1VKXB

Crystal structure of the nfkb p50/p65 heterodimer complexed to the immunoglobulin kb dna
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
312
structure length
312
Chain Sequence
b'GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*GP*GP*GP*GP*AP*CP*TP*TP*TP*CP*C)-3')
publication title Crystal structure of p50/p65 heterodimer of transcription factor NF-kappaB bound to DNA.
pubmed doi rcsb
molecule tags Transcription/dna
total genus 50
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 1997-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00554 RHD_DNA_bind Rel homology DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vkxB02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1vkxB01
4PTUB 4BUGA 2Z31C 1OOAA 4OF0A 1DBJL 2BJML 1TCRA 2LAGB 4N90D 5SWQB 4L3ED 4MVBC 3GM0A 1UJ3B 5CEZL 1HQ4A 4FZ8H 1AO7B 1OB1B 1FVEA 3DURA 4WWKB 2Y07L 2N4IA 1UWGL 1MIEL 3QFDA 4U1NA 3C60C 3GGWB 4JZJC 3V7AG 5TH2B 4PJCB 4OLZL 4MQTB 2ED9A 4V1DA 3LPFA 3QEQD 5GGRY 3NZ8B 3HZYB 3QUZA 1XR8A 1YNTA 4OQTH 1C7SA 3IS1X 3BKJH 1F2XK 1NC4A 4MX7B 1CICC 3A6BL 4N5ED 3WIHA 4NHCL 2VLRB 2KZWA 5EU4B 3EUUA 4AZ8A 3DMMA 1OAUL 3SDXE 3VJ6A 2VZTA 3S35L 1CDJA 2X70A 3S5LB 3S37H 3FO0L 5FYKE 3RTQD 2DIJA 4UDUB 3UJTH 2EEBA 4G8GE 2L7UA 1A6ZA 1MQKL 1U95A 3DPBA 3BUYB 1NANI 2VQ1A 4PJBB 4Z0XB 5HVWA 1SJVA 3GM8A 5IOPA 3CFBA 3S5LG 4UIMA 2NTSP 3ZKMC 1RJCA 1JWMB 3TN0C 4D9LH 4P4KA 1EAPA 1HCFX 1NAML 4RNRA 3KPRA 3T3MF 3NH7L 3RX8A 5FV1L 3GBNH 4ONFH 4OZIB 2BHUA 3V5KA 4UIKH 1J0HA 2M26A 3P77A 2HWZH 1A5FH 4Q9BA 4XT1C 3O8XC 1TJHH 2GTZB 3MODH 4OCMC 5CEXB 3HC4L 4YO0B 3CLFH 5SWSB 2YD4A 4UV7L 3KJ4C 3KNBB 3RVVD 2XY2A 1UG9A 4M03A 5F1NA 5D1XC 1GIGL 1JUFA 2O61A 1UM5L 1IAOA 3QRGH 3TNMB 1MFNA 3VXRE 4W6WB 5CILL 2NMSA 4FXGA 5EO9B 2CXKA 3T2OA 2D7OA 4MNHB 5CKGA 1YC8A 5JMRA 1FFOB 1RZ7H 2KPNA 4R2GC 1BZ9B 5KN5B 3T4AA 1N5YH 1DBKH 1DVFB 3BAEL 5ESAA 3FFCB 1OSPL 2WWKO 2WANA 4YAQA 3CX5J 5F6IC 2DQIH 3OKKB 2EH8L 3QUZD 4P2QB 1AKJA 3T0ED 4C4KT 4U7SA 3ZDYE 1NEZA 1NC4D 1ZHLB 2LU7A 3CFJB 5FYJU 5J11B 1NGWB 4LLDB 3OKEA 1L7TH 1AIFB 3MSPA 1B90A 4KJQC 4JM2F 2V2WB 3RJDA 2P8PB 3VFNB 3NN8B 1W72H 1VERA 5D7LE 5IM7A 3FKUS 4K7PX 5ITFA 3TFKC 5F7EH 4KK5C 1A3LL 4NKQB 5EBLA 4KRMB 3MUGB 4RAUB 1IM3A 3O4LE 4XPFL 1MLCA 4I8DA 3ROLB 5KS9A 1FCCA 4FFWD 1BEYL 3ULUC 4X7TA 5T33H 5DJCB 5IHZB 3VWJB 2NNAB 2XY1A 2Z4QA 4O9HH 4RWHA 3H3KA 3KPRD 2E9BA 2Z92B 3OAUH 1LO3L 1OP5K 3OTTA 3LN4A 2QJDA 4R9HA 4Y4FC 3VFWA 1FYTE 5KVDH 1L4IA 3ARBB 3W82A 2DF3A 3CSBA 3K81A 2EO9A 3QEQB 1E4XI 5IMOB 2PR4H 5CEYA 2IAMA 1SBSL 4XMKH 1FDLL 3ARFA 2NPLX 4Y16D 4CMHC 4NKMB 2VR9A 2Q7YB 1XGQA 5FYLE 1G7MA 1H3VA 4YHNB 2BFVL 3ZT6A 1BF8A 4OZGF 4ODWB 1G7HA 4UAOC 4HJ0C 3BQUD 1Y0LA 2VR5A 1G7QA 2VZ1A 5HHMD 3EO0A 5D8JL 1RUKL 4TSBH 1H3GA 4W4NA 1MRCH 4LHJB 4OZHB 1CR9L 1OSZB 3UBXI 3V4VL 5EO0A 3ORJA 3O9WB 3BZFA 3T0AA 2HG5B 4F80A 1I1AC 2APXA 4C58B 3TP4A 3NFSH 1AC6A 3QUMB 5TDNB 5HHOA 1CGVA 1LO2L 5INDB 5DQDH 5JXAL 4PP1C 1AKJD 2P5ED 4Z7UE 1CFSB 4Z0BL 1OPGL 2HMID 3D48R 3RNQA 3PXJA 5CJXA 1UVQA 3ZE0E 3FT4B 2MJWA 4JRWA 3BZDA 2I07B 3D18A 5AZEH 1GH7A 4RIRA 2LE9A 1FNAA 1HK6A 1I75A 1FG2B 5A3IC 4BH8B 5FYJL 4LNVA 2NY3B 4JKMA 2BOCA 4GQ9L 3FOMB 3PWVB 2DLHA 5CP7B 1JPTL 5CJOH 4D0BB 2VB5A 4O5LL 1UH2A 2BHYA 3TJEL 5JNYB 2XOTA 3JUZA 2D7TL 1RHFA 1BGXH 2PW1B 3QIBA 5E8NA 5HDQH 1WWAX 4XH2A 2R8SL 5DD0L 3SHSA 3T65A 3VGAC 4ZUWB 5EU7E 3U82B 1NFDE 3U1SH 1QP1A 1DJSA 3GMRA 4HQQL 4UDTA 1BQSA 3V0VB 4RGNB 4I13B 3VXSE 1D5BB 3IDGB 1OF2A 1U8JA 1CGTA 4LBEB 3QULA 3G5YB 4UT7H 4TRPL 3FO9A 4J3VA 3MA9L 1QNZH 4OIAA 4L3AA 3ARFD 2BP3A 2AV7B 1MREL 1BVLB 3LQZA 3E6HA 5LCVH 2GFBB 1A14H 4JM4L 4ODBD 2GAZB 3QFJA 1CFNA 5TE7H 4PIRF 3JTSA 4P5KB 3AB0B 2BNRD 4UNVA 3V7MA 1R3KB 3GI9L 1G1CA 4S1QH 3I9GL 3BN9D 3KVQA 1DUYA 2YEZA 1R24B 2VISB 1R3LA 4ODVL 5I17B 2V2XB 1EEZA 2X4RB 5F7MC 4P99A 5F9OL 2GK2A 4N9GA 5TDPB 3CPLA 2EICA 5MENE 3WNOA 3M17A 1KC5L 5ID1A 4J23A 2HRPH 3D0LB 3V0WH 5GS0L 2DWDB 2EDWA 1OT1A 3MV9A 3QPQC 3CFCL 4N0FB 1T22B 4YK4C 1FFPB 2VQTA 4G3YH 5L6YL 1K5NA 2VERN 3DTXA 2EEAA 4PJHA 2AJYH 5EZLB 4HK3J 2Q6WB 3C6LD 2D0HA 3TBYB 1BD2E 2OP4H 5FXCH 5KVGH 5ECJE 2PW2B 4HJJL 1LVEA 2QHLA 3LEYH 4XP1L 3VU2A 3PDOA 5FO9A 3TBVA 3LRSA 3NIFF 4JY6B 4LKCB 4MMXC 4JRXD 3QXDA 5C0IA 4JFEB 4LCIL 1NSNL 1S5IH 3LEVH 3RUGF 3QNXB 1MEXH 4P5TB 4NCDA 2X7LB 3ZE1E 1YUHA 3QIBD 4PJFF 3TO4D 1X6NA 3O41B 5C2BL 35C8L 4WHDA 5HI3D 4F7PA 1CLCA 1OP9A 4A2LA 4KROB 1TTGA 5D7SH 4IJ3C 1NL0H 2B5IB 1WAAF 1I8LC 4XXDA 3VFRA 3R4DA 4P3DB 5B38A 1HIML 3NPZB 1NBZA 1EA9C 2CKNA 3CH1B 3WIHH 3QUKA 2FRGP 1B0GB 1LNUA 4Z8FH 4PD4J 5IEKB 1P2CA 3MBEC 4MAYB 4WGWB 5D96C 4ZXBA 1SJEA 4BQ8A 1V7NH 3QDJA 1A1MB 1WWWX 4JREC 3G5VA 4MB4A 4CADB 1WBYB 4MQSB 3QFJD 3WFBH 4K71B 3OR6A 1UADC 1E4KC 1MCJA 3QQ9D 2VNCA 2VABA 2I24N 1ETZA 3C9NA 2D7PA 5I8OL 1RAMA 4K23H 4FQJL 5B8CA 4P9ML 4BK4A 5EN2B 1P6AB 3MLTA 2GJZB 5E94B 3UC0H 2XQYK 5D1QC 2BXZA 4JE4B 1PKQA 1VEPA 2XQBH 4JGUA 4RBPH 3ARPA 3VXUA 4JN1L 3AS1A 2Q86A 4U1SB 3IU3B 4LCWA 1D9KB 1MSPA 4TUJA 3ET9F 4MZ3A 3VFMB 1MRDL 2YPVL 2AK4D 1MHEA 1F6AB 2ZUTA 3QAZB 5AAWA 1F58H 3UTSA 2R4SH 1Z5LA 1ZTXH 4U1GC 4XNUL 3VG0L 4ZUSB 2VO5A 5TF1L 1GGBH 3B83A 5DA4A 1R5VB 3MUHL 3S8WA 3FRUB 5D6DA 4XMPL 1Q1JH 1PX3A 2B1AL 3LD8B 4MD5A 4X5WA 3HG1B 1IGIL 4DJMA 3CUPB 2J88L 4GG8A 3LHPL 2YA2A 1NGZA 3MLXH 3NIDF 2PXYB 5DA0B 4BKLA 1DN0A 5D70H 4OV5B 1FIEA 3TYFB 5IT2H 1LO0H 5KAQF 4HS3B 4JEGB 1VPOL 1YQVH 1U6AH 4KTDL 5E2TH 1W0YT 3MCKA 3U7YH 3V0AC 3CFIC 5C0EB 1AH1A 3PQYE 3DVGA 2BVPB 4WEUD 4WNQB 5DJAA 5ALCL 2AXFA 3RWHA 2RIKA 3U9PL 3GBMH 4I0PB 2APFA 1QO3A 5C07E 1K8DA 5DZLA 3UDWC 4WGVB 5GSRB 1HHKA 2FH8A 1ITBB 4CVZA 1EFQA 4OFPA 2BVQB 1LEKB 2OTWB 2V7HA 2NXZD 4AIOA 1HKLL 4YFLI 3H9HA 4PJDE 4K9EL 2GY7B 4PJAE 4PG2A 4ZXBD 3WL9A 1S9VA 1C12B 3DYPA 2FBJL 1NANH 1P4IL 1FLRH 1YEEL 4XPGH 1NH6A 5EOTB 1OARL 1RZKH 3BZ4B 2XN9D 4I5BA 5H94B 1RMFL 2YKLL 3ZLQC 4MS8D 3L5JA 1JGUH 4HIEA 1KT2B 1TZHB 1G7JB 5KVMC 3VWKC 3UJJH 4M43L 3MV8A 1BJ8A 3ZKQD 3BIAX 3BP4A 1DSFL 1F8TL 2PCPA 4NQDB 4YXHH 3NFNB 4HHAA 1A6VH 1HSBA 4G6FD 1JI2A 4ZNEA 1MFDL 4PP2A 2DIBA 2AXGA 3IXTA 1I4FA 4LCWD 1H15B 5JHDA 5I8EB 4LSUL 2NXYD 2XT1B 2E9JA 3MLWH 1I1YB 3TZVB 4YDIL 2VXSH 5FB8A 5IMLB 4G9FE 4Y4HD 4JB9L 4QRRE 2R29L 4HPYL 4OKVB 3NFPB 2IBZY 3UTOA 1K3ZA 3EYUH 5GQBA 2ZSWA 1M1SA 4HWEL 4DGYL 1IGJB 5H8DA 4MWFA 3RX7A 3IKKA 4MJIA 1G7LB 2DL9A 5EG6C 5DRXB 4NOBA 2E6QA 4ZPTA 3Q6FA 1N6UA 1UZ6F 5TFSL 3ARDB 3RZCC 3RTQC 4KMTH 1C5BH 4L8DA 4HKJB 3LZFL 5ITBL 1D3CA 4U0RB 4LDLB 4YDVB 4IOIB 5K9QI 3ILQD 3ARSA 1ZS8B 3VW3L 4H1LH 4ZUVA 2O5ZH 3HI1B 3OKMB 5C0FA 1CGUA 1KTDA 4NGHH 3HE7C 5BVPH 5C0AD 1PSKL 2HT4D 2XV6B 1AQDA 1OTTD 4HC1H 1Q9WA 3WO4C 2WNGA 2VLMD 3GIVB 2EH7H 4B0MM 4M1CC 4TUOA 1ED3B 5BO1L 3T77B 5GZNC 1PY4A 3BWUC 2E7LA 2ICWJ 2LVEA 4FQHA 2VE6A 2C1OB 1OAKL 3MYJA 4N0UE 3HKFA 4OGZA 4XXCC 5HHNA 5JXEA 3TA3B 3SDDB 3BP6B 5JOPE 1WCBA 3I6KA 3A67L 2XA3A 2DBJA 3NIGF 1LO4H 1YDPA 3MV8D 4KUCF 5D6CB 3RVVC 2I25N 3PDGA 3B5GA 4EZMA 1C08B 4JN2A 3ZYJA 1C5DB 5EOQH 5DYOA 1HSAB 3QP3A 2WAHA 3X13B 1WJ3A 5D71H 4OGYL 5KSAA 2EYTB 5BS0E 4ODHH 3HI6L 4PUBL 4WI6A 5DDHA 2ADGA 4TUKL 2EYRA 3FTGB 3FAXA 4LOUD 4WFFE 1NC2A 4XNQA 5CAYB 1ZV5A 5J1SC 1N7MH 4XX1E 2V5TA 2KUTA 4MDJB 3RWEB 2ARJQ 2CIIA 3QUZC 3JUYA 4OLUL 3T0EC 4ETYA 4BSJA 2X4TA 5F88B 3PP3H 1G9NH 3IDIA 4F9LA 3MLVH 1X5ZA 2YSSA 4MJID 3ZKXB 5FF6B 4D9QE 4DCQA 3MREB 1KNOB 5E2VH 2XN9B 5EBMB 1NMAL 1EEQA 3MRBB 1PQZA 3EZJB 3CVHB 4I18A 3SDCA 1CDHA 2OS7A 1JPFA 1ZK9A 3C6SB 2WWKT 1NMBL 1IEAA 4LNRA 4LVEA 4YBLC 5LJYH 1BP3B 2FLRT 4UOJA 5HHVH 1BWWA 4OLVH 4KHXH 4BSWA 4DVRH 5GGTL 2AW2A 2HVKA 1T7YA 5FDWA 5I8CB 4MNQD 5TQ0H 1BBDL 4GKNB 4ETQA 4ODXB 4P4KC 5E95B 1L9NA 1XGPA 3LKOA 2CMRL 2C3VB 5HPOA 2VDOL 5C3LD 2H32A 1JHKH 4Q9RH 2BOBB 5T3XD 1UWXH 4KJWC 5D7IE 1JNNH 2VDRL 3FB6A 3R0NA 4XNZB 4LRIA 4GG6B 1HH9B 2QSCL 4GRWB 4GKZB 4OTXH 5DLMH 5EZJB 5I16B 2BMKA 2B1HL 2R1XA 1KIQB 4U7KA 4U3HA 2FR4B 4I2XA 2RQ8A 5DK0A 3OXRA 3V5DA 3PWJA 1CBVL 1SBBA 1ZGLB 4LLVA 5AG8A 4PJ9A 3F7YA 4NSKB 3C5JB 3U2SB 4OM0H 1F97A 5EIIB 1UYWH 3MNVA 4FQQB 4QXGH 4BZ1H 1XF1A 3ARWA 5J8OA 5IQ9A 2VZSA 3BKJL 3RPIA 5KSAD 1A47A 5KBNC 4PJIB 4PTUA 4LHQB 5I75B 5E8DL 1NQBA 4ZSOB 1IGCH 1NC2D 3RP1A 2NW3B 2NZ9D 4L4TD 4M5YL 1JRHI 2DL2A 3MV7E 3WN5B 4MZ2A 5EZOL 1UJ3A 1ZOXA 3VXPA 5C0AB 1MLBB 4PY7A 1OB1A 2ORBH 4JR9L 4HEME 2HMIC 4BM7A 4WWKA 2HFEB 4S0TD 3O6MH 3VDBA 1FVDB 3GGWA 3QUXD 4NHUB 1EEYB 2D7QA 4NFCA 4WHTB 1S9YB 5E6ZA 1IBGH 1MY5A 4Z95L 4KUZH 3HZYA 3ULVL 4FTVB 4P4RB 2AK1H 4HX1B 1UZ8A 4TVSa 4OCRH 1RZKC 1VCAA 3K7UA 5F6HI 5EU6D 2PYEE 1IEBA 3HR5A 2X1PA 2VLRA 5SV3A 4OD3H 3MGTB 2FJFB 5I30H 1HILB 3WDJA 4PRID 4AIZB 3S5LA 3HNVH 3DUHA 1YEGH 3CLFL 3KPSA 3KYKH 4HXAH 4YBQD 1K4DA 3SQOH 1URLA 4PJBA 2AAVA 3T8XB 1XGYH 1UB5A 5DUPL 3HUJB 3VXOB 3S35X 4CW1A 4IBLT 4ZFOB 4WHYH 4K94H 1NLBL 2PTTA 3OGCB 2E6JA 4PV8B 5TJWK 2Y4SA 3I6LE 1IGMH 1T5XA 3FB8A 3FMGL 2IAMC 3FT2B 1AE6L 4FQLL 4J1UB 2WQ8A 4JPWL 4N0YL 1VENA 4RFOH 4G6JL 2OQJB 4O4YL 3ARFC 4UILL 4LPWA 3V8CA 2P8MA 2VLKD 1YMMD 5IMMB 5I19H 2C3WA 1U8LB 2HJLB 2GTZA 3BN9C 2EDQA 3HR6A 4KK8D 1V5JA 2F54B 1FYHB 2KBGA 2IMMA 1U2CA 3KNBA 5KSBF 1MCWW 4AG4H 1QFWH 4L3EE 1KACB 5TE6L 4EI6B 1I8IA 3S88H 1H3PL 4X83A 2J5LC 1U91A 5ICXB 2ICWA 4JPVH 1BAFL 4PJGA 5EO9A 3HC0B 3S36L 4OF8A 5A2JH 4ISVA 3RVTD 2FB4L 1EHAA 5E2UH 1BZ9A 3WCYA 5CJXC 4UT9L 4ZNCD 5D4QA 3S96A 1DVFA 2E27L 3QEQE 4XPAL 5F9WB 4E41D 4GMSL 1DEDA 4EIZC 1GGIH 3FFCA 3C6LC 3O3AB 3ZO0A 4HLJA 5IVXE 5EZIH 1IQDA 3OKKA 3L95B 4P2QA 1WBXB 3PHQB 4Z7WE 2BRQA 1NGWA 4I77L 5AWNL 1KENH 4LLDA 3REWA 1WC7A 3L5XH 4BELD 4N8VB 3QCTH 4JPKL 4J6RL 3FCTB 5J9PB 2JK5B 2CK0H 1FRGL 5E9DB 5KVDL 4YR6B 2V2WA 4R96B 1EO8L 2R56L 3VFNA 5ERWB 3QIBC 3TH3T 5C2UB 2VXUH 1T21A 1KJMB 2DMBA 1Z3GH 4CDHA 5HI3C 3D85B 3K8MA 1MHPH 3KPSD 3MUGA 5BRZB 4IDJH 3B3IB 4RAUA 4UMGA 4L29B 1TTFA 4YPJA 3ROLA 1BECA 3HZKA 2DM3A 3KPMA 3SEPA 3EJJX 5K9KB 5DJCA 5IHZA 1IC4L 4WEBH 5I6XC 4PRHB 3VWJA 5E1HB 4HLZG 3S97C 2ZSVB 5DHYB 5C9JB 4WW2C 1Q0YL 3RGVA 5I8KH 2A83B 1N5AB 3QUXB 3E3QE 1U8MB 2AJZB 4J3XA 4K8RD 5IMOA 5DQDL 4CU8A 2JELL 3MLYH 1DLHA 4ZS6D 1G9NC 5DMIL 5E8PB 4JHWH 2Q7YA 1E6JH 1CXFA 3GMQB 4LRNH 4XB8A 3VH8G 4XPTL 4YHNA 1IAIH 2MHAB 4XGZB 2MQ0A 2QEJA 2ATPA 5T3XH 3GRWL 4KY1H 4ODWA 4QRSB 4UUJA 4XBEL 1PYWA 2IH3B 2V17H 4PRIB 3QDGA 1S7QA 3BW9B 1AHWA 5FUOH 4I3RL 4OCYL 1AGFB 3CSGA 4OZHA 3U7WL 1OSZA 5DXWA 4FABH 3OKLB 3O9WA 4P5MB 4RQQB 3DSFH 2HG5A 3SDYL 4JM2D 3U6RB 2QR0B 3MLRL 3QUMA 3I3DA 5TDNA 2BVOB 3T0EE 3LN5B 3LVEA 3VG9C 4WCYH 4XCCH 1OTSC 2WM0A 4X7FC 1CFSA 1T0NB 4P23B 3V6OA 1UXWB 1X4XA 3N50A 1DANU 4HUKB 2GUOB 2HFGH 2CRMA 2I07A 4HT1L 4NPYB 2C4XA 1UKQA 3MROA 2E5EA 3CXHJ 3UX9B 4PTTA 4UU9A 2DLTA 1YMMB 4L9LB 5HHXH 1BX2A 1ERNA 4KPHL 5D2NB 2NY0B 3VDAA 3JVGA 1KFAH 2J2ZA 2ADIA 2NY7L 3UPRB 4J3SA 4EXPX 3FOMA 4JO1L 4Y1AD 4L8CB 5ISZA 3IRPX 3GMPB 4G42B 4D0BA 5BOPA 1INQA 1OAZL 5AZ2H 3CSPA 4MMZC 5JNYA 5F70A 2XACC 1T5WB 1VADB 2ZZUT 4HJGB 4S1QL 5GGSA 4KQ4H 1QUNA 2QADD 4ZUWA 4H88L 2FNBA 4NJ9L 3KPRE 1MJ7L 4G8FB 2NXZC 3MTRA 4OIIH 5FO7B 3VCLB 4GS7B 1A3RH 4RA3A 4ZXBC 1SY6L 4URTB 5C0BA 4YIQB 5LKNA 4WHCA 5JOFA 5CSZB 3V0VA 2BVUA 1DBML 3DX7B 3ZDYF 3G6JB 2M8XA 3IDGA 2A6DB 2ZNXA 5IB2A 4LBEA 4OZ4B 5HDOA 3G5YA 5GGUA 1I9JH 2OMNA 4MS8C 1T83A 2WW8A 2E9WA 3L1OH 2F58H 1H5BA 5B8CC 1KB9K 1PG7L 1A6PA 1GOFA 2F19L 3V6ZA 2YD7A 4U1JA 3PL6B 5DRNB 2GAZA 2IANB 2H32H 5AUMB 2YS4A 5HHME 2ARWA 3QDGD 5DTFA 2YD9A 4F33B 1RZJL 5I17A 4FN0A 2X4RA 2P5WB 5ENWB 3KS0J 5F7YC 1F3DJ 4PLJC 1QLRB 3ZTNH 4G7YH 3W11D 5T1MA 5CD3B 3OX8B 2FBOJ 4L9DA 3SOBL 3CDYA 3D0LA 3EYFB 1V3MA 2DWDA 2P5EE 2P4AB 4ZTPH 4JFPB 4NC0B 5D6DC 5LWYL 5KVEL 4N0FA 2R1WA 4YNYA 3HFML 3PV6B 4U05A 1R0AH 1IFHL 2UY6A 3GIZL 4AEEA 4APQA 4ZTOH 2OL3L 1IC7L 5EZLA 3KHOA 1OTUD 4X80H 4K94C 1AD0B 2VMFA 5EUOA 2XQYG 1MFCH 1XF2B 1CE6B 4BFBD 5I1AB 4LKCA 4RMQA 1FO0B 1HEZB 5ISZD 4R7NB 2XRAH 3ILQC 3G9AB 3QNXA 3PHOB 1KIUA 4XP9L 3O41A 3JXAA 2DQTL 5DFVC 3UXFA 1IT9L 1ZANH 3F7QA 4XAKD 4JFXB 4ODUB 1CFTB 1JWUB 2DM7A 2R1YA 4PG2C 3QXWA 4LEOB 4FQIL 3U0WH 4ZAKA 5C0BD 1DBAL 2ERJC 3PGFL 4YQXL 1T3FA 1XF4A 5TQ2L 1IGYA 4P3DA 2GT9B 1F02I 1P6FA 3D39D 1PDKA 1P69B 1B0GA 3WSQL 1EV2E 4GAJL 5IFHL 3F8UB 4DN4L 4RA0C 1CLZL 4MAYA 2IBZX 5L2JB 2H45A 4G5ZL 1CIUA 4DK3A 2K3TA 2OR9L 2LV4A 4X9GA 1A1MA 1XZ0B 3MGAA 1QFHA 2BNRE 3JV4B 3SKNA 1WBYA 2C7UA 2FO4B 2AKRA 4HGWB 1H8NA 2QQLH 1T2QL 4FS0A 4ZUUB 3ZHLA 1QSZA 4N0CD 3RWJA 2VJXA 5T5FH 4PG9B 1CXEA 3T09A 3OKDA 1LMKA 2DAVA 5EN2A 5IBTH 3WD5H 4NQTA 1T2JA 1FZMA 3VFOB 4LOUC 1YEFL 5C0DB 2GJZA 5C8JA 5E94A 1I7UB 1NFDF 5H37G 1UXSA 1LEIB 4R97B 1R3IL 5FV2A 1FFRA 3LH2L 5DRWB 5D5MA 3U7YL 2A9MH 4K8RH 1FGVH 1Y18B 4U1SA 3IU3A 1NBQA 2DLEA 3MRJB 4P2OD 1D9KA 5L8LB 1AXTH 1EXUB 4APQD 1LEGB 4GAYB 1F6AA 4LPVA 4FQPA 4JFFA 4CVXB 1CFQB 2W38A 3ZDZF 3GBML 4RWYH 4GUPB 1KB9J 3WIFB 1R5VA 3DARA 4ZFZA 1KXTB 1P7HL 3JTTA 3ZTJG 5T3ZH 5D2LB 1E6OL 4OZGB 1SJXA 4FFVC 3HG1A 4JRXE 2QQQA 3DBXA 2FX9H 2Y9RT 2YXFA 3CUPA 4OT1L 2AP2A 1KF9B 2PXYA 5AG9A 4LP5A 3HE6B 4JKPH 1X3DA 4HDIA 3TBSB 4XC3H 1HDMB 4HS3A 3BH8A 3HMWH 4PRPB 5C0EA 1BVKB 3BGMB 1MCHA 4JKKA 3ILPB 4X99A 5HHPB 2WP3T 3LKSB 7CGTA 4ZAKD 1VGKB 3SKOB 4QOKD 5F89B 2LAAA 4Z77A 3IJSB 2IADA 2G5BA 4NDMB 4I0PA 4OZFB 4ONOA 2W91A 5TGBB 5JA8B 1VHPA 3QXTA 5GSRA 2E7LC 3BEVA 2EO1A 5J57B 1TZGL 2Q3ZA 3HI5L 5JXEC 3DECA 5DD3H 1LEKA 1RK0B 2ITCB 2KH2B 5IEHB 1C12A 3IJHA 1HH6A 2YZ8A 2B2XH 3EFFB 1MIML 1I3RA 3M1BB 4K7PH 5H2BB 3QFJE 1JZ5A 4NO2A 2XWTB 2X89A 3BZ4A 3L3IB 2KKQA 3FQTA 1N6QL 1MF2L 5DJ2B 4KZDH 3DIFB 2NY1D 3TH2T 1FE8L 1KT2A 1TVHB 2C9AA 3EJYD 4KKBD 5KSAC 3ZE1F 1CXLA 2MCG1 3EYUL 1F4WH 1KEML 4F7TB 1ZHNB 1DUZB 3QA3B 4JDTH 2OK0L 1WFUA 1X44A 1BOGA 4M61B 1KIPB 1CF8L 4X6FB 4EDXA 3NFNA 3B9EA 4WW1B 1MFBH 2P46B 5F72S 4Y4KD 1T03H 4ACPA 2AK4E 3LB6C 1H15A 4DGIH 3MBXH 3FB7A 4PJHE 3H7BA 5I8EA 2JB6B 4F9LC 4JFFD 3QEHB 2VAAB 3HZVB 3TZVA 3EFDH 3MXWH 3SN6N 2O5ZL 1QRNB 5B4MD 5IMLA 4WTWA 2F74B 3NFPA 5FHAH 1EH9A 4ZQKA 1A1NB 4I18C 3SDCC 15C8H 2NY2B 5IKCB 4ZUTA 5LXGH 7FABH 5JR1H 4LSVH 1HKFA 1YYLH 1G6RL 4JFOB 4JO3H 2UWEF 3RA7H 3NA4A 3D3VB 2RAMA 2XA8L 4N8CH 1A8JH 4M1GH 1QKZL 3NCJH 1QLFB 3KPLB 3QUMH 1EBAA 4FQXB 2YD2A 3STLB 3N9GH 4F2MA 1OVZA 4L5FL 5FYLL 5I1DB 2ZCKL 5DC0A 2XTJB 5ANMB 1SEQL 2APBA 1J8HD 4YBQC 4YDVA 1TJIH 4HKZB 4NN7B 4DW2L 1WEJH 3TO2A 3HI1A 3OKMA 4XVJL 3AVEA 5I71C 4LKXB 4HBCH 4LARL 1E4XL 4GXUM 1TJGL 4FP8L 1DQLH 4LRIC 4LLQB 3IAPA 4PJ5D 4Y5YB 1J0IA 4FRWA 1QFUL 3X3FH 3GSOB 5IK3A 1ED3A 3T77A 3UROR 1U8HB 3KPQB 3T04D 3QJHB 2XN9E 1D5IH 1NBVL 4MHHG 5DJZA 5I66A 4OV6F 2X89D 1JPSL 5DQ9B 3RUGB 4X8JA 1YNLH 4EIGB 2VLLB 2C1OA 5FA4B 4PJ9C 1II4E 2JKXA 1RK1A 1KN2H 3EOTH 3SDDA 2FX7H 3QRFM 4M93B 2DLGA 5GGRA 1N4XL 4G8IA 4KK8C 3MO1B 4PGJA 5K9JL 3MLSH 5C0GA 5GZOD 2V9QA 1G9NL 1WTLA 4ZOCA 4ONGH 1C08A 1C5DA 1QLEH 4OLWH 1HSAA 1IL1B 4PJ7E 5C08B 1O7SA 4NUJB 3ULUF 4LCWE 3C09C 4S1DC 3X13A 5J6HB 1FL6B 1REIA 3LPWA 4YEEA 5E1AB 4ALAL 2EYTA 2WBJB 4NNPH 1MJUH 3RBSA 4YXLH 3I02B 5ICYB 5CBEB 5F1IA 3P4MB 4GG6E 1SM3L 4GRWE 4PJDF 1KPUA 4GXUN 1T0PB 5E5MB 4UOW1 4XBPB 1F4XH 5F88A 1CFVL 1JNLL 1NLDH 2W0LA 1F3RB 3TPKA 1KNOA 2YBRB 3B6SB 4M7JH 5IHBA 1MCLA 4PJIE 3LIZL 1U0QA 4ZMAT 3FQXB 2X9YA 3CVHA 4QCIB 1S9WB 3CJJA 3GKZA 5KJRH 3BFOA 3MUZ1 2P7TA 2H3NA 4IMLB 2A0LD 3KPOA 3BPOB 1ORSB 2FIRT 5K93A 1U92B 3C5ZD 5C0AE 3CFEB 3QO1B 3DO7A 5JIPA 1N6VA 2YD3A 1UYWL 2VLME 4HFUL 2DS4A 4POZD 1OP3H 4GKNA 4ODXA 3NGBC 4XZUA 3BVNB 4Y4KB 1CL7I 4LLYB 4IM8A 4I48B 4KUCD 2C3VA 4DKDC 4EUPB 4P3CH 3TV3L 5E4EB 1IGCL 4BYHA 2ZKHH 1A7PH 5IBLD 4PFEA 2IG2L 4H20H 4K8RC 3T2PA 5L2KA 5ADPL 4CMMB 3W2DH 5EZJA 1G1YA 5T1LD 3QWOB 3MV8E 2DQEH 4NQXA 1KIQA 1FZOB 1MFEH 5GS3A 4EN3A 3O6ML 1JIBA 1KPVA 1KJ2A 4M7KL 3VD7A 2FR4A 2A6IA 1I8MB 1MWAB 2GSIB 2PTUA 1RVFH 3MFFA 5KAQG 4OCXH 3T4YB 3U2SA 1NAKH 3C5JA 5E56A 4YHZL 1E4WH 3VRJB 3MXVL 4A6YH 5MEQB 2I27N 5EULV 2WUCH 3CU7A 3WUWB 2LTQC 4ZSOA 1SJHA 3K2UH 1K2DB 2R9HD 5F1SA 4LF3A 4XCFH 3S6CA 2ZG3A 4RZCB 4NFBA 5GS1B 3FHQA 4K7FB 2PETA 4X4XA 1J18A 3O4OC 2NX5B 5BV7L 3JBG7 4G8EA 4O02L 1WSST 1JWSA 1M7DB 2YK1L 1FZKB 1I9IL 4ZS7L 1TZIB 3EHBD 2AXHA 2HFEA 1S7XB 3GK8H 4MJIE 1FVDA 1T0MB 3C08L 4NHUA 1EEYA 1S7UA 4WHTA 1S9YA 3QIWD 1KCSL 4JFYB 2IFFH 1JZ2A 1SMOA 5EA0H 5IV2B 4FTVA 3TYGH 1IGML 2CQVA 2I60H 5BZWB 4EQ3A 3MRNB 4HX1A 3UCRA 4BA8A 1FGNH 5I74B 1Q72H 1ZLWK 3KPTA 1EX0A 2PYFB 3O45A 3BUTA 4DN3H 4YHPB 2FJFA 2AJSH 4MNQE 4Q58C 4IRJA 3Q0HA 4P3WA 4YWGH 3F62A 1ZWIA 4X7EC 2QADC 4EOWH 3VWJC 1BZ7B 5J06A 1F6LL 5DWUH 4ZFGL 4B53A 5T3XE 4IEFB 1S7SB 3RGVC 4KZEL 1KULA 2EDDA 2ENYA 3U4EB 1RZFL 3VXOA 3F7RA 5HPMA 2IQAA 2XZCL 5JW3L 4KHTL 4ZFOA 3RIAF 3IFNH 3MRKB 4LVNB 4PV8A 1JE6A 5CJQL 2J8HA 2DLFH 3LSOA 3FT2A 2DD8L 3ZKND 5IVZA 5J1TC 4K2UH 2OQJA 1MVFA 2EIZB 4QRQA 2CSPA 4WI4A 4Z7VF 4L4JA 4XWGL 5IMMA 3I2CL 2H6PA 1FQ9C 4RMVA 2DQFA 2EXWD 4LFHG 4M00A 2HJLA 4RAHA 1CTOA 3IRZA 2F54A 4G6AC 1AHWC 3SDAD 4X4MA 1NAMA 1QEWB 1OAXH 4L4TE 2M1KA 3O9WC 1TFHA 1G0YR 3W11C 1XIWB 5K33A 1RUAL 3UTTB 2OM5A 5EUKA 5ICXA 2JIXB 3BD5A 3NZHL 3EYVA 1HYSD 3TWCL 1HNGA 3BKMH 4U2ZA 5D7IF 1QZ1A 3BHBB 3V6OC 4LASL 5E08L 2RFXB 3IVKB 1C16B 1TQCC 1OCWH 3GJFB 5EU5B 4MAUL 1H3XA 5A43C 2ZUSA 3SKMA 2EDEA 3O3AA 3PWLB 2NW2A 1VFAB 3S36X 4RSVA 1Y6KR 5CEZD 4Q6IB 3JVGC 1J05B 1WBXA 3PHQA 3VGGA 1J0YA 4QHLB 3T2NH 5EU6E 4OGXH 1CZ8L 3FCTA 2OJEB 1Z0MA 2JK5A 5C7XH 2DQDH 3H42H 4M6ML 4R4FH 2V2TB 4PRIE 1S7VA 4R96A 4U1KA 5D7KD 3Q3GA 5DJ6B 1C7TA 2W1NA 4IRJD 4WUKL 3MZTA 4K3JL 4OF3A 2BERA 2KL6A 4G6KL 4K3EL 2F5AH 3SGEI 3THMH 4NZUL 1C8PA 3DUUB 1EGJL 3SJVD 5BRZA 3JWDL 3B3IA 3P11L 2EKSB 1TPXC 3ARGB 3B9AA 5DEFB 3UO1H 3VE0B 5L88H 4RGNC 4PGCA 1UENA 4WJ5B 1ZLVH 5E2WH 2CGRL 3KS0H 1S7TB 1Q9KB 4IRSA 1JJUA 4ELKA 4Y5XA 2XXCB 1RFDL 1T83C 4MA8L 5FUOL 5C6TL 4KMQA 1H5BC 5DHYA 2B4CL 4RDQF 3IFLL 2VLKE 1YMME 5HI4D 3CDGA 3UJIL 1NCNA 2N7AA 1U8MA 2HAZA 2OTUB 3EOBB 1IGTB 3VH8A 3NA9H 4NKOB 2YD6A 4BUHA 1T4KA 4JPIB 4XCCL 3M8OH 1YPZA 3N85L 4NQSA 2J12B 4NO0A 1N3NA 3QNYB 1AD9B 3BN3B 5E8PA 3V7AE 5IFAL 4W68A 2AQ1A 4XGZA 3RNKB 5ABDE 2C1PB 4QRSA 1C5CL 3TBWB 2IH3A 4HKBB 3K46A 4Y2OA 1GC1L 3MRLA 2WQRA 2FO1A 2IBBA 1A2YB 3BW9A 3PABB 4P2OC 2DQCL 4JVPA 4ONHB 4E41E 4APQC 2FECI 2NY6B 4RQQA 1LE5A 3U6RA 4TULH 4XNYH 3QUYD 2QR0A 3GJEB 1BREA 5C0CB 4JRYB 3X14B 3EO1A 5DEGB 1X5IA 4F15B 3VD9A 2BK8A 4KQ4L 3BE1H 3UAJD 1T0NA 1UXWA 1T66D 4LMQE 5F21B 3SQBA 4NPYA 1RIUL 4WUUD 1MH5B 3MRQB 2J1KA 4ZYKB 4L9LA 2A74B 4HWZB 1QSEB 1AI1H 6FABL 5FM5O 1YJDL 5D2NA 1GHFH 4QYOB 3KPSE 2W9EH 3KDMB 3SE4A 3T3ME 2OSLB 4FA8A 4L8CA 4X6CF 1EZVX 2MPAL 3GMPA 1V7MH 2CDFA 4ZAKC 4P2RB 1KGCE 2DJUA 4TVPD 1PD6A 4NWTL 1OW0A 4HJGA 4IRSD 3D69B 3TIDB 1HHHB 3DXAB 3RVUC 5FO7A 4MAYC 4QHNA 1QR1B 1M05B 3CVHH 1EUUA 2ZUXA 3D2UA 5IVXF 5HY9B 4YIQA 3REVB 3IU4L 2C3GA 3IF1A 1ZEAL 5M94B 2VDPL 3DX7A 5D72H 3G6JA 4K71C 4OZ4A 3TPUB 1A4KB 3GMNA 2W0KA 2NY1C 4NO3B 4MJ2A 5FGBC 2DDQH 4Q9QL 3WFDL 3F58H 4LCYA 3EJYC 4KKBC 4NO0D 1CQYA 1K6QH 1U58B 3VFGH 5DO2C 3DVIA 2VXQL 5LGHH 4X9HA 2IANA 1T1YB 1J0JA 2YMXL 43C9B 3EW3B 4PBVC 3DX8B 4LQFH 2YRZA 4UNUA 2KZ1B 4GW5B 1MJJB 1PG7X 4DKEH 1INDL 1NCWL 4JAMB 2P5WA 1LO5B 5ENWA 1QLRA 3TT1L 5CD3A 1KJ2H 1YEIH 5D7JA 1N0XL 3EYFA 1W0VB 5JIIA 1DZBA 5B4MC 1LWRA 4X98B 1Z9LA 3O6LH 4JFPA 4LSSH 4OF6A 4U1MA 4IIQB 3J8F7 4OLXH 5JW4R 3PV6A 3LRGA 3LY6A 3ARRA 4CU6A 4EI5B 5ESQB 3ZYOA 4HG4K 5KSBB 5JDJA 3IETB 4MDIA 3BGFC 3PWNA 3WXVH 1TETH 1AXSB 4CRPA 3H9SB 2H26A 4MQXC 5DR5L 1XF2A 2ZUYA 4Y1AE 1QSVA 2Z35B 5INCB 1CE6A 3BJ91 4M8VA 1P4BL 4XMLH 5GXBB 5ALBH 1X6LA 2IGFH 1SYVB 2VLJD 2YA0A 4KQ3L 4R7NA 4WFGD 1ND0B 2XIDA 5F9DC 4WV1C 3U0TB 3HAEB 3PHOA 4OI8A 4I0PC 4FMFA 3DX6A 1EHLH 1YEHH 3DYOA 1DBJH 4Y19A 1XGTA 4JFXA 1KEGL 1CFTA 1JWUA 5CEZH 4GXVL 4LEOA 3HAEG 3D2UD 4GFTB 2Y07H 1YN6B 3T1WA 4YEFA 1UWGH 1MIEH 12E8L 4PGBB 2NY4D 3OB0K 1OGAD 2HRLA 1MVUB 3OJVC 1OWRM 3DVFA 3RU8H 5T5NF 3V6FA 4OLZH 2IQ9L 2X4OB 2DYPA 3C8KB 4YHKL 1FGVL 1AY1L 4QT5B 2ESVA 5L2JA 1NMCB 1KSRA 3RIAK 5GZOC 5KW9L 1CK0L 1QTYT 4JG0L 3JV4A 1B4JL 4HGWA 1JRHL 4WUUB 3A6BH 2H41A 2R39A 3PNWA 4XB7A 5JDSA 3QI9B 4NHCH 4UV4L 4ZUUA 3QDGE 1OAUH 4M7ZB 3CSYA 3S35H 2EDBA 4PG9A 5ETUB 3FO0H 1JGDB 4W81A 2HKHL 5GHWL 2ZCHL 5E70A 3VFOA 2DQUH 5C0DA 1MQKH 3TZVC 1I7UA 1GAFL 5D7JD 1MCOL 1AJ7L 1W8NA 3MACL 3MV11 2Y5EA 1TDQA 3P9MB 5F1KC 5CLTA 4U33A 3V6OE 2WBWB 2D3VA 3OBAA 5I0ZA 1WLHA 1OP5H 3MRGB 1NGXA 1EXUA 2P48B 4QO1A 4GAYA 3SDXB 5GRXG 1AGBA 1NAMH 4HMCA 3H9ZA 4YHIA 4GUPA 2VXVL 3NH7H 4U6YB 1XR9A 5GS0D 5D2LA 4H8WL 5ISZE 4LHUB 3PJSB 5IFJB 3HC4H 1A7NL 4UV7H 4I3SL 3KXFD 1CGXA 4U6XB 3TBSA 3O6KL 1GIGH 1HDMA 1UM5H 4YE4L 2C4FU 4XAKE 5DEZA 2ATKA 4PRPA 4Y19D 1ZVSB 5T1KD 4L8BA 5CILH 3BP7B 3QH3B 4LHUG 2CK2A 5C0BE 5F89A 1JGEB 5SWZD 3AM8A 3D39E 4NDMA 5TGBA 3G5XB 5IHLB 1H0DA 3OAYK 1AR1C 5IBLC 3WHXB 3BAEH 5GISL 1OQOA 5I1CL 3TCLA 2H9GA 1OSPH 3SDDC 1I3VA 5C86A 5HVGB 4GRLB 1QSFD 4PREA 4DGIL 3KYNB 2EH8H 4ELMA 5IEHA 3VXRB 5H2BA 1EJOL 1PFCA 3LKPB 2P47B 2XWTA 2CR6A 3EFDL 3KGRA 4MCZB 4O2CB 4Z78B 3GSNB 3IFPA 4GMTL 5EO1B 1J1XL 5BCAA 4JZNA 4HV8B 4PJXA 5KS9F 3BIKB 3SE3A 1TVHA 2NQCA 1DQDL 5FHAL 3R8QA 3V9FA 5E0QA 4O2FB 5LXGL 2VDMH 1NKOA 2AJUL 2W60B 3KPNB 1A3LH 5CGTA 1P5VA 4F7TA 1ZHNA 2IPKB 2PTVA 3D1MC 3RHWK 1DUZA 2HH0L 3QA3A 2DI8A 3GSXB 3MLZL 4M61A 4ESKA 4XPFH 3T0VA 3RWCB 1WFNA 5A2FA 5I1LB 4LGRB 1BEYH 1TXKA 1GZPA 3NIFE 4WW1A 1YYML 4JGJA 4JFZL 3DV4A 5DMGD 3D9AH 3DO3A 1QA9B 1F6FB 4ENED 3P73B 5DI8B 4PJFE 5HGDA 1GYAA 5D7LB 3HZVA 1LO3H 1QRNA 4QRUB 5EUOE 1OGAB 1NGPL 2MQ3A 5DD6B 4LVOC 3TVMB 4GBXB 5F7DB 2L0DA 4YLQT 3O4LB 2F74A 3GMOA 1ADQA 4MVBD 4TNWF 5C0JA 4WO4B 1SBSH 4JFOA 3HHRB 4HCRL 1FDLH 4MXWL 4YUEL 1U42A 5DSCB 4P46B 1R6VA 4JLRB 3KR3L 2X44D 4QRPA 3EOTL 3STLA 5L7XL 2BFVH 3AMKA 1FYTB 5BZDB 1UM6L 5GGVL 4QOKE 5ANMA 1J9CT 3CD4A 1F4YL 3E1F1 5D8JH 1RUKH 4DZ8B 3ME0A 3SGDI 1G6RB 4HKZA 1CR9H 3VXQB 3V4VH 3TEUA 4LIQL 1EHNA 5JPMB 2HJFA 3EYSL 5I1HH 2JJSA 3SGEH 4ZPVB 4Z5RB 1JK8A 4LLQA 4Y5YA 1LO2H 5JXAH 5LGKA 5FECB 3IJYB 2IC2A 3GSOA 1X5GA 1OPGH 3KPQA 1RJZB 4EN3C 3QJHA 4NOFA 1H8OA 2Y72A 3GNML 5DK2B 5EU3B 1Q8MA 3CIQA 5EFIB 1U8OA 5FA4A 5A16A 1F00I 4YH6A 5C0ND 1GOGA 3ZKMD 1YNKL 1EAJA 3MO1A 4H0IA 5JMOC 4L4VA 5FYJH 1W2KT 2CLVB 2F53D 4GQ9H 3ALPA 5AD0B 1JPTH 2NY5L 4Z7UB 3GSUB 2D31B 4AYFA 5HVHB 4O5LH 3QISA 1ZLUK 4RGMC 4NUJA 3TJEH 1FL3A 2D7TH 3UYRL 2B39A 4GKOA 5E1AA 2UZIL 1HYSC 2WBJA 3U0PB 3O8XD 4K7PY 5DD0H 5HYSB 2R8SH 4RX4D 3NIDE 4NRXB 4NRYB 2NYYC 3UBXB 3P3YA 3I02A 5ICYA 5I1EL 3RDTA 1P9MA 4JFHD 4WW2F 4HQQH 6CGTA 2EEDA 4JDVB 1A6TB 5E5MA 5LAXB 3BD4A 1RJLA 1VGEL 1JGLL 1FNHA 3DROB 5HYSG 3QXUA 4FG6D 2YOCA 1TLKA 3OJDB 3UBXG 4TRPH 3CC5A 5BXFB 4OD1L 3MA9H 2XFXB 4R2GD 1D5XA 2HP4A 4NM8L 5J1AA 2AS5M 1MREH 5I76B 2YBRA 1CIDA 1N64L 1JF6A 1NFDB 2BX5A 2D2OA 1MI5D 4JM4H 4QRPD 2YPLD 4IRJC 5D1ZB 5IQ7L 4U0QB 1J8HE 2BRRL 1S9WA 3GI9H 3NPSB 3I9GH 4LSPL 4HXBL 4OFIA 1YN7B 4ODVH 1ORSA 5F9OH 1RVFL 1U92A 2DJ4A 2WMPA 3DGGA 3EOAA 4PJHF 4PJ5E 4NN6B 4H5SA 3I3BA 1CLOH 5GS0H 2B20A 3BVNA 3H3BC 2DKMA 2CKBB 3CFCH 2J4WH 2HT3D 1A7OL 4I48A 3TFKD 2CJUL 4XVUC 2YD5A 1JTPA 4M8QB 5HI4C 5L6YH 1FG9C 4ZO8A 4V2CB 2VRAA 2Z31B 5HYJA 4CNIA 1MUJB 3UYPA 5GGTA 4MA7L 4GO6B 3G04B 1XGUB 4U6TA 4O51B 3UTZB 3PWPD 5MENB 1MHCA 3QWOA 4X6EB 3O6FA 1FZOA 2CRZA 1LDPL 2APVA 2P44B 4HJJH 4XP1H 3FQUB 4L4VD 2JJUA 4PGEB 4WIQA 3NAAH 5FKPB 1I8MA 2GSIA 1AFVL 1KBGL 1PEWA 4C54A 2QBWA 5LG1A 3HPLB 4NC2B 2QQNL 3RGHA 5I9QC 3AGVA 4LCIH 3B9KA 1NSNH 3C60B 4JZJB 3GHBL 1B6UA 1VKXB 1NJ9B 1EVTC 1UH4A 1WICA 1I3GL 5B21A 5ADOL 5MEQA 4MCYA 5DRZB 5C2BH 2SEBA 35C8H 4RMWA 1BD2B 1I9RL 3MR9B 3NCFB 3RDTD 2DQGL 2G9HA 2VTFA 2I9LB 4PJEE 1KYOK 1CICB 1DQJB 3MRCB 4K7FA 4TN9A 3VDCA 2NX5A 3P9LB 1HIMH 1TZIA 2ZP0T 4PR5B 4TPRL 4HS6A 5H37H 1KTRL 3BX7C 1S7XA 4XPBL 2EDLA 1T0MA 5DD5L 4AIXA 5DF0A 3HS0B 2ADFL 4JFYA 2PN5A 5E5UB 4U6VL 4OKDA 2JJTA 4U2YA 3KPPB 4MNGE 5IV2A 2Q7NA 4G9DB 3HNTL 4LPYA 5DJ0B 3MRNA 2AABL 4PP1D 4M9PA 2HT2C 3ZTJH 4CN6A 1U3ZA 5I8OH 3TN0B 4FQJH 4P9MH 2BNQA 2FJHA 4OBRA 3QHTC 5IB3B 2PYFA 5KG9A 2X2YA 5E6YA 1EERB 3HCVA 4PV9B 3OKOB 4IRSC 5BVJB 4Y5XC 4K3DL 5AEAA 1S8DB 5BQ7A 1U8IB 1WUNT 3O8XB 4JN1H 4LSRL 2R2HB 3X11B 5CUSL 1MRDH 2YPVH 2UWEB 3U4EA 3KJ4B 1A9BB 5HYJD 5D1XB 1JGVL 3P4NA 3VG0H 5TF1H 4DTGL 2LABA 4XMPH 2B1AH 3SCMA 3QXVA 1I3UA 1IGIH 5DZOA 2J88H 3LHPH 4WDIB 3L6FB 1RU9L 3GMLB 3U30C 3B9KD 2UYLB 4LLMA 1VB9A 2E6PA 1GRWA 3KAAA 1DBBL 1NCAL 1IJ9A 4JZOB 2I9TA 1UKTA 1VPOH 4KTDH 1QEWA 5T1DL 1FHGA 4JO4L 3F7PC 1IAKB 1OQXA 4UB0L 5ALCH 1XIWA 4D94A 2EE3A 4JJ5B 2OI9C 3UTTA 5FUCC 1J1PL 3U9PH 3V4PL 1AXIB 3ETBF 4XTRC 1QBBA 4YHYC 3QYCA 3QBTB 5EC1B 3VXMA 3WFHB 1R5IA 1PEZA 2RFXA 1HKLH 3IVKA 1AGEA 4K9EH 4QY8B 5ESVB 2FBJH 1P4IH 3PQYB 4JDZB 1HINL 1YEEH 4LLUA 3PWLA 1IC5L 1OARH 3LPGA 2DICA 5D2NC 5HHQA 1KLUA 2R23A 1RMFH 2MCPH 4FQ2L 2YKLH 4HH9B 3VGEA 5IVOA 3ZSTA 1OHQA 4QHLA 3SE4C 1F4AA 1Q9OB 2BVYA 3PWPB 2FZ3B 2Y7QB 4UNTA 2BNQD 2GI7A 2OJEA 3P4OA 4IOFD 4YHLL 4PY8I 4M43H 2V2TA 3BT2L 2AEPL 1U3HA 4PJDB 1YEDB 4PJAB 2C3HA 1BQLL 3F7VB 4Y4FB 1OW0C 1ACYL 1NGYA 1DSFH 3ZMRA 1F8TH 4DFHA 4NWUL 1IM9A 2EKSA 1MFDH 4KXZI 4WI5A 3ARGA 5E6IA 5F7KC 5DEFA 4WJ5A 4CMHB 5FKAB 3WO3B 1S7TA 1Q9KA 3L3KA 2XYCA 4YDIH 4RMRA 4TSCL 3OG4B 1DQQB 1Q9LB 4J12A 3FHAA 1J0ZA 4JB9H 5DS8A 4KH2A 4P2YA 4UAOB 2R29H 1WVZA 4HPYH 2NTFB 3MRDA 2X4SB 3GI8L 3UEZA 4JVWA 4HWEH 1QHPA 3RWFB 2OTUA 4DGYH 3EOBA 1ONQB 3L7EB 3RL2B 2WIIA 2DQJL 5L0QC 4NKOA 4KGLA 4NQCB 1LGVA 1I1AB 3EDDA 5CSBA 2C26A 5IF0A 3D87B 4ZD3L 4J3UA 5TFSH 2ZPKH 1A9EB 4D3CL 1AD9A 3BPNB 3IAGC 1WIOA 5HSFA 4G9FB 3IDMB 2R4RL 3MJ6A 4U7MA 1KIRB 3LZFH 1I7ZB 4QXTB 5ITBH 2F5BL 1BFOB 3IFOA 3MA7A 2ZUQC 4JFDD 2Z91A 1M7IA 1AI1L 3QZWB 3ROOB 2ID5A 5D7JC 3VW3H 3WKML 3TBWA 1R3JB 3S9DB 3N1GC 4HKBA 5ILTH 3VXMD 4F8TA 3WLWD 1PSKH 3PABA 2HLAB 1GGUA 4F57L 4Y5VC 8FABB 3QZWG 1J86A 1SYSB 1L0QA 5BO1H 3BO8B 43CAB 1XEDA 5C0CA 5CEZE 4RMSA 4XVSL 5GS0C 2QHRL 1NCBL 4OD2B 1OAKH 3LS5L 3PGDB 3ECBA 3IGAA 3B8SA 3B5HA 5J12C 3VI4F 3VGAB 3A67H 1TIUA 3IDXL 1KXQE 1BQUA 4OCSL 1MH5A 1FVCB 5D7KE 3P9WB 4ZYKA 2A74A 4HIXH 1U3HD 3HB3C 2HJKB 2VXTL 4YC2C 3SJVE 3F12B 3KDMA 4NBXB 1XAUA 1MNUH 1T1XA 2X4PB 3K8KA 3L5WA 2AV1B 1IM9D 2FEDD 1OM3L 4N0UB 2I26N 4OGYH 5E6ID 4F37K 4P2RA 3HI6H 4PUBH 4LAQL 4Z7QF 2YUVA 4TUKH 1FFNA 5LGHL 5C71A 3WFZA 1VA9A 3D69A 5C92A 5C09D 2I5YL 3TIDA 5SX5K 3DXAA 3GDBA 4WY7L 5FUZL 5K9QG 1M05A 4OLUH 5HY9A 3REVA 5JA9A 2BSTB 3U46A 2VDLL 2W65B 4QKXB 3ZKSD 4HUVA 3DWTA 4OI7A 2EDFA 5DT1L 5BS0B 1A4KA 4KDTA 3DOSA 3QQ4B 1BJMA 5DJDA 1NMAH 1QFPA 1ZA3B 2J8UA 3C2AL 1F5WA 1SY6A 4YK4B 4ZOEA 1NMBH 1T1YA 1TETL 3GB7B 2R0KL 1GGTA 3CX5K 2OYPA 3B2UD 4ODTL 4R97C 3T08A 4XX1G 3QG6A 3A6CL 5GGTH 4KKLD 4M1DH 4GW5A 3WFCL 1MJJA 1FJ1A 1LO5A 1BBDH 3MLPA 1MCFA 3S4SG 4RAVB 4ENEC 3VWKD 4Z7VB 2D03L 4IHOA 2CMRH 4J8RB 2VDOH 3FQNB 2XWJA 1EHLL 5TE4L 1YEHL 2FSEB 4X98A 4LCCA 5HGHA 2VDRH 4UZGA 4Z7OF 3WIIL 32C2B 4EI5A 2QSCH 1JHTB 4WUUE 2B1HH 4WRLA 3IETA 3IDUA 4CN4A 3O81A 3N1QC 3RI5K 1NGQL 3JV0A 4CVUA 3RU8L 4CUCA 2R2BB 1CBVH 3PWUB 1T20A 5I1IL 4HUUA 4MLSA 4GW1A 1HWGB 1ZXQA 1U8QB 1CL7L 2HLFD 5D7IB 5IW1B 3MBEB 1SYVA 1I7TB 4TVPE 3OF6A 2OL3A 3U0TA 3HAEA 2C4FT 5D96B 1AC0A 3AM8C 2A73B 1QOKA 3RWIB 5FO8A 1MCDA 3AREA 5E8DH 1UACL 3PUCA 3O3DB 4BSVB 4NQED 1F2QA 2AI0L 4JREB 4L8SA 4M5YH 4QHMB 4ZFOL 5MERA 3QIUA 1KTLB 1BFTA 4R0LA 3E2HC 3KWWB 5EZOH 4MJ6B 5J6GB 3RZCD 5E5RB 3BRGC 3MJ9L 3BDYL 4JR9H 3WNLA 3TLRA 4M6NL 1YN6A 5KSUB 1S78D 2DQUL 4PGBA 3NCMA 4WU5B 5DGQA 3BJLA 4M48L 5DMJB 1OD7A 5C0NC 4LEXL 3HE7D 1W72B 4Z95H 5D1QB 3LKRA 3SE3C 4QT5A 3ULVH 2CDGB 2BSSA 1XF5B 2VZOA 3MUJA 1OY3B 4K9EC 1CD1A 3P2TA 5HGGS 3MV7B 3G9VA 3QDMD 1M6OB 4XPHL 4M1CD 3MJ8B 2FL5A 1TQBC 1D6VL 5GZND 1U8PA 2DN7A 4KTYA 3U9UB 3LKNB 4PJBF 3GFUA 1NBYA 3SKJL 4U1GB 2CR3A 2Y06L 1HI6B 1RSFA 1HYRC 1W0WB 3JWNC 3ARYA 4DVBB 1QBML 1NFAA 1A0QL 1TCMA 4NZTL 1RULL 4KDWA 5E8EB 5DUPH 2P24A 4NN5B 4FG6C 4LVHC 2PYEB 1NLBH 3H7LA 1SMAA 1DDHB 3D25A 2OXGA 1OD9A 2NY2C 3FMGH 4FQLH 3SDXA 1AE6H 1P4LB 1AGDB 4JPWH 4N0YH 1D5ZA 3CVIL 1ZE3C 1HOCA 4G6JH 4U6YA 4O4YH 4RFEB 4UILH 5J13B 3MQIA 3AAZA 4G8GA 5JUEL 4V1DD 3U4BL 3VFSB 3U36A 1S7WB 4YXKL 5LQBL 5GJSL 2VLJE 4PJGF 4WI3A 2EDKA 2XTJC 2ZUWA 4LHUA 3PJSA 5IFJA 4AT6B 3OF6D 5CP3A 3NTCL 2PO6A 3ARED 4NN7C 5FDYA 1TNMA 5KZCB 1LE9A 3O11A 1MJ8L 5I1JL 5JLZB 2EZ0D 5TE6H 3JZ7A 1H3PH 2JJSC 3DMMD 3QIUD 1BAFH 4Y5YC 5CMAB 3W39A 4ORGA 3IXAB 4NO5B 1Z2KA 3S36H 4MA3B 2VDML 3OQ3B 2HT3C 5IIEB 1I7RA 1OGAE 1JGEA 1ZA6B 2FB4H 2VDQL 2CDEB 2GJ6B 3BSZH 2XZQL 4KRPD 4UT9H 3WHXA 4DQOL 1GZQA 2E27H 1HHGA 4XPAH 1RIHL 4GMSH 1S3KL 2J3SA 4N9OB 5C70A 4F7CA 5DUBA 4GRLA 5HDBE 1XCQA 3M07A 4L3EB 3KYNA 3KLHD 1OGTB 3D9AL 2E7BA 2IH1B 3EDKA 2NCMA 4HWBL 4LAJH 1MFAL 4P4KD 2WWMC 3WS6A 1HXYB 2GCYB 2X9WA 3PP4H 5AWNH 4I77H 4OQ1A 1I1CA 1U8KB 4H25B 4OUUA 4MCZA 4JPKH 4J6RH 4Z78A 4KVCL 4AM0A 3GSNA 1FRGH 4YDJB 3BWAA 2X42A 4KJWD 1EO8H 2R56H 1X5HA 5K9OB 3CH8A 4XBGB 4OFYA 2Y6SD 2WBJC 1A6UH 5IVXB 2HN7A 4FZEL 3S3JA 1A4JA 3RDTC 1P9MC 1EEUA 2RCSL 5I1LA 4Y2DA 3RWCA 4Z7WB 3OHXB 2R2CA 3JV5A 4Z76A 1IVLA 1IC4H 2COQA 5HGBB 3RTQB 5D7LA 3DI2B 3GO1L 1Q0YH 5HGAA 1FNLA 4QRUA 4AL8L 4G8GD 3VFTA 5I1HL 3TVMA 4F3FB 3DX9B 3O0RL 3HLAB 2BSED 3X3GL 1MAML 2JELH 3KHQA 3L3DA 4PRDB 3VFVA 3WO4B 3KXFE 5A2KH 3QHZH 1L9MA 4OZHF 2PO6D 5DMIH 2JLLA 3BPOC 3TNNB 4IRZL 2NR6D 3GSVA 2FD6L 4Y19E 4P46A 4JLRA 4PD4K 4XPTH 4D9RE 3V5HB 4YHML 2YN3A 5GJTL 3GSRA 4XVTL 3L3OA 3GRWH 1FYTA 2V9TA 4XBEH 5BZDA 3BZEB 2QKIB 1WITA 5SWZE 4DZ8A 1JPGA 4E42B 4I3RH 4OCYH 1I1FA 1G6RA 1UH3A 3U7WH 5E4EC 2AGJL 3VXQA 1YMHB 5DFWH 3G08B 1BJ1H 3SDYH 1I85A 4UOW0 3MLRH 4ZPVA 1QSFE 3MLUL 4PRBA 2M2DA 1BZQK 1TCRB 2D7NA 3IJYA 3O6FC 4KXZH 1HXMA 5B3JF 1UQSB 4HUWA 5SV4A 4OJFL 1HQ4B 4NIKB 5EU3A 1CGSL 2DMKA 1FVEB 2YRPA 3DURB 5M7QA 3MX0A 1BHGA 2BVTA 4HT1H 3QFDB 4D2NA 5I2IB 3B9KC 4LPCA 4EKXA 2EDTA 4KPHH 2BVEA 3ZDZE 4HIIB 2IAMD 4JFQA 1XMWA 2NY7H 1XR8B 2CLVA 3QUZB 4CAGA 2FECL 4UINL 3T0EB 4JO1H 4OLYH 4FXLA 1NC4B 1ZSDA 2FJGA 4Z7UA 3GSUA 4Q6YA 4QF1B 1X5YA 4Y2DD 1OAZH 3ZHKA 4KI5D 2QV2A 3DRTB 1LK2A 1ROWA 3U0PA 4TNVK 5HYSA 2CD0A 1KJ3L 4NRXA 4NRYA 4H88H 2X70B 3UBXA 2HTKD 4NJ9H 1MJ7H 5IB1A 1GGCL 1SY6H 3ZE2F 1U95B 4C56A 1FC2D 1DBMH 5FGSA 5LAXA 2JJTC 2VQ1B 1ORQA 4HKXA 5IOPB 5HHOD 1CLOL 3BGAA 2J4WL 4BFEA 3MNZA 2X4QB 4JO2L 2GSGB 2OJZL 1FO0L 4P4KB 4H0HB 5I74C 4IOFC 1PG7H 4RNRB 1VFBA 3KPRB 2F19H 4JQVA 3O3BA 1T04A 1A6WL 3V5KB 3ULVC 2DKUA 1FNFA 3EOYG 3P77B 4O2EB 4KDVA 4ODSH 3VXSA 1OAQL 1D7FA 1YN7A 3NAAL 1WFOA 1RZJH 1MRFL 4NNXA 3V52L 5C0RL 4YX2L 4Y16B 5HD8D 4Q0XL 1RUPL 1BBJB 3SOBH 4ELME 1RIVL 1DQML 5IB4A 5IHUL 4JHAL 5EOCL 4YDKL 2CKBA 5LWYH 5EUOF 3CXDL 3G6AB 4FXGB 5KVEH 3SCMC 3BQUB 3DLQR 2EIEA 3HFMH 1XF3B 4M8QA 5HHMB 1IFHH 3GIZH 3BYYA 3SY0A 2OL3H 1IC7H 3VA2C 3HAEH 5HVFB 2GJJA 3QDAA 4DGVL 4EVNB 4X6DA 5FGCB 2F15A 3G04A 3BEWA 3WFEL 5DVNA 2OXHA 5MENA 4K07A 4X6EA 2F53E 3HMXL 4UT6L 4YAQB 3FQUA 4PGEA 3OXSB 1Z9SA 1AKJB 5FKPA 3T0BA 2P5EB 2W9DL 1XFPA 1F11B 1IQWL 4IS6B 1XIWC 3GSQB 1X5AA 1P1ZA 3ZYZA 1VKXA 2MOVA 4XP9H 5IBUB 3TF7C 5GS2D 2DQTH 3QEGL 1IT9H 3WLWC 1G6VK 3OKNA 2UWEE 1BD2A 3CFKB 5IM7B 4JFHE 5EBLB 4FQIH 1DQJA 2Y36L 1DBAH 3MRCA 3PGFH 5JO5A 4JY5L 4YQXH 1K4CB 4C56D 1IM3B 5TQ2H 1ZAGA 4V2BA 1K85A 5KS9B 1Q94A 3WSQH 25C8L 4PR5A 2D0GA 1PKOA 4X7TB 4GAJH 5IFHH 3MV9D 4DN4H 5KVFH 1CLZH 1TVDA 3P0VL 4KKNA 5DURD 1KCUL 3HS0A 4G5ZH 1MI5E 4RMUA 1ZGLM 2Z4QB 4MGXA 2Z8WC 1P7QA 4U1HA 2OR9H 1DN2A 2YPLE 4Q2ZB 2ENSA 1U3HC 2GYSA 3KPPA 4G9DA 3DRQA 5DJ0A 1T2QH 1QD0A 1RZ8B 1OTSD 2LQRA 5D5MF 5CEYB 2EDNA 2FEDC 3ARGC 5E6IC 3M45A 1QFOA 2R15A 3ARFB 4KTEL 4JANB 1YEFH 3OKOA 5BVJA 1H3TA 2DTML 1FIGL 4D8PA 1R3IH 4ZOBA 2BNRB 3LH2H 4YGVA 1U8IA 2DTSA 5FCUL 4P0DA 1G7QB 4R90L 5M95B 3EO0B 3QB7C 4AMKH 3ULUE 2BC4A 5CP3H 5EO0B 5D1XA 3PWPE 1NFKA 1ZVYA 2J5LB 4L4VE 1E6OH 3T0XA 5HHOB 5LGJB 3LKQA 3W0WA 4P9HL 1HWHB 2WK2A 5J0BA 3RNQB 3L6FA 4OT1H 4S1RL 3LV3B 1MCPL 1UVQB 3QDJD 4H1LB 3BPCB 3CZFB 4F9PA 2X41A 1KB5L 1CG9A 2VL5A 3B2UC 3D18B 1YEJL 3S7GA 3C6LB 2MCPL 4RIRB 1FL5B 3DYMA 4KKLC 4R7DB 3QDHA 2XI9A 1FH5H 3F5WB 1SEBB 1N26A 1IAKA 2NY6C 1V3KA 4H1LG 4Z18A 2BOCB 1IKFL 4JJ5A 4JRXB 1W8OA 5F9AC 3TBTA 3TGXA 2OR7A 3OL2A 4X0KA 3WMSA 1TZGH 3HI5H 3OSKA 3QIBB 3TO4B 4JKWA 1ADQL 4XH2B 2MSPA 3VXUD 2IALA 3KYMB 3SPVB 2ZOKA 3VMOA 1EFXA 4NQCE 4I9WD 5HYIA 1MIMH 5FK9A 4OGAC 4PLJD 3HNSL 2D9QB 1P7QD 1K3IA 2JCCE 2YR3A 1G0DA 3UTSD 3LEXB 3STZA 3V79C 2HFFA 5KTEL 1N6QH 1MF2H 1U8JB 2X4NA 5C07A 3V95A 1FE8H 3QULB 4S2SB 2HLFC 2FZ3A 5I6XB 3FO9B 4HPOL 5I1GL 5DVMA 1KEMH 3N1PC 4WW2B 2BXYA 1RV6X 4PJDA 1YEDA 4PJAA 4LSQL 1RHHB 4P57A 3LQZB 3E6HB 4QTIL 2Z8VC 2ICCA 4R3SA 2OK0H 4DWHA 1A6AA 3QFJB 1CF8H 1CFNB 4PJEF 2IF7A 2ZPKL 5DK3A 2VSDA 4EJ1C 5JTWA 4M9OA 1DUYB 2YEZB 3QG7L 5IG7B 2XKNA 1BQHB 3QWRA 5C6WH 1R3LB 2DQHL 5HYJE 2PKDA 2CUMA 1S78C 1V05A 4IDLA 5IMKB 5FKAA 2XTLA 5JQHC 2AJVL 3CPLB 4KDTC 4M5ZL 3M17B 5ILTL 3OG6B 1Q9LA 4HWUA 5DFVD 4HFWA 1EGJA 1N2RA 1GPOL 4KI1A 3W0WD 1BQHG 4WTXA 5IGXL 2GK0B 3CDFA 2NTFA 2X4SA 2EIBA 2R0LL 3RWFA 3F65A 3H3PL 4DEPB 1G6RH 1K5NB 2AK4B 4J3OC 1I1AA 4PJHB 2XA8H 4LLAA 1QKZH 1JNHA 2GHWB 1A9EA 2V5YA 3VG9B 4L5FH 5FYLH 2AXJA 2ZCKH 4G9FA 3IDMA 1SEQH 2HA1A 2Y25A 4QXTA 4QRRA 1BFOA 3SGJA 4FQCL 4HIXL 4ZG1A 3QZWA 3ARVA 2FEEI 4DW2H 4XVJH 1FP5A 4LCCC 4LARH 1E4XH 1MNUL 4ERSL 1TJGH 2XKSA 3QT2A 2HLAA 4FP8H 3ZYIA 5F6HJ 4EI5C 1RZJC 4C57C 1CQKA 1H3WM 5ACMA 1QFUH 1EFXD 8FABA 4YDLC 1SYSA 5MEPA 5JHDD 3BO8A 43CAA 1NBVH 5DMYA 4LLWA 4HWNA 1JPSH 3VFRB 3MFGB 4OD2A 5B38B 5C07D 1LNUB 1LP9E 2BNQE 1KN4L 5GS2H 4MSWB 1N4XH 3WLBB 1XGRB 1A02N 2NXZB 5K9JH 1FVCA 1EK3A 4ZXBB 4CGTA 1SJEB 2FWOB 2IPUK 3AREC 1NDMB 3K74B 2WP3O 1OLLA 2EZ0C 4L8SC 3F12A 3DMMC 3QIUC 1CWVA 2X4PA 3OR6B 4R0LC 3Q5YA 5CIPA 4FFVD 4Z7VE 1P84J 4PB0L 2VABB 1UEYA 2IPTL 4N0UA 4ALAH 1ETZB 4R4BA 3C9NB 3RAJL 1ACZA 4KRPC 5BW7A 5BMFL 5JPNB 4PJ8A 4PB9L 1SM3H 3R06A 3MRHB 1CT8B 3CNKA 4YHOL 1Z9MA 4M1DL 3KLHC 1UWEL 4PJ7B 4G6FB 4ZDHA 2JTDA 1BWMA 1QVOB 2BSTA 3PIQB 1WBZB 4LCWB 4TUJB 1CFVH 1JNLH 4Y0GA 1MWAL 1MHEB 2NXYB 3UTSB 4FQ1L 4DUXA 4I1NB 5JXED 3AMLA 2BDNH 1WZKA 3LIZH 2GTWA 4Y4HB 2Y6SC 4X5WB 5DJYA 4JFDE 3S4SA 4GG8B 3GB7A 3FN0L 1G7PA 3X17A 3VXME 4GW4A 2HVJA 2WUBL 4F8QA 4OUOA 1DN0B 1CLYL 3FQWB 1VDGA 2UY7A 4HFUH 2V7NB 5D93B 1F90L 1HE7A 4NZDA 4CVWA 2VC2L 3DVGB 4J8RA 5DJAB 3TV3H 4A2MA 1Q0XL 5SWQA 1QO3B 1K8DB 2IG2H 3MV01 1SQ2N 3AXLB 5ADPH 3FONB 3Q5OA 3L7FB 5F9JB 1AO7A 3LB6D 1G9EA 3UZEA 3H9HB 1QPPA 1X4YA 1S9VB 5HJ3B 2PO6C 4M7KH 3IDJB 2ERJB 2NR6C 2R2BA 4PJCA 5TH2A 1U8NB 3PWUA 5EH1A 4FFYL 4YZFF 2ILLA 4YHZH 2RBLA 4I5BB 3NZ8A 3CLEL 1O5DT 3MXVH 4NZRL 3MUY1 4N0RA 5EC2B 4XNXL 4E5XB 3SDCD 4MX7A 4XRCB 1G9ML 5CCKL 2A73A 3RWIA 1DQTA 5C09E 2IMNA 3MV8B 4QHMA 3LOWA 3RY4A 4CDGC 4JHZA 5EU4A 3BP4B 2D0FA 5BV7H 1XH3B 4O02H 5KANI 4GRLC 5J6GA 2PCPB 2YK1H 1I9IH 1S5HB 4HHAB 4ZS7H 5IUSA 1HSBB 3BPLC 4KK9C 4HZAA 3NVQA 4UDUA 3WS6C 1ZMYA 4LSTL 3IXTB 5KSUA 1KCVL 3BUYA 3BDBA 3C08H 4Z0XA 2OTPA 1KCSH 2XWBB 2RHEA 4PPTA 1HZHL 2CDGA 2WINB 4Y89A 4M7LL 1XF5A 1JWMA 3GKWL 3MV7A 5KSVB 3T3PF 3RVWD 1E27B 4NM4L 4KV5E 3AU1B 3U9UA 5IJVB 4OZIA 4Y2DC 4MWFB 1LD9B 4MJIB 2W59A 3GSWB 4PJ9D 1LK3L 2K9UA 4KI5C 4RISL 2GJ6E 2DOCA 1OL0A 1PY9A 1PLGL 1KLGB 4DVBA 2ED8A 1P5UA 5CEXA 4YO0A 2HTKC 5SWSA 2AQ3A 3CXHK 4L8DB 4ZFGH 3WNNA 2DBLL 4JKLA 4TSAH 4KZEH 4N90E 5E8EA 4RMTA 3TNMA 1RZFH 3O2WL 2XZCH 5JW3H 3TVMC 4KHTH 4ZUVB 2PYEA 4X6CE 5C0FB 2RR3A 1KTDB 5CJQH 3TT3L 4S1DD 1DDHA 1AO7D 4MNHA 2DD8H 1P4LA 1AGDA 4MNQB 1FFOA 4WWKD 1CDYA 1H8SA 2Q8BL 2Y23A 3BSZL 4RFEA 1NCDL 5KN5A 4XWGH 4P46C 3I2CH 3VFSA 5CZVL 3LMJL 3UDWA 4FQHB 4OM1L 2VE6B 4X4ZA 5HHNB 4PS4H 1R3HB 1ZHLA 2CLZB 1WCBB 3CFJA 3I6KB 3PP4L 3QCVL 3I85A 1AIFA 4NQEE 3OZ9L 5HD8C 1I85C 2VLRD 1RUAH 5E03A 4PRAB 1J5OL 2P8PA 3NN8A 4NP4L 3NZHH 5F8RC 2ZCLL 3IXAA 4NO5A 4MA3A 4MA1C 1M7XA 1V3LA 1JCKA 3TWCH 5IIEA 2VUOA 2ZOLB 2VZUA 4N8VG 1A6UL 1ZA6A 4GOSA 5KSAB 4RGOH 4LASH 1BFSA 4HAFA 3RJQB 5E08H 5DDHB 4MAUH 2EYRB 3QNZB 5MP6L 1NC2B 4HULB 4LDEB 4L4TB 4NFDA 2W9LA 4L3EA 4HF5L 4QRTB 3VGDA 1DCLA 3QDME 2NNAA 4P2CG 1F4HA 2CIIB 1HXYA 2GCYA 4HBQA 1U8KA 1CZ8H 3LQAL 2Z92A 2X4TB 3IDIB 4LL9A 3L3JB 4M6MH 3ARBA 4DCQB 4HGKC 3QEQA 4XBGA 4WUKH 4K3JH 4ZO7A 4G6KH 4K3EH 4NZUH 1EGJH 1PQZB 5SWSD 3JWDH 3P11H 4LDOB 3QHZL 4I18B 4TTDC 3T0DA 4NKMA 4Z7WA 2B8OT 3E8UL 1IEAB 4LNRB 3EGSB 1L6XA 1YA5A 5EU6B 5T3ZD 4POUB 4XHJC 2CGRH 1WISA 3GJFK 1JMXA 3MRMB 3U4AA 1RFDH 3SO5A 4J4PA 4MA8H 3ARZA 5C6TH 1YPZF 5DHVB 4ETQB 2B4CH 3SE8L 3IFLH 1XGPB 5F3BB 4V1DE 3EO9H 3UJIH 1DVFD 1KG0B 4JQVC 2WLZA 4F3FA 2H32B 3FFCD 1NUNB 2OMBA 4NKIL 4KVNH 3HLAA 5INDA 3NPSC 5GRUH 4P2QD 3HA0A 3FB6B 1FN4B 3N85H 3FO2B 2BMKB 2BY3A 3RY5A 3TNNA 3FT4A 5IFAH 4B5EA 3ZT7A 3V5HA 3OXRB 3V5DB 2VLKB 1WWCA 4EBQL 1FG2A 3F7YB 1C5CH 3BZEA 4BH8A 1JFQL 1GC1H 3MNVB 4BZYA 3B4NA 3LDBC 4E42A 1L0XA 2DQCH 3PWVA 5CP7A 1RD6A 2EECA 4HCRA 4OLYL 5E99L 3ALWA 1YMHA 4AEIL 1X5LA 3G08A 1B6DA 4POYA 3W5NA 2PW1A 5I1KL 2H2PC 5EWIL 4AENB 1SVCP 3VXPB 1UQSA 3C09B 3VWJD 1N59B 3H0TB 5CIPH 4PY7B 4W6XB 2A77H 3RGVD 2P8LB 5I2IA 5JW4M 1RIUH 4UTAL 1RURL 3ARBD 4E41B 2N1KA 1D5BA 1QHOA 6FABH 1YJDH 2A9NL 2H1PL 2WIMA 4HIIA 4WTZG 3R0MA 1TENA 3FZUC 3T0EA 5C1MB 3SKUD 2MPAH 2AV7A 1UZ8B 4QF1A 1BVLA 2E9IA 2GFBA 2APTA 3R1GL 3HR5B 1IEBB 1WIUA 4P5KA 5FYKU 3G6JF 3DRTA 4NWTH 1R3KA 4QHKJ 2MKLC 4ODSL 4J4PD 4GAFB 4RFNC 1R24A 2VISA 4G6AD 3OB0H 2V2XA 3KPSB 5FGCE 5HDBF 4G6ML 5TDPA 3O9WD 3IU4H 1K4DB 3QXAB 1ZEAH 2VDPH 2Q3AA 2J8OA 5BV7C 1S7RB 1UB5B 2UUDH 1S9XB 4X9BA 2J6EL 4CW1B 2PTTB 4PGZA 1T22A 1E28B 1T5XB 1FFPA 2FGWL 3FB8B 1ZLSL 2X4QA 5JW5B 2GSGA 3WFDH 4Q9QH 3NGBB 4TOYL 1T1WB 5JW4N 3RRQA 2VYRE 2EIDA 2VXQH 3TM6A 2Q6WA 2R0WL 5IWLA 2P8MB 3TBYA 4F7MB 2YMXH 1FC1A 3OPZL 2PW2A 4O2EA 3H2WA 2NY3D 4JY6A 2OCFD 1INDH 1NCWH 4XP6L 3WXWL 2JE8A 5KS9E 4JFEA 3TT1H 4Y16A 1MOEA 4OCWL 1BBJA 4MQ7B 4P5TA 2CXGA 2X7LA 1N0XH 1I8IB 4I4WB 5HI5D 1U91B 2ICWB 3RWGB 3G6AA 4PJGB 3BQUA 1XF3A 2DRUA 4DAGL 2FX8L 4G7VL 2LTQB 4ISVB 1FORL 4XAWH 4ZOAA 4QGTA 3GHEL 4RGND 4EVNA 4F9PC 3S96B 3U83A 4JM2B 3CH1A 3O4OB 1BM3L 1FNSL 5IEKA 1IQDB 5DR5H 3OXSA 5KVFL 2B0SH 2P5EA 1P4BH 3OB8A 4KAQL 1F11A 4IS6A 3GSQA 4P49A 1A1OB 2NZIA 4KQ3H 3REWB 1WC7B 4KI5E 1FPTL 4CADA 3KLDA 3G6DL 4TVPL 5H35B 5GGQL 3CFKA 1T21B 3QO0B 1KEGH 5E7BA 3VD4A 1J0KA 4GXVH 3OAYH 1EZVY 1DFBL 4Y1AB 1K4CA 5FYKL 5HHOE 12E8H 4OSUL 2X9XA 4HH8A 3UYOD 1Z0NA 1RUQL 2YUXA 3HZKB 1NCCL 2VH5L 2GIYA 2IQ9H 4MD4B 3KPMB 1ODAA 5HBBA 4YHKH 4CBPA 1AY1H 2QADB 1D6EB 3MOBL 3VFMA 4AEFA 4AMKL 3I6GB 3S98A 3BKCL 3WBDA 5KW9H 1CK0H 4Q2ZA 4JG0H 1B4JH 3RGVB 3BKYL 5JZ7D 1JRHH 3W9EB 4ZUSA 4KJPC 1A7RH 5CZXC 3JWOL 1UEMA 3D0VB 4UV4H 5EBWB 3FRUA 1RZ8A 1KELL 1PBYA 2EXYD 1DLHB 4S1SH 2HKHH 5GHWH 4JFED 2ZCHH 4JANA 3DV6B 4P5TD 1GAFH 4M62L 4OV5A 3TYFA 2XXMB 1MCOH 2BNRA 1AJ7H 3MACH 4GLRI 5D2LF 2ATPB 2VDKL 4UUJB 1Z6JT 1FH5L 1PYWB 3JWDC 5CD5C 2ADJB 4KROD 2QQKL 2BVPA 3QDGB 4WNQA 5I73B 1S7QB 3Q2CA 1AHWB 2VDNL 1INEH 4MXVF 1FNEB 2DI7A 2OBGA 2VXVH 5F8QC 3GSNL 3MRFB 5LGJA 5GRVL 2BVQA 4H8WH 1MCWM 2EC9T 2OTWA 3RVUD 3ZDXF 4MAYD 3BPNC 2B4CC 2R69L 1IZKA 1CN4A 3H6JA 4X9IA 3MPCA 5MI0B 3O2DL 3VGHA 3B5TA 3LV3A 4OZFG 2HTLD 1A7NH 1TQCB 4H1LA 3SGJC 3BPCA 3CZFA 5EORL 1BVZA 5EOTA 1WZ1L 4I3SH 3MROB 4OB5L 4PBXA 3MMEB 5H94A 4PTTB 3C6LA 3O6KH 1MCIA 2JB5H 1FL5A 4UU9B 4YE4H 2R2EB 1BX2B 4R7DA 4X6BB 3KG5A 4HC1A 4XCYB 4NJAL 3F5WA 1SEBA 1TZHA 1G7JA 2ADIB 2G2RB 3S3PA 1U3YA 4ELMF 4C56E 1FSKB 2LVCA 4JRXA 1YZZA 5ISZB 5DO2D 2ARJB 5JHLL 1KB5B 1INQB 1T7WA 4YBHA 3CMOL 3MV9E 4NQDA 5GISH 1GC1C 5I1CH 3TO4A 4PGDB 1UA6L 5CGYD 5K59F 4PJXF 2QL1A 5GGSB 4XCNB 3KYMA 3SPVA 1D9KD 2D4DA 2VITB 1UKSA 1TPXB 1EJOH 4U1LB 5C0BB 3KLSA 1I1YA 3LEXA 2CLRB 3GZKA 5JOFB 3MJ7B 1FZJB 1JV5B 4XWOD 4DKFL 3D39B 4GMTH 1J1XH 5IB2B 1MELA 4S2SA 5GGUB 3HG1D 3INUL 4OKVA 1DQDH 2A1WL 3S34L 1H5BB 2AJUH 3ES6B 5A40E 1ZLUH 4WI9A 1IGJA 4WW2A 1P7KB 2PXYD 2HH0H 1RHHA 3RQ3A 1G7LA 2R0ZL 5ELIA 4H26B 3PG2A 5BW7C 3V6ZB 5DRXA 3W81A 1C1EL 4PJ8C 1YJDC 3MLZH 4U1JB 5JOEA 2AEIT 2IEPA 1DEEB 2Z8RA 2X4UB 3B2VH 4MQXD 1YYMH 5L9DH 3ARDA 4TQEL 2DB8A 4JFZH 4M6OL 3HC3L 3RVXC 3V4UL 5IG7A 1X5KA 1BQHA 4MJ4A 2YC1B 3K1KC 3QQ3B 4HKJA 2GQHA 4KWUA 5DTFB 5IMKA 3K8LA 4IOIA 4X6DE 1ZS8A 4I0PD 5CGMA 3VD3A 5T1MB 4NCC2 4M7LT 1KCRL 2IPUG 1NGPH 2LFGA 4XC1L 3FFDB 3S3SA 4B7IA 4PLNC 3SE9L 3GIVA 2GK0A 4XP4L 2R1WB 5DQJB 4YNYB 4P2OB 3QDJE 4LPUA 3RVWC 4BQBA 3NACL 5GRVK 3JV6B 4APQB 2AK4A 4HCRH 3HRPA 4MXWH 4YUEH 2BY1A 4HAGA 1CGWA 3W5MA 1J11A 1KJVB 2VR4A 4PJFB 3TA3A 3KR3H 4BZ2L 5L7XH 3BP6A 5EUOB 3KYOB 1MCKA 3Q1SL 1UM6H 5GGVH 4GAGL 1F4YH 2EKJA 5D6CA 2Z93B 3L3GB 1PKQE 1PVHA 4LIQH 4NQDD 3EYSH 3VXUE 1UJ3C 5HYQB 4I9WE 1JF1B 4UTBL 3CK0L 4WWKC 1JF5A 3UTSE 2Z0BA 2R1YB 2BZDA 3FTGA 2MNUA 3GNMH 4ZAKB 2O5XL 4QOKB 3TZVD 1FAIL 1T3FB 1ZT4B 1XF4B 4X7SL 1IGYB 4A6YB 2C5DC 4MDJA 1LDSA 4U1IB 3RWEA 1MHHB 4MSWA 3WLBA 1XGRA 1YNKH 3KJ6H 1ZT7B 2FWOA 1QRKA 1QBAA 1NDMA 5DUML 3STBA 3FJTA 5FF6A 2XPGB 1QFWI 3MREA 2NY5H 3SKNB 3DUSB 2C7UB 4LSDA 2AKRB 2XN9A 5EBMA 2BCKB 5AYUL 2BDNL 3MRBA 3E0GA 3ARDD 4KMLB 4UI2A 3UYRH 2NY1B 1CVRA 2UZIH 3NMEA 3RWJB 2CKBL 4FNLL 3C6SA 4CN1A 3OKDB 4W4OA 5I1EH 1FCGA 5JPNA 1FZMB 4U6HB 3MRHA 1CT8A 5C8JB 3P0YL 4O58L 2VN4A 3W0WE 1VGEH 1GJIA 1JGLH 1UXSB 2JCCF 5I8CA 4PJ7A 4HS8L 5D5MB 1KLFA 1QVOA 3SO3B 3PIQA 1WBZA 4OD1H 3MCLL 4RCAA 4U31A 4JFFB 4NM8H 1H9VA 2BOBA 4R8WL 4D0DB 1AR1D 3QHFL 2YN5A 4Q74A 1N64H 2PUQT 2P49B 3TA3D 4ZFZB 3SDDD 4GG6A 3JTTB 2OX5A 1HH9A 4Y4HA 4GKZA 5IQ7H 5I16A 3RKDD 2BRRH 4EUPG 4LSPH 4HXBH 3DBXB 4XP5L 2AEQL