1VLIA

Crystal structure of spore coat polysaccharide biosynthesis protein spse (bsu37870) from bacillus subtilis at 2.38 a resolution
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
367
structure length
358
Chain Sequence
b'AAFQIANKTVGKDAPVFIIAEAGINHDGKLDQAFALIDAAAEAGADAVKFQMFQADRMYQKDPDVSIFSLVQSMEMPAEWILPLLDYCREKQVIFLSTVCDEGSADLLQSTSPSAFKIASYEINHLPLLKYVARLNRPMIFSTAGAEISDVHEAWRTIRAEGNNQIAIMHCVAKYPAPPEYSNLSVIPMLAAAFPEAVIGFSDHSEHPTEAPCAAVRLGAKLIEKHFTIDKNLPGADHSFALNPDELKEMVDGIRKTEAELKQGITKPVSEKLLGSSYKTTTAIEGEIRNFAYRGIFTTAPIQKGEAFSEDNIAVLRPGQKPQGLHPRFFELLTSGVRAVRDIPADTGIVWDDILLKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spore coat polysaccharide biosynthesis protein spsE
publication title Crystal structure of Spore coat polysaccharide biosynthesis protein spsE (BSU37870) from Bacillus subtilis at 2.38 A resolution
rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
total genus 106
structure length 358
sequence length 367
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03102 NeuB NeuB family
A PF08666 SAF SAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1vliA01
3.90.1210.10 Alpha Beta Alpha-Beta Complex Type Iii Antifreeze Protein Isoform Hplc 12 Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 1vliA02
2DP3A 5CG7A 3UPBA 4O16A 5F2LA 3CB8A 1H1ZA 4LY8A 3NL3A 3LXAA 4S1FA 3IGXA 3PG8A 2OMAA 1TV7A 1GG1A 4Z0SA 3W7QA 5DXXA 5HUOA 3BARA 4RXGA 1H60A 2X30A 2VXNA 2OT1A 2E6FA 1XBXA 4O0KA 3P84A 4JS3A 3GAKA 3HG5A 4PCFA 4XWUA 2ZZ4A 2P1FA 4HIBA 2WNNA 1XDMA 1THFD 1ZNNA 2B7OA 4JX4A 3A22A 4AB4A 1GVRA 1A53A 3B04A 1TRIA 3PB0A 1Q6OA 1XKYA 4O11A 2YPIA 3MP3A 5KZEA 3S9YA 3HPSA 1LRTA 4YL2A 1ICSA 2C18A 3DH7A 1SZEA 4ORMA 2YW3A 2C3ZA 5T26A 2YSWA 2E6AA 2GJNA 3QF0A 5LNWA 1RQHA 2ZTKA 4AXKA 3BG9A 3TKFA 5K4ZA 2QEZA 3G0UA 4O18A 1FXPA 4RX0A 1GZIA 4C1KA 2PURA 4LU0A 4IGHA 3THQA 2Y89A 3NL6A 2TPSA 4FNPA 3MO7A 4JTKA 4RJEA 4AWUA 4ZZ9A 3PBYA 3ABSA 1H62A 4DO4A 5FI8A 1MXSA 5FF4A 5AC8A 4IMDA 1JJKA 1FBAA 3NAVA 3N9SA 2ZRXA 3ZS4A 1JRBA 3FKRA 1R46A 3ZWTA 1QO5A 2TYSA 1FQ0A 3TFCA 3FYOA 4P61A 3Q94A 3OG3A 3EWXA 4LUIA 2VFHA 4YMZA 1TCDA 3W73A 4FXSA 3HGJA 1DOSA 2ZA3A 1HUVA 4UFIA 3UNDA 4JEQA 3W7KA 4LVAA 3G1SA 2QCDB 3MMTA 1LZOA 2CWNA 3NM3A 3N9RA 2NZLA 3F03K 1L9WA 4LTSA 2E68A 3W7GA 2V2HA 5FF2A 1ICQA 1WOAA 5CSRA 2NX3A 1KFJA 4DELA 2J9YA 1U83A 4Q4KA 4XTDA 2Z2UA 3LBMA 4UR7A 4UMAA 4I7UA 3TAOA 4RK8A 4DBEA 5J5DA 1T96A 2YW4A 3LB0A 1H7RA 1RZMA 3MI3A 3AJXA 1TTQA 3M5YA 3LLFA 4EOUA 3LTPA 4GWEA 5AHFA 3NA8A 1H7NA 3FLUA 3DBPA 4NQ1A 4GNJA 3OBKA 1QAPA 3TQKA 3GNNA 4QIUA 3HIJA 3L9CA 3C61A 5G4EA 1VQTA 5K7JA 4ONVA 5G2WA 4CNOA 5DBUA 5LGZA 1YXYA 3CU2A 2H8ZA 2Z6IA 1JCLA 2RDWA 4IJBA 1SR9A 3TSDA 1SUXA 3W1UA 1G4TA 3SW6A 2WOQA 3HO8A 4CCDA 2E5DA 2J27A 4CQ8A 3LTSA 3R12A 4IMFA 2V2CA 3U6WA 2ZRVA 4BR1A 3VE9A 3W7JA 5KSWA 4TU1A 1VLIA 2H90A 3A21A 1OFQA 5IBXC 4KWVA 1SZFA 3DGRA 3WK2A 4YCOA 3LCIA 1KLZA 1YTDA 4QJ1A 2E6YA 3P61A 3LCFA 4CNNA 3GZ3A 5D2VA 4UR4A 3KFTA 4O12A 2ZA1A 2G95A 3Q2DA 1NFBA 3A9IA 3BLEA 3LXBA 5D2WA 3W84A 3W1PA 1GTEA 1JR1A 1UBSA 3GR8A 3TMQA 3S42A 2E1DA 4QQ3A 5LZLA 2ISWA 2PRLA 1SPQA 5G4WA 3RMJA 4CNPA 1PHWA 1PCKA 3T78A 5BRBA 4UUIA 3TX9A 2PE4A 2WNQA 3QEZA 2B7PA 3L68A 3S5ZA 2A5HA 3A23A 1A50A 4UR8A 3RLUA 4UFLA 2VEMA 2VELA 1JQXA 2VEKA 4FX8A 4IMEA 3DXIA 1BWKA 1VJIA 1TPDA 2XN2A 2B0MA 3CHVA 3NQDA 3FRNA 2NUYA 1MZHA 5CKSA 1W5OA 3VFLA 1O95A 3W7DA 3W1LA 1KM5A 2Y61A 3SZ8A 1FCQA 2QCLA 3STGA 2NX9A 5AHIA 5LKYA 5DXYA 4K36A 3ZR4A 1I2RA 3TK7A 4HNUA 1KM2A 4GUIA 4GUFA 4QAIA 3T7VA 1OX5A 9AMEA 1N55A 4JTTA 3EXRA 3S5OA 3O6DA 4JX5A 2J9XA 2QR6A 2LX2A 3VCRA 2NV1A 3KRUA 3NOEA 3LV5A 3EWZA 4OT7A 4NJIA 3C52A 3NDOA 1XM3A 1RR2A 3NQFA 1HO4A 3B0UX 1WBJA 2QCMA 3FEMA 4YCPA 3D0CA 3JR2A 1L6SA 1KM3A 2CLIA 1LBFA 4DBDA 3ABQA 1MO0A 4EF8A 2XFWA 5AFDA 1Z48A 1FWRA 4IUOA 4A29A 4K8EA 4MZ8A 1TPC1 2WO5A 3U8GA 5HQEA 3QF6A 3O15A 2E09A 4LT9A 4AAJA 4KFPA 4WD0A 2GQ9A 2WSQA 1HL2A 3NQ8A 5DCBA 3W2LA 3TQ0A 3W7IA 5HR7A 4MZYA 1M6JA 4UXDA 4LS0A 2MSJA 3UWQA 3AMEA 4KFNA 5AYYA 1TSIA 3CM4A 3W83A 4ZQRA 3C3NA 3DI1A 1RV8A 3M41A 4NVTA 1B57A 4JY8A 3L5AA 4OQVA 3VE7A 4K7VA 4A2RA 3G1FA 2V30A 1IIHA 1G7UA 2JIAA 4LVDA 1BTMA 7AMEA 2Z1BA 1EKLA 4N9DA 2YFNA 3V1PA 2OX1A 3M7WA 3HOJA 1GWJA 4NXKA 4O15A 2NUWA 4BWLA 1DV7A 4FIRA 4N4QA 5LNVA 1WXJA 1EWDA 3W1AA 3TUUA 1TTPA 5AHEA 1XBZA 2Z6JA 3G18A 4JDYA 5H91A 1FCVA 3OVRA 1OJXA 4Y6GA 1TYGA 1JUBA 1MSIA 3V75A 2EHHA 1WQ5A 1G4PA 3S0CA 3IGUA 4WXZA 1KFCA 1WA3A 2C0AA 4O17A 1LBMA 1GVFA 4E0CA 2GVJA 3QPYA 4NU7A 1K03A 4TMBA 4JGDA 1XUZA 1SO6A 1H7XA 1T8XA 3NZ1A 2ZZ2A 5F2GA 5SWUA 1ZHAA 4RXFA 4UNLA 1B4EA 3W7MA 1DHPA 3E0IA 1I2NA 3P8JA 2YR1A 3NVTA 1EUAA 3HPXA 4LC6A 3T44A 1K7XA 2VEIA 3N2XA 1I2OA 1T0OA 1F76A 2G5WA 4QNWA 5AYZA 3NR0A 3CEUA 1VPXA 1JUKA 3WK0A 4NY6A 3OEXA 2R94A 2ZCGA 2B4GA 1H1YA 1W5PA 2VKZG 1H50A 3WFAA 2LLEA 4ZL1A 3VNDA 2BX7A 3IIOA 1PHQA 3QYQA 1B7KA 4UFJA 4GRSA 1F74A 4LS2A 3G3DA 3NGJA 3DHDA 5HINA 4K8HA 1FY6A 1W56A 3M0ZA 1GYLA 2AQWA 3I7SA 3DHFA 5A8GA 3I68A 1JCNA 3UYCA 4J9JA 2FLIA 2X16A 4HNTA 3QQ0A 5KINA 3IEBA 3MUXA 5I3IA 1WV2A 3VI2A 3NQAA 4IWWA 3GKFA 1KFLA 2QCHA 3P82A 4WZHA 4Y90A 3C8FA 2H8XA 3WK1A 4O52A 1XBYA 4WOQA 1TV8A 4KFOA 3NQ7A 4UMBA 1AMKA 4IPIA 1O5KA 2W79A 1HO1A 3GKAA 4NNAA 3O8AA 4BI7A 5DCDA 2PRHA 1OFPA 4XZ9A 2ZRUA 2VFEA 3CLMA 1TB3A 4H6KA 2Y85A 1S5VA 2A6NA 1ZFJA 4HNNA 1YTKA 2X1RA 2Q3OA 3P60A 1FCUA 1OFRA 4IPJA 2GUUA 3G1HA 3EX3A 3B4UA 4XTIA 2ABAA 3TH6A 4ZVJA 5KMYA 3M5XA 4OE7A 1OYBA 4TR9A 3QW3A 5C6MA 5EY5A 1VRDA 2WQPA 5D2TA 3SECA 5MHBA 2QKFA 4IQLA 4AEOA 1RD5A 3TXVA 4CQAA 1HG7A 2CZDA 3CT7A 3L0GA 2FIQA 1SU5A 4O19A 3H53A 4PC8A 1FXQA 1OYCA 2DZSA 3W7EA 4OGZA 3TJXA 4RLIA 1OVDA 2RH9A 3PWAA 4O57A 2O7SA 3OA3A 4AMAA 1JCXA 4UTKA 4CCCA 4A3UA 3W70A 1GJPA 3G1AA 3RNDA 2ZFAA 3LCHA 3PAJA 2R8WA 4N02A 1WBHA 8TIMA 1S5WA 4N9EA 4NJKA 1M7PA 4AWSA 4NJHA 1ZCOA 3G3MA 1GZGA 1AW1A 6MSIA 2CZ5A 4D2JA 2Y7FA 4AH7A 4JYEA 1QPQA 3M44A 2ZRWA 4JD4A 4JR5A 1JCJA 3M47A 1TJPA 3L67A 2PRMA 5EBUA 4X3ZA 2BXVA 2DORA 2RHGA 4RR4A 1C29A 5GVJA 3W2NA 5DCEA 1KTBA 3NPXA 3NQ2A 5AHNA 1Q6QA 1SW0A 2VEPA 3UWUA 3DKLA 4LWWA 2QJHA 2DZTA 3W23A 4JIPA 4N6EA 5E1QA 3MW7A 1LORA 1Z42A 1VCVA 3SR7A 4PODA 1LLWA 2HMCA 3Q37A 1PIIA 4HPJA 4UTMA 1EA0A 1AG1O 3NQVA 3LHYA 1D3GA 1LRQA 5CPLA 4UFHA 2ZZ3A 3NL2A 2J9ZA 4O50A 3B0VC 2J6XA 1VGAA 2OCZA 5D37A 4DF2A 4O4VA 2EF9A 4XUGA 3THAA 4FIQA 1FCBA 5D32A 1SQ7A 4UTTA 1QNVA 3LHVA 3VKJA 1TTJA 4DPPA 4KKXA 4QM1A 5DELA 2H3DA 3NQMA 5CSSA 3W76A 1YPIA 3SGZA 5G1YA 4CCEA 3TE9A 3PSVA 3QZEA 3BW3A 1E51A 4DPQA 5EYWA 3P80A 3IRDA 4NZFA 1K8ZA 4NZJA 1VR6A 1XL9A 1PV8A 3TIMA 3MYPA 3CQ0A 2ZTJA 5FEXA 4CQ9A 2Y7GA 4UTIA 4OHQA 3STCA 5E0KA 4UNKA 2BWGA 3O1NA 2FPTA 3IVUA 3KRSA 4MY8A 4UTUA 4JTUA 1G6CA 3EWYA 3ABRA 3W7LA 5LSMA 1OFAA 4M19A 1MSJA 4JTJA 3MBDA 1AW5A 2E6DA 2TRSA 1YXCA 2A7NA 4OV9A 3E9AA 1FDZA 2CLKA 4I9AA 3UWVA 3AO0A 5HR6A 3UY8A 5CPNA 3N3MA 1K7EA 1UUOA 1AW2A 1EP3A 1Z41A 3QSTA 5LNRA 1QMLA 3GVGA 2V81A 2VFDA 1A5AA 2HTMA 3PUDA 2ZZ5A 3KOFA 2PC4A 1O4UA 1OX6A 1H61A 1SO5A 3GDKA 2NXGA 3L21A 3GDMA 1KDFA 4YLWA 4O53A 4Y9AA 4UC5A 4IOTA 4WUIA 7MSIA 2WV8A 1LM1A 1XXXA 3PBVA 3S1VA 1G69A 5L6UA 1PL9A 1WDWA 3RDNA 1J4EA 2V8ZA 4UCGA 3R2GA 1LP6A 1DBTA 1TPEA 2G97A 3LHTA 4N9CA 3TC6A 2YDAA 1YYAA 2VENA 3IGSA 3P81A 1XUUA 4POCA 3HB9A 1IGSA 1VCFA 3O16A 4IMCA 1ZJIA 2Q8LA 1C8AA 2VFIA 3QM3A 2ZA2A 1CI1A 2YZRA 5AYXA 2DZWA 3NQEA 1WAUA 4FNSA 5EL1A 1W31A 3HF3A 1KTCA 4JTGA 3GR7A 5DLCA 3IVSA 3F4NA 4JDBA 1P0NA 4O14A 2RFGA 3NQ6A 4JNMA 3FFSA 1ME7A 4O1DA 4O1AA 3HGOA 3PUOA 1W5MA 3W7RA 4YWIA 1S3HA 1ZY9A 1GVQA 3KVKA 1L6WA 1ME9A 2V82A 5I3HA 1A5SA 4C1LA 1YTEA 4MJMA 2QCGA 4ADSA 4MY9A 1SZNA 1S5TA 4LVBA 1RQEA 3KAOA 4O28A 1G4EA 1EUNA 3A5VA 2NXHA 4JTEA 3RF9A 5L9FA 1YPFA 2DZXA 5D30A 5G1TA 5AB3A 4L4LA 4AF0B 3HG4A 2CLHA 3SIZA 3RFAA 2C13A 4JYFA 2C6QA 2CLMA 3W72A 3LX9A 4WOZA 1K8XA 1RVGA 3S8HA 1Q6RA 3ANYA 3LCWA 1MEWA 2CW6A 3LV6A 5AN7A 5U4NA 2DZPA 3OHIA 2WSRA 4PH6A 1GVOA 5K9XA 1NVMA 5CZ0A 2ZYFA 4MZ1A 2XN0A 5F4SA 5ABTA 4NX5A 2RKXA 2CLOA 2ZRZA 4H4IA 5KZDA 3A5FA 1IXNA 2X1SA 3E02A 1GTHA 4U28A 3G8EA 5HWMA 3C2OA 2P0OA 2C1HA 3QMTA 1H7PA 3L0NA 5KITA 2ZZ6A 3O6CA 1KFKA 2EPHA 1C9DA 2FPVA 1HFBA 1C89A 1A5CA 4UTJA 4I7VA 3LOTA 5EMUA 1N8FA 3W71A 1TO3A 3HBLA 1O60A 4FHAA 8AMEA 3NQGA 4TIMA 3ATZA 4LVFA 3MHGA 5D05A 3B06A 4AF0A 3R13A 3NYZA 2UV8G 3MI6A 2BLEA 1EPXA 4UMCA 4DF1A 1JUEA 3W75A 4PL1A 3NQCA 3PR2A 3WJSA 1JQVA 1LRNA 2CLFA 3P5ZA 2LX3A 2ZBTA 1QO2A 3BGJA 1CW2A 2RDTA 1G7VA 4AWTA 4ZQPA 3L0KA 4RZ6A 3W22A 2WJZA 3KX6A 3BK0A 3UWYA 4H3DA 4M7TA 1OG0A 5I3JA 3R5EA 2HSAA 3LHUA 5K4XA 1V7YA 2GOUA 3PS7A 1FX6A 1FWNA 2B7QA 1UB3A 1W0MA 2C15A 3LCXA 5CZTA 1WOBA 2ZDRA 1W37A 2ZRYA 2JKPA 2A21A 2NV2A 1KM1A 2A7RA 3ATYA 5F1VA 4O8RA 4ZQNA 1FWSA 3OVQA 8MSIA 1JCMP 3BPWA 3BLFA 3QMSA 3ZFHA 3O05A 3WJYA 3O07A 5LHEA 5DBTA 3WJZA 4OBTA 1TPFA 4Z1DA 5HUPA 5TIMA 3C2FA 3W6YA 3R89A 3UQNA 3QFEA 1EWEA 4GBUA 1SFLA 4N6FA 3SJ3A 3LTYA 2Q3RA 1RQBA 4E38A 5F2IA 2YXGA 3UZJA 3YPIA 3G1VA 3C4UA 3A24A 4LW7A 4WY0F 1F2JA 5HWJA 4RZ5A 2QUVA 3LLDA 1EP1A 3I7QA 3EWUA 3HGRA 4X22A 1DL3A 3W86A 1DKWA 2BZNA 3CPRA 3SFKA 2EAWA 2V5BA 1FDYA 2CZEA 3SY5A 4FEZA 2TMDA 4MOZA 1P0KA 2CLLA 1PS9A 4BWLC 1QWGA 4U4MA 4BK9A 1Z44A 4LUJA 1VYSX 2GQAA 5FF3A 3TSBA 1C8VA 4HKPA 4UTWA 3C0JA 4UFMA 3CEPA 1KM4A 3I65A 4MJZA 2C16A 4LV9A 1NF0A 1GVSA 4ORIA 3CWNA 2A4AA 4PFMA 1B3OA 3GYEA 1H63A 1BEUA 3W85A 1ZAIA 3PY2A 3M16A 1OABA 5BMXA 4IXXA 4LNYA 2ATMA 3LI0A 3DAQA 4DO6A 4QITA 2NWSA 2J24A 3LHWA 1OK6A 6TIMA 3NL5A 3DFOA 1IXPA 1CX9A 1UCWA 4AHPA 1P4CA 1M7OA 5DY3A 3EEGA 4M6PA 1Q45A 5LHFA 3TDFA 1R47A 1ZENA 3TXZA 3M5VA 3QC3A 5AHMA 3W2JA 2Y63A 3RLVA 3PULA 2ISSA 3L5MA 3QMRA 3UWZA 3LRLA 4JX6A 5D09A 1H7WA 1L6YA 4Q33A 4O13A 1IXQA 3BW2A 1KV5A 1JABA 1DQXA 1AL8A 3NM1A 3GXNA 4JTLA 4MLRA 2DJLA 4RZ4A 3I6RA 1KBJA 2Y62A 2V5LA 2XN1A 3DFQA 1QOQA 3W87A 3QSRA 1DJNA 3WJWA 4QISA 4NUWA 2V0TA 1OF6A 3PF3A 2GVLA 3TROA 4BI6A 3QQ1A 1OK4A 1SSDA 4MLJA 3TQVA 3HQ1A 1RPXA 2FDSA 3TNOA 3TW6A 4GXMA 1OFDA 1W8SA 2JKAA 3S5YA 5CZSA 4GUJA 5LNUA 2CFFA 1EIXA 3S1XA 4MY1A 4EIVA 3U2OA 1DORA 1IXOA 3PG9A 3PBWA 2JK2A 3KXQA 1QPRA 3LDVA 3FKKA 3BLIA 2A0NA 3E96A 3M43A 3N2MA 1R2RA 2JGYA 3IVTA 4HHPA 5CPOA 2GQ8A 4JN6A 3L2IA 3QPZA 4MYXA 4JY9A 4AVFA 4IMGA 1K02A 1GEQA 2QJIA 3PBUA 1LTDA 1F05A 2QCEA 2I14A 1K3UA 2G96A 3G24A 2V2DA 3LCLA 3ELFA 6ALDA 2NWRA 2HS8A 1UUMA 2OZ0A 3NXFA 4JYDA 4K38A 3L65A 2Y7EA 1N7KA 3EWBX 5F2MA 3K30A 5BOOA 1ZALA 4FO4A 1ZAHA 5CZJA 1WYIA 2QDGA 4XQ6A 1QR7A 1VS1A 4R7JA 1YXDA 5K3VA 4UTHA 2SPGA 1TPWA 1Q3NA 2FTPA 1EP2A 2QAPA 1YDNA 1X1ZA 2QAFA 3HGSA 3EX4A 3GDLA 1D9EA 3KRZA 1F5ZA 4K37A 1FDJA 5KZMA 3G8RA 2R91A 4Z08A 3PUEA 1SO3A 3W1MA 2YCEA 3PB2A 3LXCA 1XBVA 2AAMA 3DFPA 1YDOA 1ICPA 4LVGA 1H7OA 4RCXA 4JTFA 4XBSA 1KM6A 4ZQCA 4OV4A 3W7CA 3LERA 2I1OA 2JGQA 3MP4A 4JTHA 3QH2A 3I7RA 3LGEA 4Z0JA 3TV8A 5DY2A 3USBA 2C19A 4YXGA 1OFOA 2W0UA 2O7QA 3GK0A 4ZQOA 3UXDA 1IF2A 1TPVA 1LDCA 1KW1A 1SFJA 3FS2A 3CIWA 3T40A 1X6UA 1VCGA 2DU2A 1LCOA 1TRDA 3B0PA 1J2WA 3KVLA 3CC1A 4Z1AA 2CLEA 3KVMA 3EKLA 1TPUA 4LRSA 1GOXA 2FFCA 4OWGA 1R30A 2H3BA 1W5NA 3NPUA 1SZGA 4M6VA 1HTIA 4MKNA 4O1CA 3EWWA 5C2XA 3MSIA 4HNVA 2ISVA 3B05A 5FF7A 1NSJA 3MYOA 4FNTA 4JTSA 4QNEA 5FEWA 3M9YA 4PEKA 5G5IA 9MSIA 4CLMA 1ADOA 1QCWA 1KBIA 4LOCA 4XBKA 1AMEA 4K39A 3FIGA 3TR2A 1MEIA 3O63A 2QUTA 4Z1CA 5HNRA 3KHJA 3N73A 3W1XA 5I3FA 1UASA 2ZZ7A 4AHQA 1OFEA 3LRKA 1TMHA 3M1ZA 1BWLA 5EKYA 1LOLA 1L2UA 4S2BA 2Y88A 4FX6M 1IIGA 3L66A 5D38A 4PA8A 4WY0B 4MUZA 4GJ1A 4O1BA 4TX9A 4UTTC 4O54A 2VFFA 2A2IA 2Y7DA 3WJXA 3SGUA 5IBXA 1WVOA 1PCWA 2WSYA 4HN4A 4I7WA 4M5PA 4AMEA 2E5BA 5IM51 4HSNA 2D73A 5F4WA 1NF7A 3FJ6A 1TTIA 2VC6A 1SSGA 3STEA 5MSIA 1BKSA 2GPTA 3MWAA 1I45A 2ZZ1A 3W2MA 1TREA 4A22A 4FX7A 3G1DA 3PSWA 2QDHA 1KM0A 3NLAA 4ADUA 1GPWA 2Z0IA 3JS3A 3QW4B 2YYUA 2NX1A 4DO5A 2BSLA 2E5CA 1FWWA 1OPSA 2HS6A 4O0ZA 4E2BA 4A21A 5J5RA 2CU0A 3W1TA 3W7NA 1W3IA 2VOMA 5AC6A 4WXYA 3FYPA 2QUUA 2YYTA 3EXSA 2I9EA 4PTNA 3IIZA 2QCDA 3UZ5A 2AMEA 1J5TA 3EXTA 4TMCA 4K7YA 5U7SA 2IQTA 3W7PA 1TQXA 4NT0A 2QF7A 2Y6ZA 4Z1BA 1JRCA 3W3OA 4XKYB 4NXSA 4WY0A 3Q58A 4BF9A 4FNUA 3PM6A 3W2UA 5H2ZA 1KTNA 4L4MA 4NX0A 5FEZA 4X2RA 5A5WA 3P8IA 4Q32A 4OU1A 2MSIA 1OFBA 1XFBA 1W3TA 4UTLA 5C55A 4IX2A 1P5BA 4R33A 2VFGA 4P2VA 3TJLA 4MIMA 4ALDA 2GJLA 3C56A 4Y96A 3UPWA 2AGKA 1LYXA 3T4CA 3W1QA 2EKCA 1MSSA 5FF0A 3O06A 2OT0A 1G4SA 5I3KA 4R34A 3S6DA 2V9DA 1ZAJA 4IX0A 4MPQA 4Y8FA 4RKAA 1YDVA 3DENA 3GB6A 1VHCA 1K8YA 3TA6A 3GAYA 1KFBA 2YFOA 2FPYA 3N19B 3EKZA 2H6RA 3FJLA 4JICA 4WJEA 1JCYA 5BNKA 1WX0A 5K9DA 3MHFA 1B7IA 4DEFA 1KDEA 3TCEA 4FNQA 4A2SA 3N14A 1FWTA 1VC4A 5FESA 2NUXA 2JKEA 4FF7A 3WK3A 1GT8A 4EVZA 3BGGA 3RK8A 2ZQ0A 6AMEA 1OYAA 3PVFA 3C6CA 1DVJA 5BMWA 4XKYA 4LS1A 1AL7A 3C2RA 3MBFA 5CPMA 4JIQA 2A85A 1H5YA 2ALDA 4N2YA 1GQNA 3MJYA 4RV8A 3TMLA 1MEHA 3GXTA 5D2YA 1OF8A 4GUGA 1XDLA 1K7FA 2WNZA 3JRKA 4UFKA 1M5WA 3G0SA 1TPH1 3MI2A 2TSYA 4MYAA 2YGYA 4WQ6A 1LBLA 4DXVA 3LBCA 4LC8A 4PL2A 4MFDA 3P74A 1DQWA 2B7NA 3HG2A 1I2QA 4QSHA 5I3GA 3CTLA 2DJXA 3P7YA 1KA9F 4ADTA 1AK5A 3F4WA 5D04C 2C14A 4G1KA 1OX4B 4FB7A 2GVGA 1PE1A 3ZWSA 3MP5A 1DJQA 2RDUA 3B03A 5CGQA 5HMSA 1XI3A 3NNTA 4GC4A 1TQJA 5EA9A 3UY7A 5KTLA 4N4PA 1ME8A 2ATSA 3NG3A 2QJGA 4X9SA 5C5YA 4IXHA 2EGZA 1A5BA 3F1QA 1XCFA 1SW3A 3H55A 1VLWA 4S2CA 5HJLA 2F84A 2Y70A 3P62A 1JULA 5LGXA 3IIPA 3STFA 3TAKA 3W9ZA 1SW7A 4O4WA 5AC7A 3IV3A 3NPVA 4E2DA 3E49A 4R53A 5K2ZA 1QPNA 3LHZA 2NLIA 3LRMA 2Q8ZA 3QRHA 2DZUA 4LV4A 4FNRA 2WPBA 3TC7A 7TIMA 4ML9A 2A1YA 1TJRA 3W2KA 1OHLA 3C2EA 1LROA 3OIXA 3MHUA 1ALDA 1F7BA 2A6LA 3LM7A 3DZ1A 4ZQMA 1VYPX 5LNSA 2OJPA 1R2TA 5K9CA 2JBMA 3L5LA 2NXIA 1TPB1 3S1WA 3DI0A 3DU0A 3BW4A 1PVNA 4B5NA 1TV5A 3W7OA 1EEPA 3BO9A 3GLCA 2FQIA 1D3HA 3G1XA 3O6YX 1OX4A 2BTMA 3W7HA 1W54A 3TU9A 5AOUA 4AHOA 3GDTA 3DKJA 3E12A 3TW7A 3NO5A 3W1NA 1KV8A 1LLZA 2A7PA 2FJKA 3INPA 5BW6A 1Q6LA 1F6PA 1B9BA 1VYRA 3LI1A 3BV4A 3RU6A 3DFSA 3ABOA 3HJZA 5TBOA 3BG5A 2X1TA 1O94A 2YX0A 3G22A 4HT3A 1QOPA 3BG3A 1T99A 1R2SA 2J88A 5D33A 2DZVA 2PCQA 2QCCA 4M7SA 4WX2A 3SSJA 1ML1A 3GDRA 3EX2A 1EX5A 1P1XA 1YADA 1I8JA 5HWNA 4TO8A 4HPXA 4HSOA 4O10A 5F4XA 1UCSA 1KFEA 4JTIA 1O5XA 1VHNA 3M6YA 1HG3A 3BVJA 4DQWA 1EB3A 4NNCA 3EX6A 1GYNA 4KWWA 1TIMA 3B8DA 3IIXA 2CZFA 2R14A 3UD6A 4ZMGA 1B4KA 3S5NA 3N34A 5FEPA 3CIXA 4BI5A 2E77A 4K6AA 4M6QA 3TFXA 1ONRA 1YLVA 3PC0A 4LRTA 1W5QA 1FUYA 1SO4A 2F7FA 3P67A 3GXPA 5TQLA 3T55A 3W74A 4UTWC 1B7JA 5C54A 5G2IA 1QDSA 4FXRA 2FB3A 3LCGA 4ICNA 1NAL1 4GUHA 1U5JA 1QFEA 2FB2A 3HPZA 4DF0A 4BFAA 1GG0A 3OVPA 3CWOX 1W3NA 5HULA 1X8FA 3EB2A 1I4NA 3C2VA 4GE8A 3GX9A 3NEVA 5F1UA 4NJJA 3HG3A 2KZHA 3EX1A 3IIVA 3QJAA 3DFTA 3S1UA 2QCFA 3W88A 1UJPA 2X1UA 3G0XA 3NPWA 4MVAA 1LOQA 4UIOA 4EF9A 5D03A 4UR6A 3G1YA 4W9TA 3P5YA 5G2HA 2QCNA 3W1RA 1XC4A 4GFSA 5DN1A 2ABBA 1V5XA 5D2XA 3SI9A 1W1ZA 4NNBA 1JVNA 1X7FA 3W07A 3NZRA 3FOKA 4NJGA 4MFEA 3KVJA 4JXCA 3M5ZA 1VZWA 1F73A 3UXAA 2WKJA 3GIYA 1NEYA 2X2GA 3TSMA 3GNDA 1QPOA 3FA5A 1H51A 1Y0EA 3H54A 1F6KA 2W6RA 3DFNA 2P10A 1I2PA 1LOSA 3R8RA 1X1OA 3UWWA 4MSIA 3HMJG 5AHLA 4N9BA 5EPDA 5E93A 1G67A 4EWND 1VH7A 1KLYA 5D02A
chains in the Genus database with same CATH superfamily
2CXGA 4O8AA 4O16A 2G37A 4LY8A 3LXAA 4S1FA 4UNIA 4LUSA 2OMAA 1TV7A 2V3DA 4OOUA 4Z0SA 1P43A 5DXXA 3W7QA 1E1EA 3MVIA 4K1GA 2VXNA 3CMGA 2E6FA 2VGFA 1XBXA 4O0KA 4F0KA 4DLFA 2B7OA 2D69A 4AB4A 2PU0A 3PB0A 1M53A 2QULA 4O11A 2NQ5A 3MP3A 1VFSA 4L7ZA 3HPSA 1LRTA 2C18A 2XISA 3DG7A 4F0SA 1VFOA 5C9XA 2YSWA 3BG9A 2QEZA 1VIZA 4O18A 2IXVA 1GQJA 4RX0A 3G5EA 2POTA 4IGHA 2Y89A 2VDHA 3K13A 4IGMA 1GK8A 3BLOA 1JRBA 2ISFA 1R8LA 3FYOA 4P61A 1ENUA 3O9NA 3LMZA 2VFHA 3WQWA 2X0YA 4W88A 4HHLA 1AH3A 5JU6A 2J66A 1PO9A 3UCQA 5DMNA 3F03K 4DB7A 2P76A 5JVLA 4LTSA 4IH3A 4WDUA 3NYDA 5FF2A 1E6ZA 9XIMA 5ABHA 1FH8A 4DELA 3OYXA 2PLMA 1J0IA 1U83A 4Q4KA 4XTDA 3ICJA 2ZX8A 3DHPA 3M46A 4UR7A 5EMKA 1Q2SA 1C7SA 4PCPA 2PWFA 2O9TA 2OZTA 1JDFA 2YW4A 3BUVA 3MI3A 3AJXA 3M5YA 3N4AA 4EOUA 4NAEA 3VOGA 4YYCA 4C90A 3WBAA 3T05A 2ZX6A 2VUYA 4NQ1A 4FOJA 3OBKA 3SUTA 3GNNA 3VIOA 4C6IA 1ZBWA 4C7FA 5LGZA 5DBUA 1YXYA 2Z6IA 1SR9A 1GHSA 3TSDA 1SUXA 2CERA 1WUFA 3BH4A 2DT1A 4L6OA 1G4TA 1LJYA 3QV6A 3R12A 1KO0A 4IMFA 4XD5A 2CBVA 4AZBA 1OY0A 3W0KA 3AWOA 2VEGA 4TU1A 1VLIA 2H90A 1S5MA 3WK2A 4YCOA 2ZXAA 3VZYA 1NDWA 3LCIA 4QJ1A 2E6YA 3LCFA 3T81A 1GQLA 2HK1A 5D9MA 3KFTA 2TODA 1J96A 2G95A 3A9IA 3BLEA 1Z8AA 4DVOA 3W1PA 1JR1A 4O1EA 2Z2AA 3TMQA 2F9RA 2E1DA 4QQ3A 4CGTA 1SPQA 3T78A 4DXKA 4UUIA 1C93A 1W2PA 2PE4A 2QDDA 2WNQA 3HU7A 1CT5A 2G3NA 3FSUA 3L68A 1HKVA 3WMSA 2GFTA 3A23A 1OEPA 4UR8A 3AAMA 2D23A 1W1PA 4X61A 1JPHA 1JQXA 1BWKA 4V28A 1GW9A 4C6QA 2GGEA 2WC3A 2CBIA 4J2PA 1V3LA 5CKSA 4EXAA 2XVNA 4GI6A 1O95A 4ZGYA 1KM5A 3KL0A 3SZ8A 2E28A 4PMYA 5DXYA 2R1KA 3TK7A 1S1PA 2PD5A 4I5UA 1KFWA 4REQA 3HFYA 2WKLA 2Z29A 2IKGA 4ZOCA 3ZLFA 1EF2A 5DT5A 2J9XA 1T6MA 1NIUA 3EOLA 1RBLA 3V18A 3SUWA 4PTMA 3NDOA 1RR2A 1WBJA 3FEMA 4YCPA 4L1WA 1LQ0A 1KM3A 5M5DA 1A5MC 2EPLX 4EF8A 4IIHA 3M0KA 4P7QA 4K8EA 1ZSXA 4H8VA 3WQVA 4PMVA 3U0HA 2EJAA 4IPNB 2GQ9A 4KFPA 3NQ8A 1L8PA 3W2LA 4MZYA 3OLIA 3WQCA 3WO8A 3AMEA 4KFNA 1TSIA 3CM4A 4FOUA 1TWZA 1RV8A 3WDQA 4NI3A 4OQVA 4K7VA 4D8AA 4J27A 2V30A 2WB5A 2POZA 1G7UA 1UR0A 5C7HA 4PTVA 1BTMA 2Z1BA 2VQUA 3ITLA 3EOSA 4CEUC 3M7WA 5MKGA 4FIRA 1GZ1A 1LL7A 3UJFA 2VURA 1XIEA 4UQ9A 3ARPA 5H91A 1VIWA 2VYOA 4B2DA 1FH7A 4A3YA 4LAMA 1JUBA 1MSIA 3EMCA 3U7VA 2VT0A 4WXZA 1X6LA 1WA3A 1UH3A 3QHOA 1OZMA 1S3TC 3FN9A 2PPGA 1M3UA 1EC8A 2R1MA 1K03A 1SO6A 3GG7A 3E5PA 2ZZ2A 4CD5A 4QE4A 4RXFA 1PPIA 1YIXA 1JYWA 1DHPA 1EJWC 3E0IA 1I2NA 3NVTA 2R1NA 1K7XA 3OHMB 3VDGA 1T0OA 1F76A 4A4AA 1HXJA 4QNWA 1N2VA 5CBIA 4HA0A 1JUKA 1V0NA 3WK0A 5I00A 2ZCGA 3RCMA 2B4GA 3BAYA 2VKZG 3THUA 3H23A 3E2QA 3WFAA 4Y9MA 4JQ1A 3WBXA 1PHQA 3QYQA 4ZEPA 3LSBA 4GRSA 1XW8A 3NGJA 2PU1A 2UWFA 3FXGA 4ATLA 1XIDA 1GYLA 1AODA 2AQWA 3DHFA 4HNTA 1MFVA 4LCRA 1IR2A 2VD9A 4YHGA 2OFJA 1A5UA 4IWWA 4LB3A 1BLIA 3N17A 3CAWA 3P82A 4WZHA 5RUBA 4O52A 3GC4A 1E71M 4KFOA 1KQYA 2OLHA 2VUNA 2WMHA 1W3LA 3OZMA 4ZFMA 3N9KA 1JPKA 5BXSA 1UWSA 4TTUA 4RDWA 4AY7A 4H6KA 3R0UA 5TD4A 3R6IA 1F07A 2HEJA 1FCUA 3AUJA 3HQPA 3WBYA 1X7IA 3B4UA 1Q13A 1EZWA 4XTIA 3BMXA 2JFEX 3TH6A 1TR9A 3TEVA 1IZCA 1OYBA 4TR9A 3QW3A 3RR1A 1VRDA 6REQA 2QKFA 2O9OA 3SADA 2O0TA 1RD5A 3VD5A 3TXVA 5REQB 2VC7A 1XLBA 2FTWA 1OYCA 4B5SA 4OGZA 4RLIA 1FWHC 1E4LA 4O57A 3OA3A 4UTKA 4M1BA 3G1AA 3VKBA 1WDPA 2ZFAA 3VIIA 1V3MA 3O7UA 4N02A 1E6RA 4I5RA 3KOXA 1M7PA 2ZOXA 1W3JA 3VO0A 1ZCOA 3RRAA 6MSIA 2CZ5A 2GVYA 4D2JA 5IRPA 3BE7A 1QPQA 2ZRWA 3EB3A 2XIJA 4JD4A 4DZHA 3ITTA 3VYLA 4HA4A 4S3AA 1W1VA 2FMOA 2PRMA 4XZWA 2DORA 3BV7A 5LIUX 5CGTA 4UWMA 5GVJA 4QG8A 3TYDA 1UH2A 9RUBA 4YN5A 5A6SA 4JIHA 1WXYA 3NQ2A 2GGHA 5AHNA 3TTEA 3WMBA 1SW0A 3D3FA 3UWUA 2QPUA 3GUWA 3DKLA 4JIPA 5E1QA 1Z42A 5AYBA 2DSUA 4E6MA 2XIIA 3MCOA 3VIMA 3QC0A 2Z25A 3LG3A 4XZLX 3E0WA 1KCZA 1HVXA 4IFKA 1R9YA 2X41A 4UTMA 1EA0A 2OB3A 1UZ1A 4EE9A 4C6FA 1LRQA 5CPLA 4UFHA 2ZZ3A 4GKLA 3B0VC 2OCZA 2F2HA 2EF9A 2XVPA 4O4VA 3K4DA 4MWAB 3AMDA 3GTXA 3VKJA 4DJDD 4KKXA 3LQLA 3BOFA 1BRLA 1V6VA 3NSMA 2P0IA 3BW3A 4DPQA 3VDBA 1SYTA 5PTDA 4LANA 4NZFA 1NOWA 4NZJA 3FJNA 3S1GA 3TIMA 3MYPA 1FWJC 5FEXA 3RG6A 1RCQA 3STCA 3BL3A 1M68A 3SUUA 2Q01A 2WHMA 2ZXBA 3QLLA 2R82A 3W7LA 1OFAA 1MSJA 2PDQA 2R1PA 3MBDA 3BZGA 4HNOA 4KS0A 3OLEA 4LX4A 3QKEA 4MMWA 3VC6A 3UWVA 4Q4SA 4JPGA 3AI0A 3EWDA 3WQOA 5HR6A 1LWHA 3UY8A 3DECA 3N3MA 3QSTA 4R88A 3GVGA 5HMDA 2DZBA 2V81A 2VFDA 2PC4A 1O4UA 1OX6A 4JKKA 3GDKA 3O3RA 2BFGA 3GDMA 3KBWA 5DANA 2QVHA 3B0XA 4XSLA 4IOTA 1ZS2A 1XFCA 2WV8A 1Q8AA 4DJEC 1QATA 5C71A 3S1VA 5L6UA 1PL9A 1B0IA 4TX6A 1KCKA 1AQMA 3PWIA 2CWXA 3R2GA 2PWDA 3PZMA 1XYZA 1CDGA 4PUKA 4C6LA 3PJUA 3SGGA 3WN6A 4C6CA 1XUUA 2HV5A 2ON3A 4HK6A 1UJQA 4DUVA 1RP8A 2VWSA 1SFSA 2P8CA 2NW0A 3NQEA 4ERIA 2CITA 4D6IA 3CAVA 3PANA 1HT6A 4GJJA 3CUXA 1P0NA 1E4MM 1OCBA 2RFGA 5AC5A 2WC7A 3U2EA 1HQTA 5HMFA 3W7RA 3WD4A 1PEZA 1OBAA 4OIFA 4R9XA 4C1LA 1X39A 1YTEA 4MJMA 1B54A 1S5TA 2E7FA 4LVBA 3KAOA 3A5VA 3BICA 3HG4A 3SIZA 3UXLA 4JYFA 1R3YA 4JAWA 2DH2A 2BY2A 3PK7A 5CEWA 1CGTA 5CC3A 5AN7A 5U4NA 2DZPA 2WSRA 5DMYA 4PH6A 1KCLA 1W3KA 5K9XA 1B3VA 2ZYFA 4G7EB 2WWDA 2XN0A 2RKXA 1US0A 4PMZA 2CKRA 4LCQA 5T9BG 4HQVA 1YRRA 3A5FA 3TYUA 1IXNA 4QXIA 3E02A 1GTHA 4U28A 3QMTA 3EPOA 4YHEA 3ONCA 1XH1A 1C9DA 3LGDA 1HKWA 4US5D 1JEZA 3AHZA 1Q6GA 3OZPA 1BHGA 4I7VA 3LOTA 1T5AA 1RUSA 4PUNA 1PTGA 1EBHA 1TO3A 4PMDA 1TR1A 3IJIA 3AZSA 4FHAA 5C0QA 2SFPA 3B06A 3GTHA 4JL1A 4AF0A 3R0KA 3MI6A 3VZZA 1M9HA 2PB1A 4PL1A 3NQCA 1O1HA 2VI0A 1E0TA 1O5QA 1LRNA 4Q8TA 2LX3A 1CW2A 4ZQPA 4RZ6A 4US6A 3MVTA 3TVAA 3URNA 1QJWA 3KX6A 4H3DA 1C91A 5I3JA 3LHUA 2CHOA 5B7ZA 5HQLA 3PS7A 1FX6A 4MDPA 1K77A 4LPCA 3RMEA 1AMYA 4FPSA 4GY1A 1MW1A 1W37A 1XYBA 3HTWA 4EPDC 1I0BA 1XISA 3REQB 2NV2A 3ATYA 4O8RA 1Y5VA 4ZQNA 1GOIA 8RUCA 3OVQA 5I02A 3QMSA 3W82A 3ZFHA 3O05A 4KRTA 3WJYA 2VQTA 4ZO9A 3R7MA 3GFZA 5HUPA 5TIMA 4AMCA 4I90A 3GNOA 2IXUA 3SCVA 4N6FA 3LTYA 2Q3RA 3VNLA 3ARRA 3VUSA 4B4HA 3UZJA 3SQSA 3SN1A 3YPIA 2TAAA 4LW7A 1SZRA 2GSHA 4ASTA 1F2JA 3ZT7A 3N6JA 4R27A 2G3MA 3R8GA 3EWUA 1UH4A 4X22A 1DL3A 1NOUA 1FDYA 2CZEA 4HU0A 1KCXA 4J2MA 3SY5A 2BS9A 2C71A 2CCRA 2CLLA 1NDVA 3GDBA 1Z44A 1VYSX 3VCCA 3ABXA 3UT0A 2CLPA 3D46A 3TN5A 2O4MA 3I65A 3U48A 3NZPA 3CBWA 3LPGA 4GYKA 4JN7A 1OABA 5BMXA 1QW8A 3TC3A 3DAQA 1GPFA 4DX3A 4OUEA 4QITA 6TAAA 2J24A 1UYQA 4L9XA 3SAZA 4B3KA 4MJ2A 1ITUA 3DFOA 1WDQA 5CAHA 1R7AA 5A1AA 1P4CA 1DXEA 2PDPA 3HN3A 2I16A 3AALA 3KL3A 3EEGA 1AUSL 4D71A 7PTDA 1D8WA 1KGXA 4OTKA 4ZBCA 3QC3A 2WMJA 3W2JA 1DEDA 2ISSA 1PWMA 3ZVHB 4Q8QA 4KCUA 4JX6A 1L6YA 1IGWA 1TMLA 2E0PA 3EPNA 3GC5A 1IXQA 3EYPA 3WL1A 1M03A 1NQ6A 1TWIA 4JTLA 4AG0A 3TZFA 4E3VA 2V68A 3FDKA 5A94A 2V5LA 2XN1A 1QOQA 5IOBA 4XAPA 3TN4A 1UQZA 5AY7A 2V0TA 3GH4A 2GVLA 2Z7KA 1XSJA 5FJRA 1R3TA 5H6HA 4FLOA 3L12A 3ARVA 1Y65A 1RPXA 1B30A 2YLLA 4AWEA 1DWGM 4GXMA 1UKQA 4J3ZA 2CFFA 1VD6A 3VU2A 2JK2A 4BHYA 4NRSA 5CPOA 3L2IA 1JDAA 2IPWA 4JY9A 4IMGA 3EAUA 1AJ2A 2QJIA 4HP5A 4IIFA 5D9OA 1B9ZA 2YCIX 1F05A 1K3UA 2V2DA 3LCLA 1JXKA 2NWRA 3FSTA 1I1WA 1JG9A 4K38A 3VGHA 3EWBX 4W7WA 5F2MA 2WYSA 3K30A 1GOQA 3R11A 5MF5A 4XQ6A 1QR7A 3QOKA 4ZE5A 1VS1A 4GO9A 4R7JA 4P8WA 1GOMA 4GYPC 4GO8A 1HL8A 1X1ZA 1XLLA 1M01A 5G1MA 2QLYA 4FLQA 3VIPA 2EJ1A 5KZMA 3G8RA 5BWAA 3Q4DA 1GKQA 2BASA 2EEXA 2YCEA 1VFLA 3EEZA 1ICPA 2V38A 4JTFA 2V5JA 2NQLA 1XP3A 1M7XA 4OV4A 3T8LA 3W7CA 3MP4A 1ZGDA 1DIOA 3AIRA 1FWIC 2HCVA 4YXGA 2W0UA 4ZQOA 1IF2A 3MSYA 1KW1A 1KGWA 3T40A 1X6UA 4H9VA 2Y4SA 4JFVA 3B0PA 3GHUA 5DFAA 2CLEA 2YCJA 3GVRA 3KVMA 2OZ8A 4GXWA 1EGZA 3K5XA 2H3BA 3K4AA 4M24A 4ZOAA 1UD5A 1B3ZA 5LA0A 1JCTA 3MKCA 4FNTA 4QNEA 3VZXA 3CK5A 3HV8A 1YNQA 3N12A 1QCWA 1CB2A 5M3WA 2OWXA 4LOCA 2FGBA 1GOKA 4W8BA 1LUCB 3ITCA 2EG6A 2QMKA 4MADA 4Z1CA 5HNRA 3KS5A 3N29A 4QQUA 3W1XA 5XIAA 2WAGA 1LLOA 1TMHA 3H2NA 2O9PA 1L2UA 4KGLA 1QT1A 4LJ3A 4HOWA 3OOQA 5D38A 3A4WA 4PA8A 4UOZA 3AOFA 1V8EA 3APTA 4GJ1A 4O1BA 1F6YA 4TX9A 4O54A 3CPUA 2VFFA 3KL5A 1WXZA 3W27A 3LN3A 4D6HA 4KMQA 3SFWA 3WUFA 3QXBA 2DEPA 3TLQA 5HANA 2VM8A 4ENLA 1R9ZA 3T09A 5F4WA 1GCYA 3KS6A 4TVDA 3FJ6A 1RJQA 3STEA 3MWAA 4HYWA 3MCNA 2C91A 2X2YA 4JOMA 2OQHA 4A22A 3SN4A 3NLAA 4URIA 1UP3A 2J7EA 2Z0IA 3MSDA 4FF5A 4C6DA 2NX1A 4DO5A 1UWUA 1FWWA 3OO2A 4O0ZA 1TX0A 1HJWA 5J5RA 3W1TA 3W7NA 1UP0A 4WXYA 2I9EA 3IIZA 3TCSA 2QCDA 3UZ5A 3BMWA 3VGBA 1J5TA 1JI2A 3KBSA 1GJWA 4K7YA 3F2CA 5U7SA 4M3PA 3W3OA 4MKVA 3D6NA 3Q58A 3DFHA 1ITQA 4MWAC 2D2JA 2ASHA 3FGCA 3OPSA 3UA3A 4Q22A 3RCNA 5A5WA 2BXZA 1OFBA 1XFBA 1MUWA 1W3TA 2GWNA 4NI8A 4UTLA 5C55A 3S9ZA 4IX2A 1JYVA 4D6DA 4DWSB 3W38A 4P2VA 1YE6A 3UPWA 3T4CA 3W1QA 2EKCA 3E0FA 1QRQA 4LALA 1L0PA 3V36A 1K9EA 4MPKA 1AH0A 1GUVA 4RKAA 4PB4A 4PMOA 1YDVA 2JF7A 4DI9A 1ONEA 4EANA 3AYTA 2VC5A 4L80A 4WJEA 1PJ9A 4CU8A 3C86A 1B7IA 3SN0A 2A3HA 4FNQA 3EMQA 3KWSA 3N14A 3WLIA 4E8DA 5D9PA 3ID7A 5FESA 2NUXA 1K4GA 2JKEA 4FF7A 1GT8A 4EVZA 4HK5A 4A8RA 3BLPX 2Q02A 2ZQ0A 3UG8A 1RJPA 4LS1A 1AL7A 4IM4A 3ERPA 3LY0A 1MDLA 1TZZA 1GQNA 1H4PA 4ZFCA 1MEHA 4LAUA 2WNZA 4NL1A 3GIPA 5C2GA 3MI2A 2TSYA 4HK7A 5I78A 2YGYA 4INFA 1LBLA 3MZNA 2ZX5A 4PL2A 3WL0A 3WLHA 3AHVA 1I2QA 4QSHA 2PDWA 3CTTA 3N1AA 1ZP3A 1KA9F 3MUCA 3T0DA 3H7UA 5D04C 2WSPA 3BOXA 4FB7A 2GVGA 2P3ZA 3SURA 3T0AA 1TV3A 1VFFA 2J62A 2RDUA 3B03A 3I6EA 2QGYA 1XI3A 1J6OA 1HGYA 3V3WA 4YTTA 4GC4A 3UY7A 3R1ZA 1B3YA 1WDSA 1XCFA 3S6OA 1VLWA 4V33A 2E25A 4S2CA 2WPGA 2F84A 3PTMA 3IIPA 3VDCA 3GVVA 4ZODA 1PIGA 4HNLA 3CHEA 3B8IA 3OZYA 3NPVA 4E2DA 5A95A 3FK4A 3QV9A 1V0KA 2Q8ZA 3W2KA 3WG6A 3WQ4A 3C2EA 4FS9A 1LROA 1GQKA 3S9IA 3MHUA 2ZX7A 1BVZA 3LM7A 5LNSA 1R2TA 4NAFB 1KWKA 2X42A 3GTIA 3CQKA 2CKSA 4FZIA 2C1IA 3CGTA 2KAUC 2REQB 2D0HA 2BMBA 4FXFA 4B5NA 4B3ZA 1EEPA 1CXKA 1VBUA 5C9ZA 2FQIA 4AY1A 4HOZA 3B9NA 2GL5A 3G1XA 3W7HA 3TU9A 3DKJA 3E12A 3TW7A 4EPKA 5I79A 2FZBA 1KV8A 3DC8A 3EDKA 3I3DA 1V6YA 4PB3A 5BW6A 3VOCA 4C6PA 1F6PA 3WLJA 2H9AB 4GABA 3TYEA 2OYLA 3GW0A 4GD0A 3RU6A 4FALA 2DW6A 3DFSA 8CGTA 2NT0A 2YB1A 3BG5A 1O94A 2J88A 2DZVA 2PCQA 4DHGA 2DY3A 4XX6A 2HROA 1EX5A 3R25A 4GI4A 3VD9A 1EGVA 5HWNA 1TWDA 4HSOA 4AC1X 4JTIA 1Q4NX 1HG3A 1UMLA 3LZ3A 3IS4A 4F40A 3PPCA 2HISA 3PNZA 3DG3A 2NQZA 2CZFA 3RLHA 1M1BA 4PMRA 3KBNA 4MB1A 1ONRA 3MO4A 4EXQA 1FUYA 1E6NA 4UQDA 5TQLA 1B7JA 2AKZA 2FB3A 1P6WA 4GUHA 2GGGA 1QFEA 3K8KA 4CNUA 4DF0A 4CNTA 4PBEA 2OEKA 4H6EA 3UGRA 3CWOX 1V02E 5HULA 1I4NA 4GE8A 3NEVA 2Y24A 2QCFA 3U57A 4ZOBA 4DZAA 4UIOA 5FJPA 1HKMA 3M64A 4EK7A 1NWUA 4W9TA 5D4YA 3JU2A 2PDCA 5G2HA 1REQA 1J9YA 2GUYA 5DN1A 1QW7A 2ABBA 3SUVA 1FTXA 1CGXA 1S2CA 5D2XA 3SI9A 1X7FA 2HXTA 4Q6JA 3HPFA 3MUIA 3ZJ8A 4HHMA 4JXCA 2OOGA 3CL8A 4NG3A 3M5ZA 2NLYA 1VZWA 4ES4A 1F73A 1VBGA 2OKTA 1JNEA 4EWJA 1NEYA 2X2GA 4Q8NA 1V0MA 1QK2A 4NZ5A 3WLPA 1X98A 3H2EA 3H54A 2DT3A 2Y5SA 2W6RA 2YDSA 1RY8A 4K2SA 2P10A 1V7AA 1XWYA 1I2PA 1LOSA 4UTFA 2QPSA 2VRJA 1CECA 5AHLA 1NM9A 2ZUMA 4N9BA 1YKWA 5E93A 1TVPA 2DT0A 4C6JA 4C6OA 3T0TA 4EWND 4C5YA 2I5GA 1KLYA 5D02A 3M0IA 5F2LA 1H1ZA 1JF5A 2J47A 4R3UA 3DUGA 1OG6A 3IGXA 4W85A 7CGTA 1GG1A 1DP0A 3BARA 4RXGA 2PFHA 4P7LA 5ENLA 3AXHA 2OT1A 2Q8XA 4H9ZA 3HG5A 2J8TA 2ZZ4A 2P1FA 1TUFA 4ZXOA 1SVDA 1T40A 1XDMA 1QUMA 4F8XA 1IT8A 1TRIA 3VNYA 1Q6OA 1KRAC 1XKYA 1XJBA 5KZEA 3I3BA 2VZVA 3VD3A 4XB3A 3LGGA 3DH7A 1SZEA 2QQ6A 5HQMA 3AJ7A 1JFHA 4JHMA 3RRXA 2Y5JA 1IZJA 3CNYA 7REQA 3RO6A 4MM1A 4AXKA 3GQYA 4QE5A 3T0BA 1XCXA 2UY3A 4W5UA 1GZIA 3AZTA 3MO7A 4IGSA 1IEVA 4JTKA 4AWUA 3PBYA 2BOEX 3ABSA 1HZYA 2BDQA 1H62A 4Y9OA 4WVXA 4JZ5A 4IMDA 3QQWA 3UPMA 5A3HA 1WAWA 1XYMA 4LCSA 3F4DA 2VGGA 3AYRA 1UWTA 5C9UA 1V51A 2ZUWA 3AIUA 1KBLA 1HUVA 2ZDSA 4PTWA 3G1SA 4DJEA 1P7TB 2CWNA 4JN8A 3CZKA 3N9RA 4Q4QA 1T7LA 1G94A 1XIIA 4W86A 2W67A 3VC5A 5CSRA 4Z42C 2NX3A 2PBGA 1LL6A 2PI6A 1GZJA 2QIWA 5CJMA 5A6LA 3DYPA 4UMAA 1ZU8A 4DBEA 1JYNA 5J5DA 3RGTA 3NSXA 1GORA 5GNZA 4AZ7A 4S3JA 3LLFA 1XLKA 5AHFA 3CQIA 4IJRA 3NA8A 1H7NA 2V5KA 3FLUA 1PZ1A 4G6CA 3GO2A 3DBPA 4GNJA 2BHUA 2J7GA 4CU7A 3SCNA 4QIUA 1R3WA 3C61A 5K7JA 4H9TA 1V3IA 4Q4PA 1WE5A 1S2WA 2DSZA 4AD4A 1V4YA 3SW6A 3O2LA 4CQ8A 3CAQA 3HFTA 3U6WA 2ZRVA 1PXGA 3AICA 3VE9A 3A21A 2GJXB 4KWVA 3COTA 1SZFA 3DGRA 1JZ5A 4KCTA 5IXEA 2A3LA 4RL3A 1JL8A 3P61A 4O0QA 1OSEA 2Y8VA 3BAJA 4UCFA 2YA2A 2ZA1A 3GS6A 1XLAA 1NFBA 3AU2A 2YBUA 5D2WA 3SCUA 3UG3A 1UBSA 4AFYA 2YA0A 4UQCA 5LZLA 2QJNA 4CNPA 1PX4A 1PHWA 1PCKA 1TVLA 4WJXA 3EA1A 1UZHA 3OIHA 4HTBA 4JKMA 2A5HA 1A50A 1OIFA 3RLUA 3OGSA 1A0CA 2DSWA 2VELA 1EC9A 3MUAA 4FX8A 3GU9A 1EJSC 1V3KA 1CGYA 3LNMA 2DDXA 3NQDA 1XPGA 1LF1A 4DM2A 3BWWA 3KP0A 1S2TA 5A6BD 1SMDA 2Y61A 1FCQA 1C9WA 2QCLA 2NX9A 5AHIA 1C3FA 4PZVA 3N3TA 3ZR4A 1I2RA 3STPA 3NOYA 4HNUA 4GUFA 3CV7A 3PTKA 1JZ7A 3H4XA 3TW9A 1V0LA 1E70M 1OX5A 3NUKA 1OINA 4MNLA 3ZT6A 4XZHA 2RJHA 3O6DA 4JX5A 2LX2A 2VDIA 3VCRA 2NV1A 3DDMA 4AIEA 3NOEA 4H7ZA 4QS6A 3GRIA 4E3TA 3C52A 5GJNA 1WO2A 2IPGA 1XM3A 3NQFA 2CLIA 4DBDA 1FWFC 3WQGA 2PWGA 1Q2RA 3CZGA 5AFDA 1Z48A 4IUOA 3PZQA 4MZ8A 1TPC1 1JGIA 4F48A 3QF6A 2E09A 1UOZA 4WD0A 4P8XA 1HL2A 3S2JA 3SRFA 1V93A 4JL2A 4G7FA 1CENA 3A12A 1HL9A 3VNKA 4Z2HA 4LGXA 1E55A 5CZKA 4ZB0A 4CCZA 4DWSC 1QNOA 3W83A 3DI1A 1DYSA 3PJWA 4KRUA 4A2RA 2QUNA 1IIHA 1DTNA 3ARTA 3PZ9A 1VP5A 7AMEA 1PX8A 8XIAA 3V1PA 2OX1A 4FLRA 2OZ3A 3HOJA 3VIGA 2NUWA 4O15A 1J0YA 1DV7A 2V3GA 1SJAA 3IJDA 1HKJA 2PDGA 5LNVA 4JDYA 1DQUA 4QAWA 3OVRA 1TYGA 3VA8A 1L8NA 2EHHA 1G4PA 3S0CA 4HB7A 5BXPA 4HA1A 3FW6A 2WVUA 1KFCA 4RPPA 1GVFA 3IV8A 4GHRA 2VZOA 3AXIA 3WX7A 3WLNA 1DE5A 4TMBA 3UP8A 1H7XA 3MC5A 3RXZA 1VFMA 5F2GA 1ZHAA 3USZA 3CH9A 1E6SM 4JEJA 2OU4A 2YR1A 3HPXA 2G4FA 2VEIA 1UR9A 3UWEA 4MTVA 2G5WA 2XIMA 4DBSA 5AYZA 2AMXA 1VB9A 2XHYA 1W1IE 3CV6A 4MNKA 1VFUA 2XFFA 1NY1A 1TA3A 1W5PA 4HZ7A 1XD0A 3VNDA 4FLSA 1AQFA 3AHTA 1B7KA 4UFJA 1PZ3A 1M41A 1W56A 3MCMA 3VNIA 3M0ZA 5TF0A 3S2LA 3FHAA 2FKPA 3HMCA 3PBMA 1JF6A 1KR1A 3PFRA 3UBPC 4AD1A 5A8GA 3I68A 1Z89A 1JCNA 4F9DA 3QQ0A 1XIBA 5KINA 3C3UA 3SB0A 3ZM8A 3MUXA 4TXEA 1HJXA 1WV2A 5HPOA 1V77A 2YCKX 3NQAA 3GKFA 5BZAA 4Y90A 3C8FA 1GKRA 3WK1A 3TNBA 3SBFA 4WOQA 4GKTA 3NQ7A 1HKIA 4GVFA 4IPIA 1O5KA 2W79A 5JBFA 3RX2A 1U5HA 4NNAA 5J8LA 5DCDA 5A8QA 4PTDA 3IAPA 4IF2A 4DM1A 2ZX9A 4I5XA 2VFEA 3N4EA 1TB3A 4LUSB 3ARUA 1ZFJA 3IJ6A 4HNNA 1OFRA 4NRRA 2GUUA 3EX3A 4DWSD 2A3BA 4K8GA 1EJ7L 4ZSUA 1V6WA 5HDRA 1JPDX 3EB4A 3WEOA 5D2TA 4LSBA 1JIBA 4IQLA 2YLAA 1EHNA 3B8VA 3ENLA 4AEOA 3RILA 3VIJA 2CZDA 3H70A 4CEXC 3H53A 4PC8A 3W7EA 2DZSA 1E40A 1EIBA 2RH9A 3PWAA 2O7SA 1HJQA 4F79A 1JCXA 4CCCA 5LA1A 3NO3A 3RJXA 2AL2B 4PB5A 2F2KA 4MB5A 2WVVA 2R8WA 1S5WA 1CXFA 4I8DA 3VMNA 2WNWA 3VNMA 4XD6A 5GNXA 1Z32X 4NJHA 5FAJA 4F66A 3G3MA 1JZ6A 3QLDA 2G3IA 4AH7A 4JYEA 5DEZA 1A5OC 1PDYA 4JR5A 4QDWA 3WLTA 1K70A 3TP4A 1TJPA 3L67A 3AIWA 1P0DA 1C29A 2QIIA 3W2NA 4XUYA 3ARYA 3RM4A 3ITYA 1BF2A 4LWWA 2DZTA 3W23A 3U7BA 4BEQA 1XC6A 2D22A 1QBAA 1PIIA 4L1GA 1U22A 1AG1O 3NO1A 2XH2A 4J4KA 5E0CA 1GYMA 2OXNA 3NL2A 2J6XA 5HMEA 4L4OA 4HU4A 1SQ7A 2QF8A 1QNVA 3LHVA 3U5UA 1TTJA 1S39A 1W91A 3KZPA 4QM1A 3SQMA 3IJQA 3EA3A 4QE1A 2H3DA 5CSSA 3W76A 3TE9A 3FNDA 1E51A 3P0WA 1E3XA 3TTOA 4BZYA 2PGRA 4ZOEA 3QGVA 4QSFA 3NTYA 5I06A 4YVVA 4IQEA 4ML4A 4CVUA 3CQ0A 4GMEA 3BLKA 3NWRA 4UNKA 3C0QA 5D9NA 3O1NA 3IVUA 3RPDA 4MY8A 4A3HA 3PNUA 4JFUA 5LSMA 1XX1A 3UR8A 5BXRA 3KTSA 3W01A 3FA4A 4JTJA 4EAYA 2TRSA 1YXCA 3FVDA 4OV9A 3E9AA 1PTDA 1FDZA 2W4XA 3OLGA 1R3RA 1W9UA 5JIPA 3RX3A 4XZIA 1K7EA 1UUOA 4PRRA 1RH9A 3BSGA 1QMLA 1IZKA 5LNRA 2X7WA 1MVYA 2AKMA 3RM9A 2ZICA 4MWAA 5FAGA 1H61A 4ZB2A 4YLWA 5LIXX 2AMGA 3WEMA 4DAIA 7MSIA 1Q7MA 3CH0A 1LM1A 1XXXA 2DH3A 3K4WA 1IT7A 1J4EA 2V8ZA 4UCGA 3BXWA 4KW2A 4KWUA 4QFUA 1TVNA 4U2YA 4NZ3A 4U31A 2VENA 4BY3A 2WMIB 1EXBA 3M0JA 1CXIA 4JFWA 4H83A 3GNRA 4IMCA 1BQGA 2PTXA 3K1DA 1ISXA 1BQCA 2Q8LA 4Q8MA 2E9MA 2VFIA 1LT7A 2ICSA 4QDMA 2OYKA 3WF3A 5EL1A 3GE7A 3KHDA 1I6NA 1US2A 4REQB 3IVSA 4A35A 4O14A 3NQ6A 3JZUA 1YBQB 3ABZA 1C92A 4O1DA 3V16A 3C0LA 3UCCA 1BD0A 3KZSA 1KNWA 1GVQA 3GBEA 1ME9A 4GNKB 1UWRA 1RCOB 5HNNA 2PDLA 1KWGA 1SZNA 1RQEA 3VOHA 1E1CB 1PKYA 4O28A 1EUNA 2XSXA 1YPFA 4L4LA 2WZTA 1R3VA 2C13A 2CLMA 4UR9A 1VAHA 1DIEA 3B8WA 2Z26A 3LV6A 5A8NA 1F9CA 3MMWA 3S4TA 1Q5MA 4C1NA 4WDXA 4EX4A 4MB4A 4MGGA 3FCPA 4MZ1A 3VMPA 2CLOA 2ZRZA 2BOFX 4C65A 1RALA 3WH9A 2BODX 4GGHA 4PCNA 2ZZ6A 3MQTA 1HFBA 1IEIA 1A5CA 3MU7A 2QW5A 5EMUA 1N8FA 2VCAA 3CYVA 2ESCA 1O60A 3K46A 3NQGA 3RX4A 4LVFA 1FHVA 3R13A 3NYZA 1J5SA 4RNJA 1JQVA 2CLFA 3P5ZA 6CGTA 2ZBTA 4MB3A 1QO2A 3U4FA 3BAXA 3QGKC 3W22A 2WJZA 1UROA 4G1NA 4M7TA 3CUGA 4G7EA 1ESWA 3R5EA 2HSAA 1A5NC 2FZMA 4Q8VA 1V7YA 1UPPA 3RUBL 3OU8A 2B7QA 1UB3A 3F4VA 1T41A 2C15A 1E9IA 3LCXA 3GBDA 2ZRYA 3VFCA 1XV8A 4Q4OA 5AVHA 1X38A 3BPWA 4X60A 2F6KA 1NFPA 4GYFA 2NQ9A 4Z1DA 2DPEA 4L9ZA 1EC7A 3UQNA 3AS3A 3QFEA 1EWEA 4QX4A 3GNXA 1SFLA 3SJ3A 1IEWA 2E1WA 3M0MA 1RQBA 3BQ5A 4AZ6A 3WD0A 2VMFA 3IGHX 4R7OA 2QUVA 4GQGA 1TE6A 4W93A 4B9ZA 1DKWA 3SFKA 2EAWA 2J8FA 4NASA 2TMDA 4XIMA 1VJZA 1UKTA 4GCAA 3G6MA 4BK9A 1SM9A 4LUJA 1TG7A 2GQAA 5FF3A 3TSBA 3UVAA 4ZTXA 1M04A 3REQA 5KEZA 4GI9A 2OGJA 4MJZA 1NF0A 2W63A 4AVNA 1QNRA 1UR4A 2DVXA 1RSCA 4PFMA 1B3OA 3R79A 5CBBA 3TWAA 3PY2A 2ATMA 4DO6A 3LEPA 2A79A 3H4GA 1EJTC 4GA8A 3NL5A 2I9UA 1IXPA 1UCWA 4J3VA 5AKQA 4Q7BA 1KXHA 1Q45A 5LHFA 3TDFA 1R47A 1UZDA 1DXIA 3U9IA 3TXZA 1U2YA 3NZGA 3RLVA 1W6TA 2IPJA 3UWZA 3LRLA 5D09A 1H7WA 3ONBA 1FKWA 3BW2A 1DQXA 1KR0A 1NH6A 1QNSA 4MLRA 2W9MA 4GI8A 3I6RA 2XVGA 3N2CA 3AQUA 4HPNA 3QSRA 1DJNA 3WJWA 4QISA 2CYGA 3P3BA 4NUWA 4A8LA 1OF6A 1CWYA 3AMCA 4IG2A 4BI6A 4F3HA 1U1UA 4P5UA 4IZGA 2FDSA 4WK9A 2E3ZA 4LBUA 4AZCB 3QBUA 5CZSA 4GUJA 2V5DA 2YL6A 3D3AA 1EIXA 3S1XA 4MY1A 3U2OA 1YPXA 1IXOA 3PBWA 4NKCA 3P0XA 2BOGX 3FKKA 3KTXA 3PTDA 1OGGA 2HVOA 1EYEA 3E96A 1O6IA 3M43A 1QNPA 1Y7VA 3IVTA 2GQ8A 3OGVA 4JN6A 3QPZA 3WMLA 5CGMA 3WNNA 3O6AA 1TJ2A 3UNTA 5CBJA 3ZVHA 4GPNA 2OR2A 2YKKA 3KWXA 3PBUA 2QCEA 2G96A 6ALDA 2HS8A 3SCSA 3L65A 2Y7EA 2PDKA 4PSPA 1E6PA 1TWSA 5CZJA 2QDGA 4EXBA 3ZXWA 3POHA 1Q63A 3CHFA 4UTHA 1TPWA 1Q3NA 2FTPA 2QAFA 1BVWA 3HGSA 3EX4A 1D9EA 6ENLA 4HGXA 1SJCA 4Q4MA 1F61A 3PUEA 1FWBC 3FYYA 4DN1A 4H8NA 3EDEA 4X0NA 3N25A 5FIPA 2WK2A 3NXLA 1XLJA 4LVGA 3A47A 1UW9A 4ZQCA 2I1OA 4RNIA 4G8TA 2DUAA 1AFSA 4AD3A 3I7RA 4Z0JA 1MFUA 3BDKA 1OFOA 2O7QA 1EJUC 4IJCA 3BANA 1QPKA 1LDCA 3FS2A 3E3HA 2PDYA 2PP3A 5FSEC 7A3HA 3GFYA 2FFCA 4OWGA 2DT2A 4FXJA 3XINA 1UD6A 2Q09A 3JUGA 4MAVA 4M6VA 4XV0A 4B9YA 5I23A 2WJEA 1XGDA 3MA8A 1HTIA 4O1CA 4PRTA 3CV1A 4D6JA 4V2XA 5C2XA 2ISVA 5FF7A 4PULA 2VX7A 1BGAA 4CU6A 2OODA 5FEWA 4FI4A 4ZO7A 3T8QA 4CLMA 4M1RA 1EDTA 1J6PA 3WNKA 4N42A 4XBKA 1MNZA 3FIGA 5CPQA 2QUTA 4UQBA 4AZIA 4C6NA 2ZZ7A 3NGFA 4AHQA 3QVQA 4M81A 3LRKA 4XVEA 1BWLA 5EKYA 2QS8A 2Y88A 2RDXA 3F5LA 4FX6M 2W91A 3CUFA 2DSVA 4MUZA 4GIYA 3IUDA 4UTTC 2A2IA 3UG5A 3SGUA 2I17A 4HN4A 4AMEA 2E5BA 5IM51 4HSNA 4S3CA 3H6OA 2D73A 2XIOA 3W24A 3NEHA 5EMJA 2NT1A 1W9VA 1J79A 2VC6A 1SSGA 2QT3A 5MSIA 4Z17A 5EFDA 3S2CA 3UVIA 3E1F1 1I45A 2ZZ1A 4FX7A 4ADUA 1S38A 2AOSA 5A6MA 1CB7B 2NQHA 1J2BA 2WJFA 3VUPA 2E5CA 4B5XA 5EMYA 1LUCA 1S2VA 4E2BA 4A21A 4F2TA 2J7BA 2Q6ZA 2EQDA 2OWCA 2VOMA 3CXOA 3VD4A 5AC6A 1WKFA 2YYTA 4PTNA 1UIOA 2AMEA 3RHGA 1VRXA 4GIAA 2IQTA 3W7PA 4RDZA 1TQXA 3OLDA 2QF7A 4Z1BA 1JRCA 3KBVA 4XKYB 4NXSA 3M0VA 4BF9A 2Y0FA 3EDFA 3PM6A 2V5CA 4PMJA 3W2UA 1F3XA 1VBHA 4NX0A 1GJUA 3KOYA 2AGTA 4Q32A 1MI3A 4HMCA 4OU1A 3U4AA 4RPQA 1PKLA 2JQXA 3HURA 4MIMA 2GJLA 3H2AA 6XIMA 4GOAA 4BKNA 1G4SA 2UZ9A 4R34A 1JAEA 1VKFA 4S23A 4Y8FA 2R9RA 3AMGA 3VKCA 3EKZA 2H6RA 3EMZA 2AAAA 4YU1A 4E2VA 3WZ0E 2ZVIA 1E72M 1YDYA 3A4JA 3O0FA 3TCEA 4E2OA 3TOYA 4LUYA 3WQEA 1FWTA 1VC4A 2V63A 1EGMA 3VGEA 3GZAA 4I9MA 3ES7A 3URQA 3BGGA 3RK8A 2XSBA 3VPLA 2ZUNA 1WZLA 5GJMA 4L65A 4I6VA 2A85A 2WZHA 2VGIA 4N2YA 3WLLA 3MJYA 4RV8A 1ONWA 2WM0A 3OZOA 1H09A 4ZA0A 3F7JA 1D7KA 2XWEA 3AFBA 4DWSA 4XAFA 1JI1A 4MYAA 3UXIA 1BVNP 4WQ6A 3LBCA 4GY0A 4ACYA 4C7DA 2B7NA 2I57A 5HATA 2YCLB 2QDEA 4JNYA 1XRSA 2DJXA 1LQ2A 1Z6KA 1DWJM 1AK5A 4QLJA 4G1KA 1OX4B 1EBGA 2VL4A 4N7QA 1PE1A 3ZWSA 3MP5A 1DXFA 3OYZA 5H8MA 5HMSA 4D8LA 1Q7ZA 3NNTA 2XSAA 1ME8A 2ATSA 2C7FA 4DJFC 5C5YA 2UY4A 2EGZA 4E5TA 5ECUA 2C79A 1JULA 5I6SA 3TJIA 5LGXA 3STFA 1UWAA 4O4WA 5GNYA 3HA1A 4R53A 4JTQA 3HJEA 3PPHA 2NLIA 4S3GA 3U3HA 4L6DA 4FNRA 2WPBA 7TIMA 1TJRA 3SJNA 3OIXA 1KRMA 1ALDA 5BU6A 3GYCA 4ZQMA 4M6UA 4EAMA 3VOIA 1OQFA 3ARQA 2JBMA 2NXIA 1VPQA 3S1WA 1DWHM 1EL3A 3WENA 2WBKA 1TV5A 3O0KA 4WGHA 4QCEA 3MB9A 3SCQA 1D3HA 2Z00A 2BTMA 4AHOA 2B81A 3E0LA 3KDOA 4S3KA 3PJXA 3NO5A 4Q4RA 2WW5A 3W1NA 4H7CA 3THDA 2A7PA 2BHZA 3W02A 4M80A 3V0TA 3GUGA 2MNRA 3UJRA 3ABOA 3RN6A 4AIUA 3A3WA 2X1TA 3UU0A 1L6FA 2YX0A 3G22A 3WF2A 1QASA 4KPLA 4J1OA 1T99A 1R2SA 2VR4A 2QCCA 3E2VA 1ML1A 3GDRA 4YTUA 1I8JA 2DVUA 1XF0A 5M17A 1A5KC 4W84A 3JW7A 2VNCA 3M6YA 2REQA 2VCCA 1ZP4A 4HMDA 3WMCA 3ARZA 5BXTA 1GYNA 1W1YA 4NZ1A 4S39A 3SM0A 1XDJA 3ITGA 3VX0A 3IIXA 1EX1A 2R14A 3UD6A 3WEZA 1ODUA 3S5NA 3CIXA 2E77A 3A4XA 4K6AA 3WDJA 4PUWA 2VR5A 4DJDC 3UGVA 4LRTA 1W5QA 2XDFA 1RVKA 1SO4A 1CNVA 2H9AA 1H49A 2QJMA 3M0XA 1JPIA 4UTWC 4JNZA 1DIDA 3NJ3A 3T08A 3BSHA 5C54A 2P3EA 4AD5A 2C1GA 5I24A 4ICNA 4I9TA 2FB2A 3HPZA 1UHVA 2XM2A 3AXMA 3OVPA 3DEQA 1IWBA 1MXGA 3EB2A 3C2VA 1YE4A 2NVCA 4LFYA 4RE2A 2KZHA 3EX1A 4DJFD 4PGLA 2ZADA 4QGCA 1GGOA 3G0XA 4KEUA 4MVAA 4EF9A 3W4RA 2UY2A 3PP7A 3E6EA 5D03A 4UR6A 1DHKA 2XZ7A 3G1YA 1JZ4A 2Z1XA 3KP1A 4HJFA 5KETA 1V5XA 4AY8A 1JVNA 3U2CA 2QMJA 1NU5A 1UKSA 2JEQA 3EKGA 4AXNA 2VTFA 1OGSA 3SCOA 3PPGA 3TSMA 4KCWA 3A9BA 1QPOA 4C6KA 1OB0A 1Y0EA 1BXNA 5FD0A 4FR1A 2Y5EA 1IHIA 4MG4A 2IMRA 4JIEA 3ANUA 1F3EA 1G67A 1GOOA 2XGIA 2ZE3A 3TQPA 1VH7A 1UA3A 1XYLA 1EKOA 2DP3A 3VX1A 3UPBA 1CYGA 4DYKA 3NL3A 3H2MA 3B9EA 2GYIA 3KLLA 1D8CA 5HUOA 5A8PA 2X30A 2CETA 4JQAA 3P84A 4JS3A 1A4MA 2WMFA 4ZO8A 4XWUA 2PF8A 2WNNA 4HPHA 1THFD 2RGMA 4JX4A 4LAKA 5HA7A 5JIWA 1A53A 5HNTA 4HU3A 1OC7A 3MY9A 1ADDA 4YL2A 1JAKA 3UZXA 4J3XA 3ORWA 2YW3A 4J3SA 5T26A 3UZZA 2GJRA 2ZTKA 2QGHA 5K4ZA 2IUZA 4Q8WA 4E4UA 1FXPA 4C1KA 1G01A 2YBVA 1RXOB 1AJZA 3KCLA 4RJEA 4ZZ9A 2DIJA 1MXSA 5FF4A 5AC8A 1CLKA 1JJKA 1FBAA 2ACSA 3T2QA 3ZS4A 2UY5A 1R46A 3ZWTA 1MQPA 1QO5A 4A3RA 3TFCA 5AZ0A 1C8QA 1X8CA 1EOMA 3Q94A 1K1DA 4GQRA 3ARSA 2PDIA 3OG3A 3EWXA 4LUIA 4J35A 1W9PA 1FVPA 3UJ2A 1A3XA 3W73A 3HGJA 3QKZA 4IICA 2EPMX 1DOSA 2YBTA 4UFIA 3UNDA 3W7KA 4NILA 2QCDB 1LZOA 2OYMA 3NM3A 3MZ2A 5HNUA 2VD8A 5CLWA 2PZ0A 2BV9A 2E68A 1MDRA 2V2HA 4HMEA 3V4BA 3MDWA 4B3LA 5E09A 3MSRA 2Z2UA 3W37A 3LBMA 4PUMA 4F0HA 3JVAA 3LB0A 1IEQA 1RZMA 3L4UA 3WFLA 4RE4A 3LTPA 4GWEA 3FAXA 1VF8A 3IARA 5E5CA 1S2UA 4KWSA 5IHRA 3L9CA 1VQTA 3WD1A 5G2WA 1WKEA 3WLQA 2H8ZA 2RDWA 2YB4A 4IJBA 4PCTA 1J0KA 3W6LA 2Z27A 3W1UA 3K3SA 2FTYA 2OLSA 3AS0A 4HSHA 5ABFB 4CCDA 2E5DA 1US3A 1NJJA 1CBGA 4QBXA 1P7TA 3FEQA 4Y2WA 4QRNA 3W7JA 3AU6A 3CJPA 1Q6EA 5KSWA 1SJBA 1A5LC 3PFMA 1E9YB 1OFQA 2QXWA 2YA1A 4RW3A 3V5OA 1FWCC 1KLZA 4H41A 3GZ3A 2X09A 1W1TA 1TKKA 2OPJA 4UR4A 2Y2WA 4O12A 2BNJA 2BVYA 2E40A 3N6QA 1EYWA 5E6ZA 3LXBA 3VAVA 2CC0A 3W84A 1GTEA 2ADAA 4M56A 3ALFA 1HN1A 3GR8A 1ITXA 3S42A 4N0RA 2ISWA 2PRLA 4TUFA 3RMJA 3OBAA 2HBVA 4IIBA 3FA3A 5BRBA 3IPWA 3TX9A 2B7PA 1UG6A 1WUEA 1AQ0A 2FHBA 2WWCA 4UFLA 2VEMA 4Q8OA 5C7VA 4FA3A 3M7SA 3HQNA 4U33A 1TPDA 2B0MA 3CHVA 2RAGA 1LG1A 4HMNA 4QDPA 3FRNA 3ALGA 4A05A 4IFOA 3N13A 1MZHA 1W5OA 1FWGC 4D6FA 4DLMA 3P14A 2GJXA 7XIMA 2IPFA 1ZJBA 3W1LA 1A0EA 1GNXA 4AW7A 4IFRA 1XCWA 3LD5A 2F6UA 4GUIA 1O66A 4QAIA 1DIKA 3T7VA 4AEEA 2VRQA 4G2DA 3GR4A 1FH9A 4M51A 4JTTA 3EXRA 2OX4A 4YIWA 4QTGA 3S5OA 1PDZA 4R9OA 3KRUA 1F8IA 3LV5A 3EWZA 3TONA 5D8WA 4NJIA 5HAOA 5G4HC 1HO4A 2GDUA 5LXEA 1KRBC 1MNSA 3B0UX 3HQOA 1F3TA 3D0CA 3JR2A 2ZUSA 1L6SA 2NSOA 4E4FA 1H0IA 1MO0A 2PDJA 2HPMA 1WNOA 1XYFA 2WO5A 4A6GA 3U8GA 4AAJA 2WSQA 3RPMA 3TQ0A 3OODA 1XH0A 2PWHA 5HR7A 1UD8A 3QPEA 3FV9A 4LS0A 4P7NA 4LXFA 4PE8A 4ZQRA 3M41A 2NV9A 3L5AA 2Y8KA 4ATWA 3SQLA 3GHSA 1IT0A 2JIAA 4LVDA 5JQ9A 3F2DA 1EKLA 1JDDA 2YFNA 5I2UA 1J0HA 5I0DA 2BGSA 1XGZA 1GWJA 3GC2A 1MRQA 1VEMA 1EWDA 2PLCA 2G3FA 2PP0A 5I03A 5AHEA 1UR3M 4B5TA 3G18A 4H9MA 1FCVA 1XQLA 4Y6GA 3V75A 1E5NA 2VO5A 4QHRA 2YL8A 4UQEA 1PBGA 3GHTA 3URAA 4Y7EA 1YNYA 3IGUA 4DO7A 4WDWA 4LBRA 3WH6A 4E0CA 2PDHA 4TVUA 4LYKA 2OWWA 4U5IA 4PUJA 5EMLA 4NU7A 2OVLA 3B4YA 4M82A 1EH9A 3C5QA 4D72A 1E1FA 4UNLA 4RUBA 3W7MA 1ISWA 2L5HA 3ITXA 3WCZA 4CQCA 1EDQA 1XH2A 3AIEA 3UF9A 2GLKA 4LC6A 3T44A 2F8QA 3PAOA 3SSZA 3N2XA 1KC7A 1I2OA 4AVOA 3GW3A 3NR0A 3CEUA 1VPXA 4X2PA 4RV3A 2R94A 1WCGA 2BBFA 4GQBA 4PR4A 1H1YA 1GOWA 1H50A 3UYIA 3OQ8A 1R7OA 4WHBA 4RE3A 2I5IA 2E4TA 3G3DA 1RLDA 3CO4A 3DHDA 4K8HA 1FY6A 3VNZA 1QNQA 3I7SA 2GVEA 4AIBA 3CUZA 3UYCA 2X16A 3DYMA 1OCNA 3AS2A 4QLKA 4ERAA 5I5RA 4ATDA 4IP7A 3URBA 5I3IA 3T0CA 1J8VA 2PEVA 4HBKA 2QCHA 4DYEA 3MMDA 4KEVA 2H8XA 2DFAA 1TV8A 1E15A 2AQOA 4UMBA 4QJ4B 2VR2A 4E8CA 3O8AA 3QZ6A 3LQGA 2PRHA 1OFPA 3VIKA 4XZ9A 1GHRA 4W5ZA 3CLMA 4MDOA 1S5VA 1YTKA 2X1RA 3P60A 2INFA 2HE5A 2CEQA 2ABAA 1H3GA 2HQAA 4AQLA 5JXQA 4ZVJA 5KMYA 3M5XA 1EXPA 2FGLA 5EY5A 2ZXDA 2WQPA 3SECA 3M0LA 3DCPA 2IKJA 1UKOA 3PZVA 5C2CA 4HZ8A 4CQAA 1HG7A 3L0GA 2HJPA 1VBJA 5CC7A 1SU5A 5BU9A 4O19A 3VIFA 1Y5XA 1RAKA 1OVDA 3TJXA 2FVLA 2G50A 3H2OA 3T6CA 3W70A 4A3UA 1GJPA 3UR2A 2XG9A 3GVWA 1VEOA 1XQKA 4DNHA 1S1RA 4BA0A 1UD2A 3PAJA 3VABA 1J01A 1QI4A 1WBHA 5I7GA 8TIMA 4HHHA 2PP1A 1FWEC 2HZGA 4KERA 4N9EA 3WQ5A 3QTPA 4NJKA 4AWSA 5BROA 3CL6A 3II1A 1AW1A 4PFHA 4HA3A 2Y7FA 4X0VA 1VEPA 2CXEA 4QR6A 2FH6A 1JCJA 3RM8A 3VINA 5EBUA 4X3ZA 2BXVA 4IQJA 2P50A 1XG4A 4GYJA 5DCEA 1QI5A 4F0MA 1KTBA 1UC4A 1Q6QA 1RD6A 2VEPA 2IKIA 1V03A 2QJHA 4W89A 4N6EA 2HNHA 3MW7A 3N2BA 1ISZA 4OZOA 2J78A 1Q6FA 4PODA 4TV6A 1LLWA 5FJOA 1RBAA 2HMCA 3Q37A 1ECQA 4HPJA 3LS9A 4F4RA 3OJGA 2V6AA 4LEFA 3WNPA 3VMOA 2AL2A 2ZKMX 1D3GA 4PN2A 3F2BA 4O50A 5D37A 2VEFA 2X1IA 4DF2A 4XUGA 2BG5A 4HPGA 4JHZA 3B8TA 3THAA 4AD0A 1FCBA 2ALRA 2VZTA 5FACA 4UTTA 3NSNA 1VFHA 4GZ7A 1KRCC 4I3GA 4Q3MA 2PDBA 1DTUA 1JZ3A 2GGIA 3A4AA 3NQMA 1JDEA 3BAWA 3SGZA 5G1YA 3BCDA 5EU9A 3PSVA 4KRZA 4ICCX 5EYWA 1UR8A 3MTWA 3OA5A 3P80A 1K8ZA 1PV8A 2Y1HA 3JZEA 1W9DM 2ZTJA 3AUOA 4CQ9A 2G4JA 4UTIA 4ACZB 5LIWX 4BCEA 1BXCA 1H2JA 4YTQA 2BWGA 1QI2A 1G6CA 3EWYA 3ABRA 4MF4A 4M19A 3R94A 3UERA 2E6DA 4DXXA 2CLKA 4UB9A 4J3UA 2PZNA 4GJIA 4I9AA 5HJXA 4B16A 1MUCA 1E0XA 5CPNA 2WMKA 1AW2A 1EP3A 4TX8A 3CS2A 3T2OA 4KT2A 3BOLA 1A5AA 3UESA 4CQDA 4G5DA 2ZZ5A 3KOFA 1MYRA 3V5CA 1E9LA 1SO5A 4OBRA 5JH1A 2D0FA 1HF6A 4UC5A 3K2GA 2VCBA 3SO7A 3OGRA 4OOZA 1ODZA 3ZQ9A 4A8IA 1G69A 3VM5A 1ZUAX 1WDWA 4HZMA 2IW0A 3NIYA 1TPEA 1DBTA 2G97A 2D0GA 4QS5A 2BB0A 1YYAA 3ZIZA 3WLMA 1O5RA 3ZJ7A 3HB9A 1IGSA 1VCFA 2W62A 2Z1KA 2AQVA 2ISDA 2INEA 3N11A 3SRHA 1ZJIA 4M8UA 4LBSA 5HPCA 4WKAA 4TV5A 2PAJA 1CI1A 2DZWA 4FNSA 1W31A 4JTGA 1AH4A 4F9JA 5DLCA 2YL5A 1TFVA 4JDBA