2DVXA 4NRSA 3WBAA 3R0UA 4CQ8A 4PEEA 4Q7NA 4O28A 1LQAA 1OFPA 3E2SA 4IJBA 1V3KA 2OVLA 4GOAA 1CXKA 4WXYA 5C2CA 4D6HA 2D20A 2CWXA 2A3BA 3Q4DA 1MUMA 1HN1A 4C90A 1DJHA 4JTSA 1Q85A 3TYDA 1NOUA 4IPLA 2L5HA 1MXDA 1JQVA 1OFBA 4JIHA 4TQTA 3I4KA 1YE6A 5E09A 4KEMA 3VIFA 4BJHA 3N13A 3ZJ7A 5TF0A 4DLFA 2RFGA 3VKBA 3CQKA 4OUEA 2UZ9A 4Q32A 1GVQA 3QEZA 5PTDA 1KQYA 2HROA 1J8VA 2WNWA 3MI3A 1JZ6A 4AX6A 4OE7A 1EB3A 1V6WA 4BI6A 4DF0A 1XFCA 4CU8A 3U2EA 2F84A 3SSZA 4QCFA 5HULA 1KB3A 3BSHA 5GQBA 1WBJA 3EKLA 4X2RA 4FIQA 1IIGA 4A4AA 1TWZA 3ZMRA 1M1BA 3WF0A 4NXSA 3EX6A 1KR1A 2Y4SA 2C16A 1TE6A 4LH8A 4I9TA 3UT0A 2ZA1A 3R1ZA 1IEIA 4AAJA 3RU8X 3EXTA 3T07A 2VDHA 3WQ4A 3EWBX 1ENUA 3VYLA 4H41A 3ICJA 2VEMA 4NX5A 2YXXA 3MO4A 1NAL1 1ISZA 3QH2A 1YDYA 3EWCA 2D2HA 1K03A 2TAAA 3KZSA 5G2HA 2V63A 3VMPA 1Q6LA 1IEQA 5FJOA 5AC8A 1XKJA 3ITOA 3ZQ9A 5D05A 3KRUA 5J5RA 1YTDA 2OEJA 3NSMA 4IX2A 2J7EA 4CKQA 2P8BA 4R88A 3LCHA 4DVOA 4MHBA 1F4HA 5CPMA 2BX7A 3B05A 3WEOA 1GNXA 4EX4A 3SEPA 2DT0A 3S1UA 3NGFA 4O14A 3G24A 3MUZ1 5AC5A 3L7RA 1A80A 2V81A 5D30A 3V7PA 3ANYA 3GU1A 2XWEA 3VO0A 5CH9A 2X05A 3QLDA 1U22A 1FCVA 2ZXAA 4WKHA 4KRZA 1BYDA 3E74A 4AWTA 1RP8A 1GHSA 1KTNA 5D9OA 1AW2A 4KMQA 5LIXX 3LSCA 1H63A 2GL5A 3QBUA 4KFOA 5A94A 5FESA 2C1GA 1EDTA 4NILA 1KBBA 3O06A 2WJFA 3N2BA 4JTLA 4JFWA 1QTWA 3GWQA 3HQ1A 1CXFA 1KW1A 3KBWA 2Z1WA 3LTPA 1RH9A 5IRPA 4B3LA 4HJWA 3KXQA 5T8GA 1WDWA 3EOSA 1C9DA 3TN6A 3H26A 4OGZA 3ANVA 3PUGA 1DJQA 1OX6A 1Z69A 3AWOA 1H4PA 3OGSA 1V6TA 3WG6A 3NQBA 4J35A 4J5NA 1A3WA 1UMLA 2YW4A 4XZWA 3KBSA 2PWEA 3LXCA 3R4IA 1AW5A 5DXYA 2G3NA 3MMDA 1JPMA 1O95A 4EPKA 5T9BG 5BOFA 1HO4A 4GE8A 1DE5A 1F4AA 3B40A 1DTNA 3UJRA 4H9MA 2Q71A 1K8ZA 3U57A 1W1IE 1XH2A 1D9EA 4HOXA 1Z3NA 3WJXA 1XIEA 5EPDA 1P0KA 1CI1A 1XCFA 4JYFA 4M6PA 1IEWA 4D72A 3SCUA 4JKKA 1V3IA 4B91A 1TUXA 5FKYA 3S1XA 1C91A 3GW0A 4DLMA 3ZWSA 1S2VA 4FLQA 3BCDA 2VKZG 1DXIA 4ZODA 1VB9A 1V51A 1XXXA 4S3AA 1KBJA 4FR6A 1VEPA 4MJZA 4OT7A 2EAWA 4PL2A 2VUYA 4IIEA 4NAFA 3K4DA 3E38A 1JEZA 1MW3A 5DMMA 1A5SA 2PDYA 1BYAA 2ZXQA 4I5XA 1KCLA 3NYZA 1P43A 3M7WA 3ITTA 1W31A 4U3AA 3M5YA 5M2FX 3TUUA 4I6KA 2CKSA 2NV1A 2XFYA 3VIOA 3W53A 1FWIC 5DT7A 2NXGA 4AXNA 3ZR4A 4UQCA 1NOWA 3OPSA 2X0SA 5I3IA 3W22A 2QMJA 4IJRA 3HQNA 4XIMA 4CNUA 3L4UA 1BYBA 4PTVA 4DUWA 1E9LA 1I4NA 1NP2A 1GONA 4JS3A 4E2DA 3ZOAA 4CQCA 4JICA 3MW7A 3CUGA 3N6JA 3N11A 2P50A 2DDXA 1E0XA 3RLVA 1XYCA 4P7OA 1GQLA 2OZ8A 2XM1A 2ZRZA 4MJ2A 5H1WA 3CLWA 2ZDRA 1AZ2A 3BZGA 3O16A 3GXNA 4WZHA 1EUAA 1B3XA 3OG3A 2ZZ1A 4BKNA 4AYGA 1UD4A 1UWQA 2YGYA 1PAMA 3T2PA 1UR9A 2AQOA 3GH4A 1GTHA 1FH7A 1NFBA 2DU2A 5TD4A 1XIFA 4WDTA 3ZJKA 4A3HA 1ME9A 3R5EA 4DBSA 1E71M 3OLIA 3IK4A 4Q7IA 4H9XA 3LRLA 1F6YA 4J3XA 3FYYA 2PDFA 3TTSA 3EX4A 4MYXA 1NELA 5D2XA 1M7PA 4B5SA 3NCOA 4MTVA 1FTXA 3M5VA 4KGJA 3W37A 1BSIA 4DO5A 3TE9A 1YNQA 5I0DA 3GR7A 3T44A 3JW7A 2UV8G 3T7VA 1E6SM 2CZVA 2EKCA 5D32A 1CENA 3A22A 2J9ZA 3SCSA 2Z4GA 2DFAA 2NUWA 1K1DA 2PDGA 3LSBA 4ZZ9A 5FJUA 4EAYA 3HG2A 3TZFA 1BVNP 2REQB 1OADA 4ACZB 1MO0A 1DP0A 3DDMA 1E9IA 3HB9A 1FWEC 4IXHA 1C93A 1U2YA 3MY9A 3WL0A 1H7WA 3U8GA 4UOQA 3CB8A 1JDDA 5HPCA 5KZDA 4J28A 5E6ZA 5LNVA 2XIIA 3VKDA 3JRKA 1PVNA 4WY0A 5TQLA 3KS5A 3SUSA 3B0YA 4IFKA 4CNNA 1NM9A 1PKYA 2X09A 5HK4A 3AIQA 2YL6A 3L68A 3WELA 2HBXA 3LHUA 2ALRA 2VTFA 4LCSA 3C4UA 1VEOA 1LUCA 3KVJA 3TTOA 2FJUB 2VZSA 2ZE3A 4Z1BA 1UKQA 1OY0A 1D8WA 4GI4A 4DBWA 4NKCA 1LP6A 3WJSA 3THAA 1NARA 2J27A 1ZBKA 2BFGA 4JX4A 4WDWA 5E70A 2QIWA 1VKFA 4C6LA 2CU0A 4HMNA 2X8RA 4WX2A 2YBUA 4AY8A 3GZAA 1UUOA 5A2AA 4JTRA 1HL8A 4MWAC 3LQLA 1OYCA 4A3QA 2P3ZA 3TN3A 3GR4A 5MKGA 2J9XA 2YYUA 5JBFA 3M0KA 1DJXA 3MV01 3N9RA 1BRLA 1KBKA 4H2CA 3RRAA 1OINA 1H7PA 5JUVA 2ZUMA 2BNJA 2IQDA 5F2IA 3PN8A 2BVWA 4QTGA 1X7IA 4LPCA 4DM2A 1F6PA 3TTQA 4U33A 1EEXA 1B3WA 3B04A 3CHEA 4K38A 4JEQA 3SZ8A 3XINA 4H6QA 4BQ3A 1YDNA 3SCPA 1NQKA 1FWFC 4NYYA 4XVDA 4XZNX 4AXKA 2J8GA 3Q65A 3JU2A 2WMJA 5CJMA 2QCLA 3T0TA 3DC0A 3U6WA 1M53A 5CG7A 3I6EA 4TMCA 3W7NA 3F4VA 3P81A 2EPHA 2GJXB 1EGZA 5HR7A 1MMFA 5AB3A 4BS0A 5I2UA 5J8LA 1FP9A 1E9YB 2VEGA 3HJEA 1R86A 3CQJA 3KTXA 1J4EA 2FLIA 1WZMA 2DUZA 2IXUA 1FY6A 1OABA 1EXPA 3VUPA 3L2LA 3EA2A 4RR4A 2WMIA 2NQZA 3URNA 3T9PA 1TPB1 1ITQA 1F73A 4PCNA 4FNSA 2BWGA 5K9XA 1GVEA 1GPFA 4M7SA 3FA3A 4AEFA 2R1LA 3RX3A 4KGLA 3WDJA 4GA8A 4UMAA 2DUAA 1PE1A 1SZGA 5M17A 5KEZA 4IMGA 1TJ1A 2JFEX 3RLGA 4EACA 5E9XA 4QXIA 1TZZA 2WPGA 3CXOA 2CC0A 5CSYA 2C79A 1K77A 2B7NA 4UFIA 1KWGA 1OCBA 5I78A 4W85A 3PS7A 1KM2A 2X0HA 4F0MA 3Q45A 3M43A 4PBGA 4AWSA 2GGHA 1S3TC 4EPDC 1P0DA 5DMNA 3HFTA 1R3TA 4GHRA 2NQHA 4FX6M 3DX5A 4G9PA 4ZFCA 4H2HA 4OFCA 1E1CA 1QOPA 3S1VA 2ZX5A 2JGQA 3PSVA 1B3ZA 3MANA 2H8XA 4IWWA 1GQIA 1UD6A 2A79A 3T0DA 2PF0A 3PM6A 4LVBA 4AHPA 4ZO7A 1W5MA 2H9AA 4UIOA 5LXXA 2VR2A 3D3AA 2BY1A 3BAXA 3VNYA 3USBA 4AX7A 2FZMA 5BMWA 4O15A 4FIRA 2WWCA 2HK0A 1AQ0A 5A8MA 3THUA 3SUUA 3GTHA 4GZEA 1IF2A 1O7AA 3DU0A 1TQJA 1N82A 4QGCA 2PZNA 4WOQA 3LGDA 1WXJA 5LYRA 4FAMA 4QLKA 2Y89A 4O1EA 3SRDA 1VHNA 3B8IA 1W3HA 3B3DA 3I3EA 4HNUA 1H49A 2DPEA 4ZQMA 4LGXA 2X1SA 4J3ZA 4V15A 1Z48A 1KFCA 1TIWA 3F1QA 3AUOA 5CAHA 1EIBA 4GQRA 3N2TA 2PDLA 2VR5A 2ONEA 4HN8A 4LQ1A 2QVHA 4R34A 4YPJA 1OX4B 3CNYA 1GOXA 1A5MC 4LCQA 4DWSD 4DEFA 3LG3A 5A6TC 3TYCA 1UKSA 4ADUA 3PULA 1GCYA 1EF2A 4IG2B 2OYLA 5HQEA 2CXGA 3L4VA 4M8UA 1U1UA 4ZO9A 4MF4A 4WOZA 4FNRA 3PR2A 4R7WA 4J3SA 4GYFA 5CCZA 1L2QA 3KP1A 1DJZA 3T42A 2GSJA 5CPTA 3CJPA 4S2CA 1FRBA 1Z41A 1B54A 4JEJA 5GNXA 1VP5A 1Q8JA 5JH2A 3AXIA 2IPGA 3PBMA 5AHLA 3GAKA 3VD4A 1HQTA 4H9VA 4DQWA 3DZ1A 1V6UA 3NOEA 3PAOA 3EDKA 1MFVA 3TA9A 2KX9A 3WO8A 4DJFC 1F05A 2E9MA 2FGLA 1ZQ5A 1JCXA 4Q4KA 3H7VA 1Q3NA 2VVNA 4MIMA 3PZVA 3MJMA 1W56A 2Y8UA 2IS7A 1F2JA 1RPXA 5GJMA 3H8AA 3S5YA 4MLJA 3ZS4A 1TMLA 1LOLA 3PZOA 3LYEA 4NT0A 4A2RA 2ZBTA 3G0XA 4LUIA 2YW3A 1REQA 3VABA 2CLHA 3NQMA 3TLLA 4V1XA 2WBKA 3CBWA 3CZKA 4YHGA 4AD0A 4JDYA 2YKKA 1HVQA 3MI2A 1PZ0A 1O60A 3CAKA 4D8ZA 4IIDA 3QQWA 4DNMA 2BODX 3TTYA 3HG5A 3CZJA 3UW6A 3DESA 2UBPC 4PUWA 4UZUA 2D23A 3AU6A 4M19A 4I6VA 2WNZA 3W7PA 1MEWA 1O5QA 3ALGA 1I2NA 4LAUA 3FGCB 3AZRA 4ACYA 5HNTA 4B9YA 2X16A 1RP9A 3G1DA 5CPSA 1QT1A 2CBJA 5D03A 1CXEA 3O15A 3TQKA 3LV5A 1SO4A 1LYXA 4L4OA 3G8RA 1TWWA 1S3HA 3F7JA 3F2CA 4IQLA 3FHQA 4MUPA 4FNTA 4K68A 1TV4A 4BI5A 1RQEA 1PL9A 1RQHA 2OOFA 2VC6A 3W1MA 3HQOA 1JJKA 2B31A 4GGHA 3FJLA 3ABSA 2H3BA 3OQEA 1KGXA 4GFIA 4HOZA 1EL3A 4AWEA 3O9NA 5EL1A 4O10A 5EMYA 3OBAA 1VH7A 1XSIA 1KNWA 3TQ0A 2OZ0A 1TE1A 2XGBA 3EPNA 4IMFA 4XX6A 3QN3A 2ZVRA 3DFHA 5HINA 1ITUA 1NDZA 3VX0A 2ACUA 4RNJA 2NZLA 1JF5A 5CJ5A 5CZKA 3CH0A 4UB9A 5LNUA 1KFJA 2DJXA 1UP3A 4KF1A 4UMCA 4KT2A 4ONVA 1JI2A 1BGAA 3RMJA 4LSBA 3K30A 2AL1A 1R3WA 2PLMA 3DECA 5LIWX 2WLZA 4GISA 2X42A 3PZQA 1Q2SA 1H7RA 1XFBA 4MG4A 2XJ7A 2VUNA 3WQFA 5BNKA 2GQ9A 5HNRA 4W8AA 1J18A 1PIFA 3F4DA 3T40A 3L4YA 1ZAIA 3VOFA 1XKYA 2BY2A 4O50A 1HKVA 4AFYA 2FHFA 1WDPA 1EP2A 3VKJA 3KVKA 3M0XA 1EX5A 5FIPA 1I45A 2GJLA 2EXOA 1OJXA 2WMGA 3P82A 5H6HA 2ZUUA 3KE0A 2FFIA 1XGEA 1FWCC 2W79A 3EOEA 2V5JA 4HU0A 2E6DA 1XBXA 4CEXC 3CWOX 1J5SA 1XYMA 1HKIA 1OX5A 4CD8A 1Q7ZA 3V5OA 4O17A 4LB4A 3T2OA 2CW6A 3FX4A 5CC5A 2X40A 3KWSA 2HMCA 4B4HA 4C1KA 4O1DA 3WEMA 6PTDA 1LWJA 1DJWA 3P6LA 4HA3A 4R9OA 4ZB5A 3SUVA 4DXKA 4UR9A 4HOWA 3N18A 3VDGA 2PBGA 1QNRA 1MUCA 4J1OA 2D2OA 3ZSSA 1MNSA 2WWDA 4HCHA 2D0HA 2GFTA 1DQXA 3WQ5A 5J5DA 4KH2A 3WF1A 1DWAM 7REQB 1SFLA 3QPZA 4K39A 4FOUA 3DXIA 3LN3A 1XLFA 1TMHA 3C86A 2E8YA 4XD3A 3HTWA 1TJRA 3GHSA 3W7IA 3L5AA 3PZUA 2BBFA 4FXJA 4O52A 3BPWA 4NZ1A 3TLQA 1ZNNA 5C70A 4H9ZA 4WDXA 3QQ1A 3WDRA 1EWEA 3FEQA 2UY3A 2VZUA 1LL7A 5DX7A 1FDZA 1IHIA 1LLWA 4QJ5B 4F4RA 3M0VA 2VFIA 3ARTA 4P7RA 3PPFA 3TXZA 1SMDA 3WIJA 3LNMA 2VFHA 3EWZA 2FDSA 2Q6ZA 4L6DA 1SPQA 3D6NA 4U5IA 2QT3A 1IT7A 1VRDA 4L80A 4MUZA 3EX3A 3GYEA 2QQ6A 2IKGA 2ZXDA 4ZOEA 3G18A 2V5BA 3ATYA 1TRDA 3MUAA 2ZZ6A 4X61A 5F1UA 5KITA 5ABHA 3RK8A 1HJXA 2BXVA 3VE7A 3EWXA 3Q58A 1GKRA 3WD0A 3AYRA 3RO8A 4ERGA 3EX1A 2XM2A 4IPJA 1XGDA 4IGMA 2FKPA 4Q33A 6CGTA 4XK2A 3G1VA 2PP3A 3W6LA 3LGEA 1FA2A 4MB3A 1XIJA 1U1JA 4YYFA 1LL6A 3CWHA 2HE5A 3S2JA 4AHQA 3VGFA 1ZAJA 3HURA 3TFXA 3VGEA 3G1SA 3NL6A 1QXLA 1JG9A 4UTTA 3WSUA 1KCXA 1B9BA 3DG7A 2O9TA 3LX9A 1XM3A 1GYLA 1J6OA 4YJ5A 4GRSA 1DWHM 1TVPA 1WB0A 1BTMA 2EJ1A 4S38A 1R7AA 1VFHA 3WLJA 1JYWA 3V3WA 4IPIA 4JCMA 1VHCA 4YL2A 3C8NA 3VDBA 4NZFA 4GWEA 1ADSA 3KDOA 1W1PA 1JDEA 2GUYA 3TW6A 4PUJA 2FVKA 5F2MA 3VM5A 1QOXA 1YDVA 4RJEA 4CU6A 3H54A 3K1GA 3E5PA 2PDKA 3W9ZA 2CHOA 4EE9A 4AUBA 2DT2A 1MQPA 3MWCA 1VJSA 2GOKA 3XIMA 4HZ6A 5I03A 3HGRA 1UZHA 2QMKA 3S1WA 4GYJA 3W2JA 3NUKA 4HQVA 4K2SA 1ZP3A 2FYMA 5HMFA 2PCQA 4QE4A 4D1IA 2XVNA 3L65A 2C18A 1YNYA 4JTQA 1A0EA 1GPWA 3N25A 5D33A 1I6NA 1GEHA 1DXEA 5K4ZA 1XHGA 1UA7A 2PGFA 3B8VA 1BWKA 3N6QA 1M7JA 1NH6A 4GC4A 4IIBA 4I8YA 3AC0A 1QO2A 1IEVA 2ABBA 4TO8A 4DJDD 2RJGA 2DJLA 2VGIA 4N9BA 4Q22A 1EC8A 1W17A 3TQVA 1VBJA 4PUEA 1JGMA 2WNQA 3T8LA 1XW8A 1W3TA 4HPNA 3CUZA 3H53A 2X1UA 2GOUA 1IXOA 3PZIA 5DCBA 4LW7A 2VX5A 4X9SA 3B9OA 5HXMA 5BXPA 4PC8A 2FTWA 3P67A 1OGBA 1W5OA 3GVWA 1MZRA 1QI3A 1F9CA 1OM0A 1A3HA 1L9WA 3TC3A 4FNPA 4AZ6A 2INFA 1S1PA 2GSHA 2HV5A 2QUVA 3MZNA 3PSWA 5LA2A 1HJSA 4M6VA 5EA9A 2YB4A 3CPRA 1H3GA 3PANA 3T0AA 3KL3A 3VZZA 3TR9A 4ZQCA 1E6RA 3F03K 3D0CA 1WOAA 3MJYA 2FFCA 1XLEA 1BGGA 1KFLA 4JCLA 5HWMA 3N6HA 4A3RA 5D38A 4IP5A 1XJBA 3C3UA 2JIEA 1TKKA 2D1ZA 2R6OA 1O6IA 3GU9A 1MNZA 4EF9A 1NY1A 2QJJA 2VR4A 2CZ5A 2DZTA 2GGGA 4GABA 3URBA 3TZNA 4FX7A 4E0CA 4ZQOA 3QHMA 2F38A 3PF3A 3POHA 5IM51 4FPSA 1EOKA 1PUDA 2G4JA 2C3ZA 3TA6A 1UP2A 2J77A 2FZBA 2WSPA 2QGHA 3W7JA 1XYLA 5GPRA 5HQMA 1HXJA 3TROA 3NQ6A 4N6EA 1RAKA 3PZNA 1DV7A 2O4QA 2X30A 4M5PA 3CQ0A 1GZ1A 1IGWA 3R8RA 1T8XA 1ITCA 3TDFA 3T81A 4KW2A 3BAYA 4AZ5A 5AHNA 4X0VA 1C3FA 1AMYA 2JKEA 3EDJA 2WQPA 4HU3A 2ACSA 2QLYA 2OEKA 2F8QA 2BHYA 3CO4A 1JZ7A 1FXQA 3ZFHA 3L12A 2CBIA 1Y8BA 4LYKA 1DHKA 3OBEA 3VTRA 4E2VA 2GJRA 1QBBA 1G4PA 4Q8WA 2JALA 3FDGA 4W7UA 3V4BA 4AZGA 1FKWA 4AZCA 3UA4A 1EHNA 1UQZA 3WLPA 1LWIA 4JIQA 5HATA 2MUCA 4P7LA 1TPEA 4ICCX 1EC7A 2C7FA 4E8GA 2PLKA 3H2FA 4AH7A 1A5KC 3GG7A 1K9TA 4YTTA 1D7KA 1W1ZA 3BLLA 1BG4A 4ZQNA 3WN6A 1P1XA 1IV8A 3RNDA 4AC7C 4Z17A 4WSHA 4MZYA 1GT8A 4JX5A 3GNOA 1XLAA 5A3HA 3B0VC 2VO5A 4OQVA 1PS9A 2VHLA 4QG9A 5LXEA 4AW7A 2NVCA 3QTPA 4D6IA 4NXKA 4MFEA 2ZRVA 4H7VA 3LGGA 2XDFA 4Q6JA 1T40A 3IANA 3ENLA 4FS9A 4P8WA 5K3VA 4LS2A 5LA0A 7TAAA 2QUTA 2BOFX 4NZ4A 1OF8A 3M41A 2CNCA 2PFHA 3WH7A 1M04A 3FV9A 3CYVA 2AL2B 5E9AA 2JF6A 3E5BA 2QCGA 3H2NA 1CGYA 3IWPA 5H8MA 3PFRA 3TAKA 4QX4A 1J6PA 1TA3A 2O92A 4B9ZA 4CUCA 5FEZA 3ZIZA 1PWMA 1J01A 1DE6A 3WZ0E 4PUUA 3W7RA 1UKPA 2DZVA 3GYCA 4EVZA 4XKYB 4L1WA 1W9VA 4AC1X 4Q4RA 4MNKA 2E7FA 4QISA 4JL1A 2OWWA 4HU8A 2J4GA 1X1NA 4LS0A 5K9DA 4W9TA 2BGQA 4NZ5A 3AISA 3NO5A 3WH6A 3TR2A 1RJRA 2PWHA 1NWUA 3FAXA 3QPEA 3NPUA 4GY1A 1X6NA 2O7QA 5A1AA 2ASHA 1UBSA 2OB3A 1B3VA 2I9EA 3R2GA 1W1VA 3ARVA 1C8YA 4CD5A 2XYLA 4UTFA 3DFTA 4BK9A 2D2GA 4IMCA 3ONBA 1NU5A 1GG1A 3FJNA 3BLIA 4JTAA 4HNOA 3UY7A 3K8KA 1J0HA 1ZJIA 3O6DA 1VC4A 4O12A 3H4GA 2G3JA 3VUSA 1R87A 3LLDA 3E49A 2ISWA 1JD9A 1QNPA 2NLIA 1R47A 3TC6A 1F7BA 3QY8A 4IFRA 3IIPA 4FHAA 1RJQA 1C90A 1SW7A 1W1A1 1R3YA 1RVGA 1FWAC 1EJSC 4WJEA 3OVQA 1R2TA 4LY4A 4GACA 2H8ZA 1WAWA 3FYOA 1KFBA 4HBKA 1XLLA 3EB2A 2WVVB 3DYPA 3FJ4A 3PBWA 5DY3A 3TTEA 4BI7A 3EKGA 2R8WA 3CUHA 4JQ2A 3IS4A 1S5WA 4IGNA 5TIMA 1EWDA 3MCNA 4FA3A 4Z0JA 4F48A 3GHUA 4XAYA 3L4WA 5I24A 4DZ5A 4KESA 3CTLA 3TJXA 2ON3A 3SCQA 1BWLA 3AS2A 2OX4A 4AD3A 1QU4A 3CASA 4MDOA 3NSXA 4AD4A 4XBSA 3OA3A 4EANA 4NZJA 2KAUC 1PZ1A 3URAA 1K9DA 4ML4A 3V5FA 3S9IA 3NZ1A 4B5UA 1JXKA 1XL9A 4O54A 4DYJA 2PAJA 5EMJA 3AS1A 2QW5A 2PWVA 3AIBA 4GH3A 1BF2A 4JTTA 3NZQA 5RUBA 4GNVA 4QBXA 5I02A 4JNYA 4DN1A 4GI8A 4R27A 2PUZA 3CEPA 3KRZA 1WUFA 2W4XA 3UWVA 5G2WA 3NFUA 4NIRA 4UTMA 3TMQA 2OO6A 4LALA 1SU5A 3OP2A 5DFAA 1X97A 1JZ8A 1NWSA 2VFEA 1PBGA 1EDGA 3W1LA 1W3JA 2QJMA 3PUEA 4B5XA 1LRTA 2YL9A 3ES7A 3R0KA 2Y5JA 1FDYA 5DBUA 4GO8A 1LG1A 4H3DA 3FKKA 5EFDA 1R7OA 2EQDA 3MKVA 4H9UA 4QDWA 2CPUA 3PBVA 3WNPA 1W6TA 4AZHA 3EEGA 1EJUC 4Y9AA 1TPFA 3QTGA 4G6CA 1HKKA 3LY0A 3QR0A 2WNNA 2WZIA 3VZYA 1UUQA 3WMBA 2DGAA 3WDPP 3MSGA 1HIZA 3UZXA 1EPVA 4TR9A 4B5NA 3UVAA 3GVRA 1FX6A 3L21A 4M1BA 2B7QA 3UWWA 3LZ5A 4KWOA 3DFPA 3C3NA 2OWCA 2XH0A 1NP0A 4B2DD 1FBAA 2PRLA 1K9EA 1QATA 2CESA 5I23A 1TPDA 4W89A 2GDQA 3L2IA 4MB1A 4V2XA 3M0IA 5GJNA 5D9NA 4WHBA 1PV8A 1OT1A 5A2CA 3ZSTA 3BAKA 4NI3A 1CXLA 2V68A 4IOTA 2Q8LA 2P0OA 2YLLA 4HGXA 2VEKA 3NQAA 3ZXWA 4CLMA 3BGAA 4F0SA 2OLSA 1RPKA 3BQ6A 1UIOA 4L4PA 2G41A 4CCCA 3V5CA 3Q37A 1UASA 3UZWA 1VFUA 3TJ4A 1IYXA 2PWGA 3KOYA 2ZZ5A 4AQLA 4U3CA 2OZ3A 3DHDA 4J3VA 3W2NA 5C6MA 3GNPA 4QLJA 3S2MA 5DN1A 2W66A 3B06A 5TAOA 2XFRA 4LC6A 2PU1A 3E2RA 2YCLB 4JNZA 3N14A 1YXDA 2G97A 3R58A 1QPQA 4CD7A 3SCVA 3GIYA 2FVLA 5DMYA 4JIRA 1HTIA 3KHDA 5KTLA 2R1MA 2ZUWA 3G3MA 3CUJA 4AEEA 4F66A 4ILSA 2YZ5A 4UOZA 3I68A 2ZC8A 3QZEA 3FAWA 2YX0A 4YNGA 3CZ8A 4C6OA 3GXPA 3MMTA 4WY0F 1FVPA 4GXMA 4Q4MA 2R9RA 3UF9A 1N8WA 3VGDA 5CXPA 3NQ8A 1TFVA 3UR8A 2RDXA 3TFCA 4LCRA 2VZTA 3LOTA 4UR7A 1SR0A 1ELSA 5HOSA 3FXYA 3W86A 4YTRA 3VIPA 1ZFJA 1FP8A 2VFFA 2I5QA 4G5DA 1A5LC 4AIOA 1B2YA 1LOQA 4URIA 2Z2UA 1JYNA 1V79A 3WQGA 5MHBA 3EMCA 4PMJA 5F1VA 3G3DA 3BV4A 1JRBA 1KRMA 3AYSA 4DWSA 4Q8MA 2QDEA 3L4XA 3H2MA 3WBEA 4NYUA 5IXEA 4ICMA 5D02A 1SZEA 4L56A 4HA0A 4QR6A 4HSNA 3C8FA 3N4FA 2HK1A 4XWUA 1X96A 3ISIX 4RNIA 1W3LA 4QQ3A 2X0YA 3T2QA 3AIWA 5D2YA 2R1PA 3N2CA 1JDAA 4DO7A 4UFLA 1RK6A 4M7TA 4PULA 3C6CA 2X41A 3NQCA 4HT3A 2HXTA 2QUUA 1PKLA 3PG9A 1H2JA 3AIEA 5BRQA 4OOZA 2ISSA 3D5HA 2RHGA 5JIWA 1IZCA 2Z1BA 3W4RA 3F4WA 1SJDA 6TAAA 3WMSA 1EIXA 4K6AA 4CQBA 1QNSA 3C0QA 3U5YA 4O1FA 1Y0EA 2VL4A 3GQYA 2A7NA 2GPTA 1FHLA 4UTHA 4C7GA 1I2RA 4F79A 1J96A 3KTSA 2CBUA 5H8PA 4JGDA 1P0EA 1UR0A 4UQDA 3HMCA 2PLCA 2OXNA 1UWUA 3A5VA 4M81A 1RD6A 3M0LA 3G1FA 4Z0SA 4W93A 5I79A 3GHRA 2BZNA 4LF1A 3AZSA 5AYIA 2DT3A 2VI0A 3SGUA 3D3FA 2H6RA 4PUMA 1MW1A 5LHFA 4EK7A 3WX7A 4LANA 1W2PA 4GZ7A 3IIXA 1BXCA 5E0KA 1V3JA 1BVWA 5EMLA 3F2BA 3CAQA 5I07A 4FX8A 1UOKA 1SMAA 5DANA 4ZQRA 2NX3A 3VFLA 3PY2A 2WSYA 4DUOA 3INPA 3U48A 3IARA 3O7UA 4LAMA 4G1KA 3NXFA 3ITYA 1FQ0A 2DEPA 3M0ZA 1SO5A 3E12A 2FPTA 5B7ZA 3MVIA 3VILA 4W87A 3SSJA 5ENLA 4NUWA 1QI0A 4PR4A 3K5XA 3GTIA 2QCHA 1TV3A 5BZAA 5C9WA 3VMOA 1XIDA 1S46A 1KM1A 2J8TA 2PDQA 5LNWA 3BC9A 3SFKA 1VQTA 3LI0A 2RH9A 2P3EA 1V93A 1R9YA 3A12A 1GKPA 1H1ZA 3VINA 1VD6A 1DIOA 5FF3A 3PPGA 3LV6A 3VNLA 2DIJA 4ZOAA 4DO6A 1X6LA 4M24A 3W7CA 3SRHA 1OZQA 3P60A 4NHVA 1CZ1A 4Q8NA 2VXNA