1VLIA

Crystal structure of spore coat polysaccharide biosynthesis protein spse (bsu37870) from bacillus subtilis at 2.38 a resolution
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
367
structure length
358
Chain Sequence
b'AAFQIANKTVGKDAPVFIIAEAGINHDGKLDQAFALIDAAAEAGADAVKFQMFQADRMYQKDPDVSIFSLVQSMEMPAEWILPLLDYCREKQVIFLSTVCDEGSADLLQSTSPSAFKIASYEINHLPLLKYVARLNRPMIFSTAGAEISDVHEAWRTIRAEGNNQIAIMHCVAKYPAPPEYSNLSVIPMLAAAFPEAVIGFSDHSEHPTEAPCAAVRLGAKLIEKHFTIDKNLPGADHSFALNPDELKEMVDGIRKTEAELKQGITKPVSEKLLGSSYKTTTAIEGEIRNFAYRGIFTTAPIQKGEAFSEDNIAVLRPGQKPQGLHPRFFELLTSGVRAVRDIPADTGIVWDDILLKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Spore coat polysaccharide biosynthesis protein spsE (BSU37870) from Bacillus subtilis at 2.38 A resolution
rcsb
molecule keywords Spore coat polysaccharide biosynthesis protein spsE
source organism Bacillus subtilis
molecule tags Biosynthetic protein
total genus 106
structure length 358
sequence length 367
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03102 NeuB NeuB family
A PF08666 SAF SAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1vliA01
3.90.1210.10 Alpha Beta Alpha-Beta Complex Type Iii Antifreeze Protein Isoform Hplc 12 Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 1vliA02
2ZRWA 3VNDA 3PG8A 1GYNA 3HB9A 2V30A 2QUVA 3NPWA 2C18A 4DBEA 4IWWA 1KBJA 1HL2A 3W07A 3P5YA 1XDLA 1OF8A 5EPDA 4JTUA 4NX5A 2WSQA 4XBSA 5H2ZA 3DU0A 4JTKA 4UR4A 2J9XA 1C9DA 2HS6A 1XBXA 3CEUA 2H8XA 1GVRA 1X8FA 3FIGA 3MP3A 3W2LA 4AWTA 3SR7A 1VHNA 9MSIA 4UTMA 1D9EA 4WUIA 2WO5A 2YGYA 5K9DA 3QH2A 1OHLA 3MYOA 2NWRA 2C0AA 2C14A 4QIUA 4AXKA 1TREA 2V5LA 2E5BA 3STEA 1T0OA 1VLWA 5LNVA 3G8EA 3DGRA 2B4GA 1H7OA 1YDVA 5F2LA 2YCEA 3NM3A 1SU5A 3LXCA 3NQ8A 3LXAA 5HR6A 5A8GA 1IGSA 5D03A 5EMUA 3OEXA 1W37A 3WFAA 5EKYA 1TPC1 1HUVA 1TYGA 1ZJIA 3CIXA 1SO6A 4A29A 1DORA 3NOEA 3QJAA 3QC3A 3NQVA 1SO3A 3TAKA 1GZGA 4GJ1A 5EY5A 3PG9A 4IQLA 1B7JA 2NUXA 4FNQA 4MZ1A 1R2SA 2H3BA 2NX3A 1P5BA 2I1OA 2V5BA 3HOJA 2GVGA 2TYSA 2TRSA 1YXCA 3MI2A 1SW7A 1X6UA 2WSYA 3M44A 2FFCA 4QITA 3MSIA 1H60A 4LC8A 3DI1A 3UQNA 2ZRXA 3RFAA 2WKJA 1GOXA 3GX9A 1L6WA 3C56A 4LVAA 3LERA 4PFMA 1QWGA 3W7RA 5K9XA 4N4QA 1SPQA 3AJXA 1KM3A 2QCFA 4GXMA 4AHOA 4DQWA 2ALDA 4K8EA 4PC8A 2IQTA 4FX6M 5DY3A 4FNRA 4CQ9A 1NVMA 4QQ3A 1W5OA 2QCLA 3N14A 4UR7A 3V75A 3HQ1A 4RXGA 3TCEA 5CSRA 2NUYA 3TQ0A 3KVLA 2AAMA 2GQ8A 3T40A 1PCKA 3VKJA 1NFBA 2DJLA 3P82A 5F4XA 2O7QA 3QQ0A 3RF9A 5DBTA 1LRTA 2PRHA 1KM6A 4GUGA 4WXZA 3WJWA 3NZRA 1PHWA 1KBIA 3L0GA 1SZEA 3KRUA 8TIMA 1J4EA 4FO4A 1MXSA 2GPTA 5HQEA 1K02A 3NQMA 3G24A 4O15A 4X9SA 3GR8A 3S1XA 4UTIA 4FIRA 3IIOA 4WX2A 4S2BA 4H3DA 2XN2A 4E0CA 3N9SA 3ANYA 3P8JA 4PCFA 4DO6A 3P5ZA 1T96A 3QFEA 3U8GA 1I8JA 3LCGA 1TIMA 5H91A 1LROA 1LZOA 2A7NA 4U28A 6AMEA 3E9AA 1AMEA 2EHHA 3LGEA 3DFSA 4UFMA 2ZFAA 1S5TA 3IGUA 2QUTA 3B03A 5D2XA 3NYZA 3PBWA 1BKSA 3G0SA 4IMFA 1J2WA 5KTLA 3DFQA 5BMXA 4WY0B 1NF7A 2DJXA 4GUJA 2YYUA 5C5YA 3RK8A 2ZDRA 2NUWA 1SFLA 1XBYA 2BXVA 1ZCOA 5TQLA 4X22A 2B7NA 3QSRA 3LHWA 3SIZA 4R34A 5AHLA 3A5FA 1IF2A 3W86A 3R2GA 5LGXA 2BX7A 1B3OA 1H7RA 2OMAA 3NQ2A 1FWWA 5EL1A 4YWIA 2CLKA 4O52A 1GG1A 3RU6A 4BFAA 4IPJA 1OX6A 1KM2A 2DZUA 3EX4A 3N2XA 3FKKA 1UCWA 3HIJA 3MHFA 4O0KA 3ABQA 1PS9A 4HNVA 3HG5A 3WK3A 3W22A 2YX0A 2DP3A 1W5QA 1TPFA 4O1BA 2BTMA 3LX9A 1I2QA 3LBMA 3DFNA 2Z6IA 3M9YA 1QPQA 1TPVA 4UFIA 2J24A 4ADUA 5I3JA 3N9RA 2X1RA 3ABSA 3NQAA 1HO1A 1MSJA 3LBCA 3C6CA 2VENA 2QCMA 4LVGA 3PM6A 4K6AA 1W0MA 2FB3A 1OG0A 2JBMA 2RDTA 4ALDA 3UWQA 1TV5A 2WJZA 2W79A 2JK2A 2FQIA 3S42A 4LTSA 1B7IA 1J5TA 4WY0A 3O1NA 4YCOA 4LUIA 1VYPX 2NZLA 4K7VA 2OJPA 4ONVA 4IGHA 1I2RA 3TFXA 3SI9A 4TMBA 1OYBA 1KLYA 3CC1A 1EUAA 3B06A 3ABOA 3G22A 3GDLA 4CCCA 1XM3A 3PB2A 1JQVA 1QPOA 3GVGA 1H51A 2GUUA 3BG5A 3Q37A 5CPNA 1AW5A 4XTDA 3HJZA 3FJ6A 3QMTA 3BW3A 4JD4A 1H1ZA 1SO5A 4W9TA 1VYRA 3VFLA 4AB4A 4RZ6A 3NGJA 3TMLA 1LLZA 5C2XA 3ZFHA 4AMEA 1C29A 5HR7A 4GE8A 1VCFA 3HBLA 4K39A 1VPXA 4A22A 2NX9A 3G1AA 4RZ5A 5I3HA 3LHUA 1OFBA 1JRCA 4I7WA 3SZ8A 2ISWA 2DZSA 1L2UA 2GJLA 1MO0A 2V9DA 2QEZA 3EWXA 3HF3A 3STCA 5D02A 4UTHA 4XUGA 2WSRA 5K2ZA 3FKRA 4QAIA 3A5VA 4DXVA 3CHVA 2ZTJA 4JICA 1YPIA 5K7JA 3NQ6A 3W1UA 3R89A 1AMKA 4O19A 5LSMA 3LHTA 1H7PA 3W88A 2ZTKA 3TX9A 3M47A 4JY9A 3N34A 1EPXA 3I6RA 1SR9A 3LDVA 2RHGA 3NO5A 5D38A 4UR6A 4XWUA 2YW4A 4JTEA 4CCEA 1TO3A 3W72A 2PCQA 4NJGA 1M7OA 2CU0A 4HNUA 1A5CA 2QJHA 3CT7A 2Y62A 4Z0SA 2FIQA 2V81A 1HG7A 1SW0A 2EKCA 3B04A 2VEKA 1ZALA 3W1NA 2QDHA 3TAOA 3E96A 5HWNA 3BLEA 3KFTA 4H6KA 4Z0JA 3B05A 2RDUA 1WQ5A 2E5CA 3GB6A 2LX2A 2Y7GA 1QMLA 3CU2A 5AC6A 5KZDA 3RLVA 4DO5A 1Z44A 1G7UA 2EGZA 3W7LA 2VEIA 1KW1A 1L9WA 4RJEA 2BSLA 4DPQA 1GZIA 5TBOA 3BVJA 3EKLA 3TIMA 2EF9A 3MMTA 4AHQA 1Q3NA 1F05A 5HWMA 3P74A 1QNVA 1LLWA 3PAJA 4NU7A 3LHZA 2A2IA 5U4NA 3KX6A 2Z2UA 4UMCA 4UFHA 1WVOA 2VELA 2GVJA 4RKAA 2E77A 5DBUA 3DFTA 4Z1DA 4CCDA 2PRMA 4N2YA 2NV2A 5CPLA 1B9BA 2HMCA 3UZJA 2XFWA 1JCMP 4JY8A 3KRSA 4OU1A 1QO2A 1VC4A 3TXZA 2YXGA 2CZ5A 4ZQRA 1ZNNA 2JKAA 3EXRA 3QQ1A 4HSNA 2J88A 4JTSA 4JX6A 4R7JA 1GVOA 4IXXA 5AYZA 1Z48A 2RH9A 2F7FA 4XKYB 1T8XA 1IXPA 1Z42A 2GQ9A 2ZBTA 4O54A 4CNNA 3S5ZA 4CQAA 4JTIA 1ME7A 3HPXA 1RR2A 3IRDA 5DXXA 1XCFA 4O1CA 3FOKA 3D0CA 3Q58A 1C89A 4MFEA 2WQPA 3S0CA 3P80A 4LVFA 1GT8A 4K8HA 3PULA 3G1YA 3UPWA 3PS7A 1TRIA 3W23A 1IIHA 3MYPA 1F5ZA 2VFDA 1GQNA 1L6SA 4JTGA 4CNPA 4NXKA 3NZ1A 1JUEA 2NWSA 3L0KA 1Q6OA 2H3DA 3W7PA 1AW2A 4GFSA 4LVDA 2RDWA 2HS8A 2V0TA 3E49A 3AO0A 3BO9A 5DCBA 4RR4A 5FESA 4IXHA 4FX8A 1SZGA 5D2TA 1K8XA 2QJGA 4DPPA 1LBMA 3GYEA 3NQ7A 4KFNA 3TU9A 3GDRA 2ATMA 1N7KA 2C6QA 3NLAA 5CKSA 4DF1A 3I68A 5KINA 4OV4A 1TTJA 1M7PA 4GNJA 3PUEA 1EP2A 3E0IA 3G8RA 1CI1A 3M16A 3TA6A 1KV8A 1I45A 5G4WA 3MP4A 2G95A 1ZAIA 4S1FA 3LM7A 4OWGA 4R33A 4XKYA 1O5KA 1D3HA 1G67A 1YYAA 3I7SA 3WJYA 4LWWA 3HG3A 1RV8A 3MHUA 1ZFJA 3EX6A 1DL3A 3W85A 3KAOA 4RXFA 3A23A 4ICNA 1H62A 2YDAA 4POCA 4UFJA 5E93A 1OK6A 4WQ6A 1FWNA 3PUOA 4KFOA 2ZQ0A 4NJJA 5ABTA 2C19A 3W1AA 4DF2A 5CGQA 1TQXA 3G18A 4EF9A 1H7NA 4IJBA 3S1WA 2W0UA 1OFPA 3AMEA 3MBFA 4ZVJA 3L5MA 2YW3A 3JR2A 4M6QA 3CB8A 4EWND 3LCIA 7AMEA 3A24A 2Q8ZA 3I7QA 1H7XA 2R91A 1Q6LA 3DFPA 3LCHA 3N2MA 1K7EA 5BOOA 3HG2A 4FNSA 3FLUA 3G1XA 3PVFA 2VFFA 4NQ1A 4MY8A 4LS1A 2NV1A 4KWVA 1TJPA 4RCXA 3M5ZA 4KFPA 4WZHA 3ELFA 3LV5A 1V5XA 1RQEA 1GTHA 4O28A 1FDYA 1TMHA 2ZZ4A 4QNWA 2OX1A 2CW6A 4FF7A 3W2MA 4AEOA 4K37A 1KV5A 4U4MA 4AVFA 5D2VA 1IIGA 1JCNA 4AWUA 4GBUA 3LTPA 3PF3A 1TTPA 1XC4A 3FFSA 4ZQNA 1GVQA 1JULA 4BR1A 4FIQA 1W8SA 5DXYA 4MZYA 1SZFA 3KHJA 5AHIA 2QKFA 5FF0A 3TROA 1TPEA 4IOTA 5D05A 1A5AA 3E02A 4C1LA 4MJMA 2JGYA 2GJNA 4I9AA 3P81A 2ABAA 1U5JA 3W87A 4BI7A 1VR6A 3QZEA 2H6RA 3P67A 2P1FA 1KM4A 2NXGA 5E1QA 1IXOA 4QM1A 2FPVA 3F03K 1OYAA 2E6DA 2WNNA 5DCEA 1JQXA 4O10A 3ATYA 3QPZA 5G1TA 3O8AA 1AW1A 4LS2A 1OJXA 1PCWA 2JKPA 3GXTA 5F4WA 4HNTA 3S9YA 2WPBA 4UTTC 3NR0A 3DHDA 3KRZA 3GKFA 3KVKA 2VFIA 2XN0A 4MOZA 4NZJA 3UWVA 2J9YA 4RV8A 3DI0A 3SW6A 1H7WA 4DEFA 1CW2A 3W3OA 1EWDA 1XKYA 3NQDA 3W7NA 1JCYA 1XI3A 5E0KA 1A5BA 2TMDA 2O7SA 3TC6A 3W7EA 1FX6A 4MZ8A 3QM3A 4RK8A 1LOQA 3CLMA 1YADA 2FPTA 3EEGA 2GOUA 4N02A 5CG7A 4FXRA 4JX4A 5FEZA 3ZR4A 4XQ6A 2QCDB 3B0VC 3W2KA 2H8ZA 4JS3A 1LOLA 1WBJA 4AH7A 3LB0A 5G5IA 2PC4A 4O14A 1JJKA 2QJIA 1DQWA 4JEQA 4Z1AA 1QFEA 4CLMA 3G1SA 2YZRA 3G3MA 3Q2DA 3TDFA 3JS3A 1H1YA 3IVUA 3C2VA 2ATSA 3MBDA 3TW7A 2E5DA 1FUYA 1D3GA 3PBUA 2VFHA 3GNNA 3MP5A 3W7QA 2CLFA 3LCWA 1SUXA 3DBPA 4OHQA 2CWNA 5U7SA 3W1MA 2CZDA 3C2OA 3BV4A 2V2HA 1ZHAA 5EYWA 1K8ZA 2VC6A 5CSSA 4FNPA 2VFEA 5J5DA 3RLUA 3IIZA 1OX5A 5DELA 3ZS4A 1TV8A 1WYIA 3L9CA 5AC8A 5CPOA 3T78A 3HO8A 1W3IA 3IIXA 5BRBA 4TO8A 1VLIA 3W1PA 1QOQA 5C55A 3MI6A 4LVBA 3QF6A 5AB3A 4AAJA 3OA3A 4LRTA 2QCDA 2UV8G 3OVQA 4NJKA 1OFDA 4QJ1A 1BWKA 3NL5A 2CLLA 3TC7A 5T26A 2BZNA 5D32A 3V1PA 2ZRZA 3BW2A 1HG3A 1V7YA 1X1ZA 3F1QA 1G7VA 3N3MA 2HSAA 4IMGA 3W74A 2ISSA 4DF0A 4QNEA 4ZQOA 2ZYFA 3C61A 1UUMA 2Q8LA 4O8RA 5F4SA 4UFKA 1P1XA 3UWWA 4MFDA 3O06A 5KZEA 1JVNA 3M6YA 5KSWA 5HUOA 3TMQA 4N9EA 4ML9A 1H61A 3EWYA 3QSTA 5K3VA 3E12A 3MW7A 3NVTA 2MSIA 1GEQA 1XUZA 4JYFA 1O95A 5AYXA 3WJZA 2A7RA 3CPRA 1OPSA 3CTLA 3P8IA 3TSBA 3VCRA 3UNDA 1H5YA 4FNTA 2C3ZA 5DN1A 1H63A 1JRBA 2PURA 2DZTA 1KTCA 2LLEA 5AHFA 1F6PA 3FEMA 5FF4A 4UNLA 2A1YA 2CLEA 3BK0A 3PWAA 4O17A 3QRHA 4LV9A 2ZA1A 3HMJG 1AG1O 4E38A 1KTNA 3M5XA 5D33A 4IUOA 3GNDA 1W54A 3FS2A 1LDCA 2GQAA 1EP3A 5FEXA 2NX1A 3L68A 3BPWA 3L2IA 4CQ8A 2Y61A 3LLDA 1XDMA 3G1DA 5G2WA 4JN6A 3R5EA 1DOSA 4BI6A 1K3UA 2I9EA 2YSWA 3YPIA 1UASA 1MZHA 4TMCA 3L66A 4O50A 2ABBA 1OYCA 2AMEA 3NDOA 1ME8A 2Y7EA 4MYAA 5BNKA 4H4IA 2KZHA 2Y70A 4WXYA 3ABRA 4LC6A 5F1UA 3W7KA 4UNKA 3GAKA 4JIPA 1QPNA 4NVTA 3QW4B 5D04C 4DBDA 3PC0A 1XBVA 2PRLA 2GVLA 5G2HA 2RFGA 1YXDA 4UMBA 3FJLA 4GUHA 3OVPA 2Z6JA 1A53A 4HPJA 3NL2A 1KDEA 4HPXA 3TSDA 3GXPA 4YLWA 3F4NA 1VS1A 4BI5A 5AC7A 3B0PA 3W75A 3C3NA 3HPZA 4JTLA 2I14A 3OHIA 2QCNA 1NF0A 2RKXA 4G1KA 4XZ9A 3EX3A 4YCPA 3UD6A 3C2EA 1VZWA 4TR9A 1QR7A 1YLVA 4NZFA 4R53A 3B8DA 1KDFA 3W7GA 1LBLA 4Y8FA 4LU0A 2X2GA 1WXJA 2ZZ2A 3L67A 5IM51 5HUPA 3OIXA 1TTIA 1SSDA 1EX5A 1FWRA 1MSSA 4UTKA 2VEMA 5DCDA 2A21A 3BGJA 2ZRYA 4AF0B 4UUIA 1GYLA 2C16A 3IGXA 1PIIA 4N6EA 5BMWA 4JX5A 4O13A 3TKFA 1F6KA 4QISA 1R2RA 2JGQA 3STFA 3PR2A 4KKXA 3NQCA 1FXPA 5C6MA 2P0OA 3S5YA 1AL8A 3K30A 1SO4A 3LXBA 4EIVA 1YDOA 2QUUA 3HGOA 3GAYA 2X1TA 4JTTA 5DY2A 3LRKA 5LNUA 2G96A 4MJZA 5CZTA 3TJXA 1OVDA 4X2RA 1YDNA 1KFLA 3HGJA 3C2FA 2A6LA 2ZZ1A 3MJYA 5L6UA 1I2PA 4XTIA 5K4XA 1OFEA 3INPA 3O63A 2CLOA 3PBYA 3BLFA 1RPXA 4JXCA 1ICSA 3M43A 3TQKA 1UUOA 2VFGA 2PE4A 4NJIA 3IIVA 2X16A 3G3DA 4Y90A 3DHFA 1YTDA 4L4LA 4GUIA 4J9JA 3CEPA 1ZAHA 1WOAA 1Q45A 5LZLA 1KFKA 2WV8A 1G4SA 3CWOX 3R12A 4M7SA 4AF0A 1PHQA 3EKZA 5FF7A 3CQ0A 4GRSA 4Q32A 6MSIA 1OX4B 3LLFA 1FBAA 1GVFA 3BG9A 1KFJA 2E1DA 3LHYA 3P84A 1JR1A 1IXQA 1K7XA 3TFCA 5FI8A 5D37A 5LNSA 4AWSA 5C54A 1A5SA 1KTBA 1EA0A 2ZZ3A 1S5VA 1EP1A 1FDZA 3G1HA 3W83A 2V2DA 2OZ0A 1VHCA 2ZZ7A 3CWNA 2NLIA 1W5MA 3C8FA 4S2CA 1ICPA 2G5WA 3IV3A 5G4EA 2F84A 3W6YA 1TSIA 2VXNA 4D2JA 4JGDA 3EX2A 1DVJA 1VCVA 3ZWSA 4NXSA 1QPRA 1N8FA 5LGZA 1UBSA 1BTMA 1A50A 4KWWA 4M5PA 1X7FA 5CZ0A 1IXNA 2C13A 3QYQA 3WJXA 3NPVA 3WK2A 3GXNA 1LCOA 1NSJA 4Y96A 3T4CA 4MY9A 3TE9A 1XBZA 4FEZA 4ZL1A 2QCHA 4C1KA 1NAL1 1DJNA 5AHMA 2ZRUA 1KFBA 1FCUA 3M41A 2ZZ5A 2TPSA 2DZPA 4ORMA 1QCWA 3W70A 1GWJA 5I3FA 1KM0A 1RQHA 1MEWA 3THQA 2HTMA 1W3TA 4IPIA 4Y9AA 4Z08A 3NXFA 7TIMA 1LBFA 5F2MA 1HO4A 1OX4A 3EWZA 3RMJA 1UB3A 3CM4A 4OQVA 4RLIA 2FDSA 4BF9A 1K03A 4OE7A 1G4PA 1M6JA 3M1ZA 4O1AA 4X3ZA 1KA9F 2A6NA 3DKLA 2W6RA 1DHPA 1R2TA 4I7VA 4TX9A 4JR5A 1Z41A 3NEVA 1I2OA 1E51A 2FJKA 1O60A 2CZEA 1G69A 4HHPA 3T44A 3W73A 3JRKA 4BWLA 2VEPA 4O57A 4JDYA 4ORIA 4MLRA 1GJPA 1TV7A 9AMEA 1L6YA 3NL6A 4RX0A 3O15A 2FPYA 3H54A 2Q3RA 2FTPA 2G97A 3PBVA 4ADTA 5D2WA 4HIBA 1F74A 1ZENA 4PL2A 1KFCA 1B4EA 2R8WA 3GDTA 2WNQA 1GTEA 4O16A 1B4KA 3FA5A 1OFQA 1B7KA 1VCGA 4A2RA 4EOUA 2Y63A 4O11A 1FQ0A 2C15A 3G1VA 4DO4A 1PE1A 2X1UA 3S1UA 1K7FA 4IMDA 4TIMA 2DZWA 2FLIA 3NQFA 4NX0A 5KITA 2JIAA 3KXQA 3W7HA 1JCJA 1P0KA 4ZQCA 5IBXA 3F4WA 1R47A 1W56A 2YR1A 1TRDA 3GLCA 3HG4A 5FEWA 1TPUA 3MO7A 2DZXA 1OK4A 1ONRA 5LNWA 4GC4A 2LX3A 1G4EA 3PSVA 2TSYA 2FB2A 4PODA 3IVTA 3ATZA 3G1FA 3W1LA 2OT1A 4MY1A 3P61A 1AL7A 3OG3A 6TIMA 4FNUA 3NQGA 2E6FA 3W7CA 3P60A 6ALDA 5CZSA 1C8VA 1F76A 3UY7A 3FRNA 2DORA 4MUZA 3EX1A 3TUUA 3SECA 4HN4A 4NUWA 1CX9A 3S8HA 1H50A 2X30A 4NY6A 1O5XA 1WAUA 1WA3A 4JNMA 1R46A 3NQEA 5I3GA 3MI3A 3EXSA 1VH7A 5K4ZA 2Y6ZA 3I65A 4UTWA 5I3KA 4PEKA 1EUNA 3N19B 1GPWA 3N73A 4TU1A 4GUFA 1JUKA 3USBA 3W84A 3RNDA 3UZ5A 3VI2A 3TJLA 4LNYA 1TB3A 3DENA 3ZWTA 1RZMA 3R8RA 3IIPA 5FF2A 1TPDA 3WK1A 1Y0EA 2QCEA 3QEZA 2QAFA 4B5NA 1YPFA 5EA9A 4DELA 3P7YA 3FYPA 1JABA 2CLHA 3M5VA 2Y85A 1MEIA 3GDMA 5D09A 4M19A 2VKZG 2Z0IA 1ML1A 1XUUA 2V82A 4ADSA 1PL9A 3BARA 3UY8A 4O1DA 4Z1CA 2B7PA 1ADOA 1Q6RA 4NNCA 1VJIA 3O6DA 1UCSA 3GR7A 3O07A 3NA8A 1SSGA 5G2IA 1FCBA 3QMSA 5CZJA 2ZA3A 8AMEA 3IVSA 1TPWA 3NL3A 3QW3A 1DJQA 1EB3A 3QPYA 4LV4A 5F2GA 4UTJA 1HFBA 3M7WA 4JTJA 3H53A 4O0ZA 4OT7A 1LTDA 1YTEA 3HGRA 3L21A 4JYDA 4N4PA 4K38A 4IMEA 2A85A 1LOSA 5D2YA 3SGZA 2J27A 3Q94A 1W5PA 1KM5A 3MUXA 5LHFA 4JYEA 2QCGA 3THAA 1LYXA 4ZZ9A 1LRQA 4BK9A 4Y6GA 4HT3A 4AMAA 4IX2A 5A5WA 3UWZA 4MSIA 1OABA 1P0NA 3GIYA 3TNOA 1LM1A 3L5LA 4K36A 3W1XA 4FXSA 1VRDA 2V8ZA 1FWTA 2WNZA 2DU2A 5HMSA 1OFAA 1I4NA 3LI0A 4GWEA 2YFNA 4MYXA 2A4AA 3LHVA 3A9IA 3BG3A 4M7TA 3B4UA 3LCXA 4HSOA 4BWLC 4MLJA 2B7OA 4O4VA 4E2DA 2EPHA 1DV7A 3NG3A 4LW7A 4UTUA 3TW6A 4YXGA 3S6DA 1QDSA 1R30A 2Z1BA 3DAQA 3TV8A 5AN7A 1QO5A 4PTNA 4XBKA 1N55A 2X1SA 3O6YX 3EWWA 3C0JA 2Q3OA 1G4TA 5DLCA 3IEBA 1S3HA 2E6AA 4WOQA 2E68A 4FHAA 3U6WA 3O05A 4RZ4A 2BLEA 5HNRA 4QSHA 4FB7A 3UWUA 3PY2A 2CFFA 1DQXA 3W2NA 3LTYA 1QAPA 1EEPA 5J5RA 4JDBA 1RVGA 5F2IA 5IBXC 4CNOA 4N9DA 4ZMGA 4HKPA 3BW4A 2QF7A 4JTHA 3B0UX 3TSMA 4UMAA 3W7IA 3T7VA 5KZMA 3DFOA 3SFKA 1S5WA 1U83A 3W7JA 2R94A 2YPIA 1O94A 2WOQA 2YFOA 1TPB1 8MSIA 2CZFA 3W1QA 3M5YA 3NM1A 4A2SA 3GKAA 5HWJA 4PL1A 2QCCA 4UCGA 1ZY9A 2H90A 4UTWC 1B57A 4WOZA 4A3UA 1FY6A 3G0XA 4PA8A 1JCLA 5HULA 4UC5A 5I3IA 3I7RA 3TXVA 1K8YA 2Y89A 1EWEA 4YMZA 4N9BA 1ZAJA 4UIOA 3HGSA 1LRNA 1TPH1 4NNBA 1F73A 1SW3A 3LTSA 1C8AA 2AGKA 3DZ1A 3OBKA 3W2JA 5AYYA 1ICQA 3TK7A 2E09A 3A22A 2NXHA 1PVNA 3S5OA 1T99A 3SGUA 3W9ZA 3PUDA 2J6XA 2R14A 1XXXA 3KVJA 4HNNA 5G1YA 3MWAA 3DXIA 1DBTA 1I2NA 1TJRA 4NNAA 3UYCA 2Y88A 4O18A 3HPSA 3O6CA 1BEUA 4OGZA 4UR8A 4NT0A 3W71A 4IMCA 1BWLA 3UWYA 3CIWA 3WK0A 1SFJA 1ALDA 3C2RA 4OBTA 3PB0A 5LNRA 1W3NA 3LCLA 5BW6A 1TQJA 4Q33A 4UTLA 3EWBX 3SY5A 5L9FA 3G0UA 4JIQA 4LS0A 4ZQPA 1RD5A 1HTIA 1PV8A 1YXYA 5MSIA 3LV6A 5AOUA 2OCZA 5LHEA 3NNTA 4WY0F 3LRMA 2CLIA 4PH6A 2JKEA 1LORA 1TTQA 4K7YA 3WJSA 3NAVA 3P62A 3TQVA 1OFOA 2AQWA 3NPXA 5CPMA 4LUJA 3QMRA 1F7BA 1W1ZA 2CLMA 2Y7FA 3VE7A 4N9CA 3M0ZA 2QR6A 7MSIA 3BGGA 3L65A 3BLIA 1FCVA 4AHPA 3UPBA 1M5WA 4LOCA 3H55A 2VOMA 3SJ3A 2QAPA 3MHGA 3VE9A 3GDKA 5EBUA 3L0NA 1RQBA 4O4WA 2ZA2A 3UXDA 1GG0A 3W7OA 2B0MA 2V2CA 4MPQA 3TH6A 3FYOA 1O4UA 2OT0A 1QOPA 4JTFA 3C4UA 3S1VA 3NPUA 1KFEA 5HJLA 3EB2A 1OF6A 3GZ3A 1WBHA 2YYTA 3OVRA 1FXQA 4WJEA 1GVSA 1FWSA 3T55A 3RDNA 1W31A 2EAWA 4OV9A 1Q6QA 3W2UA 3W76A 1VYSX 1YTKA 4LY8A 5K9CA 2D73A 4N6FA 5AHEA 1VQTA 2B7QA 4P61A 1VGAA 1MSIA 5HINA 3LI1A 1EIXA 4LRSA 2SPGA 3C52A 1NEYA 1XFBA 5D30A 4Q4KA 5FF3A 4NJHA 4L4MA 2DZVA 3O16A 2ZZ6A 2BWGA 1MEHA 5MHBA 1XL9A 2MSJA 4MIMA 1THFD 1SQ7A 4UTTA 4Z1BA 5AFDA 2E6YA 2ZRVA 4MVAA 4FX7A 5AHNA 2ISVA 5F1VA 4I7UA 3U2OA 2NXIA 4IX0A 3R13A 1WDWA 3W7MA 4P2VA 4MKNA 2A7PA 3QF0A 3STGA 3LRLA 1P4CA 5LKYA 4LT9A 4ZQMA 1UJPA 2J9ZA 4A21A 1EKLA 4M6PA 3GK0A 4WD0A 1G6CA 3DH7A 1DKWA 3UXAA 3L5AA 3KVMA 1SZNA 2C1HA 4O12A 1ME9A 4EF8A 5SWUA 1LP6A 1AK5A 5GVJA 1JCXA 4E2BA 4EVZA 3IGSA 3S5NA 3EWUA 3LCFA 1F2JA 3W7DA 3TR2A 3EXTA 3DKJA 3A21A 1WX0A 2P10A 3W1RA 3KOFA 4YL2A 4O53A 2Y7DA 1W5NA 2XN1A 4UXDA 4UFLA 5KMYA 1KLZA 3LOTA 1JUBA 4M6VA 2ZCGA 3PSWA 3W1TA 1FDJA 1OFRA 1TCDA 1FCQA 3SSJA 2A5HA 2A0NA 2QDGA 5FEPA 1WV2A 5TIMA 1X1OA 1KM1A 1WOBA
chains in the Genus database with same CATH superfamily
2ZRWA 4EPEC 1NFPA 3HB9A 2QT3A 2C18A 1UZ4A 3KCOA 4IWWA 4PTMA 4L64A 1KBJA 1AQHA 3P5YA 5M5DA 3SRHA 1GHRA 4NX5A 3ZJ8A 4JTKA 1UP2A 4FA3A 4UR4A 1C9DA 1A3WA 1K9DA 2G3MA 2H8XA 4S3BA 1CGWA 1KGUA 1UIPA 2YGYA 1NTHA 4FSAA 1GOKA 4QIUA 5MKGA 1FFQA 4AXKA 4PFHA 1MNZA 4LUYA 1T0OA 4V15A 3DGRA 1OIFA 3AIEA 1A3XA 3NQ8A 5HR6A 1MXDA 3WD0A 3ZOAA 4IIHA 4J3TA 5EKYA 1SO6A 4FMVA 4A29A 4IHCA 3AIUA 3SM0A 1EXPA 3NQVA 1SO3A 3TAKA 1FKXA 2G4FA 1B7JA 4US6A 4JTQA 5C2CA 3XINA 1K70A 2NX3A 1P5BA 2I1OA 3R0DA 2V5BA 2YLLA 2GVGA 3MI2A 2E8YA 2C71A 2WSYA 3M44A 5HK4A 2IPJA 3MSIA 4LC8A 3DI1A 4CNUA 2VO5A 1OC6A 4F40A 3GX9A 4Q7IA 4LVAA 1VPQA 2VNCA 2VVNA 1QWGA 3E1F1 1MW1A 3GHRA 2GGGA 2QCFA 4GXMA 2PZ0A 4PC8A 4A8IA 4CQ9A 4I8DA 5A6KA 4LCRA 4QQ3A 1QI5A 1D7KA 4L1WA 4GNKB 2DT1A 3V75A 4I6KA 1WUFA 1MRQA 1KGWA 1RLCL 5AC4A 3WBYA 1PCKA 2DJLA 3PFMA 2Z2BA 4A3QA 2NQJA 2VX7A 5DBTA 3UXIA 2UY4A 4WXZA 3WJWA 4W7VA 2YCKX 8TIMA 1SZEA 5DMYA 5DRIA 2GPTA 1KWGA 3NQMA 4X9SA 2YA0A 3S1XA 2ZXDA 4UTIA 5B7YA 4FIRA 3DGBA 2CXGA 1HJUA 4IICA 1X39A 3ARRA 2AOSA 3H6OA 3VNLA 3GC2A 1JGMA 4DO6A 1T96A 2ASHA 3PZMA 5EB8A 3LCGA 4NF7A 1TIMA 5H91A 5I23A 1LROA 1X8CA 1G01A 1LZOA 4JQ3A 4DYJA 3LGEA 2EO7A 3ARYA 1S5TA 5FAJA 2VVSA 3EDFA 3RYSA 4O0QA 4IMFA 3K4DA 3PJWA 3BAYA 2PTWA 3NUKA 3CQJA 3RK8A 4M29A 1Y7VA 5CZKA 1XBYA 1V02A 1ZCOA 4MDOA 1DHKA 1ZP4A 4X22A 2B7NA 3U9IA 3LHWA 1LJYA 4R34A 1IF2A 3W86A 2QDEA 3TN3A 1H7RA 4YWIA 5BRPA 4GBDA 2O0TA 3L7RA 4QG8A 2VWTA 1KM2A 2WVVA 3UZYA 3VCNA 1LWHA 3EX4A 1E15A 1KCLA 3ZT6A 3H23A 1V3IA 4H01A 3WQ4A 1PS9A 4HNVA 1BF2A 3WK3A 3BQ5A 3B8WA 4KGLA 1FH8A 3LX9A 4AZHA 3WDRA 3AS3A 3LU2A 4XSMA 2J24A 8XIAA 3ABSA 1ODZA 2VZTA 2VENA 3DYMA 4WJ8A 1G5AA 3WQ8A 2RDTA 1GQKA 1ISXA 1Q6FA 2W79A 2VJXA 4OOUA 2ZX5A 3K4WA 4QEHA 1B7IA 3O1NA 1RA5A 4YU1A 4LUIA 2OJPA 4HYVA 1I2RA 1KLYA 2OLHA 5LYRA 2PMQA 3ABXA 3GDLA 3GNOA 3WEMA 3PB2A 1JQVA 1FKWA 3GVGA 5HATA 3AXHA 1ITCA 1K4HA 5CPNA 1CGTA 5LIWX 1GVIA 4HK6A 3AXXA 2BY2A 3DX5A 1QVBA 4KMQA 3AMGA 1XIJA 3ZFHA 3ICJA 4UTFA 4AMEA 1ECQA 3CBWA 1PAMA 1Q13A 4UZSA 4A22A 3GH4A 3LHUA 2V5DA 1JRCA 1HQTA 2QEZA 3HF3A 1UD4A 3AHYA 2VP8A 3IJLA 4H9UA 4DXVA 3W1UA 1YNQA 2I57A 1AMKA 2OSXA 3M47A 2HISA 4JKMA 4L6HA 1JEZA 3NO5A 5D38A 4ZODA 1TO3A 2DT2A 2PCQA 4HNOA 1O66A 1JGIA 1A5CA 2QQ6A 2XDFA 1HGYA 4H9VA 1ZBKA 2EKCA 3B04A 1XFCA 2E40A 2VEKA 2W92A 3L4TA 1BWVA 4W84A 2ZOXA 1ZALA 3EPNA 5I06A 4DZAA 4DJDA 4RW3A 3GD6A 1WQ5A 2F6XA 3R94A 2VQTA 2LX2A 2VGGA 3IGHX 3VDAA 5AC6A 1DE5A 1XR2A 2V3DA 5D8WA 5CC7A 1G7UA 3DESA 2EGZA 3P0XA 1L9WA 2GSEA 4DPQA 5TBOA 2J7HA 1E9ZB 1V6WA 2VWSA 1Q3NA 3DG6A 3TNBA 4D6DA 1ITUA 1REQA 2A2IA 6A3HA 4UMCA 3BV7A 1WVOA 3W82A 2GVJA 1EPVA 2E77A 4C5YA 4XIMA 3S6OA 3UR7A 3UGRA 4LYQA 2F9RA 2NV2A 1UKTA 2V38A 3KRSA 1A47A 2X7WA 1WDDA 1S46A 4U3AA 4OU1A 4UWMA 1VC4A 2X2YA 2BNJA 2DVUA 3EXRA 4HSNA 1KCZA 2J88A 4JTSA 5HPOA 3QN3A 5AYZA 3ECQA 3ZLHA 2F7FA 1IXPA 2GQ9A 3FSTA 4CNNA 4QLKA 3UEQA 3WBAA 4JTIA 4AWEA 1PWMA 2D2JA 5DF0A 2E9LA 3WH9A 3VGEA 3BGAA 2GDQA 3Q58A 2E28A 3CO4A 3KOYA 4LVFA 3HU7A 1MFVA 4U5IA 3MYPA 1F5ZA 1GZJA 1IZJA 1WKFA 3H7UA 2J66A 3W7PA 3QPEA 1O5RA 5G1MA 2HS8A 2X1IA 3M0HA 3AO0A 3U48A 5FESA 2D0FA 4IXHA 4QJ5B 4LALA 3VX1A 3M0XA 5HOSA 3DBNA 1UD5A 2ATMA 3AXKA 3TYCA 3NLAA 3ITVA 5KINA 1TTJA 4HMNA 2WVSA 1JYWA 3EOOA 3QHNA 4Z2GA 4NZ1A 5JU6A 3TTOA 4WKHA 2I56A 1HKIA 2PLJA 2XGBA 4S1FA 2BDQA 4ZTXA 3S5SA 3JVAA 3BAIA 4W8AA 4OWGA 4LUTB 3ZLGA 1D3HA 3TN6A 1RCOB 1YYAA 2PD9A 3CUXA 3SIMA 3NTYA 2RGLA 4G6CA 4RV3A 1ZFJA 3SCQA 1S39A 3EX6A 3HA1A 3QKZA 1SR0A 3KAOA 4S3AA 3A23A 3CV2A 3RJXA 2ZADA 4GI9A 4ICNA 1H62A 1AFSA 5E93A 1AH0A 2ZQ0A 5ABTA 4REQB 2W66A 2J75A 1UMLA 4DF2A 4C90A 2RDXA 4A8LA 3U0HA 1H7NA 3L5MA 4PMVA 5HANA 4Z42C 1P7TA 1U5VA 3CB8A 2WC3A 4EWND 7AMEA 4QHRA 1JPDX 2R91A 3RIKA 4HYRA 2PLCA 1K7EA 5BOOA 2PC8A 4FLQA 4LS1A 1CXEA 1HJWA 4RCXA 3M5ZA 4HHMA 4WZHA 2GJXB 3LV5A 1V5XA 1XCWA 2GGEA 1EJWC 1GTHA 5LA2A 3QLLA 4XG1A 4AEOA 1C7TA 4K37A 1E6XM 1KV5A 3WH6A 5H1WA 4GGHA 2OKTA 4GBUA 4M56A 3OO2A 7REQA 1TTPA 4ZQNA 4MJ2A 1WKEA 4PBEA 1JI1A 1CXIA 2ZUSA 1LG1A 3TROA 1B9ZA 4QX4A 3EDDA 3ARZA 4PULA 1A5AA 3UESA 3UCCA 1PWLA 3MVIA 1BXNA 4FZIA 5A6MA 5REQA 2JGYA 2GJNA 4H6RA 4ICCX 3CUZA 4QG9A 3WUBA 1XGZA 1U5JA 3UZZA 4M81A 4D8ZA 1KM4A 2NXGA 1AZ1A 5FL0A 2E6DA 4Q4QA 4O10A 1Z6KA 4QCEA 2INFA 3DIPA 3ZT7A 4PUJA 4DNHA 1OJXA 1EYEA 5F4WA 3NR0A 2XN0A 2NSOA 2QV5A 4AZCB 1C8YA 1VFOA 1OEPA 2ZUTA 4K3ZA 1Y5XA 4DEFA 2H9AB 3PZGA 3CZGA 3WMSA 1XKYA 5HQMA 1IZKA 1MVYA 3TC6A 1TVLA 6REQB 3N11A 1LOQA 4AVNA 3LLXA 1BTCA 2XIIA 2VC9A 5FEZA 2AMGA 3ZJ7A 4XQ6A 5A6BA 4GG9A 3W2KA 3TJIA 4LAKA 2BOFX 2WAGA 4AH7A 5BXTA 3ZZ1A 3AWNA 4ROQA 4I5XA 3WUEA 4J3WA 1HW6A 4CLMA 3G1SA 4PGLA 3G3MA 3JS3A 3ARPA 2OYKA 3BZJA 1YBQA 1H1YA 3IVUA 3C2VA 3T0AA 5C9ZA 4CN6A 1JZ5A 2IPFA 3UXKA 1FUYA 1D3GA 3V3WA 5JIWA 5C0QA 2CC0A 4XD5A 2CLFA 2IPWA 3LCWA 1DE6A 1A5UA 3PTDA 4XAPA 4NZ5A 5BU6A 1V3KA 5CSSA 4FNPA 4FK9A 1OX5A 4V33A 4EAMA 3DC0A 1GQIA 1XRVA 4XIAA 5CPOA 3T78A 4LANA 1VLIA 2R1KA 2JQXA 2Y1HA 2Y24A 3MI6A 4F9DA 4EPBC 4AAJA 5AB3A 2QCDA 3OVQA 4WDTA 1BWKA 4OJYA 4CEXC 3TC7A 5FL1A 4XZWA 1TX2A 3BW2A 1K1DA 1SJDA 1JDDA 3BLPX 1HNYA 5JMUA 4QNEA 4ZQOA 4HMCA 3RX3A 1XG4A 4H83A 5GNZA 3LUTA 1EL3A 4MB3A 2OEJA 4J27A 3UWWA 2QPUA 1DTUA 4MFDA 2RJGA 3AU2A 3M6YA 3QY7A 5HUOA 3IV8A 5K3VA 3PFRA 2MSIA 3L4WA 4JYFA 3L4UA 1AQMA 4US5A 4Y9NA 5AYXA 1WO2A 2A7RA 3CPRA 1OPSA 4B5UA 2WZIA 1EHAA 3TSBA 2OZ3A 4C6QA 1KTCA 4JFSA 3VUPA 5E9AA 1F6PA 4O17A 3V16A 2ZA1A 5FD0A 1HKMA 4CKQA 4QS6A 3BMVA 1ZJBA 1Q4NX 3FS2A 3RM4A 2GQAA 1OCQA 1MFUA 1ISVA 2OOFA 1CGVA 3L68A 3BPWA 4PCSA 3EPMA 4CQ8A 4V28A 1VEMA 1QW9A 3G1DA 5G2WA 4JN6A 3Q67A 1H09A 1EX1A 1CZ1A 4TMCA 3U5YA 3L66A 4O50A 2D2HA 3PJXA 1W9UA 3NDOA 2FHFA 5BNKA 4WXYA 4XO6A 3ABRA 5F1UA 2WM1A 4JIPA 2EJ1A 4IFOA 3PZIA 3GVRA 4G2DA 2GVLA 4Y9OA 3SN4A 1YXDA 2OGYA 4KQNA 3OVPA 4HA3A 4IIFA 2Z6JA 3NFUA 4HPXA 3TSDA 3GXPA 1E6RA 1VS1A 2WCGA 5AC7A 3B0PA 3CL8A 4AZGA 2QCNA 1NF0A 1GOWA 4G1KA 4XZ9A 3R43A 3C2EA 1QR7A 3TZNA 2ZKMX 4HNCA 3KRBA 4Y8FA 4LU0A 1WXJA 2REQB 1TTIA 1P6CA 3OIXA 5FOOA 1FWRA 1A80A 4UTKA 3IRSA 2OEMA 4ZFCA 3VGDA 2YBUA 1CLVA 4PBFA 2MUCA 4GYFA 3TKFA 3A4WA 3OVGA 4PTVA 1BG9A 2JGQA 3QV7A 5J04A 1DYSA 2VUYA 3NQCA 3BLOA 5C6MA 3L4VA 4Q4SA 2FZNA 2P5NA 5M2FX 5DY2A 3LRKA 3URAA 5LNUA 1LQ2A 4H04A 3HGJA 3C3UA 3MJYA 1HVQA 1I2PA 4XTIA 1OFEA 2DH2A 3PBYA 4L1GA 1J6PA 3GU9A 1ICSA 3M43A 4NP7A 3AHVA 4O1EA 5BROA 4RNIA 2AL2A 4MMWA 3WQOA 4NJIA 2X16A 2Z27A 3TLQA 1KRMA 1PTDA 1DPMA 3BURA 5E0FA 1E71M 4QXIA 1Q6GA 4CCZA 3CEPA 1FVPA 3WF4A 3H4WA 1B54A 4L6DA 1QBBA 2OWCA 4J3UA 2CHNA 3CQIA 2DUXA 3BMXA 1C3FA 2XHYA 1QNPA 4YVPA 1PHQA 3EKZA 1FHUA 2VMFA 3GG1A 4GRSA 1E0WA 3CUGA 1ZCCA 5CAHA 1ENUA 3QY6A 3OJGA 5I5RA 3RR1A 3P84A 1JR1A 4WEVX 5FI8A 1R3QA 3N17A 4J28A 1UYQA 1N8WA 4XZHA 3E5BA 3SAZA 1XYCA 2ZZ3A 1S5VA 1EP1A 3B8UA 3N2BA 2ZZ7A 3C8FA 4GY1A 1JD7A 2WWCA 1DXFA 2F84A 3W6YA 5MF5A 1XLJA 3OYXA 4PCNA 3C2YA 5LGZA 4KWWA 1VJZA 4M80A 3QQWA 3KLKA 2RAGA 3QFWA 3LD5A 4ZL1A 3R1ZA 1R3SA 1NAL1 1DJNA 4C1KA 5AHMA 2ZRUA 1KFBA 1RK6A 5D9NA 2ZZ5A 3URNA 1XD1A 2TPSA 4KIEA 3BAKA 4BKNA 4DJFC 2UY5A 5LIUX 1RQHA 3R7MA 3RGTA 1W3TA 4IPIA 4EX4A 1XQLA 5CSUA 3N29A 4X60A 7TIMA 5F2MA 1HO4A 1OX4A 3NDYA 3WLOA 2HXTA 4BF9A 4OE7A 3A4XA 3M0KA 3A47A 4X3ZA 1GCYA 3RMEA 3O7UA 2BASA 2W6RA 2ZX6A 1D8CA 4I7VA 4TX9A 4L9YA 3MSDA 4GVIA 1G69A 1ZSXA 3H26A 4FS9A 3NXLA 3W73A 3PZVA 1M53A 2BVYA 1W9XA 4O57A 4JDYA 4BA0A 1TV7A 3E0FA 9AMEA 2J7CA 3O15A 2VC7A 3OU8A 2WKLA 1F74A 1KFCA 3VVGA 1W9VA 4JL2A 2W27A 1OFQA 3OA5A 4EOUA 3TYDA 5HMDA 4PUKA 1UR9A 4HMEA 2FLIA 3NQFA 2JIAA 5GJPA 3K8KA 3RCNA 5CQ1A 4GINA 1PYFA 2XWEA 2DZXA 4QQUA 1OK4A 1ONRA 4O1FA 3SCUA 1G4EA 2OXNA 2VQUA 3WX7A 3G1FA 1HP5A 1UA7A 3M46A 3KBNA 6TIMA 3REQB 3FRNA 3WLTA 5CC3A 3EX1A 1BVNP 3DHUA 4HN4A 4E3TA 3CV7A 3S2NA 4TTGA 1O5XA 3CAWA 4F2UA 3T4WA 5I3GA 3EXSA 1VH7A 3I65A 5I3KA 5ABFA 2DW7A 3N19B 1GPWA 3ORWA 4L61A 4LBUA 1JUKA 4CD6A 5DX7A 1GQJA 2CERA 1IT0A 4LNYA 3DENA 2GK1A 5JIPA 4C6PA 1QI3A 3IIPA 3RCMA 3IJ8A 2YCLB 2VRQA 4DELA 3FYPA 3RG6A 3VA8A 2QW5A 3M5VA 2Y85A 1MEIA 4LYPA 4F3HA 4GABA 2Z0IA 5DMLA 2V82A 1BXCA 4RDVA 2NQZA 5CLWA 4LJ3A 4XB3A 3NA8A 4F4RA 5ECVA 2DY3A 4HOZA 4RNFA 5M17A 2WLZA 3B0XA 8AMEA 8CGTA 2DSZA 3QW3A 1EB3A 1UJQA 1ZQ5A 1GKPA 5HPCA 5F2GA 4UTJA 3M7WA 4JTJA 1XYBA 2CKSA 5FCZA 1J6OA 4AX6A 1ONWA 4AIUA 2V3GA 1Z3NA 1XLAA 4IMEA 1R38A 5I03A 1XG3A 2V5KA 5D2YA 3RRXA 4NAEB 5AC5A 1PUDA 4B3KA 4Q8UA 4GZJA 4IFKA 2QCGA 1LYXA 1LRQA 4IX2A 1DJIA 4MSIA 4HZMA 4K36A 1VRDA 2V8ZA 2W63A 4FLSA 4C6DA 4GWEA 2YFNA 2ON3A 1P0EA 1R3RA 3BG3A 4M7TA 2DQXA 2BGNE 5CH9A 3EA2A 3N4FA 2QGYA 3KW3A 1DV7A 3NG3A 3WBXA 5I79A 3T2QA 5CBJA 4ZSTA 1XF0A 2IKHA 3DAQA 5AN7A 3GBEA 3EWWA 2D24A 3M0YA 4WOQA 4KERA 5IDIA 1WPCA 4FHAA 2X05A 4AMCA 5HNRA 1DJYA 4FB7A 5I09A 1BYAA 2I7GA 3E3HA 4CNTA 5F2IA 5FJPA 2XIMA 2BHUA 2D22A 1XRFA 3UW6A 1KKOA 2W91A 1J8VA 5E70A 1W3KA 1US2A 2JEPA 4GX8A 1XH0A 3FJ4A 1Q65A 1UOKA 3GIQA 5AECA 4ZA0A 4GPNA 1S5WA 3W7JA 2O4MA 4X63A 6TAAA 1O94A 2WOQA 4JFWA 3NEHA 2CZFA 4QAWA 4JCLA 2QCCA 4UTWC 1B57A 4L6OA 2G8ZA 1UKPA 1JCLA 2FVKA 3TXVA 2VCCA 2CXEA 4YMZA 4F0SA 4UIOA 2Q71A 3BLKA 1TPH1 2PWEA 1SW3A 1PPIA 3LTSA 3AISA 2AGKA 3WLPA 3MUAA 3VKKA 3A22A 3BLDA 2DUAA 2R14A 4EKJA 1K6AA 1MW3A 3DXIA 4BQ3A 4F66A 1I2NA 4NNAA 3UYCA 3PZTA 3SY8A 2Y88A 3EKGA 4NT0A 1BWLA 2BBFA 3UWYA 1SFJA 5LNRA 3VNYA 1EJVC 2WHKA 1WUEA 4CEUC 4UTLA 3EWBX 4JIQA 4LS0A 2HPMA 1RD5A 5MSIA 3T0CA 1E6PA 4H7CA 2OCZA 5D9PA 2VI0A 4J4KA 3RX4A 2CLIA 2JKEA 1E6ZA 1UH4A 3WJSA 3U4AA 3TQVA 4QE5A 2AQWA 1SFTA 3NPXA 4AD3A 5CPMA 4LUJA 4DJEA 2FFIA 2CLMA 1EGZA 1XIBA 3M0ZA 2QR6A 7MSIA 4AZ7A 4OKDA 3BGGA 1JDFA 2DSVA 1HJSA 1WE5A 3TLLA 1HKWA 2WKGA 1CWYA 2VOMA 3DEQA 3VE9A 3VNZA 2XISA 3IANA 1OF6A 4RDZA 4RPPA 1QHOA 4ZCWA 4WJEA 1UH3A 3RDNA 3BWWA 1MQQA 1RCQA 5T91A 4DWSB 5K9CA 3KOZA 3EDKA 4P61A 4YHGA 1J5SA 5LXXA 5HINA 5AYIA 1L8NA 1EIXA 2OLAA 1BKHA 1E4MM 3C52A 4WGHA 1RBLA 3VIFA 2W5FA 3AIBA 1DEDA 3WD1A 1XGEA 2ZZ6A 1GKQA 2VDGA 2PDPA 3ME3A 1XL9A 4X61A 5M03A 1UHVA 3AQUA 4W87A 4KGJA 1VRXA 2ZRVA 2ISVA 3OW1A 3G6LA 2NXIA 5E09A 1KCXA 1WDWA 4P2VA 2A7PA 2D0GA 4DLMA 1QI0A 4OUIA 3TYBA 4UQBA 3VIJA 2ZC1A 1UJPA 3TW9A 1TWIA 4D6EA 3GYCA 3OLEA 1HJXA 2PGFA 5MKGB 3OTRA 3MMWA 2C1HA 4O12A 1JXKA 2O92A 3CJPA 3G1RA 3WLNA 4RZBA 1GVYA 2YXXA 3LCFA 3ARTA 1OB0A 3TR2A 1CXFA 3TYZA 2QPSA 3EXTA 3E2RA 3A21A 2P10A 4YL2A 1VFUA 1Y5WA 2Y7DA 4UFLA 4MJ4A 3OODA 4DUXA 4OUEA 2VX6A 3GUWA 3IS4A 5DRCA 3HJEA 5BOFA 3W1TA 4IISA 3WG6A 4K1GA 3BCDA 2A5HA 2MANA 5FEPA 5TIMA 3DECA 2NW0A 2PI6A 3PZQA 4W93A 4EWJA 5I2UA 2V30A 1HL2A 3W07A 1XDLA 5B80A 2Z1KA 4JTUA 2PDJA 3V0UA 5H2ZA 3DU0A 2J9XA 1BSIA 2QZRA 3T0TA 1XBXA 1XRSA 3CEUA 3IJQA 4XVEA 3WZ0E 5LXEA 4LY4A 1GVRA 3FIGA 3W2LA 1J96A 3SR7A 2Z26A 3VIPA 4UTMA 4E8DA 3OPSA 3PK7A 2PDBA 3UG5A 2WO5A 1C92A 4PZVA 2C14A 3R58A 3UT0A 2Q02A 1KBLA 1AH3A 2E5BA 3E2VA 3QHOA 3G8EA 1WXYA 2B4GA 3VDCA 1KO0A 5F2LA 2YCEA 3RM9A 3NM3A 3W28A 4EP8C 2ZE0A 3LXAA 3Q4DA 2DH3A 4K2SA 1HXJA 2YJQA 5EMUA 2ZX9A 4Q6XA 1W37A 3UFYA 1CIUA 1HUVA 1TYGA 4NZCA 1EKOA 3CIXA 2Y8VA 3ARUA 1DORA 3NOEA 4P7RA 2QPXA 4UBPC 3LM3A 3UR8A 5HMEA 4WLCA 1VKFA 1GZGA 1US3A 4GH3A 5EY5A 5F7UA 1B1YA 2NUXA 1R2SA 4JN8A 4E4UA 1W91A 4JL1A 2TRSA 4M1BA 1SW7A 4A3RA 4Q8TA 1H4PA 2FFCA 3CYJA 1H60A 3IAPA 2PDXA 2D69A 4HB7A 2ZRXA 3G5EA 3A3HA 3C56A 4Q22A 1WDPA 3CZKA 1Q7MA 3A9BA 5BU9A 2C7FA 3F2CA 3AJXA 4X9YA 4YVVA 1KM3A 1Q6EA 1MNSA 4AHOA 1AVAA 1L6FA 4FX6M 5DY3A 3EMZA 1W5OA 4DI8A 4U31A 2QCLA 3N14A 4UR7A 4AC1X 4PMRA 4GMEA 1C7SA 1US0A 2PGWA 1QI2A 3EA1A 3VKJA 5BWAA 1RH9A 5HNNA 3FCPA 2O7QA 3QQ0A 3RF9A 2CLPA 3KE0A 1UWAA 3NIYA 1KM6A 2WVVB 3WYZA 3L0GA 3URBA 4W8LA 5HQEA 2I16A 1NP0A 3LSCA 3S2CA 2XIBA 1M03A 1DWHM 1SMDA 3IIOA 4DBSA 3QLDA 3BANA 3BSHA 1PKNA 3CIVA 3N9SA 2XVLA 3KS6A 3U8GA 1GK8A 1I8JA 3DFYA 1DWFM 4XAZA 3K5XA 4AY1A 4TOQA 4U28A 6AMEA 4DWSC 1B0IA 1AMEA 3DFSA 5D2XA 1Z69A 4IPPA 3DFQA 1NF7A 2DJXA 1B30A 2OGJA 4E6MA 5C5YA 3ITXA 2AKZA 4V1XA 2AL1A 1TJ1A 4UB9A 5M3WA 3A5FA 2GDVA 3LNMA 5LGXA 1XP3A 2XPKA 1B3OA 4MKVA 1OADA 3L2LA 4K1WA 3FXGA 5JUVA 5EL1A 3M0IA 5I78A 1IHIA 1GOIA 3WNLA 2GJRA 1GG1A 3RU6A 1E0XA 4BFAA 1OX6A 1WP6A 1X6LA 3CMGA 1CENA 2PP0A 4PTDA 2CIPA 1B3ZA 3HIJA 4NRRA 3FEQA 4Q4OA 4O0KA 4P7LA 3ABQA 1XIHA 4CU7A 3GXFA 2VZSA 4PMUA 1UR0A 4DY1A 1TPFA 1XKJA 1I2QA 4CUCA 4DX3A 1K4GA 5TF0A 3M9YA 3DYPA 3CHDA 4LCQA 1TVNA 4ADUA 1KBBA 4I5UA 5I3JA 4KH2A 2FH6A 1MSJA 3K2GA 3LBCA 2QCMA 1W0MA 3DC8A 3KL5A 2JBMA 4ALDA 3UWQA 1TV5A 2WJZA 5C71A 3SRFA 2O9PA 4LTSA 1DIDA 1VBGA 3CUIA 3BJFA 3T0BA 1QNQA 4TMBA 1XWYA 1OYBA 2OFJA 3G22A 4B91A 4CCCA 2IKIA 4ACZA 2WWDA 2FMNA 1H1ZA 4W9TA 2V5JA 3ZJKA 2DDXA 2PDGA 4UQCA 5JQ9A 3K46A 2XFYA 4F0KA 1IV8A 2XGIA 5DMMA 5FKYA 5HR7A 4DNMA 2PF8A 5FJTA 2NX9A 3V18A 2ZICA 3AZRA 3SZ8A 2ISWA 1QJWA 2GJLA 2V9DA 4PMOA 2XVNA 4XUGA 2WSRA 4QAIA 1REQB 2BGQA 2CBUA 4NILA 2ZTJA 4JICA 1TVPA 3VGGA 5K7JA 2DT3A 4R9OA 3W88A 4PUMA 3O3RA 2VURA 1EPXA 3SQSA 1SR9A 1J0YA 4XWUA 2YW4A 4JTEA 5EMJA 4CCEA 3JUGA 4FOKA 4HNUA 2QJHA 3UZXA 3KOXA 5J8LA 1HG7A 4LH8A 3A6OA 4AYSA 2EJAA 5HMFA 2YL8A 5CCZA 4U2YA 4W5UA 3E96A 3BLEA 1QK0A 4KWUA 5T9CE 2RDUA 4GIAA 2E5CA 3QGKC 4MWAD 3CU2A 1JF6A 1HP4A 5KZDA 3RLVA 4DWDA 1TELA 3TTQA 4YVXA 1H49A 3W29A 4J3XA 1KW1A 3VKBA 8A3HA 2BSLA 3V0SA 3PTMA 4B92A 2YL6A 2QJMA 4GQRA 1F05A 1XSJA 1WZMA 5A8MA 3VIHA 1SVDA 1A5OC 1A5MC 2WZTA 2Z2UA 1YW1A 4J2MA 1VP5A 4U3CA 5DO8A 4RKAA 1JI2A 4XD6A 4KEMA 3J7HA 3R8GA 3KTSA 4CCDA 4N2YA 1B9BA 1H2JA 4CQBA 3EOUA 3BOLA 3VNIA 4MGGA 2HJPA 2W9MA 4AEEA 3ENLA 1QO2A 3TXZA 3B9NA 4P8WA 3I4KA 1I60A 1GVOA 4IXXA 5BXRA 4PMXA 1T8XA 1Z42A 3ITYA 3R11A 3RN6A 1VFHA 3CNYA 3DYOA 3G77A 4OVXA 3S5ZA 4Q8OA 2HNEA 3MUIA 3OLGA 3IRDA 5A2CA 2OVLA 4O1CA 2A3HA 1C89A 1K77A 2WQPA 3P80A 3SCSA 4K8HA 3PULA 3SO7A 3W23A 1M68A 5HAOA 4BS0A 4AXNA 3WLQA 4F0RA 2OEKA 3TZFA 1P7TB 2NWSA 3M0VA 4EACA 3CL7A 4BZYA 3E49A 3BO9A 5DCBA 1UR2A 2YBTA 2ICSA 4Q4MA 3GDRA 2ANUA 1N7KA 2C6QA 3PZOA 5CKSA 1RD6A 3I68A 4DF1A 1M7PA 1EP2A 3G8RA 1CI1A 3M16A 1BYDA 3S3GA 1KR0A 5G4WA 3U57A 2DVXA 1TCMA 2Q09A 1UBPC 2XJ7A 1JL8A 2KAUC 1UW9A 1TV2A 4ATLA 3AICA 3WEZA 4B5WA 4DXXA 4XKYA 4FR6A 2OPJA 3I7SA 7REQB 1G0CA 7TAAA 3NZQA 2OQLA 4LCSA 3R6IA 1NARA 4W85A 4FXJA 5A94A 4U2ZA 3SBFA 4UFJA 3PUOA 4PB3A 3CASA 4NJJA 2GYIA 1E1EA 4IGSA 1AD4A 3NO3A 1V02E 5REQB 5CGQA 1TQXA 3G18A 1OFPA 2Y8KA 3RO6A 9RUBA 2WMJA 4DJDC 1E1FA 3LNPA 3JR2A 4M6QA 1AJZA 3I7QA 1G94A 3WF2A 1H7XA 4DHGA 2QMJA 3WL1A 3N2MA 3HG2A 3PVFA 2QJNA 2VFFA 4NQ1A 4MY8A 2A3LA 5CPQA 3CAVA 3SDOA 1TJPA 2HXUA 3FAXA 2XWDA 1F07A 3NYDA 3HPFA 4WSKA 4ROPA 1FDYA 1TMHA 3GFXA 3M07A 3MUCA 1X98A 1XQKA 4PMDA 2CW6A 4FF7A 4PBGA 4AX7A 2C1IA 5D2VA 3VU2A 4AWUA 3VOFA 3GHUA 4QGCA 5ABEA 1EIBA 1R87A 3FFSA 5JBDA 4WKAA 2O56A 1JFXA 4HHLA 1KBKA 3T8LA 1V6XA 3GXIA 4BR1A 2MNRA 1J2BA 1W8SA 3POHA 3L4YA 1SZFA 4LAUA 2QKFA 5A1AA 5FF0A 4CD4A 1UWTA 3N1AA 4ZB2A 5C9WA 1JNEA 3WMCA 4MJMA 4QP0A 4I9AA 2NT1A 3VMNA 2PPGA 4F2TA 4H2HA 4BI7A 1XLEA 4H9YA 1YBQB 2GLKA 3QZEA 3XISA 3WLJA 1W1VA 2P1FA 5RUBA 4QM1A 2FPVA 2WNNA 3ATYA 3MMDA 3BSMA 4H2CA 3EGJA 1T6MA 4LS2A 2JKPA 4MNJA 4HNTA 4UTTC 4IPNB 2HNHA 3GKFA 3KVKA 4MOZA 3R4IA 4FXFA 4NZJA 3OQEA 4RV8A 3DI0A 3SW6A 1M9HA 3VK5A 3RJYA 2Y4SA 4E2OA 4C1NA 3OIHA 2O7SA 3QKEA 3F4VA 3IUIA 4N02A 5TD4A 4B4FA 2PAJA 3KTCA 1J0KA 4BF5A 3W01A 1UUQA 4PB5A 4INFA 2QCDB 3B0VC 3E38A 1WBJA 3URQA 4ASTA 3HFYA 4F2BA 2WMGA 3WKZA 2IQDA 4G5DA 4O14A 2PDHA 1XYFA 4M51A 4HPGA 2QJIA 3MPGA 3PJUA 4JEQA 4Z1AA 2Y5SA 1XIEA 1DWIM 3I3DA 2YZRA 9XIMA 4Q8VA 4OBSA 1W9PA 1W3JA 4QDMA 3LZ3A 5HBFA 5HNTA 2ATSA 3CHCA 3VNKA 3MBDA 4R88A 4WIWA 2VFHA 1S5NA 4XAGA 3B8IA 2F38A 4ATDA 1SUXA 1V93A 3SGGA 4TQTA 2CWNA 1FA2A 2CZDA 3CMFA 3GHSA 3BV4A 3AYRA 3S47A 5EYWA 5EMYA 5J5DA 2XH0A 3IIZA 1EO5A 3CZEA 1WYIA 2VUNA 4ZOAA 5FACA 2P53A 1QOQA 4S3CA 3MC5A 4BHYA 4LVBA 2V3FA 3QF6A 2XU2A 1JPMA 3IJ9A 3RXZA 4NJKA 3WUFA 5IXEA 2J6VA 4GCXA 2ZRZA 2EEXA 1V7YA 3HMCA 3VOIA 4HOWA 1F8IA 2HSAA 1UP3A 1PYMA 4DF0A 1R3WA 1Q8JA 4AIBA 2ZYFA 2JF6A 2Q8LA 2PBGA 1SJBA 1V77A 4HMDA 2J8GA 5HA7A 1H61A 1GEHA 1VFLA 4FAMA 4D6CA 2HCVA 2Y2WA 3MW7A 4FP1A 1GEQA 4NRSA 1F3WA 5FJUA 2DT0A 1M3UA 5D9OA 2HPIA 2BGSA 4QS5A 3FEMA 4ZO6A 5FF4A 4UNLA 3PWAA 3QRHA 4LV9A 3HMJG 1D3CA 3AMCA 3MDUA 2BY3A 2WMFA 5A8NA 3VKDA 3Q45A 3ALGA 3WMLA 1EDQA 1O68A 2Y61A 3TCSA 3N25A 2OO6A 1DOSA 4QBXA 2YSWA 1Q5MA 3GXDA 1RY8A 4XSLA 1ME8A 1QATA 4HZ6A 4PE8A 4MYAA 3A3XA 2Y70A 4LC6A 3W7KA 2YB1A 1QPNA 3GDBA 4YJ5A 1GORA 3LG3A 3QR1A 3WH5A 3KUMA 1JZ6A 2PRLA 5G2HA 3CQHA 5I3DA 1QT1A 1HGWA 1T41A 3R8HA 2GSHA 3ZSTA 4GA8A 2WZMA 3F4NA 2ZX8A 3C3NA 4JTLA 3OHIA 3ARWA 2AL2B 1PXGA 3UD6A 4DM1A 1Q8AA 2Z00A 1AD1A 3W7GA 1LBLA 4P8UA 3WH7A 3A4JA 2DSWA 3ZR6A 1MSSA 1VFSA 2RJHA 4RE4A 1XGDA 3VMPA 4HPHA 1S2CA 4MF4A 1UR8A 3EOSA 2OZ8A 3AIWA 1JZ7A 1I75A 4UUIA 1UH2A 5BMWA 3IGXA 1PIIA 4N6EA 1F6KA 2J8FA 4QISA 2PDQA 1R2RA 2WK2A 4KKXA 1QHZA 4P8VA 2F6UA 3KOWA 3EDJA 1A5NC 3LXBA 1TIWA 7A3HA 3B8TA 1YDOA 2XIQA 4QDPA 3HGOA 3MY9A 2X1TA 2G96A 3TJXA 1OVDA 1M1BA 4X2RA 3C0LA 4XAFA 3NQBA 3C2FA 3MZNA 2ZZ1A 2ALRA 1FWJC 2AKMA 3PHAA 4QE4A 1TWZA 5EU9A 5K4XA 1BAGA 2CLOA 1RPXA 4HU0A 1NY1A 3CT2A 3LSBA 3P6LA 2QUNA 1DJZA 5ABGA 5B7ZA 2PE4A 1IEQA 3DCPA 2QUMA 3IIVA 4HTBA 2EPLX 1PEZA 1ISZA 1O6IA 2ZC8A 4LXFA 1Q85A 2P50A 1ELSA 1PZ2A 1YTDA 1HKVA 4GUIA 3JW7A 1ZAHA 1WOAA 3SSZA 2RUSA 5LZLA 4WF7A 1CDGA 2FTWA 2GWNA 3U7VA 1G4SA 2VRKA 3NGFA 1V3JA 4L80A 4M7SA 1CGUA 1KKRA 3CQ0A 4Q32A 4GXPA 1OX4B 1DJXA 1V0KA 1V8EA 3UERA 1GVFA 1J79A 4AYGA 1ZBWA 4AZ6A 4C91A 3LHYA 4MWAE 4PTWA 3QR3A 1KGXA 5LNSA 5C54A 3S46A 1KTBA 1FDZA 3W83A 2P8BA 1NJJA 2OZ0A 4JQ4A 1D8WA 1VHCA 3CWNA 5I07A 4PEEA 1CYGA 1TSIA 2XM2A 3K4AA 4F0MA 2WHMA 3H21A 4LUSA 4ATWA 2YOCA 1LQ0A 2VC5A 2ISDA 3VO0A 1SJAA 3TP4A 1ODUA 3TYUA 5I24A 3QYQA 3WJXA 3JZUA 3VD7A 1LCOA 4Y96A 3T4CA 4MY9A 1XBZA 4FEZA 2QCHA 2AGTA 1KRAC 2FMOA 3ANUA 2DZPA 1HZYA 4ORMA 5I3FA 2WMHA 2E67A 1KM0A 1R3TA 1T5AA 2J78A 4LFYA 3THQA 2HTMA 3N9KA 3WDJA 1LBFA 3W37A 1UB3A 4ES4A 4RLIA 2FDSA 1X1NA 1TWSA 2DW6A 2ACUA 4B5SA 3N04A 4O1AA 3O9NA 4R7OA 1EO7A 3IARA 3E0WA 4FI4A 4E2VA 1Z41A 2FJKA 4UOQA 2OELA 2DPEA 3T44A 3JRKA 2F6KA 5CGMA 5ABFB 1OCNA 2HK1A 3NL6A 1DP0A 3VNJA 3H54A 2Q3RA 2NQ5A 4ADTA 5D2WA 4HIBA 2GK1B 4PL2A 2ZDSA 4B15A 3GDTA 3SJNA 2WNQA 2HQAA 4ZBCA 1B4KA 3HQOA 1ZRQA 1VCGA 2ZVRA 1J11A 3S1UA 2V6AA 1OBAA 3KXQA 4UQAA 2YR1A 3GLCA 4EXBA 3MO7A 2HVMA 2LX3A 3FVDA 3ATZA 3K1DA 4MY1A 3OG3A 1R0MA 3MV11 2E6FA 1PKYA 4Q4RA 3MCNA 3B0YA 3W7CA 6ALDA 3SCTA 2NQLA 3RLGA 2PDCA 2DORA 5JBEA 3DHPA 3WBWA 1NIUA 3SURA 3SECA 4NUWA 1CX9A 3S8HA 1WA3A 1RHCA 4JNMA 1J18A 4YHEA 3NQEA 4M1RA 3BJSA 3CPGA 4PEKA 4IFKB 3TN5A 1KQZA 2HRWA 3USBA 3RNDA 3UZ5A 3VI2A 3ZWTA 3R8RA 1TPDA 4AD5A 2WYSA 4GYPA 4S3GA 5AVNA 2QAFA 1ZBCA 5EA9A 3P7YA 1VD6A 4AQLA 1N82A 2XH4A 4M0XA 3MJMA 1EZ2A 5EMMA 5E0CA 1PL9A 2VTFA 2B7PA 4F8XA 4H7VA 1VJIA 3WQGA 3O07A 1QNRA 3H2MA 3ITOA 4C6LA 3N2OA 3F5LA 3WSUA 1PO9A 3NL3A 4RE3A 4ZB0A 3QPYA 3ARSA 4J35A 1U5HA 2BY0A 3UA3A 1Q7QA 1LTDA 4EE9A 4AZCA 3LPOA 2DIJA 3HGRA 4EK7A 3VGFA 1SGJA 3BOFA 1M7JA 2ZXAA 1L6GA 1LOSA 4FOUA 3WEOA 1RSCA 3GNXA 1KM5A 5ABHA 3ES7A 2VDHA 3CTTA 2G37A 4BK9A 4HT3A 4AMAA 4D9PA 1E5NA 5AZ0A 5A5WA 3SADA 5DFAA 3UWZA 1PKMA 1F9CA 2X09A 3TNOA 3W1XA 3S2MA 4FXSA 4AEFA 1FWTA 2WNZA 1NP2A 1UP0A 3ARXA 2ZX7A 1NDWA 1I4NA 4UR9A 3A9IA 2DVTA 2GZXA 3A13A 4LBRA 1ITXA 2PWFA 2ZXQA 1EGVA 3IK4A 3GFZA 3W25A 4KPLA 1W8GA 2OG9A 3TW6A 4PCPA 4JIEA 5E6ZA 1B31A 1R30A 2GWGA 4AU0A 1QO5A 3WMBA 2FZMA 3O6YX 3C0JA 1F61A 5DLCA 4A3YA 2WZHA 3CQKA 4Z2IA 2E68A 4P5UA 2BLEA 3BJTA 4QSHA 2XVGA 4GACA 4N0RA 3UWUA 3PBMA 3PY2A 4B5VA 1EEPA 5J5RA 2NT0A 3O0FA 4QROA 3UGVA 4CNOA 4N9DA 4Q3MA 3BW4A 3DDMA 2QF7A 1R3YA 1ECEA 1BGGA 4JTHA 4IGNA 3W81A 3B0UX 3TSMA 5KZMA 3DFOA 2XSAA 2J4GA 2W67A 4XISA 3SFKA 1U83A 1C8QA 2GDUA 3CUHA 4A3HA 2PUZA 2QIWA 2XIOA 1HVXA 1V0MA 3DOPA 3VNMA 1GNXA 3G2GA 4DUVA 1AQ0A 4A2SA 3GKAA 4Y8EA 1V3HA 2FKPA 2YL5A 2ONEA 2XZ7A 2F2HA 4I5RA 5HULA 5I3IA 5KETA 2Y89A 1ZAJA 3HGSA 2IKJA 4ERIA 3ZIZA 3FV9A 1M04A 5AYYA 5XINA 3AYVA 1OD0A 4J3VA 4D8LA 4ZO7A 3S5OA 4CVUA 3W6MA 3FNDA 1BD0A 3TC3A 3W9ZA 2GGIA 3PUDA 1IE7C 4HNNA 1JD9A 1V03A 1DBTA 4R7WA 1TJRA 4CGTA 3O0KA 4S39A 1VBRA 4PN2A 3HPSA 1BEUA 1RXOB 3TA9A 2P8CA 3CIWA 3OGSA 2BMBA 3MT1A 3PB0A 4AVOA 3LCLA 4PMYA 4L9ZA 3AXIA 4ZQPA 5C9XA 5ECUA 1HTIA 1PV8A 1L8PA 1YXYA 2DIKA 3LV6A 3WCZA 3NZGA 2E1WA 3FGCA 3NNTA 4JCMA 4WY0F 3EEZA 4PH6A 2EPNA 1O5QA 4YNGA 3NAVA 3P62A 1OFOA 2P0IA 2VM8A 1F7BA 2Y7FA 3T08A 1V08A 3V36A 3P93A 2D3NA 4N9CA 3IAQA 3L65A 3A4AA 1UQYA 1FCVA 4ERGA 3UPBA 3T07A 1MRAA 2YCIX 2WPGA 5A8OA 3GDKA 5EBUA 3L0NA 1RQBA 4O4WA 2V2CA 3AC0A 3L12A 1FWBC 3OB8A 3GE7A 2AQOA 1QOPA 4YN5A 2CKRA 1WBHA 4PUDA 2YYTA 3GG8A 1FXQA 1FWSA 1DJHA 4ZSUA 4OV9A 1Q6QA 1RVKA 4QLJA 3AHTA 3B4YA 2VEGA 1FH9A 1VJSA 1MSIA 1UWUA 4LRSA 1CTNA 1UD3A 5D30A 3OLIA 1PX8A 4KRZA 4LAOA 3WQCA 1E55A 2E9BA 3KLLA 2BWGA 3U5UA 3W38A 4UTTA 3GH7A 3R0UA 4BJHA 1XV8A 1RBAA 4FX7A 5AHNA 4I7UA 3NDZA 3C0QA 4LEFA 3LRLA 1P4CA 1BYBA 3R0KA 3R25A 1M7XA 4OTKA 2J9ZA 4A21A 4WD0A 1G6CA 1DKWA 1Z7AA 1KXVA 3HFTA 3L5AA 2PDFA 5SWUA 3U4FA 1LP6A 1XIDA 3EB4A 1Q63A 3MO4A 1AK5A 4E2BA 5D9MA 4EVZA 3FHAA 4AY7A 1RCXB 3CZ8A 1W1IE 3T42A 2Z4GA 1WX0A 3B9DA 1EF2A 3VDGA 4O53A 4M24A 4KEVA 1V6TA 1KLZA 4Q8NA 5C9UA 1FDJA 4JHOA 1TCDA 1FCQA 3VIIA 3W53A 1WV2A 1X1OA 4Y2WA 1KM1A 3RFAA 3VNDA 3MTWA 3PG8A 2G3JA 2XGZA 3MZ2A 4FR1A 4WCJA 2QUVA 3NPWA 5H8UA 3MB9A 1XLGA 4DBEA 3ZJ6A 3B9OA 4FF5A 3GVVA 3UETA 1IZCA 1SYTA 4U10A 3VOJA 1UG6A 3CH9A 1SMAA 4IH3A 1EJ7L 1NWRA 2HE8A 2X0YA 3WELA 2FVLA 2OZTA 3KCJA 4AWTA 4DZHA 1NDZA 4Z2KA 3FW6A 5K9DA 2V63A 1OHLA 1PB0A 3QHMA 3KBSA 1TREA 1A0EA 2OOGA 4C6FA 1H7OA 4L1XA 3VFCA 1LWJA 3S1GA 3VPLA 2X42A 2DV0A 1TR9A 2GGJA 3LEPA 1SU5A 3LXCA 4DJEC 3ZVHA 3AS0A 5D03A 1OM0A 1PIFA 1YE4A 5BRQA 4ZO8A 3OEXA 1JDAA 3WFAA 4YTRA 1TPC1 4DJFD 1ZJIA 1OQFA 3QC3A 3U3HA 4CD5A 4HU3A 1IT7A 1EYWA 2PBOA 4R3UA 2EPMX 2FJUB 4D6IA 4IQLA 3BSGA 4HA4A 2PWUA 4FNQA 4IQEA 3E0VA 3MS8A 1ONXA 2H3BA 4D72A 2Q01A 2TYSA 1YXCA 7ODCA 1B90A 1KRCC 3I3EA 4LB4A 3RLHA 2E3ZA 1L6WA 5GJMA 3LERA 4KBXA 4PFMA 3F2BA 3ABZA 4KCTA 3W7RA 1FHLA 2QVHA 1EBHA 5KZ6A 2P76A 4AY8A 2ALDA 2IQTA 2BB0A 3K13A 3NSXA 1E6QM 1S2TA 3UVIA 4RXGA 3TCEA 3LGDA 5CSRA 2NUYA 3TQ0A 3OYZA 5AVHA 2GQ8A 4ZR8A 3RX2A 2BXYA 3T05A 1KR1A 5F4XA 2JEQA 3I6TA 3UWEA 1LRTA 3VDHA 2PRHA 1NDVA 1RA0A 1PHWA 1XJBA 5CBIA 2CWXA 4AD0A 4EXAA 3HQNA 1J4EA 4FO4A 2QNEA 1MXSA 1BG4A 1UD8A 4O15A 1IEIA 1MUCA 4JOMA 2A3AA 3AYTA 3QR0A 4S2BA 3AIRA 4H3DA 1S38A 2WANA 2XN2A 4E0CA 3ANYA 1I0DA 3MKKA 2E0PA 1R8LA 1WZKA 4WVXA 2EG6A 2VGIA 3E9AA 1FH7A 3IGUA 3ID7A 4PMZA 3NYZA 3PBWA 5EFFA 4MNKA 5KTLA 1S2UA 5BMXA 5XIMA 4U33A 1U2YA 2A3BA 3MA8A 4A6GA 1VFTA 2C91A 2NUWA 1SFLA 3BXWA 2Z25A 2BXVA 3GH5A 3DG7A 4H8NA 4K68A 4LEQA 5TQLA 3ZO9A 4D71A 3QSRA 3R79A 1W32A 3S9IA 3SIZA 5AHLA 1ADDA 1EJSC 4J7RA 3W26A 1JYNA 2POTA 2I5IA 3R2GA 2BX7A 4RNHA 2OMAA 3NQ2A 1QOXA 4ACZB 3OOQA 5ENLA 4Z2JA 3ONBA 4B3LA 3KCLA 3L23A 2DZUA 2BV9A 4LX4A 1RUSA 4NAFA 4TVCA 1PDZA 3N2XA 2VD8A 1UCWA 1UA3A 3MHFA 1YKWA 3FKKA 3N18A 3IACA 2INEA 1FTXA 2SFPA 1NQKA 5DEZA 4EXQA 2DP3A 1P0DA 4O1BA 4WSJA 3LBMA 2Z6IA 1QASA 4FLRA 1TPVA 5IDZA 3IJIA 2A3CA 5A2AA 4C6NA 3N9RA 5DT5A 3APTA 2A79A 2FB3A 1OG0A 4DZ5A 5LA0A 3T2PA 1EXBA 3BAXA 4ECLA 1EC8A 2JK2A 2FQIA 1E73M 3S42A 3F4DA 4WY0A 3WDQA 4HZ8A 1VYPX 2NZLA 3V5CA 2I5GA 4IGHA 3CHEA 1XLIA 2B81A 3GU1A 1EUAA 3CC1A 2D23A 1A3HA 2PFHA 3KDOA 3ZQ9A 1PDYA 3MSYA 1H51A 3BG5A 4G7FA 4GY7A 3PPCA 2D20A 3FJ6A 4QG6A 3QMTA 2CHRA 4GX9A 3IUHA 4JD4A 4KWSA 3AJ7A 3VFLA 2EPOA 4JAWA 3NGJA 3FDGA 1GOOA 5C2XA 1BSLA 3AHXA 3GXMA 1S3TC 3WQDA 4XZBA 1VCFA 3HBLA 1AUSL 4TVUA 3G1AA 4RZ5A 3S2JA 5I3HA 1ZL1A 3SUTA 4WRHA 1MO0A 3STCA 5D02A 3V5FA 4B5TA 4BEUA 1PKLA 4HK5A 1B3VA 1EFZA 1PZ1A 1QW7A 3LHTA 1H7PA 4MG4A 3TX9A 4JY9A 3N34A 1HT6A 3I6RA 1E5JA 3LDVA 2RHGA 4UR6A 1BHGA 1UPPA 1ZUAX 1C93A 1J9YA 3OQ8A 2XINA 2YLAA 2JIEA 1M7OA 3UP8A 2CU0A 3EB3A 3WBEA 4GKLA 3CT7A 2Y62A 4MNLA 2FIQA 4TX6A 1JDEA 1SW0A 5LA1A 2IS7A 3GU2A 1IYXA 2BODX 4N7QA 3TAOA 1EDTA 1UD6A 1XYAA 4G7EA 4H6KA 3B05A 3OBEA 1BFNA 1QMLA 4E8CA 1R7AA 4L5ZA 4JIRA 1JAEA 1Z44A 1XPYA 1CPUA 2VEIA 4AZIA 5A3HA 4RJEA 1CB7B 1GZIA 2EF9A 3CL6A 3MMTA 2VR5A 4CVWA 4DXKA 3TN4A 5HWMA 3NSMA 1QNVA 1XLLA 1LLWA 4NU7A 3LHZA 5U4NA 3KX6A 4JNYA 2EBNA 3VKAA 2PTYA 2E9MA 4CD7A 2HROA 3RAOA 2G0WA 1LL6A 4HQVA 4JIHA 3DFTA 2XG9A 5EFDA 1OCJA 2PRMA 2HMCA 1X7IA 2WBGA 2XFWA 2VL4A 4PRRA 1DQUA 1JAKA 4F79A 1DWGM 2IQ0A 2YXGA 3C5QA 2CZ5A 2JKAA 3QQ1A 4JX6A 1E6SM 3T8QA 1UR4A 1Z48A 3I10A 3AMDA 3VXGA 1QUMA 4XKYB 1FWCC 2ZBTA 1CB2A 4O54A 4AZBA 3AZTA 3WIJA 4LPCA 4RE0A 1CT5A 3GM8A 4CQAA 2R24A 1ME7A 1XH1A 1RR2A 3FOKA 4C5ZA 3UG4A 3S0CA 3ANVA 1HKKA 1OINA 1UD2A 5IFPA 1A5KC 1GT8A 3HPAA 3G1YA 3UPWA 3PS7A 3EBVA 1YEYA 4FPSA 1IIHA 4HPNA 4GXWA 3VZYA 1N8IA 1L6SA 4NXKA 1JUEA 3L0KA 2H3DA 4JKKA 2F61A 3SY1A 2HZGA 1AW2A 4LVDA 2RDWA 2V0TA 1P0BA 3T09A 4FX8A 1SZGA 3HZ3A 3LPPA 5FJIA 1LBMA 4KFNA 3TU9A 1YMYA 4LGXA 3FJNA 5C9RA 1V6VA 2PD5A 2XH7A 4AIEA 4EAYA 3E0IA 4HYWA 1E3XA 1OC5A 1YQ2A 1BXBA 3BH4A 3H70A 3HM7A 3PPHA 1I45A 2I5QA 3MP4A 4KCVA 4LNCA 1ZAIA 4WJXA 1XISA 5I77A 3E2QA 2W3ZA 4QRNA 3VZXA 1G67A 3H2CA 3KM8A 4IP5A 4JTAA 3P2VA 3SN0A 4QE1A 2YXOA 1W2VA 2WMIA 5DANA 3W85A 1FP8A 2Z2AA 3EZ4A 3ZT5A 2VX5A 1MI3A 2YDAA 4ILSA 4POCA 4F9JA 2G3NA 3SUVA 1OK6A 4NIRA 2V67A 5A6JA 3UG8A 5CPSA 3TTYA 2Z28A 4W88A 1X38A 4IJBA 2GQ3A 2W0UA 3MBFA 4ZVJA 1AA1B 2E25A 2J8TA 2YW3A 4JKLA 2QLYA 3N6JA 4IF2A 1RP8A 3LCIA 3A24A 2Q8ZA 4GVHA 4GI4A 3VGBA 3LCHA 1Q6LA 2HWGA 1BRLA 3DFPA 2Z29A 3SRDA 4Q4PA 3F5KA 4W8BA 2NV1A 4WGXA 8RUCA 1GKRA 2JE8A 3ELFA 4Q8MA 1TMLA 1RQEA 1FHVA 4O28A 4WDUA 2OX1A 3W2MA 1EHNA 5BOEA 4D8AA 1IEWA 2XSBA 2HVNA 4U4MA 4AVFA 1FHDA 1IIGA 1JCNA 4EANA 4C1NB 3LTPA 3CLWA 3CYVA 3VCCA 1PZ0A 1S2AA 4ZFMA 1JULA 4FIQA 5DXYA 2OYLA 5AHIA 3H4XA 3WQWA 2Z1SA 3VKCA 5AKQA 3EDEA 2QYGA 1XLHA 4A8NA 3E02A 1MW2A 3P81A 2ABAA 2PCEA 3N3TA 1AH4A 3BDKA 3W87A 1VF8A 2DZBA 3FAWA 1SJCA 1WDQA 3GS6A 2WBKA 2WZEA 3R10A 5XIAA 3M0MA 1MW0A 2YDSA 3E74A 1OYAA 2G3IA 1MWOA 5DCEA 5GNXA 4S3EA 5G1TA 3VC6A 4BQ4A 3GXTA 3S9YA 2WPBA 5CGTA 3MUZ1 3KRZA 4ENLA 1VFMA 4HCDA 3I4EA 3N6QA 2BHYA 2J9YA 1H7WA 4K8GA 1CW2A 1DIOA 1YX1A 4GQ0A 1EWDA 4KRTA 3LK6A 1IGWA 1XI3A 5E0KA 1A5BA 1XLDA 1S1RA 1O7AA 4LF1A 3W7EA 3IJ6A 1FX6A 4MZ8A 4C6IA 4D6HA 1YADA 3EEGA 5CG7A 3VD5A 2FGZA 4FXRA 1ZZMA 3ZR4A 2D3LA 5A6TC 1F3XA 2J7GA 2H8ZA 4JS3A 1DIEA 5G5IA 2PC4A 1F6YA 5FIPA 1DQWA 3M64A 2FVMA 2R9RA 2PEVA 4E5TA 2J47A 1OZMA 1H3GA 4D1IA 3L4XA 3DUGA 4JTCA 3MWCA 3GNNA 1S2WA 4L7ZA 1J0JA 3SCPA 1JZ4A 3DBPA 4OHQA 3WENA 5U7SA 3W1MA 2OWXA 2XSXA 1LUCA 1OZQA 1ZHAA 3AZSA 4YTUA 1K8ZA 2VFEA 1XLMA 1POKA 1TV8A 3GSMA 4Z2HA 4NI3A 5H8MA 4I3GA 3HO8A 3IIXA