1VK6A

Crystal structure of nadh pyrophosphatase (1790429) from escherichia coli k12 at 2.20 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
257
structure length
257
Chain Sequence
HMDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLVQQQRRHDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCRAEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH pyrophosphatase
publication title Crystal structure of NADH pyrophosphatase (1790429) from Escherichia coli k12 at 2.20 A resolution
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 61
structure length 257
sequence length 257
ec nomenclature ec 3.6.1.22: NAD(+) diphosphatase.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
A PF09297 zf-NADH-PPase NADH pyrophosphatase zinc ribbon domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1vk6A02
3.90.79.20 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1vk6A01
1SZ3A 1HZTA 2J8QA 1K2EA 5GHMA 3SMDA 3ZR0A 1Q27A 5HZXA 3X0RA 2GT4A 3U53A 3Q91A 3HYQA 5GHJA 1SJYA 1V8UA 2QJTA 5FSLA 3X0PA 3X0LA 4IJXA 2A8SA 3SONA 1XSAA 1V8SA 3F13A 3X0SA 1GA7A 5DPKA 3EEUA 5GHIA 1Q54A 3FCMA 1V8RA 2GT2A 1RRQA 1MUTA 2FVVA 1MQWA 1VIQA 4JZSA 1F3YA 5BS6A 1V8TA 2CL3A 3L85A 1VIUA 1X84A 3GRNA 3N77A 3BAPA 4C9XA 2A8TA 1VC8A 4MPOA 4V14A 1JRKA 1V8NA 1IRYA 3P5TA 5CFJA 2A8RA 3GG6A 3Q2TA 2AZWA 5GHOA 3MCFA 1NFSA 3GZ6A 4NFWA 3A6VA 5ANSA 3GZ8A 1V8WA 3N9UA 3Q93A 1MR2A 3DKUA 5ANUA 3X0NA 1PPWA 1V8MA 2ICKA 3HHJA 5C7TA 5IW5A 2G73A 5DEQA 5BONA 2YVPA 5DDGA 1X83A 3O52A 1PPXA 4KTBA 3X0OA 1XSCA 4ICKA 1JKNA 3BHOA 1QVJA 2DSBA 3WHWA 1G9QA 4S2XA 1V8LA 1X51A 3SHDA 1SOIA 4DYWA 2JVBA 5C7QA 2A8QA 3FFUA 1PVFA 2YYHA 3RH7A 1PUSA 2O5WA 3R03A 5FSKA 3X0QA 4YPRA 3MDIA 5FSMA 2G74A 3FJYA 4YOQA 2O1CA 3G0QA 5FSOA 1V8YA 5ANTA 1VHGA 2RRKA 2DSCA 3DUPA 3KVHA 2DSDA 4NFXA 4K6EA 3QSJA 2KDVA 3F6AA 2DUKA 3ZR1A 2YVMA 1V8IA 1V8VA 3A6UA 3Q2SA 5ISYA 1PUQA 1PPVA 1SU2A 3Q4IA 3O69A 1U20A 3MGMA 2I8UA 1RRSA 2QKMB 4S2VA 2VNPA 3CNGA 1XSBA 4JZTA 4HFQA 3O6ZA 4ILQA 5CFIA 3E57A 1VC9A 2PNYA 3H95A 1RYAA 2I6KA 2YVOA 5FSNA 1NFZA 3ACAA 3A6SA 3BM4A 3AC9A 3EXQA 4KYXA 4ZG0A 3P6YA 2A6TA 3J7Ye 1OW2A 1Q33A 2Q9PA 3OGAA 3FK9A 4C9WA 1NQYA 3I7UA 2KDWA 5LPGA 3EF5A 1KTGA 2W4EA 2R5WA 3FSPA 3X0JA 3O8SA 3ID9A 4KG4A 1MK1A 2A8PA 2O5FA 2B0VA 4N1UA 1G0SA 4JZVA 2FMLA 2B2KA 2ICJA 1MP2A 2VNQA 3O61A 5GHNA 2QJOA 4N1TA 5GHQA 4S2WA 1K26A 3GWYA 3MDGA 5ANVA 1MQEA 3COUA 4HVYA 2YVNA 1I9AA 3GZ5A 5I8UA 3X0MA 5FSIA 4S2YA 1KHZA 1TUMA 2PQVA 3Q1PA 3X0KA 1NQZA 1VHZA 2GB5A 2FKBA 4YPHA 5DD4A 2XSQA 1R67A 3X0IA 3A6TA 5GHPA 3I9XA 4JZUA 1KT9A 1HX3A 2I8TA 3I7VA 2B06A 1PUNA 3EESA 5ANWA 5IW4A 1VRLA 5C8LA 1VCDA 4KG3A 2DHOA 1VK6A
chains in the Genus database with same CATH superfamily
1SZ3A 1HZTA 2J8QA 1K2EA 5GHMA 3SMDA 3ZR0A 1Q27A 5HZXA 3X0RA 2GT4A 3U53A 3Q91A 3HYQA 5GHJA 1SJYA 1V8UA 2QJTA 5FSLA 3X0PA 3X0LA 4IJXA 2A8SA 3SONA 1XSAA 1V8SA 3F13A 3X0SA 1GA7A 5DPKA 3EEUA 5GHIA 1Q54A 3FCMA 1V8RA 2GT2A 1RRQA 1MUTA 2FVVA 1MQWA 1VIQA 4JZSA 1F3YA 5BS6A 1V8TA 2CL3A 3L85A 1VIUA 1X84A 3GRNA 3N77A 3BAPA 4C9XA 2A8TA 1VC8A 4MPOA 4V14A 1JRKA 1V8NA 1IRYA 3P5TA 5CFJA 2A8RA 3GG6A 3Q2TA 2AZWA 5GHOA 3MCFA 1NFSA 3GZ6A 4NFWA 3A6VA 5ANSA 3GZ8A 1V8WA 3N9UA 3Q93A 1MR2A 3DKUA 4J7GA 5ANUA 3X0NA 1PPWA 1V8MA 2ICKA 3HHJA 5C7TA 5IW5A 2G73A 5DEQA 5BONA 2YVPA 5DDGA 4J7HA 1X83A 3O52A 1PPXA 4KTBA 3X0OA 1XSCA 4ICKA 1JKNA 3BHOA 1QVJA 2DSBA 3WHWA 1G9QA 4S2XA 1V8LA 1X51A 3SHDA 1SOIA 4DYWA 2JVBA 5C7QA 2A8QA 3FFUA 1PVFA 2YYHA 3RH7A 1PUSA 2O5WA 3R03A 5FSKA 3X0QA 4YPRA 3MDIA 5FSMA 2G74A 3FJYA 4YOQA 2O1CA 3G0QA 5FSOA 1V8YA 5ANTA 1VHGA 2RRKA 2DSCA 3DUPA 3KVHA 2DSDA 4NFXA 4K6EA 3QSJA 2KDVA 3F6AA 2DUKA 3ZR1A 2YVMA 1V8IA 1V8VA 3A6UA 3Q2SA 5ISYA 1PUQA 1PPVA 1SU2A 3Q4IA 3O69A 1U20A 3MGMA 2I8UA 1RRSA 2QKMB 4S2VA 2VNPA 3CNGA 1XSBA 4JZTA 4HFQA 3O6ZA 4ILQA 5CFIA 3E57A 1VC9A 2PNYA 3H95A 1RYAA 2I6KA 2YVOA 5FSNA 1NFZA 3ACAA 3A6SA 3BM4A 3AC9A 3EXQA 4KYXA 4ZG0A 3P6YA 2A6TA 3J7Ye 1OW2A 1Q33A 2Q9PA 3OGAA 3FK9A 4C9WA 1NQYA 3I7UA 2KDWA 5LPGA 3EF5A 1KTGA 2W4EA 2R5WA 3FSPA 3X0JA 3O8SA 3ID9A 4KG4A 1MK1A 2A8PA 2O5FA 2B0VA 4N1UA 1G0SA 4JZVA 2FMLA 2B2KA 2ICJA 1MP2A 2VNQA 3O61A 5GHNA 2QJOA 4N1TA 5GHQA 4S2WA 1K26A 3GWYA 3MDGA 5ANVA 1MQEA 3COUA 4HVYA 2YVNA 1I9AA 3GZ5A 5I8UA 3X0MA 5FSIA 4S2YA 1KHZA 1TUMA 2PQVA 3Q1PA 3X0KA 1NQZA 1VHZA 2GB5A 2FKBA 2CZRA 5DD4A 4YPHA 2XSQA 1R67A 3X0IA 3A6TA 5GHPA 3I9XA 4JZUA 1KT9A 1HX3A 2I8TA 3I7VA 2B06A 1PUNA 3EESA 5ANWA 5IW4A 1VRLA 5C8LA 1VCDA 4KG3A 2DHOA 1VK6A
chains in the Genus database with same CATH topology
1SZ3A 1HZTA 2J8QA 1K2EA 5GHMA 3SMDA 3ZR0A 1Q27A 5HZXA 3X0RA 2GT4A 3U53A 3Q91A 3HYQA 5GHJA 1SJYA 1V8UA 2QJTA 5FSLA 3X0PA 3X0LA 4IJXA 2A8SA 3SONA 1XSAA 1V8SA 3F13A 3X0SA 1GA7A 5DPKA 3EEUA 5GHIA 1Q54A 3FCMA 1V8RA 2GT2A 1RRQA 1MUTA 2FVVA 1MQWA 1VIQA 4JZSA 1F3YA 5BS6A 1V8TA 2CL3A 3L85A 1VIUA 1X84A 3GRNA 3N77A 3BAPA 4C9XA 2A8TA 1VC8A 4MPOA 4V14A 1JRKA 1V8NA 1IRYA 3P5TA 5CFJA 2A8RA 3GG6A 3Q2TA 2AZWA 5GHOA 3MCFA 1NFSA 3GZ6A 4NFWA 3A6VA 5ANSA 3GZ8A 1V8WA 3N9UA 3Q93A 1MR2A 3DKUA 4J7GA 5ANUA 3X0NA 1PPWA 1V8MA 2ICKA 3HHJA 5C7TA 5IW5A 2G73A 5DEQA 5BONA 2YVPA 5DDGA 4J7HA 1X83A 3O52A 1PPXA 4KTBA 3X0OA 1XSCA 4ICKA 1JKNA 3BHOA 1QVJA 2DSBA 3WHWA 1G9QA 4S2XA 1V8LA 1X51A 3SHDA 1SOIA 4DYWA 2JVBA 5C7QA 2A8QA 3FFUA 1PVFA 2YYHA 3RH7A 1PUSA 2O5WA 3R03A 5FSKA 3X0QA 4YPRA 3MDIA 5FSMA 2G74A 3FJYA 4YOQA 2O1CA 3G0QA 5FSOA 1V8YA 5ANTA 1VHGA 2RRKA 2DSCA 3DUPA 3KVHA 2DSDA 4NFXA 4K6EA 3QSJA 2KDVA 3F6AA 2DUKA 3ZR1A 2YVMA 1V8IA 1V8VA 3A6UA 3Q2SA 5ISYA 1PUQA 1PPVA 1SU2A 3Q4IA 3O69A 1U20A 3MGMA 2I8UA 1RRSA 2QKMB 4S2VA 2VNPA 3CNGA 1XSBA 4JZTA 4HFQA 3O6ZA 4ILQA 5CFIA 3E57A 1VC9A 2PNYA 3H95A 1RYAA 2I6KA 2YVOA 5FSNA 1NFZA 3ACAA 3A6SA 3BM4A 3AC9A 3EXQA 4KYXA 4ZG0A 3P6YA 2A6TA 3J7Ye 1OW2A 1Q33A 2Q9PA 3OGAA 3FK9A 4C9WA 1NQYA 3I7UA 2KDWA 5LPGA 3EF5A 1KTGA 2W4EA 2R5WA 3FSPA 3X0JA 3O8SA 3ID9A 4KG4A 1MK1A 2A8PA 2O5FA 2B0VA 4N1UA 1G0SA 4JZVA 2FMLA 2B2KA 2ICJA 1MP2A 2VNQA 3O61A 5GHNA 2QJOA 4N1TA 5GHQA 4S2WA 1K26A 3GWYA 3MDGA 5ANVA 1MQEA 3COUA 4HVYA 2YVNA 1I9AA 3GZ5A 5I8UA 3X0MA 5FSIA 4S2YA 1KHZA 1TUMA 2PQVA 3Q1PA 3X0KA 1NQZA 1VHZA 2GB5A 2FKBA 2CZRA 5DD4A 4YPHA 2XSQA 1R67A 3X0IA 3A6TA 5GHPA 3I9XA 4JZUA 1KT9A 1HX3A 2I8TA 3I7VA 2B06A 1PUNA 3EESA 5ANWA 5IW4A 1VRLA 5C8LA 1VCDA 4KG3A 2DHOA 1VK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZ3 A;  1HZT A;  2J8Q A;  1K2E A;  5GHM A;  3SMD A;  3ZR0 A;  1Q27 A;  5HZX A;  3X0R A;  2GT4 A;  3U53 A;  3Q91 A;  3HYQ A;  5GHJ A;  1SJY A;  1V8U A;  2QJT A;  5FSL A;  3X0P A;  3X0L A;  4IJX A;  2A8S A;  3SON A;  1XSA A;  1V8S A;  3F13 A;  3X0S A;  1GA7 A;  5DPK A;  3EEU A;  5GHI A;  1Q54 A;  3FCM A;  1V8R A;  2GT2 A;  1RRQ A;  1MUT A;  2FVV A;  1MQW A;  1VIQ A;  4JZS A;  1F3Y A;  5BS6 A;  1V8T A;  2CL3 A;  3L85 A;  1VIU A;  1X84 A;  3GRN A;  3N77 A;  3BAP A;  4C9X A;  2A8T A;  1VC8 A;  4MPO A;  4V14 A;  1JRK A;  1V8N A;  1IRY A;  3P5T A;  5CFJ A;  2A8R A;  3GG6 A;  3Q2T A;  2AZW A;  5GHO A;  3MCF A;  1NFS A;  3GZ6 A;  4NFW A;  3A6V A;  5ANS A;  3GZ8 A;  1V8W A;  3N9U A;  3Q93 A;  1MR2 A;  3DKU A;  5ANU A;  3X0N A;  1PPW A;  1V8M A;  2ICK A;  3HHJ A;  5C7T A;  5IW5 A;  2G73 A;  5DEQ A;  5BON A;  2YVP A;  5DDG A;  1X83 A;  3O52 A;  1PPX A;  4KTB A;  3X0O A;  1XSC A;  4ICK A;  1JKN A;  3BHO A;  1QVJ A;  2DSB A;  3WHW A;  1G9Q A;  4S2X A;  1V8L A;  1X51 A;  3SHD A;  1SOI A;  4DYW A;  2JVB A;  5C7Q A;  2A8Q A;  3FFU A;  1PVF A;  2YYH A;  3RH7 A;  1PUS A;  2O5W A;  3R03 A;  5FSK A;  3X0Q A;  4YPR A;  3MDI A;  5FSM A;  2G74 A;  3FJY A;  4YOQ A;  2O1C A;  3G0Q A;  5FSO A;  1V8Y A;  5ANT A;  1VHG A;  2RRK A;  2DSC A;  3DUP A;  3KVH A;  2DSD A;  4NFX A;  4K6E A;  3QSJ A;  2KDV A;  3F6A A;  2DUK A;  3ZR1 A;  2YVM A;  1V8I A;  1V8V A;  3A6U A;  3Q2S A;  5ISY A;  1PUQ A;  1PPV A;  1SU2 A;  3Q4I A;  3O69 A;  1U20 A;  3MGM A;  2I8U A;  1RRS A;  2QKM B;  4S2V A;  2VNP A;  3CNG A;  1XSB A;  4JZT A;  4HFQ A;  3O6Z A;  4ILQ A;  5CFI A;  3E57 A;  1VC9 A;  2PNY A;  3H95 A;  1RYA A;  2I6K A;  2YVO A;  5FSN A;  1NFZ A;  3ACA A;  3A6S A;  3BM4 A;  3AC9 A;  3EXQ A;  4KYX A;  4ZG0 A;  3P6Y A;  2A6T A;  3J7Y e;  1OW2 A;  1Q33 A;  2Q9P A;  3OGA A;  3FK9 A;  4C9W A;  1NQY A;  3I7U A;  2KDW A;  5LPG A;  3EF5 A;  1KTG A;  2W4E A;  2R5W A;  3FSP A;  3X0J A;  3O8S A;  3ID9 A;  4KG4 A;  1MK1 A;  2A8P A;  2O5F A;  2B0V A;  4N1U A;  1G0S A;  4JZV A;  2FML A;  2B2K A;  2ICJ A;  1MP2 A;  2VNQ A;  3O61 A;  5GHN A;  2QJO A;  4N1T A;  5GHQ A;  4S2W A;  1K26 A;  3GWY A;  3MDG A;  5ANV A;  1MQE A;  3COU A;  4HVY A;  2YVN A;  1I9A A;  3GZ5 A;  5I8U A;  3X0M A;  5FSI A;  4S2Y A;  1KHZ A;  1TUM A;  2PQV A;  3Q1P A;  3X0K A;  1NQZ A;  1VHZ A;  2GB5 A;  2FKB A;  4YPH A;  5DD4 A;  2XSQ A;  1R67 A;  3X0I A;  3A6T A;  5GHP A;  3I9X A;  4JZU A;  1KT9 A;  1HX3 A;  2I8T A;  3I7V A;  2B06 A;  1PUN A;  3EES A;  5ANW A;  5IW4 A;  1VRL A;  5C8L A;  1VCD A;  4KG3 A;  2DHO A;  1VK6 A; 
#chains in the Genus database with same CATH topology
 1SZ3 A;  1HZT A;  2J8Q A;  1K2E A;  5GHM A;  3SMD A;  3ZR0 A;  1Q27 A;  5HZX A;  3X0R A;  2GT4 A;  3U53 A;  3Q91 A;  3HYQ A;  5GHJ A;  1SJY A;  1V8U A;  2QJT A;  5FSL A;  3X0P A;  3X0L A;  4IJX A;  2A8S A;  3SON A;  1XSA A;  1V8S A;  3F13 A;  3X0S A;  1GA7 A;  5DPK A;  3EEU A;  5GHI A;  1Q54 A;  3FCM A;  1V8R A;  2GT2 A;  1RRQ A;  1MUT A;  2FVV A;  1MQW A;  1VIQ A;  4JZS A;  1F3Y A;  5BS6 A;  1V8T A;  2CL3 A;  3L85 A;  1VIU A;  1X84 A;  3GRN A;  3N77 A;  3BAP A;  4C9X A;  2A8T A;  1VC8 A;  4MPO A;  4V14 A;  1JRK A;  1V8N A;  1IRY A;  3P5T A;  5CFJ A;  2A8R A;  3GG6 A;  3Q2T A;  2AZW A;  5GHO A;  3MCF A;  1NFS A;  3GZ6 A;  4NFW A;  3A6V A;  5ANS A;  3GZ8 A;  1V8W A;  3N9U A;  3Q93 A;  1MR2 A;  3DKU A;  4J7G A;  5ANU A;  3X0N A;  1PPW A;  1V8M A;  2ICK A;  3HHJ A;  5C7T A;  5IW5 A;  2G73 A;  5DEQ A;  5BON A;  2YVP A;  5DDG A;  4J7H A;  1X83 A;  3O52 A;  1PPX A;  4KTB A;  3X0O A;  1XSC A;  4ICK A;  1JKN A;  3BHO A;  1QVJ A;  2DSB A;  3WHW A;  1G9Q A;  4S2X A;  1V8L A;  1X51 A;  3SHD A;  1SOI A;  4DYW A;  2JVB A;  5C7Q A;  2A8Q A;  3FFU A;  1PVF A;  2YYH A;  3RH7 A;  1PUS A;  2O5W A;  3R03 A;  5FSK A;  3X0Q A;  4YPR A;  3MDI A;  5FSM A;  2G74 A;  3FJY A;  4YOQ A;  2O1C A;  3G0Q A;  5FSO A;  1V8Y A;  5ANT A;  1VHG A;  2RRK A;  2DSC A;  3DUP A;  3KVH A;  2DSD A;  4NFX A;  4K6E A;  3QSJ A;  2KDV A;  3F6A A;  2DUK A;  3ZR1 A;  2YVM A;  1V8I A;  1V8V A;  3A6U A;  3Q2S A;  5ISY A;  1PUQ A;  1PPV A;  1SU2 A;  3Q4I A;  3O69 A;  1U20 A;  3MGM A;  2I8U A;  1RRS A;  2QKM B;  4S2V A;  2VNP A;  3CNG A;  1XSB A;  4JZT A;  4HFQ A;  3O6Z A;  4ILQ A;  5CFI A;  3E57 A;  1VC9 A;  2PNY A;  3H95 A;  1RYA A;  2I6K A;  2YVO A;  5FSN A;  1NFZ A;  3ACA A;  3A6S A;  3BM4 A;  3AC9 A;  3EXQ A;  4KYX A;  4ZG0 A;  3P6Y A;  2A6T A;  3J7Y e;  1OW2 A;  1Q33 A;  2Q9P A;  3OGA A;  3FK9 A;  4C9W A;  1NQY A;  3I7U A;  2KDW A;  5LPG A;  3EF5 A;  1KTG A;  2W4E A;  2R5W A;  3FSP A;  3X0J A;  3O8S A;  3ID9 A;  4KG4 A;  1MK1 A;  2A8P A;  2O5F A;  2B0V A;  4N1U A;  1G0S A;  4JZV A;  2FML A;  2B2K A;  2ICJ A;  1MP2 A;  2VNQ A;  3O61 A;  5GHN A;  2QJO A;  4N1T A;  5GHQ A;  4S2W A;  1K26 A;  3GWY A;  3MDG A;  5ANV A;  1MQE A;  3COU A;  4HVY A;  2YVN A;  1I9A A;  3GZ5 A;  5I8U A;  3X0M A;  5FSI A;  4S2Y A;  1KHZ A;  1TUM A;  2PQV A;  3Q1P A;  3X0K A;  1NQZ A;  1VHZ A;  2GB5 A;  2FKB A;  2CZR A;  5DD4 A;  4YPH A;  2XSQ A;  1R67 A;  3X0I A;  3A6T A;  5GHP A;  3I9X A;  4JZU A;  1KT9 A;  1HX3 A;  2I8T A;  3I7V A;  2B06 A;  1PUN A;  3EES A;  5ANW A;  5IW4 A;  1VRL A;  5C8L A;  1VCD A;  4KG3 A;  2DHO A;  1VK6 A; 
#chains in the Genus database with same CATH homology
 1SZ3 A;  1HZT A;  2J8Q A;  1K2E A;  5GHM A;  3SMD A;  3ZR0 A;  1Q27 A;  5HZX A;  3X0R A;  2GT4 A;  3U53 A;  3Q91 A;  3HYQ A;  5GHJ A;  1SJY A;  1V8U A;  2QJT A;  5FSL A;  3X0P A;  3X0L A;  4IJX A;  2A8S A;  3SON A;  1XSA A;  1V8S A;  3F13 A;  3X0S A;  1GA7 A;  5DPK A;  3EEU A;  5GHI A;  1Q54 A;  3FCM A;  1V8R A;  2GT2 A;  1RRQ A;  1MUT A;  2FVV A;  1MQW A;  1VIQ A;  4JZS A;  1F3Y A;  5BS6 A;  1V8T A;  2CL3 A;  3L85 A;  1VIU A;  1X84 A;  3GRN A;  3N77 A;  3BAP A;  4C9X A;  2A8T A;  1VC8 A;  4MPO A;  4V14 A;  1JRK A;  1V8N A;  1IRY A;  3P5T A;  5CFJ A;  2A8R A;  3GG6 A;  3Q2T A;  2AZW A;  5GHO A;  3MCF A;  1NFS A;  3GZ6 A;  4NFW A;  3A6V A;  5ANS A;  3GZ8 A;  1V8W A;  3N9U A;  3Q93 A;  1MR2 A;  3DKU A;  4J7G A;  5ANU A;  3X0N A;  1PPW A;  1V8M A;  2ICK A;  3HHJ A;  5C7T A;  5IW5 A;  2G73 A;  5DEQ A;  5BON A;  2YVP A;  5DDG A;  4J7H A;  1X83 A;  3O52 A;  1PPX A;  4KTB A;  3X0O A;  1XSC A;  4ICK A;  1JKN A;  3BHO A;  1QVJ A;  2DSB A;  3WHW A;  1G9Q A;  4S2X A;  1V8L A;  1X51 A;  3SHD A;  1SOI A;  4DYW A;  2JVB A;  5C7Q A;  2A8Q A;  3FFU A;  1PVF A;  2YYH A;  3RH7 A;  1PUS A;  2O5W A;  3R03 A;  5FSK A;  3X0Q A;  4YPR A;  3MDI A;  5FSM A;  2G74 A;  3FJY A;  4YOQ A;  2O1C A;  3G0Q A;  5FSO A;  1V8Y A;  5ANT A;  1VHG A;  2RRK A;  2DSC A;  3DUP A;  3KVH A;  2DSD A;  4NFX A;  4K6E A;  3QSJ A;  2KDV A;  3F6A A;  2DUK A;  3ZR1 A;  2YVM A;  1V8I A;  1V8V A;  3A6U A;  3Q2S A;  5ISY A;  1PUQ A;  1PPV A;  1SU2 A;  3Q4I A;  3O69 A;  1U20 A;  3MGM A;  2I8U A;  1RRS A;  2QKM B;  4S2V A;  2VNP A;  3CNG A;  1XSB A;  4JZT A;  4HFQ A;  3O6Z A;  4ILQ A;  5CFI A;  3E57 A;  1VC9 A;  2PNY A;  3H95 A;  1RYA A;  2I6K A;  2YVO A;  5FSN A;  1NFZ A;  3ACA A;  3A6S A;  3BM4 A;  3AC9 A;  3EXQ A;  4KYX A;  4ZG0 A;  3P6Y A;  2A6T A;  3J7Y e;  1OW2 A;  1Q33 A;  2Q9P A;  3OGA A;  3FK9 A;  4C9W A;  1NQY A;  3I7U A;  2KDW A;  5LPG A;  3EF5 A;  1KTG A;  2W4E A;  2R5W A;  3FSP A;  3X0J A;  3O8S A;  3ID9 A;  4KG4 A;  1MK1 A;  2A8P A;  2O5F A;  2B0V A;  4N1U A;  1G0S A;  4JZV A;  2FML A;  2B2K A;  2ICJ A;  1MP2 A;  2VNQ A;  3O61 A;  5GHN A;  2QJO A;  4N1T A;  5GHQ A;  4S2W A;  1K26 A;  3GWY A;  3MDG A;  5ANV A;  1MQE A;  3COU A;  4HVY A;  2YVN A;  1I9A A;  3GZ5 A;  5I8U A;  3X0M A;  5FSI A;  4S2Y A;  1KHZ A;  1TUM A;  2PQV A;  3Q1P A;  3X0K A;  1NQZ A;  1VHZ A;  2GB5 A;  2FKB A;  2CZR A;  5DD4 A;  4YPH A;  2XSQ A;  1R67 A;  3X0I A;  3A6T A;  5GHP A;  3I9X A;  4JZU A;  1KT9 A;  1HX3 A;  2I8T A;  3I7V A;  2B06 A;  1PUN A;  3EES A;  5ANW A;  5IW4 A;  1VRL A;  5C8L A;  1VCD A;  4KG3 A;  2DHO A;  1VK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...