1VLIA

Crystal structure of spore coat polysaccharide biosynthesis protein spse (bsu37870) from bacillus subtilis at 2.38 a resolution
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
367
structure length
358
Chain Sequence
AAFQIANKTVGKDAPVFIIAEAGINHDGKLDQAFALIDAAAEAGADAVKFQMFQADRMYQKDPDVSIFSLVQSMEMPAEWILPLLDYCREKQVIFLSTVCDEGSADLLQSTSPSAFKIASYEINHLPLLKYVARLNRPMIFSTAGAEISDVHEAWRTIRAEGNNQIAIMHCVAKYPAPPEYSNLSVIPMLAAAFPEAVIGFSDHSEHPTEAPCAAVRLGAKLIEKHFTIDKNLPGADHSFALNPDELKEMVDGIRKTEAELKQGITKPVSEKLLGSSYKTTTAIEGEIRNFAYRGIFTTAPIQKGEAFSEDNIAVLRPGQKPQGLHPRFFELLTSGVRAVRDIPADTGIVWDDILLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Spore coat polysaccharide biosynthesis protein spsE (BSU37870) from Bacillus subtilis at 2.38 A resolution
rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
molecule keywords Spore coat polysaccharide biosynthesis protein spsE
total genus 106
structure length 358
sequence length 367
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03102 NeuB NeuB family
A PF08666 SAF SAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1vliA01
3.90.1210.10 Alpha Beta Alpha-Beta Complex Type Iii Antifreeze Protein Isoform Hplc 12 Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 1vliA02
1LROA 2TYSA 4IUOA 1SFLA 3MBFA 4OHQA 4O0KA 2Q3OA 5DBUA 1RV8A 3CIWA 3HG3A 1WOAA 4LV4A 1ME7A 1G4EA 1PHWA 5CPLA 1AL8A 2DU2A 3O8AA 4Q32A 3DFQA 2A5HA 1XDMA 1PE1A 3GLCA 5BNKA 4ICNA 4LUJA 5HJLA 1P0NA 1J5TA 4C1LA 4N4PA 3W2JA 3CLMA 3BW2A 1FCVA 4HIBA 4R53A 1WBJA 1PIIA 4NX0A 3MYPA 4GC4A 1MZHA 4O52A 1W3NA 1TTQA 1G4PA 1SZGA 2W79A 3F4NA 1Q6RA 1OK4A 4UNLA 1L9WA 1KFKA 1GQNA 1KLYA 4UTJA 1FDYA 3PR2A 3STGA 1QNVA 3LTPA 5K3VA 1VCFA 3W88A 1OFQA 2SPGA 5MSIA 1TPC1 4UTHA 4MZ8A 3ABQA 3NQAA 3W84A 1F6KA 4X22A 4K8HA 5DXYA 1LLZA 4HNUA 5CZTA 4MLRA 3KX6A 5LKYA 1V7YA 5AC7A 2CZ5A 4OV4A 3B0UX 4UMAA 3BW4A 3STFA 1X6UA 4QNWA 1SZEA 3FS2A 4WD0A 2XFWA 1PV8A 3HMJG 3M5XA 2GPTA 3QFEA 1FWTA 1IGSA 4YMZA 3W7HA 1HO4A 2DJLA 1ZJIA 2FPYA 2YYTA 3CPRA 4MZ1A 1R2RA 3L21A 3BV4A 5EYWA 3Q58A 3ATZA 3QSTA 3B06A 3O1NA 3NL5A 3W22A 2OT0A 2E6DA 2BTMA 1SO3A 1OFEA 1F76A 4AF0A 2WKJA 1F7BA 3QH2A 1WA3A 2TRSA 4UTWC 4MY9A 3T7VA 1TPB1 6AMEA 2QCFA 3O6DA 2VC6A 1QO5A 4A2SA 2Y63A 2DP3A 3ELFA 4R34A 4E2BA 4UR4A 4JTKA 3KXQA 3PWAA 5C2XA 1ICQA 3C52A 3N2XA 3DKJA 2QAFA 1C8AA 1JUKA 2X1UA 1I2NA 3C2EA 3HIJA 2UV8G 4GUJA 3G1VA 4R33A 5AC6A 3MO7A 1KM6A 4IOTA 4H4IA 5U4NA 4O53A 4LY8A 1OYAA 5CZ0A 1HFBA 1I2RA 2Z6JA 4JYEA 4NY6A 2H3DA 3W2LA 1KM3A 5F2MA 1Y0EA 3S1WA 4UFHA 1GVSA 1EIXA 3NNTA 4KFNA 1ZY9A 3G1HA 5H2ZA 1WVOA 1TRIA 3P8IA 1ZENA 4N9DA 4WXZA 3B04A 5D32A 3JS3A 2IQTA 3LGEA 4DO5A 5HUOA 3DU0A 3SFKA 2H90A 1XC4A 3PBUA 4LT9A 3LV5A 1HL2A 2ZRZA 3BG3A 4LVFA 1FWWA 5IBXA 3HBLA 3HF3A 2CW6A 1EEPA 1K8ZA 2YXGA 3LLDA 1A5BA 1ZCOA 2CZEA 2HS6A 1W5NA 3GDRA 3QC3A 3P80A 2C16A 4IJBA 2ZTJA 1SO5A 1ME9A 5H91A 2NXIA 5DY2A 3UWVA 3DI1A 1YDOA 3M0ZA 3NPWA 4I7UA 4QQ3A 3LB0A 2KZHA 3HPXA 3IGUA 3LI0A 4JTJA 3E02A 2X30A 2VFHA 3HB9A 4JD4A 1PVNA 1TPH1 4FXSA 3R13A 2QUUA 3OBKA 3C8FA 2Y7DA 4MJMA 4WX2A 1SZNA 3W7RA 1QCWA 4K7VA 3BO9A 1EWEA 3HJZA 2ZCGA 3ZS4A 4JTSA 4IX2A 4LTSA 5I3FA 4RLIA 3O06A 4RKAA 3VFLA 3G1FA 3ZFHA 1NEYA 4O18A 4X3ZA 5KTLA 4NU7A 1DL3A 3KAOA 3KVMA 3S5OA 1IXNA 5LNSA 2R91A 1ZAJA 2I1OA 3RDNA 1RZMA 6TIMA 1IIGA 5U7SA 3I7RA 4MKNA 1HTIA 2H8ZA 2RH9A 3TX9A 3L0NA 1BEUA 4DXVA 1FBAA 4TU1A 3GKFA 3CWNA 1B3OA 2B7NA 3R89A 2H6RA 5AHFA 1GPWA 4NJHA 4BK9A 3PSWA 1KTBA 4DPQA 1ZAIA 5K7JA 4AEOA 3GDTA 4EVZA 1VLIA 2P0OA 2BWGA 5LHFA 1KBIA 2CFFA 1AW5A 1UUOA 3CM4A 2FJKA 3EX6A 2V82A 3CB8A 4B5NA 3M43A 2X16A 3TC6A 1JUBA 5AOUA 4AHOA 3T40A 1QPRA 2XN0A 3INPA 4GNJA 5D2WA 4NXKA 1KFCA 1G6CA 3UQNA 2NLIA 3CC1A 1I2PA 4LVGA 2Y88A 3W7IA 2QCCA 3C2VA 1F05A 1TCDA 4UMCA 3TQKA 3IV3A 3NQDA 3A23A 3NM3A 1JQXA 3O6CA 1K7FA 1MSIA 1FQ0A 5HULA 2Y70A 2ISSA 2E68A 4TMCA 1OHLA 1YDVA 4QISA 3GR8A 4KKXA 1G7VA 3H53A 3SECA 1Z41A 2QDGA 4FEZA 3AMEA 3NL3A 3UY7A 4AWTA 1EB3A 5CSSA 1S3HA 2AGKA 3LXCA 2V81A 3GB6A 1CI1A 2WV8A 3BGJA 3LX9A 3C3NA 4MFEA 1WQ5A 5CPOA 4FIQA 1SO4A 3W6YA 2ABBA 2HS8A 2X2GA 3BW3A 1AK5A 1ML1A 3PUDA 5KINA 3DFNA 1LRTA 1XXXA 4CCDA 4HNNA 1JQVA 2ISWA 3KFTA 4QM1A 2NUXA 1PCKA 5K4XA 2V2HA 5DCBA 3N73A 4IWWA 3TE9A 3M16A 5K4ZA 3O15A 7AMEA 2WNZA 4K36A 3W76A 4DQWA 4RK8A 2DZPA 5G2HA 5HWNA 4ZQCA 4FNPA 1KM5A 4UUIA 3MP3A 1K03A 2GVLA 3W7KA 4FNTA 5D33A 4MFDA 5AYZA 1G4SA 3DHFA 5EPDA 2OCZA 4QJ1A 1G4TA 2C13A 3W7LA 2E5CA 5AB3A 2QUTA 3NGJA 3BG9A 3G18A 3ZR4A 3MUXA 1XI3A 1OG0A 4DBEA 3LBMA 4I7WA 3P67A 4GWEA 1OF8A 1TPEA 3EXRA 1YTDA 2VOMA 1EWDA 5FF3A 3KRZA 1OYCA 2G95A 4O16A 4FO4A 4IGHA 3P74A 1JCXA 5CSRA 1TTJA 3BLIA 4M6QA 3QPYA 3W2NA 3QQ0A 2NV2A 2CLHA 2R8WA 1H7WA 3GDLA 1H7PA 3S6DA 4BR1A 3ABRA 5HMSA 5C5YA 4Z1BA 4HHPA 1SPQA 2X1SA 3RFAA 3TJLA 1SR9A 4LS1A 3IEBA 4UTTA 3NQ2A 4FXRA 3WJZA 1H5YA 1DKWA 4O13A 1LOLA 1FWNA 1YPFA 2V2DA 1KV8A 4YCPA 1AG1O 4ZQNA 2YW4A 4DO6A 1OX4A 3LHVA 5LNUA 4JNMA 4DF0A 4A21A 2YW3A 3SY5A 4EOUA 1G7UA 3A22A 3S42A 2ZZ6A 3EWBX 4O8RA 1IXOA 1JR1A 2OMAA 3FRNA 5HUPA 3L67A 3MBDA 3TXVA 3IGXA 5AHEA 2A85A 5G5IA 5DY3A 4LS0A 1TTPA 1GYNA 5FF2A 5LHEA 2WPBA 2WQPA 3W75A 3F4WA 4AF0B 4M6PA 1YXYA 4O54A 3IGSA 1N8FA 1F5ZA 4XTDA 5DELA 1TV5A 5FEPA 1ZALA 4CCEA 1M5WA 3DHDA 4IXHA 3SIZA 1GTHA 2YYUA 4MY8A 3W7DA 3PUEA 3OVQA 3TAOA 3W7MA 3TV8A 3RU6A 3M5VA 4Q4KA 1SU5A 1L2UA 5J5RA 2ALDA 1K7EA 2GJLA 3TXZA 3VI2A 2J9XA 2QJIA 2ZA1A 5LZLA 1I2OA 1W5MA 4O17A 5DCDA 1YADA 1BKSA 5IM51 3ANYA 3P84A 4X9SA 4TMBA 2ZRUA 1H63A 3OA3A 1I2QA 3GXNA 2EGZA 2XN1A 3EB2A 3NEVA 1XBXA 4CNOA 3DZ1A 5EY5A 1J4EA 2F7FA 3WK2A 1X8FA 2A0NA 2BLEA 4UXDA 2ZZ5A 5D03A 3TAKA 1F6PA 4J9JA 1VCVA 5FI8A 2OJPA 4N2YA 1Z48A 4LRSA 4AHPA 2ZQ0A 1LTDA 5K9XA 4BI7A 4QIUA 3W1MA 3TU9A 4CLMA 2DZTA 2QCNA 3NQFA 4NNAA 2WOQA 3M44A 1LBLA 1X1ZA 3G8EA 1ZFJA 1FDJA 2A7PA 1WBHA 1YTKA 2EAWA 3NA8A 1OX6A 1LORA 4UCGA 1LOQA 2CLEA 4DEFA 3HG5A 4DELA 2HSAA 3W83A 1UCSA 3LRLA 2EPHA 4PL2A 4QITA 1O5KA 1PCWA 2WSQA 1TRDA 3FEMA 5I3IA 3UPBA 3RNDA 1KDEA 2ZZ4A 1S5WA 1KTCA 3L9CA 1DQXA 3PULA 4N9CA 3G0XA 3OHIA 2NUYA 3CIXA 4JN6A 4MYXA 4DBDA 4JXCA 1TMHA 3AO0A 4ONVA 4JTGA 4O11A 5HR6A 4NUWA 2JBMA 4NJIA 4HPXA 1KDFA 2XN2A 4N6FA 3S1XA 2J88A 3TSBA 1JCLA 4NXSA 4ZQRA 3A9IA 4O1CA 1X1OA 3KRUA 6MSIA 4ZVJA 1JCJA 2Y62A 1XBYA 2ZRWA 3G22A 3M47A 1W8SA 3HG2A 3ZWTA 2GOUA 2I14A 5K9CA 3O63A 2EHHA 3M6YA 5ABTA 2C14A 2V30A 1DVJA 2NZLA 1D3GA 3MWAA 5A8GA 1TV7A 1B57A 1AW1A 4JIQA 3O05A 1KM0A 1KFLA 3KVJA 3LBCA 3B8DA 1W37A 2VFEA 4JGDA 1H7RA 3THQA 5CZSA 3T78A 2X1RA 1GWJA 3A5VA 4GUFA 2YPIA 3TMLA 5AC8A 5A5WA 1GVQA 3S8HA 3HO8A 1OFAA 2JIAA 3S9YA 4ZQOA 3GVGA 3QF0A 1IF2A 5FF4A 4DF1A 1H61A 5D2TA 1WDWA 2G96A 3FIGA 4HNVA 2QCGA 4POCA 3DXIA 2FPVA 5FF0A 3F1QA 4MY1A 3UXAA 3O6YX 4LVDA 3BARA 2V0TA 4RX0A 1NVMA 2QKFA 2Y7EA 3NOEA 2YCEA 3MHFA 1L6WA 3P7YA 2RHGA 3NO5A 1CX9A 5FEWA 3WFAA 4BWLA 1JRCA 1R47A 4FX7A 1SSGA 1P1XA 3MMTA 3G1XA 4FNUA 3MSIA 2WO5A 4XUGA 3C56A 3UPWA 4M7TA 4JS3A 2E77A 1F73A 1LBMA 3UYCA 3HGJA 3L5MA 3TA6A 5AYXA 1QPNA 2PC4A 1OX5A 2ZZ1A 4AMAA 2GJNA 3JR2A 3WJSA 3MJYA 2Y6ZA 4O15A 4JYDA 1PL9A 1OYBA 2E09A 5BMXA 4AAJA 4UFLA 2E6FA 1XBVA 4HSNA 1W5OA 2FB2A 3G1DA 3TIMA 3NL6A 1D9EA 3HGRA 1YXDA 4K38A 4GXMA 4LV9A 3C2OA 1TJRA 2PURA 3NQ8A 4NJKA 4IX0A 4O14A 1OFDA 3N19B 5CGQA 3FKRA 1S5VA 3EX3A 1FXPA 3W3OA 3B0PA 3BVJA 5FF7A 5HWMA 3IIPA 1O94A 4WY0F 2CLFA 3U8GA 1C9DA 3NPXA 4TX9A 4WZHA 3C0JA 3SZ8A 1W1ZA 4NZFA 3E49A 3QEZA 4L4MA 4JTIA 3L2IA 3B0VC 4AWSA 2G5WA 5D02A 2Z2UA 3ATYA 4XQ6A 1JULA 1DORA 2C6QA 3P62A 3B03A 1MEHA 1NSJA 1FWSA 3W7NA 3NQEA 1TPWA 3Q37A 4O0ZA 2V5BA 2P1FA 3P82A 3PBWA 1OK6A 5BW6A 5TQLA 5F2LA 4MOZA 1Q45A 2C15A 1KM2A 1TTIA 3L65A 3NQVA 4NT0A 1YXCA 4N6EA 1I8JA 4JX5A 4A29A 3FYOA 3I7QA 4ORMA 5D30A 3C2RA 4Y90A 4UTTC 3UY8A 3PUOA 3KRSA 4Z0JA 4HT3A 3SW6A 3LHYA 5E93A 1PHQA 3UWZA 3E0IA 1XCFA 4OQVA 1Z42A 5CG7A 5GVJA 4AWUA 3F03K 3LXAA 3K30A 5IBXC 3GXPA 3G0UA 5G2IA 1HUVA 2EF9A 1SW7A 1EPXA 5G4EA 5D09A 1NF0A 1GVOA 2ISVA 2VENA 4N9BA 1JJKA 5G4WA 3SI9A 2QR6A 2R94A 1P4CA 5HNRA 1QFEA 1VLWA 3RLUA 4BWLC 2VFGA 1U5JA 3M7WA 4O28A 4UFMA 1UCWA 1OFBA 1OX4B 4BFAA 4OBTA 3TFXA 8MSIA 1LDCA 4KFPA 2QCHA 1W5PA 3LRMA 4JY8A 1RQBA 3GX9A 1GG0A 3NQCA 4BF9A 4WJEA 5AHLA 1QR7A 3OEXA 5FESA 1FUYA 1MO0A 1TV8A 2Y61A 1UB3A 3W2UA 4ZZ9A 2E5BA 2O7QA 3NZ1A 3G1SA 3TR2A 2YGYA 4QAIA 3LV6A 3L68A 4O4VA 2FPTA 3I68A 4PL1A 4O10A 1NF7A 1EX5A 2V5LA 4NJGA 4LUIA 1M7OA 5EA9A 3CEUA 3G1YA 4FNSA 3W70A 3W7OA 4QNEA 1JRBA 2QEZA 2FDSA 4KFOA 5KZEA 4OU1A 4TO8A 3SR7A 5AYYA 5E1QA 4AHQA 3N3MA 1ALDA 4LW7A 3W1QA 4P2VA 5KMYA 3LCHA 4PH6A 1YLVA 1GVFA 3GAYA 3W9ZA 3STEA 2VELA 4JDBA 5KITA 2NV1A 3NAVA 3D0CA 3W7EA 4EF9A 1B4KA 1RPXA 3W1XA 4HNTA 1YDNA 3IRDA 2H3BA 1K8XA 1W56A 4LWWA 1EUAA 1LM1A 5DN1A 4M19A 1W3IA 1H62A 4UFJA 4E0CA 2TSYA 2ZZ2A 4Y8FA 2LX3A 3CQ0A 2NWSA 2F84A 3QRHA 1G67A 1JVNA 1FX6A 5SWUA 3LM7A 4Z08A 5HWJA 4UFIA 1H1ZA 4TIMA 3RLVA 3MW7A 1L6YA 4PTNA 4FIRA 2RFGA 1XL9A 5AHNA 5D04C 2VEKA 3TFCA 2A2IA 1LZOA 3OG3A 4JTLA 5KZDA 1GG1A 1UBSA 3IVUA 2E6AA 4JTHA 4HKPA 1I4NA 4G1KA 3TMQA 3NZRA 2GVGA 1C29A 1XFBA 3GDMA 4XZ9A 2G97A 4W9TA 4S2BA 1K8YA 4NZJA 3LRKA 1OF6A 2DORA 4CQ8A 2EKCA 4RXGA 3SGUA 5KZMA 3M9YA 1WX0A 1L6SA 4E2DA 3P81A 1A5CA 2W6RA 4KWVA 2GQAA 5T26A 5L9FA 1KM4A 1N7KA 3QM3A 2JKAA 1H7NA 3GAKA 3RMJA 3QW4B 4LU0A 2CU0A 2ZTKA 1CW2A 1GOXA 3CWOX 1WYIA 1HG7A 3NXFA 2PCQA 2ZRVA 5C6MA 3SJ3A 5J5DA 3FYPA 3HGOA 4UNKA 5D05A 3BLEA 1VS1A 3NPUA 3TQVA 5AHIA 2CLLA 4GRSA 4XWUA 3GIYA 4JR5A 1RR2A 2CLMA 2QUVA 5F2GA 3S5ZA 2QJHA 1KW1A 2GUUA 2OX1A 3MHGA 4IPJA 4UMBA 1UUMA 4WY0A 1RVGA 6ALDA 3W7JA 1DOSA 2A6NA 2ZRXA 3DFSA 3L0KA 3MI6A 4LVAA 3MP4A 1SQ7A 2Y85A 3QJAA 4AH7A 3TW7A 3W74A 1GT8A 5AFDA 3BLFA 4Q33A 2W0UA 3QF6A 5AHMA 3WJXA 3S5NA 8AMEA 2E5DA 1Z44A 3VE7A 4A2RA 1Q6OA 2QCLA 2C3ZA 3EWUA 3LCFA 2RDUA 3LCIA 1IIHA 3G3DA 2I9EA 1LRNA 3M5YA 2WSYA 3DBPA 3I65A 2VEPA 4O12A 3BPWA 4GFSA 1AL7A 4MYAA 4JX6A 5LNRA 5C55A 3IVSA 1FXQA 2ZBTA 3M5ZA 1TPVA 5FEXA 2RDTA 1VRDA 3I7SA 3LOTA 4MJZA 1GYLA 1O4UA 1SFJA 5EMUA 4LNYA 5DXXA 4CNPA 1GZIA 2Z6IA 2CZDA 4L4LA 1OVDA 3U2OA 2D73A 3UWQA 4ZMGA 1TO3A 1Q6QA 4ADUA 5C54A 3NQ7A 1B7JA 2Q8ZA 4EWND 1O5XA 2X1TA 3GZ3A 1JCNA 4XBKA 1V5XA 1C8VA 4GUHA 2NUWA 1QPQA 3MI3A 2FLIA 3E12A 2PE4A 3N14A 1VZWA 4JIPA 4R7JA 5CPMA 3IIVA 2FIQA 4FNQA 3NQGA 3QMTA 2B7OA 2WSRA 1QO2A 1R2SA 3V75A 1TB3A 4BI5A 2A6LA 3W07A 1JCYA 2QF7A 4H3DA 4LOCA 3UZ5A 2QCEA 1X7FA 4M7SA 3GNNA 3P61A 2LLEA 3W1RA 5G2WA 1MSJA 4JY9A 3TNOA 8TIMA 5I3JA 1RQHA 4ZL1A 4ZQPA 1F2JA 4IMGA 5D38A 3FOKA 4PA8A 1DBTA 3YPIA 5LGXA 1ZHAA 3QZEA 1H51A 1XBZA 1TYGA 2Y89A 2BSLA 3L5AA 5E0KA 3PM6A 1KLZA 4UFKA 1TQJA 1HO1A 2CLKA 2TMDA 3I6RA 4Z1CA 1DV7A 3UXDA 4H6KA 3L0GA 4ML9A 1GZGA 3IIXA 3EEGA 3LHZA 1SO6A 4MVAA 3HOJA 3P5ZA 3LXBA 3TH6A 3W2KA 5TBOA 1XDLA 4DPPA 4D2JA 2C1HA 3L5LA 1SUXA 4JTUA 3TUUA 3LLFA 1XM3A 3W7QA 3LERA 2E1DA 4P61A 4M5PA 4ADSA 2A7NA 3THAA 2PRMA 1O95A 4JDYA 1XKYA 3H54A 1A50A 3PBVA 3W23A 4E38A 2QAPA 1FCQA 4FX8A 1J2WA 1DHPA 3TQ0A 4LC6A 3WJYA 3BK0A 1YPIA 4K7YA 3TKFA 4CQ9A 3W1NA 5LSMA 1E51A 1KTNA 3WK3A 4O1AA 4RXFA 4HPJA 4UIOA 4MIMA 3S1VA 4UTUA 4X2RA 1AMEA 4O4WA 1BTMA 4N4QA 3TSDA 5F1VA 4HSOA 2C19A 1ADOA 2C18A 2NXGA 1TPDA 3QMSA 2ZA2A 3T4CA 1W31A 5CZJA 1AMKA 5BMWA 3LCLA 2YDAA 3NPVA 3QSRA 5G1TA 3W73A 1B7IA 2QCDA 2NXHA 3ABOA 5I3GA 4Y96A 1MSSA 1THFD 2HTMA 3PBYA 3TJXA 1BWLA 3PY2A 5KSWA 4IMEA 1QAPA 3HQ1A 4XKYB 3VKJA 4OT7A 3TC7A 2FFCA 3HPSA 3OVRA 4WOZA 4WXYA 5HQEA 4RZ5A 2ZRYA 1OFRA 4MSIA 3NDOA 1IXQA 3TDFA 2GQ9A 4U28A 3G1AA 3IIOA 1MEWA 4HN4A 4YCOA 2DZXA 3NM1A 4IQLA 3NVTA 3BG5A 1FDZA 1RQEA 4K39A 4YXGA 4LVBA 1FWRA 1Q3NA 1LOSA 3N9SA 5DCEA 3EKZA 3EX1A 3N9RA 4ORIA 3L66A 2CLIA 4O50A 1MEIA 4Z1AA 1A5SA 1LP6A 1VYSX 4OGZA 3V1PA 4UR6A 3S1UA 4YL2A 5CPNA 4CNNA 4IMCA 5HR7A 5EBUA 3C61A 1PS9A 2VEMA 2NX1A 1QOQA 3KVKA 3PG9A 4BI6A 4JTFA 2V8ZA 2B7QA 3NQ6A 3IVTA 2ATSA 3W71A 3Q94A 1YYAA 3QPZA 4DO4A 1OABA 1FCBA 4YLWA 1ONRA 3WK0A 3VE9A 2ZFAA 5I3KA 2AAMA 1WOBA 4GE8A 4QSHA 3TCEA 1B7KA 1VPXA 3GDKA 2NX3A 3DFOA 5BRBA 2CZFA 2DZWA 1TPUA 1EP1A 1R2TA 1VJIA 4M6VA 3U6WA 5F1UA 4OV9A 3G8RA 5FEZA 3LCWA 4O1BA 4PODA 2C0AA 3OVPA 1H7OA 3G0SA 1WAUA 3UWUA 2FQIA 5EL1A 2V2CA 3KHJA 1YTEA 4IXXA 1ME8A 3MHUA 2A4AA 3R2GA 4MUZA 3VNDA 4EIVA 1TIMA 3FJLA 4XTIA 2WNQA 4YWIA 1S5TA 2DZVA 4UTMA 4IMDA 3FKKA 3LHUA 1T0OA 1K3UA 2B4GA 1UJPA 1P0KA 2OZ0A 3G24A 2GQ8A 3G3MA 1QDSA 4NJJA 2MSJA 3HG4A 3LI1A 3EWZA 3UNDA 3RF9A 4UTKA 4Z0SA 2FB3A 3FFSA 1FCUA 3IIZA 3BGGA 1DJNA 1M7PA 4WY0B 3GXTA 5CKSA 4KWWA 1VYPX 4ADTA 1DJQA 4K6AA 4S1FA 1R30A 2ZYFA 4JEQA 2P10A 2NX9A 3C4UA 4DF2A 3N34A 2A1YA 4RZ4A 2VFFA 2JK2A 2LX2A 2Q3RA 3GKAA 2ATMA 3W72A 3DI0A 1BWKA 2GVJA 3P60A 1H50A 1H60A 2OT1A 5K9DA 2B7PA 1HG3A 2J6XA 5MHBA 1OPSA 3ABSA 2Q8LA 3LTSA 5D2YA 5D37A 3LDVA 3PS7A 5D2XA 1H7XA 3TK7A 1VR6A 4Y9AA 2YFNA 3W2MA 3DFTA 9MSIA 3UWYA 2NWRA 2QCMA 2JKPA 1LYXA 3P5YA 2VFIA 2H8XA 2YX0A 3SSJA 3W7PA 1ICPA 3B05A 3CU2A 1KM1A 2DJXA 1GEQA 3R12A 1QOPA 4FNRA 3PB2A 2YFOA 3DH7A 3E9AA 2DZUA 2HMCA 1EUNA 3B4UA 4LC8A 1U83A 3GNDA 3EX2A 1DQWA 3MP5A 4K37A 4PC8A 1GJPA 2Y7GA 1AW2A 2CLOA 1T8XA 1JUEA 5F4WA 4I7VA 3RK8A 4XBSA 2VXNA 2B0MA 3OIXA 2VFDA 3CTLA 2VKZG 4O57A 1RD5A 1B9BA 3W85A 4IMFA 2RKXA 1A53A 1C89A 3LTYA 2AQWA 1TREA 1LCOA 4MZYA 4UR8A 4K8EA 3W1TA 4NVTA 1SSDA 1P5BA 1EP2A 2ABAA 3T44A 2BXVA 3NL2A 1H1YA 1W5QA 2VEIA 2R14A 2AMEA 5TIMA 4MPQA 3DFPA 1SZFA 3PB0A 1EKLA 3Q2DA 3FLUA 3M1ZA 4U4MA 3PG8A 3LHWA 5L6UA 4PEKA 2A21A 4UTWA 4Z1DA 1QMLA 1WXJA 2J24A 5F4XA 1Q6LA 3EWXA 1XUZA 2V9DA 3KOFA 4LS2A 3DAQA 4ZQMA 4I9AA 1JABA 2ZA3A 4GJ1A 1TJPA 3T55A 1SW3A 3W86A 1XUUA 1UASA 3EWWA 4RCXA 1A5AA 1M6JA 4GBUA 2BZNA 3DENA 4NQ1A 2QJGA 2TPSA 1T99A 1TPFA 4IPIA 2Y7FA 4O19A 3W1AA 1QPOA 2PRHA 1OFOA 3USBA 3W1PA 1N55A 5LGZA 3NQMA 3QMRA 2JGYA 3A24A 4WOQA 4GUIA 4AMEA 4UTLA 3O07A 1JCMP 1IXPA 3PF3A 3EX4A 3S0CA 4MLJA 1ICSA 2ZZ7A 3NLAA 4S2CA 2QDHA 2MSIA 4FHAA 4RR4A 2Z1BA 5F2IA 3QYQA 1K02A 3FA5A 1OFPA 3C2FA 4NNCA 1GVRA 1I45A 3R5EA 1NFBA 2YSWA 1FY6A 3W87A 4GUGA 1LRQA 2YR1A 5HINA 2ZZ3A 4JTTA 4UC5A 3EXSA 3MYOA 3PSVA 3GYEA 3TROA 7MSIA 2WJZA 3UZJA 4AVFA 5G1YA 1ZAHA 4JYFA 1KV5A 4RJEA 3E96A 4FF7A 3WJWA 4XKYA 3LCGA 3TW6A 3W7GA 3GK0A 4A22A 4NX5A 3EWYA 3STCA 1TQXA 3QW3A 1EP3A 2WNNA 1T96A 1VCGA 1KFBA 5LNVA 5DBTA 5F4SA 5K2ZA 3UD6A 1W3TA 1VH7A 1ZNNA 3W7CA 3P8JA 1W54A 4EF8A 1LLWA 2CWNA 2FTPA 1KA9F 3S5YA 4CCCA 3MI2A 3C6CA 4FB7A 3SGZA 3VCRA 1WV2A 3ZWSA 1NAL1 7TIMA 2PRLA 2J9ZA 1VHCA 1KFJA 4C1KA 4OWGA 2JKEA 1SW0A 2BX7A 4O1DA 3PAJA 3NG3A 1VYRA 3O16A 3NYZA 3A5FA 4FX6M 3TSMA 4UTIA 1EA0A 1O60A 2JGQA 3QQ1A 4CQAA 3W1LA 2DZSA 4N9EA 3M41A 4AB4A 3A21A 4N02A 3EKLA 2O7SA 1K7XA 3WK1A 3UWWA 4Y6GA 3DKLA 2RDWA 2YZRA 1KBJA 3AJXA 3W1UA 1VGAA 3H55A 2E6YA 1OJXA 3EXTA 4ALDA 3JRKA 3GR7A 2A7RA 3R8RA 4JTEA 4RV8A 4PCFA 3N2MA 3KVLA 3PC0A 1GTEA 4JX4A 1LBFA 2J27A 3CT7A 5DLCA 1MXSA 4PFMA 3LHTA 5D2VA 5EKYA 2ZDRA 3FJ6A 3NR0A 1F74A 1KFEA 3LCXA 3HGSA 4A3UA 1VHNA 3CEPA 4WUIA 4RZ6A 4UR7A 5LNWA 1QWGA 4AXKA 2Z0IA 1R46A 4JICA 5I3HA 3DGRA 5AN7A 4OE7A 4NNBA 1B4EA 3CHVA 1D3HA 9AMEA 1W0MA 2J9YA 2QCDB 1VC4A 1G69A 4LRTA 1TSIA 1VQTA 3PVFA 5BOOA 4TR9A 4WQ6A 3HPZA
chains in the Genus database with same CATH superfamily
3AJ7A 3WNPA 2QLYA 1SFLA 1J2BA 3SQSA 4OHQA 1RV8A 3HG3A 1ME7A 1UMYA 2WK2A 1V4YA 5CPLA 1NU5A 1UKPA 3R8HA 1NOUA 3O8AA 2A5HA 1JZ8A 3AYRA 5HJLA 3SN0A 1A4LA 4C1LA 4N4PA 3MVTA 3NOYA 3TTQA 1DPMA 1PIIA 4NX0A 3MYPA 1CTNA 1MZHA 1TTQA 2VQUA 4RW3A 1EO7A 1W1VA 3WEOA 3SCVA 3WDIA 4PSRA 1EGMA 3PR2A 3LTPA 5K3VA 3H6OA 2FHFA 1X38A 3LPFA 3W88A 2SPGA 5MSIA 4D8ZA 1V02E 1VEOA 3NQAA 3W84A 2IXUA 4YYCA 1HJQA 5I07A 4XD4A 4C6MA 2W3ZA 4WRHA 3T42A 4LAOA 3PUGA 1GHRA 1OC6A 1LT8A 4WD0A 3UVAA 2YLLA 3GUWA 1P0EA 3KTXA 1J79A 4Q8NA 3N4FA 1YHTA 2NVAA 4M80A 1HO4A 3ORWA 1ZJIA 4Z2KA 3CPRA 3AHTA 3K2GA 2E1WA 2OODA 2E9MA 1UWIA 1Q65A 1MFVA 4JN8A 3W22A 2OT0A 1SO3A 2VOTA 4CQBA 1F76A 4ATLA 4AMCA 6REQB 2OXNA 3MQTA 4WK9A 4FOJA 4UTWC 1TPB1 6AMEA 3W28A 2QCFA 3O6DA 1TV3A 2P53A 2VC6A 7XIMA 1X98A 1MQRA 3WLMA 2Z4GA 4UR4A 5BU6A 2WM0A 4A3YA 3UR8A 1JUKA 1I2NA 4PFHA 3D5HA 3HIJA 3G1VA 1GW9A 1TKKA 4R33A 3FJ4A 5AC6A 1KM6A 4JL1A 1IZKA 4H4IA 4IOTA 3A4JA 4E3TA 3KBVA 3UCCA 2P0IA 4PTVA 3VA8A 3S1WA 4UFHA 1RY0A 1Q4WA 1REQA 3SY1A 5FAJA 3G1HA 1F9CA 2R1KA 3P8IA 1OGBA 4DY1A 5HPOA 2C71A 5FJTA 2VGGA 2Y1HA 3OVGA 4E5TA 3DU0A 4OUIA 1ELSA 1XC4A 2C0HA 5HNNA 2UY4A 1HL2A 2F6UA 3HBLA 1SJDA 4XD5A 1EEPA 2YXGA 3LLDA 1GOMA 4MJ4A 4IJBA 1YNYA 2JALA 2VMFA 2PDGA 2PDCA 5FCZA 4QDPA 4XUYA 1YDOA 4HZ8A 3LB0A 2KZHA 3HPXA 3IGUA 4JTJA 4PMVA 3H2MA 4JD4A 1PX4A 4FALA 3TEVA 2G3JA 2Y7DA 3F7JA 1QCWA 2FGBA 1EWEA 7REQB 1TZ7A 4JTSA 2ZC8A 4HU8A 3B9DA 3FGCA 4RKAA 1VEMA 3FSTA 4H01A 3G1FA 1ZBCA 1ZB5A 1FWGC 3ZFHA 2CC0A 2I5IA 4O18A 3AIBA 3B8SA 1MQPA 3WMCA 1DE5A 4H6RA 3S5OA 1US0A 4H9MA 5U7SA 3QHOA 2ON3A 3QR1A 4MWAE 4XX6A 1FBAA 1KCKA 3GKFA 5B80A 4MM1A 1B3OA 2B7NA 3TA9A 2H6RA 7A3HA 3PSWA 1KTBA 4DPQA 1I60A 5K7JA 5JVLA 1FFRA 1OCQA 1PKLA 4AEOA 3GDTA 3R0UA 4CGTA 1Q7ZA 3CB8A 3M43A 2X16A 4IIBA 1JUBA 3RITA 2DIJA 2XN0A 3INPA 4NXKA 1KFCA 3KE0A 1G6CA 2Z1WA 4GVGA 1WUFA 1F05A 4UMCA 2EBNA 3D6NA 3A23A 1HKIA 4D8AA 3BURA 3U2ZA 4TMCA 4QISA 3SCNA 1QI5A 1DE6A 3D46A 3RGTA 3H53A 2QDGA 3MMUA 1A3WA 5JMUA 3LXCA 3A9BA 3BGJA 1KWKA 4K68A 3H2NA 1HT6A 4MFEA 2DW7A 2WJDA 1VFLA 1TE1A 2CXEA 3BW3A 5KINA 2DW6A 1GZ1A 4HNNA 1OBAA 4WR3A 1Q5MA 3M16A 5I78A 5LYRA 3KRBA 1S39A 1BAGA 4K36A 3W76A 4DQWA 3EPNA 3GU9A 1KNWA 4HTBA 5JBEA 5HWNA 1UZDA 4FNPA 2CCRA 1J8VA 1UA3A 4CU6A 4PYSA 2GVLA 1MMFA 1M03A 2GJRA 5D33A 4MFDA 5AYZA 1GUVA 1NWSA 4L4OA 3VDAA 3DHFA 4QJ1A 2QUTA 5IHRA 4HOXA 3LGDA 2VC5A 4NAFA 4JTCA 5A6KA 3WH6A 2E28A 1OG0A 4DBEA 4EK7A 5LIWX 3EXRA 1EWDA 3GTXA 3KRZA 1RSCA 4FO4A 5MKGB 1JCXA 1LT7A 1QHZA 5ABFB 3BLIA 3GC2A 4RE3A 3W2NA 3QGAC 2NV2A 4B5WA 2R8WA 1H7PA 2CXGA 2NSOA 3ABRA 1KKRA 4QSFA 4MDOA 2XUCA 1V93A 4F0MA 3FVDA 5CSYA 3TJLA 1SR9A 4LS1A 3WBXA 3WJZA 1P7TA 4L65A 2FVLA 3W27A 2ZUTA 4YCPA 1PZ1A 3N18A 1AG1O 4D6EA 4PRTA 1OX4A 3LHVA 1FWCC 5HA7A 3VCCA 4JNMA 3FY1A 3UG3A 4DF0A 5T91A 4GVHA 4A21A 3UBPC 3LNPA 3U7VA 1G7UA 4JEJA 3FJNA 1IXOA 2DT0A 1JR1A 3FRNA 5DMYA 3OW1A 1LJYA 1XQLA 4LS0A 2QYGA 3ARQA 5LHEA 1QRQA 2PDMA 4OOUA 4AF0B 1W3JA 1F5ZA 4XTDA 3M0JA 3N9KA 1ZALA 3HU7A 3ITCA 1UP2A 2PDHA 3FXGA 4C1NA 4MY8A 4RNHA 3W7DA 2QPXA 3PUEA 3OVQA 4GVFA 4HA0A 4WSHA 5J5RA 4AC1X 1NTHA 2ALDA 3SUVA 3D3FA 1ODUA 1XIHA 5A6SA 1MFUA 1UR4A 2QJIA 2ZA1A 1DTUA 5LZLA 1JPKA 1ZP3A 1DQUA 1YPXA 1I2QA 1XYZA 2EGZA 3EB2A 3NEVA 3GVWA 3DZ1A 2A0NA 2BLEA 4UXDA 4Q8UA 5CPQA 1WKDA 3TAKA 1JXJA 2WVSA 1LWJA 2YXXA 1VCVA 2OJPA 4CU7A 4N2YA 2Z29A 5I06A 4ZTXA 3U4AA 4AHPA 4ZXLA 4YTRA 4P5UA 3TN3A 2XSXA 1HL8A 3NQFA 4LEFA 3S2MA 2BBFA 4J4KA 3CO8A 4W86A 2Z26A 2PP3A 5BYWA 4CUCA 2G50A 2BP1A 2VO5A 5LA0A 2GLKA 4H9UA 4BQ2A 3IARA 5A6JA 4MUPA 3WBWA 1XGZA 5I3IA 1KDEA 3L9CA 1KTCA 1KGUA 5EU9A 4JXCA 4HK6A 5HR6A 4NILA 1KDFA 4ZQRA 4LUSA 3L2LA 2WNWA 1E43A 4ACZA 6MSIA 4ZVJA 1JCJA 1OZMA 1XBYA 2ZRWA 3B0XA 1W8SA 3ZWTA 3O63A 1WZAA 2CNCA 4DWDA 3H8AA 3M6YA 3HN3A 3VD5A 1PB0A 5C9WA 2NZLA 1SJCA 3PZOA 1DWAM 3SCTA 1V03A 1S2CA 3KVJA 3THQA 3UG4A 2X8RA 4DJED 3T78A 2X1RA 4Y9OA 4HOWA 5DRCA 1UD3A 5AC8A 4ZO9A 3AZTA 4W88A 3LPGA 3HO8A 4AD3A 5RUBA 4ZQOA 2VTFA 5FF4A 3UZZA 1WCGA 1MYRA 2G96A 1MRQA 1NQKA 2WJEA 4MY1A 3O6YX 4LVDA 3BARA 4IQEA 4MNKA 5CZKA 4A8IA 4PSPA 5BU9A 3NOEA 4V27A 1HIZA 1AQHA 4BWLA 4FX7A 1SSGA 1OD0A 3G1XA 4FNUA 2WO5A 3E3HA 4JFVA 1TWDA 3UYCA 4F2BA 3OA5A 5JBFA 5AYBA 3OGRA 2OPJA 1QPNA 2F2HA 2PC4A 3MUIA 4M51A 2J7CA 1UQZA 4H9ZA 3QV8A 3V0UA 4AMAA 2Z28A 2Y6ZA 1PL9A 2ESCA 1UUQA 3V3WA 2E09A 4AAJA 3T0BA 2E6FA 4HSNA 3XISA 3G1DA 5A6BD 3TIMA 3NL6A 1EC7A 3URNA 1NWTA 1EZ2A 9XIAA 4LV9A 1TJ1A 4RL3A 4D6FA 3GH4A 4Q4MA 1QXLA 1FWBC 4IX0A 8XIAA 1R7AA 2G0WA 4O14A 3N19B 1QNRA 2YB1A 1PDZA 3ABZA 4S3KA 2BHUA 4NG3A 5HWMA 1O94A 4WY0F 4GO9A 1POKA 5I09A 4TX9A 1K6AA 4LX4A 2OQLA 2WC7A 2PBOA 4AWSA 4L7ZA 5D02A 2Z2UA 1JULA 4MNMA 1NSJA 3W7NA 3GXFA 1TPWA 3SN1A 1JXKA 4HHMA 4IIGA 1XH2A 1E1EA 4BQ5A 4ENLA 4H04A 4B4HA 5TQLA 4MOZA 1VJSA 1BXCA 1KM2A 1TTIA 3NQVA 1W9UA 4JX5A 3DHPA 3CBWA 4ZCWA 5AZ0A 2ACUA 4Y90A 4UTTC 1GJUA 3KRSA 1JZ5A 3SW6A 3ECQA 4FI4A 3LHYA 2QPUA 1UKTA 4EXBA 3WF3A 3NSNA 2GVEA 5FAGA 3F03K 3COTA 3LXAA 4DIAA 5G2IA 1Q8AA 1EXPA 3OQEA 2VENA 1JJKA 3SI9A 4OECA 2UWFA 1Z3NA 3BGAA 3MSGA 2PI6A 1QFEA 1VLWA 1R8LA 2J66A 4BWLC 3M7WA 4O28A 1UCWA 1JDDA 4BFAA 5A6TC 4OBTA 1LDCA 4KFPA 1W5PA 1GG0A 3V0SA 3QHNA 3O0KA 1DIOA 5A6AA 1E1FA 3ZZ1A 4B15A 3WEMA 5FESA 2NT1A 4JFUA 4ZZ9A 2E5BA 2CESA 3TR2A 2REQA 4D6HA 2YGYA 3SM0A 3GRIA 4O4VA 1P48A 1ENUA 4MNLA 2HE5A 4NJGA 3UR2A 1JRBA 2QEZA 4O1FA 3LM3A 2FDSA 1XIGA 1UOZA 1TG7A 3W29A 1A5MC 2VVNA 2I5QA 4C6BA 3V5CA 5AYYA 5E1QA 4WIWA 4D9PA 1GKRA 2DVUA 4P2VA 3UGVA 4IGNA 4E3VA 2H9AA 1GVFA 3GAYA 3UF9A 2UY5A 2VELA 4O1EA 2GSHA 4XISA 1E71M 4EF9A 3OBEA 1B4KA 3NUKA 3HQNA 3SBFA 1E5JA 2J7FA 3E0WA 4LWWA 2J25A 2VHLA 2FGLA 2JF6A 2HRWA 3MUZ1 3MKKA 3WH5A 2WKLA 2P76A 3NVDA 3MTWA 4NZ4A 4P7OA 5HWJA 2INEA 4NIRA 4UFIA 3WENA 3WQ8A 2WJFA 3VUSA 4H7CA 5IDIA 5H8UA 3KBWA 5FSEC 3EDEA 4FIRA 3GG1A 4QLLA 1V0NA 1XL9A 3F5JA 3PPCA 4ZTYA 2B81A 1GVYA 5BWAA 1GG1A 5PTDA 3IVUA 1XFBA 2D2GA 4XZ9A 2G97A 3N04A 1VENA 1XCWA 4W9TA 4QAWA 4S2BA 4W84A 1O5QA 5LA2A 3SGUA 5KZMA 3M9YA 3N4EA 1TE6A 2GQAA 5T26A 5L9FA 1KM4A 4LYRA 1CCWB 3QM3A 1HF6A 3G77A 1XISA 1KD0A 1F6YA 2J75A 3MANA 3TYBA 4ZOBA 3QW4B 4NP7A 3CWOX 1EQPA 3GTNA 1JCTA 3NXFA 3WUBA 1WZMA 4XVEA 5J5DA 4LUYA 2Z1VA 3HGOA 5D05A 3BLEA 1VS1A 1AH0A 3WUFA 4JR5A 3WD2A 4DJDA 3MJMA 1RR2A 4H1ZA 1H11A 2VZUA 2Z27A 2CLMA 3URAA 1NARA 1KR0A 5F2GA 4QEEA 1O6IA 4IPLA 2QJHA 4P7LA 4TVDA 1JPMA 3MHGA 3BCDA 4UMBA 1XGDA 3P2VA 3IGHX 4LVAA 3MP4A 3EOSA 2PDNA 4QXIA 1XRSA 2WAGA 5CC7A 5AFDA 2W0UA 3BJFA 5AHMA 3VIMA 2OTDA 2NQ9A 2YCKX 3V0TA 4A2RA 1UHVA 3CHFA 1Q6OA 4UOJA 1XLAA 8XIMA 2DFAA 1IIHA 4IG2B 4PTMA 1LRNA 3APGA 4JKKA 4PUUA 5EBAA 2VR4A 1J12A 2X7VA 4RV3A 3WLQA 1J0HA 2UZ9A 5LNRA 4RPQA 3CZLA 4B91A 2ACRA 2RDTA 5I7GA 4LCQA 3LMZA 3KS6A 3FX4A 4MJZA 2J78A 1GOWA 1O4UA 3VM7A 4LFYA 4US6A 2ZXQA 4WKFA 3EA2A 3H26A 1NOWA 2Z6IA 1XV8A 3WD4A 4K3ZA 1OVDA 3U2OA 4KWUA 2D73A 1UP0A 3PANA 4ZMGA 1RUSA 2ZICA 3RXZA 3GIQA 3GZ3A 3N6QA 3C3UA 2NUWA 5FD0A 4ZSUA 1KQYA 4FZIA 1GVEA 1M41A 3NQGA 1A49A 1TB3A 4XZNX 2YL6A 2A6LA 1JCYA 3UZ5A 3T08A 5H1WA 4NZ5A 2ODOA 4MDPA 3V1HA 1OC5A 1Q7QA 1IGWA 3RIKA 3OODA 5FKYA 3CL7A 4LB4A 2DZBA 3WDQA 5I3JA 4PMXA 4ZL1A 1XYAA 3PNZA 4PA8A 3YPIA 1AVAA 1XBZA 3KCLA 2Y89A 2BSLA 4ZB0A 5LXXA 1HO1A 4M82A 3ENLA 4Z1CA 3UXDA 2DSZA 4R27A 1SFTA 1GZGA 4JCLA 3LHZA 1XLIA 3QXBA 4JFSA 3ZVHB 4MVAA 2PDUA 3W2KA 1XDLA 3GVQA 4D2JA 3BOXA 3L5LA 4JTUA 1OT2A 1R7OA 1XM3A 3LERA 3N1AA 1XYCA 4P61A 4M5PA 3IRSA 1O95A 5JBDA 1XKYA 3H54A 2YCIX 3W23A 4Z1YA 4ML4A 4FX8A 1J2WA 4OOZA 3TQ0A 4GG9A 3VDBA 4LC6A 3NCOA 5M3WA 3BK0A 3QY7A 3TKFA 3VM5A 3S1VA 4UTUA 3W02A 4N4QA 4EANA 3TSDA 5HBFA 2QULA 1R3TA 2NXGA 4LALA 3QMSA 2ZA2A 4MAVA 5BMWA 1W1B1 2FMOA 3BAYA 1A5KC 3W73A 1VFHA 3VGFA 3G1RA 3ABOA 1JNDA 1VRXA 1THFD 5CCZA 1OCNA 2HTMA 2V3FA 3GH5A 2XISA 1QAPA 1VBHA 5C9UA 2DH3A 4CU8A 3A3XA 4PULA 2VZVA 1Q6GA 1R87A 3DIPA 4FLRA 4RZ5A 2ZRYA 1C8XA 3NDOA 3HM7A 4P8UA 3TDFA 3U4FA 3IIOA 4HN4A 1LUCA 5JUVA 3H4WA 4K39A 3S4TA 4YXGA 1LOSA 3N9SA 2CZVA 2A79A 3SRFA 3WNNA 4UQDA 3ZJKA 3IJ7A 3A4XA 1H2JA 3WQ5A 4AX7A 1Q2SA 3E2SA 4IISA 3T0TA 4YL2A 4CNNA 2D0HA 1R9ZA 2GK1B 5EBUA 4Q4QA 1Q4NX 1PS9A 3AMKA 3KL0A 4BI6A 5ENLA 3URBA 3NQ6A 2GQ3A 2IW0A 3ME3A 4DUWA 3WK0A 2OWWA 3VE9A 5I3KA 3H4GA 3JW7A 1WOBA 5T8GA 3SCPA 4KEVA 3V16A 3S2NA 4L6OA 4XD6A 4DVOA 1B7KA 2NX3A 4QDMA 1WPCA 5BRBA 4C6DA 1EP1A 4WEVX 1R2TA 5CEWA 1TMQA 3H2CA 5F1UA 3SUUA 4FMVA 1QNPA 1YE4A 1E15A 1DP0A 3OVPA 2FMNA 4XO7A 4KCUA 4F0RA 1JYWA 5EL1A 5I03A 1WB0A 1S5TA 1VKFA 1T0OA 1XICA 1W3HA 1FA2A 3MCOA 3HG4A 3G6MA 3IANA 1JPIA 3N3TA 3QKEA 3UNDA 3AS0A 4NF7A 4IH3A 3ARYA 1FCUA 3IIZA 1RAKA 2MANA 1XW8A 2PFHA 4WY0B 3BC9A 5CKSA 2OEKA 4S1FA 4G2DA 2NX9A 3UPMA 2QPSA 5AYIA 1ZRQA 5FA5A 4LAZA 3AHVA 1TX2A 3DG7A 3THUA 4ZOCA 3W72A 3DI0A 3MCNA 1SJAA 5D9PA 1DTNA 3Q67A 1BWKA 2GVJA 2Y8KA 1UQYA 4HTYA 1V3MA 1W17A 2WHKA 3F4CA 3GH7A 4D6IA 6CGTA 3SCSA 1DJGA 3AUJA 2J6XA 3ABSA 3LTSA 3KM8A 3LDVA 3AU6A 3BSGA 1UYQA 5KZ6A 3L2MA 4Y9AA 2OB3A 2YFNA 2PBGA 4XZWA 2E25A 3W82A 2QCMA 2EKGA 3M0LA 1OZQA 4HU3A 1UR2A 1RBOB 4UQCA 2YX0A 5FJPA 4ZEPA 3VIKA 3W7PA 1ICPA 2VM8A 5M1TA 1KM1A 1VD6A 3BMXA 3OZMA 4UZUA 4MB1A 3E9AA 3S1GA 1S1PA 1HP4A 3R94A 3KP1A 1PZ0A 3GNDA 3FGCB 2ALRA 3EX2A 2XHYA 2QGHA 1H49A 2INFA 3VTRA 1YE6A 1JFXA 3ZYZA 4IFKA 1VBGA 2OGJA 5CPSA 5F4WA 4QJ4B 1PXGA 1JYNA 3WFLA 4L1GA 1UWQA 1A53A 2EPMX 2AQWA 1TREA 2JIEA 3B9EA 3JZUA 1UZ1A 4UR8A 2A3CA 4NVTA 3K8KA 1EC8A 3M4HA 3SN4A 1M53A 4ERGA 1PZ2A 1Q6EA 4RPPA 1H1YA 2VEIA 1RCOB 1RXOB 5FJOA 1EKLA 3Q2DA 3M1ZA 4S3GA 3QV9A 2A21A 4PEEA 2RDXA 3DFYA 3PZIA 3U5UA 3BAXA 4GBDA 1Q6LA 3EWXA 1A5OC 1LL7A 2J7BA 2VD9A 4I9AA 2ZA3A 1K9EA 3AIUA 5C9ZA 1UASA 4RCXA 2J62A 1M6JA 2WLYA 2TPSA 3UT0A 2Y7FA 1XG4A 1QPOA 1Z7AA 4UR9A 4C6EA 1KCLA 6XIMA 3QMRA 2JGYA 6REQA 1IEWA 2HK0A 4E4UA 1JZ2A 4UTLA 1JCMP 2FZBA 3S0CA 3EX4A 3L4ZA 3ZSTA 4UOZA 1ICSA 2XVNA 5CQ1A 2MSIA 4FHAA 3HQOA 2P3EA 3T09A 2Z1BA 5F2IA 3QYQA 4LPCA 3DN5A 5LXEA 1OFPA 3C2FA 1I45A 4D6GA 3R5EA 2OLAA 2YSWA 1FY6A 4GUGA 1LRQA 3IJDA 5HINA 3HMCA 4JTTA 2YL8A 3PSVA 1MDLA 5FL1A 1HL9A 4RJEA 4CEXC 3T81A 4C65A 3E96A 3I10A 4MAZA 1W9DM 3W7GA 4EACA 2GGHA 3RG6A 1UG6A 3DBNA 2A3AA 4O8AA 3V5FA 4MWAC 5LNVA 5F4SA 1SMDA 2EO7A 3AHYA 4NZ1A 1W3TA 1ZNNA 1M04A 3EKGA 3W7CA 4C6FA 2CWNA 1KA9F 3OHMB 1K70A 3S5YA 5AC4A 3N6HA 1IT8A 2OSXA 3VCRA 4WGXA 1WV2A 1NAL1 7TIMA 2PRLA 2J9ZA 1VHCA 4YTUA 3WO8A 3WBAA 5MKGA 4OWGA 3BQ5A 2WZHA 1XLCA 1B90A 3NG3A 1VYRA 3UFYA 4LAKA 1XPYA 1XD0A 3UXLA 3O16A 4XB3A 3NYZA 1IZCA 3TSMA 3DERA 3N25A 3VX1A 3W1LA 3WLLA 1YNQA 1KBLA 2O7SA 3MSDA 2WCGA 2RDWA 1KBJA 4R9XA 1VGAA 1OJXA 4DZAA 3GR7A 3GHRA 2A7RA 4GNKB 2XGZA 4CEUC 3N2MA 4JX4A 2J27A 3CT7A 1C8QA 1GNXA 2XIMA 5EKYA 3EMZA 1F74A 4WVXA 4A3UA 4UQEA 4F0HA 3KLLA 2XVPA 1VHNA 4QJ5B 3CAKA 3VKKA 2R9RA 3T2QA 1CLVA 2FZ9A 1D3HA 3E0VA 2J9YA 1VBJA 4WKHA 2FZDA 4GI4A 2EG8A 3CB3A 1G69A 4LRTA 2O9RA 4M29A 1VQTA 1EYWA 3MUY1 5CJMA 5BOOA 1NDWA 4GQ0A 3M0YA 2QS8A 2A3HA 1LROA 2TYSA 4E8GA 3MVIA 5HDRA 4J3ZA 3K5XA 1M7XA 1PYMA 1ECQA 1TWWA 3CIWA 4W87A 1G4EA 3DYMA 3UG8A 3AAMA 2BXZA 1XDMA 1LL6A 5BNKA 4ICNA 1B3YA 4LUJA 1P0NA 1J5TA 3SURA 4C6IA 2Q8XA 3BW2A 3W26A 3ZOAA 1WBJA 3K1DA 1OY0A 2ZXAA 3H21A 4ICMA 3C5QA 4JBRA 4O52A 3UU0A 3B8TA 3P6LA 1WE5A 1SZGA 1Q6RA 2EPOA 4W5UA 1L9WA 3BTNA 1GQNA 4UTJA 1W1TA 3U48A 4XSMA 1BYAA 4UTHA 3ABQA 2OVLA 3TZNA 4X22A 2YOCA 4BF7A 1V3JA 2XIIA 2AOSA 1V7AA 1V0KA 3E2QA 1V3HA 4JHMA 1PV8A 5CPTA 3CQHA 4YMZA 3FCPA 1JG9A 2DJLA 5GPRA 3RYSA 3VIOA 2YYTA 3DCPA 4MZ1A 5DQPA 5C2CA 3L21A 5JIPA 3BV4A 3BOFA 1FHLA 1XLBA 3PTMA 1UC5A 2VVSA 5JH1A 2IUZA 5FJJA 1G94A 2EJAA 4AF0A 2V3GA 1IR2A 1B3ZA 1WA3A 4NAFB 4YYFA 2PP0A 1YEYA 2ICSA 1XHGA 3T7VA 4GYPC 3Q65A 2HXTA 2AL1A 1WO2A 1GQLA 2NSXA 1KKOA 4E2BA 3UVIA 2PDWA 3PWAA 3PK7A 5C2XA 1KRMA 1ICQA 3C52A 3GS6A 2UV8G 4MWAA 3U7BA 2PB1A 3MO7A 3GWQA 3QFWA 1GCYA 1OYAA 2W27A 4NAEA 3S46A 3W2LA 1JNEA 3T0DA 1KM3A 3I3EA 1AJ0A 1Y0EA 1EIXA 3NNTA 1M1BA 1JDEA 1WVOA 1BGAA 1ZENA 4N9DA 3B04A 3JS3A 3E0LA 4GFIA 2V3EA 5A8MA 4I9JA 2H90A 1SR0A 3VD4A 3K13A 4LT9A 3LV5A 4H7VA 1UC4A 4GH3A 2ANUA 1ZBVA 3F5KA 5I02A 3CO4A 1E6SM 2CZEA 1W5NA 2HS6A 3AWNA 3GDRA 2ACSA 2VUYA 3QC3A 5TF0A 4B5TA 3KW3A 2ZTJA 2PLKA 1SO5A 5CG0A 5H91A 4FLSA 5HK4A 2ZWYA 4YWSA 3ZQ9A 4KMQA 4HZ7A 1PUDA 4S3FA 3NPWA 3KTCA 4I7UA 2DH2A 1FFQA 4U3AA 3M0KA 2VFHA 5XIAA 1PVNA 3N2BA 4GO8A 1TPH1 4FXSA 3VIFA 4MJMA 3W7RA 5D9NA 3VMOA 2ZCGA 4LUSB 1O7AA 4FR1A 3VD9A 1MNSA 3L4WA 1XF0A 3KP0A 1GJWA 3FNDA 1NEYA 3WQCA 3CZ8A 4QROA 4DM2A 4Q7NA 3KAOA 1IXNA 2OU4A 1RLDA 3TWBA 2I1OA 3RM8A 1IWPA 1RZMA 1D2KA 5A6LA 3CTTA 1ZTVA 3I7RA 4IL0A 4MKNA 1ZS2A 1IWBA 1CGTA 1FH8A 1KGXA 1ESWA 4DXVA 4JZ5A 3CWNA 3H2OA 3UZYA 3RDKA 5AHFA 3AS1A 1J93A 5I23A 3OGVA 4AYGA 4JQ3A 1ZAIA 5HJYA 4IP5A 4C6KA 1VLIA 2BWGA 3ZT6A 3FYYA 2CFFA 1UUOA 3CM4A 1EDGA 5AOUA 2WWDA 4PGLA 5D2WA 1GONA 2VURA 3UQNA 3CC1A 1I2PA 4LVGA 2YJQA 1AODA 1OM0A 2QCCA 3C2VA 1TCDA 2V5JA 3GXDA 4DZ5A 3TQKA 1BSLA 2R82A 7TAAA 5A95A 4IFKB 1MSIA 1CGXA 3QV6A 5HULA 2Y70A 2ISSA 1OHLA 1E55A 3RR4A 1KRCC 2ZKMX 1Z41A 4FEZA 4D72A 3NL3A 4AWTA 1EB3A 1CI1A 1H09A 2WV8A 3C3NA 1TIWA 3W6YA 2X2GA 5C70A 1ML1A 3DFNA 4AD1A 4ATDA 1XXXA 4GLEA 4A8RA 2CITA 2NUXA 4J3VA 4G56A 1BVZA 5K4XA 4UB9A 3GUGA 4IWWA 4D71A 7AMEA 3AHXA 2WNZA 3R4IA 4IUGA 3U57A 4E8DA 2H9AB 1E9LA 5AKQA 1CLXA 1HJUA 4RK8A 2DZPA 5G2HA 2EPLX 1LQ0A 1UA7A 2NQJA 2IQ0A 1KM5A 2R1LA 4UUIA 3WNMA 2HNHA 1HP5A 4I3GA 3VC6A 1MUCA 2IKHA 4GZ7A 3FSUA 1ITCA 3N12A 2C13A 3HTWA 5AB3A 1W91A 2ZDSA 3VIGA 3MUXA 1ZZMA 3LBMA 3P67A 4GWEA 1OF8A 4EPDC 1YTDA 2G95A 4O16A 4IGHA 3H22A 3OIHA 4KETA 1B31A 5FSDC 4C60A 1TTJA 2AL2A 4V1XA 3QPYA 2SFPA 1NDZA 2CLHA 1DIDA 3GDLA 3S6DA 3LEPA 5HMSA 4AZ7A 4HHPA 1SPQA 1J0KA 1P6WA 3RFAA 1G01A 4UTTA 4INFA 4FXRA 1H5YA 2O92A 4GI6A 1IEXA 4US5D 2YA0A 4O13A 1LOLA 3QC0A 2V2DA 5A1AA 3ZVIA 2ZUUA 2YW4A 2XIOA 4DO6A 5LNUA 2DIEA 2YW3A 3GVVA 3SY5A 4NZCA 3A22A 3S42A 1B54A 3W4RA 5HUPA 3L67A 3IGXA 5AHEA 2A85A 1S2AA 1TTPA 2PDLA 1D7FA 5A2AA 2WQPA 3NURA 1O12A 1DIEA 2PAJA 4M6PA 4O54A 4DB7A 1PDYA 2ZC1A 5DELA 3EOEA 1TV5A 3OBAA 1M5WA 4HBKA 4IXHA 4N0RA 3KLKA 1E70M 1PIFA 2YYUA 3TAOA 3W7MA 3TV8A 1O66A 3AS2A 3RU6A 1Q63A 1HX0A 4RUBA 3STPA 5G1MA 5A69A 7REQA 2CHNA 1QOXA 1Q6CA 1BKSA 2OZTA 3EYPA 5IM51 3ANYA 1EHAA 4TMBA 2ZRUA 4LNCA 1H63A 3GXNA 4CNOA 4IICA 3K1GA 2F7FA 1JL8A 2VT0A 3UXKA 1XX1A 2BASA 5JQ9A 5HJXA 1REQB 3SUSA 3QPEA 4CNTA 5FI8A 3VUPA 1E0WA 4G7EB 3NTYA 5A6BA 3W1MA 3ITLA 4LYQA 3M44A 3CT2A 1IT7A 3AOFA 3G8EA 4DLFA 1ZFJA 1FDJA 5HPCA 3KBSA 1WBHA 2O9PA 2OEJA 3AISA 3HA1A 2CHOA 3OJGA 2QMJA 1FHVA 2PWVA 4XKMA 3W83A 1UCSA 1CIUA 3ZLGA 4QITA 1RY8A 1XGEA 1SJBA 1TRDA 2QJMA 3NFUA 3PULA 3A47A 3CIXA 4JN6A 3EOOA 1A0DA 4JTGA 3L4UA 4NUWA 4YJ5A 2JBMA 4N6FA 2J88A 2PDFA 3TSBA 4WHBA 3ALGA 4O1CA 2NQHA 3GXMA 3IACA 2CKSA 1NDYA 2D2OA 3S6TA 1IWAA 1P0BA 3IK4A 3PZTA 3AIEA 3G22A 2GOUA 3LPPA 4B3LA 1Q6FA 3WH8A 4AZCB 1AUSL 2E4TA 2FKPA 1DVJA 2XTKA 1VEPA 1HJSA 1B57A 3BSHA 4PCNA 2PZ0A 1IEQA 4AWEA 5IXEA 1KM0A 3BDKA 1VAHA 4K1GA 3I6TA 4W7VA 4WJXA 3B8DA 1H7RA 3A5VA 4LCRA 2Y5SA 3ABXA 5A5WA 3S8HA 3PBMA 4IL2A 2HE8A 3SCUA 1OFAA 2JIAA 4A8NA 2D24A 3QF0A 1IF2A 1EGZA 1TWSA 4M81A 4HNVA 1Z6KA 2FPVA 2YDRA 5FF0A 2JQXA 1ZGDA 1UWRA 2XIJA 3FAWA 3K46A 3VINA 4RX0A 1PWMA 1W1YA 4XO6A 4WF7A 1ISZA 1NVMA 2QKFA 2Y7EA 2RHGA 5FEWA 5EMJA 3WFAA 1JRCA 1WKYA 3SQMA 3BICA 3MSIA 4XUGA 2PS2A 3F4DA 2DDXA 2VWTA 4JS3A 6XIAA 2VL4A 4HK7A 1BG4A 3L5MA 1PX3A 5AYXA 2GUBA 1V6VA 4DXKA 3F5LA 3WJSA 5FJIA 3WLHA 3GNRA 1WP6A 1QUMA 1XBVA 4W93A 1W5OA 1GZJA 2FB2A 4QQUA 2R24A 2PD5A 3SRHA 1FRBA 1ADSA 5ABFA 4ERIA 4Q8WA 2QIWA 4CNUA 4U10A 1XCXA 2PDKA 3NQ8A 1XLEA 4H8NA 5CGQA 4FSAA 3EX3A 5E0FA 5FF7A 3MKVA 2CLFA 4NZ3A 3CPGA 2IPWA 1GOIA 2OG9A 1W1ZA 3R58A 3S83A 3E49A 4PTXA 4I5RA 4HB7A 3TYUA 2R1NA 2XDFA 3VABA 4XQ6A 4C7DA 2C6QA 4KEZA 1MQQA 4Q6JA 4IQDA 4J1OA 1FWSA 1R3QA 1R9XA 4PTDA 3NQEA 3T05A 4MG4A 3KZSA 3NO3A 4O0ZA 4URIA 3UR7A 1UR1A 1QWKA 1UR9A 1OK6A 3TYDA 1XIMA 5F2LA 4HJWA 2IQDA 2C15A 3L65A 1VFTA 1YXCA 1I8JA 2GJPA 4ORMA 2VQTA 1QASA 2XH0A 4Z0JA 3EOUA 4B5UA 3WL1A 3OB8A 4H00A 3I3DA 3L4XA 3UWZA 1XCFA 3V4BA 1Z42A 5GVJA 5EMLA 1IZJA 3K30A 5JH2A 2YB4A 3OPSA 3TR9A 1SW7A 4IPPA 3G5EA 5D09A 1GVOA 2ISVA 4XAYA 1QVBA 4W8AA 5BXTA 3ZT7A 4N9BA 2GWGA 4HOZA 1VF8A 2QR6A 3AYTA 5HNRA 2PTWA 3RLUA 4DWSA 2VFGA 3CQKA 3VDHA 4REQA 3ZSSA 3I4KA 1OX4B 3CYJA 4JNZA 1DJXA 1T6MA 3LRMA 4BF9A 3NQCA 3PP7A 2VGFA 3UYIA 1EJUC 4KS0A 1QR7A 4C6QA 3BOLA 1MO0A 1AMYA 1YX1A 4XAGA 1DEDA 3LV6A 3MZNA 3WYZA 3L68A 4AXNA 5BOFA 3RMEA 1EJ7L 3APTA 4O10A 2FTYA 3MMWA 3DDMA 3UWEA 4LUIA 1M7OA 1RBAA 4HCDA 4H6EA 4TOQA 4FNSA 3W70A 2BNJA 4FAMA 1T7LA 1GOKA 2UY3A 2PTZA 5D9MA 1T8QA 3BCFA 1GHSA 5C7VA 4S38A 3ITYA 3CMGA 4AHQA 3IK2A 1E6ZA 3N3MA 1HZYA 1TR9A 5KMYA 1W1PA 4PH6A 3L23A 4JDBA 1G0CA 1FH9A 5KITA 1QI4A 4BZYA 1EJRC 3TLQA 2L5HA 3ES8A 2QGYA 2HEJA 2EPNA 4JQAA 3W1XA 1BTCA 1YDNA 3CK5A 5DF0A 2H3BA 1W56A 2D69A 4KCVA 1EJWC 4PR4A 4M19A 1LUCB 1L6FA 1XIDA 2BVWA 2TSYA 5LIKX 1KO0A 1KCZA 2F61A 1DJHA 1NELA 1BF2A 1Q85A 1H1ZA 4U2ZA 3RLVA 3MW7A 3B8UA 5CLWA 2RFGA 4JQ2A 3VZXA 3TFCA 5IFTA 3EB3A 1MI3A 5KZDA 4HKPA 1I4NA 2ZADA 3BJSA 2FHCA 4AW7A 1C29A 2JEQA 1Z9AA 3LRKA 1OF6A 3AIQA 2VCAA 4B9YA 4RXGA 3CV2A 3UCDA 2A3LA 4E2DA 4KEMA 3GG7A 2F9RA 4MWAD 1R3WA 3G2GA 2WZTA 4RNIA 3RMJA 3IAQA 2CU0A 2ZTKA 3LMYA 5HATA 5HNTA 1BWVA 1CGYA 4DZHA 2PCQA 1DWFM 2ZRVA 4F2TA 5C6MA 3FYPA 1EF2A 2WM1A 5CAHA 4UNKA 3NPUA 3LD5A 2ZXDA 3TQVA 4PMYA 4DI9A 4C91A 3WQOA 1EJVC 2GUUA 3BV7A 1UUMA 4WY0A 1RVGA 6ALDA 1DOSA 1QW7A 3SCRA 3VYLA 1ONXA 2WPGA 1TJ0A 3MI6A 2VZTA 2Y85A 3QJAA 1FHDA 3W74A 5HQLA 3PZUA 3LA4A 2WANA 8AMEA 3EMQA 1B2YA 1U5HA 2E5DA 1S2UA 3FHQA 3VE7A 1PWLA 2DZAA 3H24A 3LCFA 3CL8A 3M5YA 2WSYA 2WBKA 1J0ZA 2HZGA 4CN4A 3DBPA 2I9UA 2HK1A 1GVIA 2VEPA 4GFSA 4H41A 3H70A 5CBIA 1EH9A 1K77A 2OFJA 4P8XA 2QT3A 1GYLA 4KRUA 5EMUA 4R3UA 3E74A 1GZIA 4ZE5A 4P7NA 3C0SA 1N2VA 3SCQA 2YCJA 4DM1A 4U5IA 3POCA 4ADUA 3V36A 2Z25A 2NQ5A 1B7JA 1ZSXA 4UTFA 4R88A 1UMLA 3D3AA 4GUHA 3KCJA 2OKOA 1QPQA 4DJFC 2FLIA 3E12A 3R10A 2PE4A 3C86A 3T07A 2OX4A 3N14A 4R7JA 2FIQA 1YQ2A 3CASA 5H8MA 4L61A 1VB9A 2DSWA 3GW0A 3PTKA 2J8GA 3BAJA 3QY8A 3ZT5A 1J01A 2HPMA 2QF7A 4H3DA 4OUEA 2VRQA 4M7SA 1X7FA 4M6UA 1O1ZA 3P61A 1OQFA 4Y8EA 4QDWA 1JDAA 4HPNA 4AZ5A 3VPLA 8TIMA 3VIPA 1UPMB 2YKKA 1E1CA 1RQHA 4ZQPA 4LF2A 5D38A 3FOKA 2DEPA 3ITXA 2PDPA 3L5AA 3CZJA 1DIKA 1KLZA 4UFKA 1BYCA 2TMDA 3PTDA 4AUBA 1T41A 2BMBA 3T2PA 4NYUA 2V38A 4H6KA 4QE5A 4NI3A 3SB0A 1SO6A 3HOJA 3LXBA 3PJWA 3TH6A 1QT1A 3A4WA 5I5RA 1E56A 2RJGA 3OGSA 1SUXA 3ITOA 2J77A 1EDQA 3VAVA 3H2FA 2GWNA 3M46A 1ADDA 3SAZA 1BF6A 2PRMA 4JDYA 4W7WA 3PBVA 2FTWA 4E38A 4JN7A 3GE7A 4HU4A 3IV8A 2W62A 4K7YA 4CQ9A 5LSMA 4FXJA 1E51A 2D22A 4UIOA 3N13A 4GNVA 4O4WA 4Q8TA 4CD5A 4I6KA 3UR5A 1UR8A 4E6MA 4AISA 1GYMA 3H2EA 4DYEA 3WQ4A 4GQRA 4HA3A 4GY0A 3QSRA 1JZ7A 1XKJA 2VCCA 2WLZA 1MW3A 3SFWA 3OLEA 1X8CA 4G8TA 3DHUA 4C5ZA 3REQB 1NP0A 3TJXA 1BWLA 3PY2A 3GTIA 2P50A 1ISYA 3IPWA 4XKYB 4A3QA 3TC7A 3N2OA 1S2TA 3HPSA 4LAUA 3OVRA 4WXYA 1IXQA 2VX5A 1H41A 2UY2A 3EDKA 2DZXA 4LVBA 1FWRA 1Q3NA 3TJ4A 3U2CA 3O7UA 1O1HA 2BG5A 4DUXA 2CPUA 3L66A 1EJSC 1MEIA 2CBIA 1F8MA 3QLDA 3ARUA 3VO0A 3V1PA 1MUMA 1A5LC 4IMCA 3AYSA 1PIGA 1VJZA 5EFFA 1E3XA 3KVKA 3PG9A 2HV5A 3QR3A 4TUFA 4JTFA 2V8ZA 2XFYA 4KPLA 3IVTA 2ATSA 1YYAA 6A3HA 4RE4A 3B8WA 3O3RA 1K8CA 2POTA 1OABA 3UCQA 1UZ4A 1ONRA 2WHLA 4GE8A 4AIEA 2ZX6A 2OYKA 2Y8UA 3DFOA 3RCNA 1VJIA 3TTOA 4WDTA 3G8RA 5FEZA 4H19A 3AXHA 4XSLA 1H7OA 1ODZA 3G0SA 3VILA 2FQIA 4JTAA 3UGRA 3AQUA 2V2CA 2VUNA 3PPHA 1CENA 4EIVA 2YL9A 3WH7A 1LG2A 4IMDA 3FKKA 3KOZA 2B4GA 4GZJA 2OZ0A 4TVUA 1JGIA 3VOFA 4Q7IA 3KZPA 4FOKA 3AXIA 3EWZA 3MMDA 4XG1A 5BRQA 1Y5WA 3W37A 1UP3A 2J7HA 3RF9A 3BAKA 4Z0SA 1UIPA 1W2VA 4Q8PA 3BGGA 3HZ3A 4FF5A 4MWAB 3S2CA 3W00A 1QHOA 1ZP4A 4YPJA 3ICJA 3GXTA 4BKNA 4KWWA 1VYPX 3E5PA 4K6AA 4JEQA 3SUWA 3C4UA 3N34A 1W9VA 4YHGA 4BHYA 5DEZA 2PGWA 1PBGA 2QF8A 1MXGA 1K6WA 4I6VA 1UWTA 2OT1A 3DUGA 5EFDA 5MHBA 1UWUA 5D37A 3CNYA 3K4AA 3DC0A 1JD9A 5D2XA 1FKWA 5FOOA 4GYFA 4IP4A 3FA4A 4DNHA 3W2MA 2VC7A 2CHRA 3WH9A 3NYDA 2VFIA 2GSEA 2H8XA 2F8QA 4C6NA 3FHAA 4PRRA 3B05A 5BOEA 5KEZA 1XSJA 2DJXA 1GEQA 3R12A 4TXEA 5I79A 4DHGA 1QOPA 3GU2A 3I3BA 4I5UA 3ITTA 4CQCA 2YFOA 3GBDA 3WDPP 5LIUX 4FXFA 2WVUA 1SYTA 3BSMA 1DQWA 3MP5A 1I0BA 4HPGA 3PPGA 1T8XA 4EP8C 2VXNA 4W8LA 4N7QA 5I6SA 4HNOA 3AMGA 3CTLA 1RD5A 4WKAA 1B9BA 1HJWA 3LTYA 2XM1A 2XGIA 1US2A 3MPGA 4K8EA 1AZ2A 4FP1A 1EP2A 2ABAA 4H2CA 3EDDA 4DUOA 2DVXA 3N2CA 2BY3A 2ZUNA 2HROA 2D1ZA 3L4YA 2AMEA 3WLIA 5TIMA 4PB3A 3DFPA 1TVNA 3WLPA 5AC5A 4CQDA 3PG8A 3BH4A 3TN4A 3E6EA 4LUTA 1BLIA 4Z1DA 1XS2A 3VCNA 1QMLA 3RX4A 3ZLHA 2WSPA 1F07A 1FHUA 3KOFA 4GCXA 2HVMA 2WMIA 2YCLB 4OKDA 3VGBA 4GJ1A 3T8QA 5A8OA 1SW3A 1W9XA 2X0HA 1TMLA 1A5AA 4GBUA 5C7HA 2BZNA 4HMNA 2VDHA 1KXQA 2QJGA 4F2UA 3SDOA 2X1IA 4IPIA 2PRHA 3USBA 3W1PA 5LGZA 3NQMA 4PCTA 2HNEA 1JD7A 2XINA 3WG6A 4WOQA 3PJUA 4AMEA 1HKWA 4DJEC 3Q4DA 3A3WA 2GJXA 2QDHA 4RR4A 1BYDA 1XWYA 4LY4A 3GHSA 2D2HA 3RPTA 1S1RA 4KGJA 1NFBA 3NSXA 3W87A 1P7TB 4DZIA 2ZZ3A 4IJRA 1BQGA 2FZNA 1RJQA 3GYEA 5GJNA 2PGRA 1OIMA 3TROA 3ARPA 7MSIA 3UZJA 1GK8A 1ZAHA 2E8YA 4I9MA 1N8WA 4HCHA 4IIDA 2V68A 1H0IA 4A6GA 5JU6A 4KRZA 1V3IA 8A3HA 1UD2A 3QW3A 4HYRA 5M03A 2GDUA 2QVHA 3WELA 5DBTA 5K2ZA 1J6PA 3P8JA 3RUBL 2FTPA 1K9TA 3QQWA 4HA1A 5E9XA 3T2OA 2ZVIA 2Z1XA 3ZWSA 2ZE0A 1IEIA 2QDDA 4KCWA 2BX7A 1LF1A 2PTDA 3PAJA 4O1DA 1E9ZB 4OTKA 1XG3A 2AMGA 7CGTA 3WEZA 4GX9A 2VP8A 3A5FA 3LU2A 2GK1A 4N42A 4S3JA 2V69A 1PX8A 2WMKA 1C3FA 2PGFA 3WMSA 2DZSA 1EHNA 3EKLA 2BXYA 4J3XA 1FVPA 4Y6GA 3DKLA 3QKZA 3DX5A 2YZRA 3FEQA 3W1UA 2OQYA 4GH1A 4XAPA 3WY1A 2VJXA 3EXTA 3VK5A 4ALDA 3R8RA 2Y8VA 4D6DA 3VNYA 3TP4A 1TWZA 1ITUA 4PFMA 3RN6A 5D2VA 3NR0A 4HJFA 4S3DA 3LCXA 3HGSA 2CBJA 5HQMA 4WUIA 3WLSA 4AEFA 1JFHA 2PPGA 5D9OA 3CL6A 1UR0A 1CXEA 5AN7A 2QQ6A 4NNBA 2Y4SA 2ZX7A 4OBRA 1AFSA 4A3HA 3E2RA 3JU2A 3VDGA 4PZVA 4D1IA 3PVFA 5CC3A 2I5GA 4TR9A 3HPZA 2O4MA 3SRKA 2GYIA 4IUOA 3MBFA 3TN5A 4Q22A 5DBUA 1WOAA 4MSSA 3ZJ6A 3B9OA 3CYVA 3GHTA 4GY7A 2DU2A 4K2SA 4Q32A 1VFSA 4LBSA 1PE1A 3GLCA 3ALFA 1G5AA 3CLMA 1FCVA 4HIBA 3HV9A 2FVKA 4QE4A 1CGUA 1XIIA 1K9DA 1G4PA 2V5KA 2W79A 1EKOA 4ZXOA 3ZXWA 1R85A 4UNLA 1KFKA 4DX3A 1KLYA 1YIXA 1BRLB 2PD9A 1OFQA 1UOKA 3Q45A 1TUXA 3R43A 4V1YA 1Q7MA 4HNUA 3KX6A 1V7YA 2YBUA 5AC7A 3B0UX 3WF2A 3VOHA 1CGWA 1PSCA 4QNWA 1SZEA 3HMJG 3VFCA 3PZQA 1FWTA 1IGSA 2I57A 3I6EA 3QFEA 2G37A 3B4YA 3VD3A 2FPYA 3OOQA 3ZO9A 3AS3A 1QI3A 4NKCA 4KCTA 3Q58A 2ASHA 3NL5A 2VX7A 1DHKA 3UJ2A 4IFOA 2WKJA 1V6WA 2TRSA 3KCOA 2CBVA 3BE7A 2EQDA 2F2KA 3WNKA 3E38A 1QO5A 3AALA 2Y63A 3ZJ8A 3ELFA 4R34A 4XVDA 4JTKA 1R86A 3CUIA 1HJXA 3KXQA 1AQFA 3N2XA 3WZ0E 4IHCA 3DKJA 2QAFA 1C8AA 2X1UA 4DN1A 1F3WA 4LB3A 1IQ8A 2E8ZA 1FP9A 4NASA 1HFBA 1I2RA 4JYEA 4RDWA 4HHLA 1MZRA 3CJPA 1ZY9A 2Y24A 4RDZA 1TRIA 1R38A 3UJRA 5D32A 3L12A 2IQTA 3CH0A 3MCMA 4DO5A 3T6CA 3GR4A 3SFKA 3NZPA 2P8BA 3PBUA 3SGGA 1VFUA 5E9AA 3S6OA 4LVFA 1FWWA 3HF3A 2CW6A 3H4XA 2HDJA 1LL4A 1ZCOA 2QZRA 5HNUA 1ITQA 5KETA 4QLKA 1UWSA 2C16A 4EKJA 2VX6A 1ZJHA 4U5KA 4PTWA 3GU1A 2NXIA 5DY2A 3UWVA 2XWDA 4U3CA 2PWEA 3DI1A 4QQ3A 3VNIA 2A3BA 5E6YA 2WYSA 4NL1A 3ZMRA 2DIKA 3R13A 1RH9A 4S39A 4DAIA 4WX2A 2RAGA 1OEPA 1CXIA 3ZS4A 4C6CA 3BLPX 4IX2A 2OR2A 5I3FA 4RLIA 3VXGA 3O06A 3S2JA 1L2QA 5AECA 1HVXA 4F8XA 2PTXA 5IFPA 1JYXA 3GZAA 3IJLA 4NU7A 3DEQA 3WQ6A 1DL3A 3TYEA 3KOWA 4M24A 2R91A 2REQB 1XIBA 2BS9A 2NVDA 1N8IA 4YTQA 5HXMA 2H8ZA 4KW2A 2VZSA 4F9JA 1BEUA 1Z8AA 3ARZA 4TU1A 3SY8A 3R89A 4NJHA 3EA1A 3A3HA 5DFAA 4BK9A 4PMDA 3NDYA 2GVYA 3W25A 3AROA 4IGMA 1QNSA 1B9ZA 2R6OA 1KBIA 2XSAA 3VU2A 4V2XA 4B5NA 2DGAA 1XH1A 4JIIX 4AHOA 3T40A 1QPRA 4M3PA 2R1MA 4QS6A 3RU8X 4GNJA 2IKIA 3VIIA 2CBUA 1HGWA 1HXJA 3II1A 2XIQA 3CHCA 1CXKA 3IV3A 5G4HC 3CH9A 1JQXA 3NM3A 3W6LA 1K7FA 2PDQA 1V3LA 3WQPA 3CAVA 3THCA 5I00A 2E68A 4JAWA 3GR8A 2QV4A 3BWWA 4C6JA 3SSZA 1JAEA 3B9AA 1G7VA 3QZ6A 2CYGA 2O4QA 4A35A 1S3HA 2AGKA 3GB6A 1P6BA 3MUAA 1GQIA 5I77A 1LG1A 1J6OA 4YVVA 1SO4A 2HS8A 3EPOA 1AK5A 4EPKA 4PMRA 3BJTA 3PHAA 1LRTA 4CCDA 1JQVA 3H2AA 4KESA 1G1YA 3KFTA 4QM1A 3UNTA 3VZZA 3MC5A 4X0NA 5DCBA 1IE7C 3N73A 4QGCA 1HQTA 5K4ZA 5CGTA 4ZQCA 1K03A 2QVNA 4K1WA 3W7KA 2J7EA 1FWFC 4FNTA 8CGTA 1G4SA 8RUCA 5EPDA 2OCZA 3A64A 1CZ1A 2E5CA 3U9IA 4YTTA 2HVOA 1XQKA 1IEVA 1HNYA 3BG9A 3C2YA 3U5YA 4KIEA 2PC8A 3H7UA 1XI3A 4I7WA 1TPEA 1NWRA 3QYSA 4CD7A 3P74A 5CSRA 3OZOA 4M6QA 3XIMA 3O9NA 2GJXB 1H7WA 3GSMA 2V5CA 3ITGA 5C5YA 1V0MA 3H7VA 1A5NC 1DYSA 2X1SA 3NSMA 1UD4A 2OKTA 3BL3A 4EPEC 3IEBA 3NQ2A 1DKWA 5LIXX 1UWAA 1AA1B 1W8GA 1FWNA 1YPFA 1KV8A 4ZQNA 4X0VA 2FZ8A 3TTSA 2X42A 4EOUA 4AY1A 2ZZ6A 3EWBX 4FPSA 3EDFA 4O8RA 2OMAA 1CLKA 4MGGA 3MBDA 4Q7BA 4A4AA 2XZ9A 1GEHA 1ZQ5A 1GYNA 3GG8A 1D8CA 5FF2A 1DWHM 1UD8A 4JIHA 1YXYA 3VNZA 1E6NA 2C8NA 3QZAA 5FEPA 1V08A 3WUEA 2EG7A 2YBTA 1GTHA 3SIZA 3W01A 5H8PA 1C9WA 3M5VA 3UA3A 1SU5A 1L2UA 2VR5A 5GJPA 3PZMA 1TUFA 4AIOA 4XZLX 3VI2A 2WZMA 1I2OA 1W5MA 1WDQA 5DCDA 2E7FA 1YADA 2X40A 2P8CA 3P84A 4X9SA 1CT5A 2J8FA 3AC0A 4MF4A 1EBHA 1RPKA 5EY5A 6PTDA 3WK2A 1E5NA 2CETA 4BEUA 3RHGA 4ZODA 1U22A 4HMEA 2XH7A 2VCBA 2PGEA 4B3KA 4LRSA 1EDTA 2ZQ0A 1LTDA 4JCMA 4J28A 5K9XA 4QIUA 1XLLA 4TV5A 3TU9A 4CLMA 4NNAA 2WOQA 1LBLA 3S47A 1X1ZA 4JIEA 1FKXA 2A7PA 5ABGA 2EAWA 3NA8A 2Q02A 4J3WA 2WVVB 4UCGA 2CLEA 4DEFA 4IF2A 3HG5A 3IJ6A 3N11A 3TZFA 2HSAA 4AG0A 2V63A 4GOAA 3E2VA 3LRLA 3GY1A 2EPHA 2JE8A 1C92A 1SM9A 4DJFA 3O6AA 1A0EA 1PCWA 2WSQA 2BHZA 1PPIA 4PB5A 2ZZ4A 5K9CA 4N9CA 1YBQB 4MYXA 4DBDA 3U0HA 3TW9A 3H12A 4O11A 4NJIA 4HPXA 2XN2A 4L80A 2E67A 5ABHA 3SJNA 1JCLA 4NXSA 3A9IA 1X1OA 3IJIA 5BXRA 3GHUA 3KRUA 1EOMA 3M0IA 1Z69A 1JF6A 1GGOA 5HANA 1OC7A 2Y62A 3M47A 1EPVA 2IKJA 1UBPC 4GINA 2QMKA 2C14A 1K4GA 4YN5A 3L4TA 1Q2RA 4IP7A 4JIQA 3WLJA 3O05A 3OYZA 1IHIA 4GY1A 1WKEA 3WL0A 2YPIA 3UZWA 3EWCA 3OZYA 3S9YA 1BRLA 3KWSA 4DF1A 2JF7A 1H61A 2QCGA 1FWAC 4AIUA 1BGGA 4POCA 1Y8BA 4GJIA 3V18A 3XINA 3F1QA 1JF5A 3UXAA 1PZ3A 2V0TA 3CWHA 1A80A 2WZIA 1EO5A 2YCEA 4AZBA 4QJ3B 3NO5A 1CX9A 2DSKA 2ZWZA 3N29A 3MMTA 4JTDA 4W7UA 2O56A 4D6CA 3S9ZA 3LAZA 1SVDA 1EC9A 4M7TA 1F4HA 2E77A 2OLSA 1F73A 1LBMA 3WF1A 4I9TA 5ABEA 4B5VA 3TA6A 3C0LA 1OX5A 2PF8A 2ZZ1A 3MJYA 3VMNA 4O15A 4JYDA 1QATA 1OYBA 5BMXA 1V3KA 3GXIA 3DECA 3CHDA 4GKTA 1OINA 1YXDA 3K8MA 4CN6A 4GK8A 3MDWA 3C2OA 1MRAA 1RBLA 2CWXA 4HU0A 4NJKA 3PNUA 2VZOA 3FKRA 1S5VA 1FXPA 3AMCA 3NJ3A 3BVJA 3BQ6A 1W32A 4UBPC 3IIPA 1A3XA 3BLDA 1V6UA 3U8GA 1C9DA 3NPXA 4IIHA 1XRTA 1CNVA 3OP2A 3C0JA 3UZXA 4MJ2A 2OEMA 3QEZA 4ZO8A 4DRSA 3AMLA 3L2IA 1KXHA 4KH2A 3ATYA 1HJVA 3KBNA 4E4FA 1DORA 4C6LA 4XZIA 4GZEA 3WF4A 2FHBA 3B03A 1E0VA 3ID7A