1VLIA

Crystal structure of spore coat polysaccharide biosynthesis protein spse (bsu37870) from bacillus subtilis at 2.38 a resolution
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
367
structure length
358
Chain Sequence
AAFQIANKTVGKDAPVFIIAEAGINHDGKLDQAFALIDAAAEAGADAVKFQMFQADRMYQKDPDVSIFSLVQSMEMPAEWILPLLDYCREKQVIFLSTVCDEGSADLLQSTSPSAFKIASYEINHLPLLKYVARLNRPMIFSTAGAEISDVHEAWRTIRAEGNNQIAIMHCVAKYPAPPEYSNLSVIPMLAAAFPEAVIGFSDHSEHPTEAPCAAVRLGAKLIEKHFTIDKNLPGADHSFALNPDELKEMVDGIRKTEAELKQGITKPVSEKLLGSSYKTTTAIEGEIRNFAYRGIFTTAPIQKGEAFSEDNIAVLRPGQKPQGLHPRFFELLTSGVRAVRDIPADTGIVWDDILLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spore coat polysaccharide biosynthesis protein spsE
publication title Crystal structure of Spore coat polysaccharide biosynthesis protein spsE (BSU37870) from Bacillus subtilis at 2.38 A resolution
rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
total genus 106
structure length 358
sequence length 367
ec nomenclature
pdb deposition date 2004-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03102 NeuB NeuB family
A PF08666 SAF SAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1vliA01
3.90.1210.10 Alpha Beta Alpha-Beta Complex Type Iii Antifreeze Protein Isoform Hplc 12 Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 1vliA02
1NAL1 1VCGA 4PEKA 2GVJA 2CZFA 4O1BA 3UWVA 4Z0JA 1X1ZA 3GIYA 1EPXA 3QC3A 4NXKA 1N7KA 4WZHA 3TROA 5E0KA 3LBMA 1GVSA 1G7UA 2C15A 3W72A 3NL3A 1GVRA 2JK2A 1RZMA 3EX1A 3NPUA 2QKFA 1XBZA 3BPWA 4AHPA 3SECA 2WOQA 1ICQA 4EVZA 4XTIA 4JYFA 4TMCA 1H7WA 1PCKA 3W22A 3NQFA 4WXYA 2G95A 5F2MA 3UY8A 4UFKA 4BWLC 3O07A 3MI6A 1AW2A 3AMEA 3ABSA 3PC0A 1EX5A 5LHFA 3TAKA 1GTEA 4A21A 2ZRXA 2OMAA 3T44A 2V2DA 1F73A 1KM4A 1PL9A 3LTSA 5K4ZA 2O7QA 4LRSA 2NWSA 3TXVA 1W1ZA 1CW2A 4O17A 4GUJA 5J5DA 3W83A 3HB9A 5F2GA 5D2WA 3UWZA 2EHHA 1LTDA 1F6PA 2CWNA 2QEZA 1D3GA 1AMKA 2DZTA 4UMAA 4PODA 5CSSA 3UY7A 1RQEA 1YTDA 5G4WA 1DVJA 1T99A 3FKRA 4WUIA 3B04A 3W75A 3S5NA 3IVSA 4QQ3A 5F4WA 1RQBA 2GPTA 2Z2UA 4FXSA 4LY8A 4C1KA 3W7CA 4JN6A 2VFDA 1LCOA 2CLKA 1TPEA 3EKLA 3ZS4A 3HPZA 3W73A 2Y6ZA 1M5WA 2PCQA 3NPWA 3GR7A 2J24A 2JBMA 3W74A 1B4KA 1VRDA 3E96A 3NQ2A 6AMEA 1LROA 3GB6A 2HS6A 1SO5A 3QZEA 2Y70A 1VYRA 1GG1A 2X30A 2Y85A 1YXDA 1VJIA 3UZ5A 2J9XA 4IX0A 4H3DA 1TPUA 1GZGA 4IWWA 1KM0A 1B9BA 4PFMA 1TCDA 4NJKA 4HKPA 4R34A 4Z1AA 4ZQMA 3S5ZA 1FDZA 4MIMA 1OJXA 3INPA 4ZQRA 1OFPA 3C0JA 3BLIA 3P80A 1IIHA 4XQ6A 3NAVA 1M7PA 3NQVA 3TNOA 3STGA 3THAA 3RDNA 2F7FA 2QUTA 3DGRA 5EL1A 2C16A 1DL3A 2H8XA 1MSIA 4N6FA 1WOAA 2ZRWA 4M6QA 2ZFAA 3EX4A 4ORIA 1UCSA 5CPOA 3M5XA 4RJEA 3C4UA 2E77A 2X1SA 2XN1A 2B0MA 1JCLA 1WYIA 2C14A 3E02A 3NM3A 4FX6M 4XTDA 3IIOA 4FB7A 2GVGA 4RR4A 1JCYA 5MSIA 4ADSA 3O06A 2JGQA 4EWND 1RVGA 1KFCA 1NF0A 4WXZA 8AMEA 1KM3A 3S1WA 3TMQA 3MHFA 1TPWA 2V8ZA 3S5YA 1KM1A 3M6YA 5L6UA 5AFDA 1EEPA 5G1YA 3QPZA 4NJHA 3I7RA 3B0PA 2P0OA 3HG2A 3PF3A 1FCBA 1L6SA 3AJXA 2YX0A 3WJXA 3CC1A 3LCXA 5LZLA 4ADTA 3HMJG 3DAQA 2NXGA 1ZAJA 4GXMA 4RZ6A 5IBXC 5LKYA 2QCDB 4X2RA 1OFEA 4ALDA 2TMDA 2JKPA 4HNUA 3B0UX 3QF6A 1W3IA 3L2IA 1FCQA 2LLEA 3TQVA 2QCDA 4O13A 3P8JA 5AHFA 4IMDA 5J5RA 2WNNA 2V81A 3QEZA 1KFBA 2E5CA 3H55A 5C55A 3TJXA 3EWZA 3KHJA 4UTKA 2UV8G 3Q2DA 1GWJA 3UXDA 1W5MA 5HR7A 3KOFA 1G67A 3EWBX 3LRKA 4FNQA 4IUOA 1OFAA 2J88A 3TV8A 4NVTA 1PIIA 2E5DA 1OABA 3DKJA 1HTIA 4LS2A 1EP1A 1F5ZA 1GYNA 3FJLA 4IMGA 2ZZ6A 1F76A 1R46A 3B05A 4LVFA 3ATZA 4M5PA 1ZALA 4E2DA 1DBTA 4NY6A 3OG3A 5CPMA 2WNQA 2NV2A 4HNNA 4UFMA 1OX4B 2YW3A 5C5YA 4MOZA 3UD6A 1Z41A 4XUGA 5AHMA 3TQKA 1H50A 3W07A 3T40A 1HL2A 1KLZA 3E0IA 1HFBA 2AAMA 3HGRA 3W1LA 1AW1A 1K8XA 2NV1A 4O15A 2V9DA 1SW3A 3I6RA 1VGAA 1SPQA 4ML9A 5D03A 1OFDA 4Q33A 3DENA 3W2NA 3G1FA 3NL5A 1TO3A 1IXPA 5BW6A 3R12A 3UZJA 1AK5A 1UUOA 3IV3A 1SSDA 3W9ZA 3QMSA 3NQ7A 1W56A 1YDNA 2VELA 3G0UA 3TSBA 6TIMA 4EIVA 4CNOA 1AL8A 3NGJA 1YADA 1VYSX 3PWAA 3A21A 2ZRUA 3MYPA 3LBCA 4FX8A 1G69A 2NXIA 2B7OA 3C56A 2WKJA 1X7FA 2FFCA 5AN7A 1SU5A 3W7DA 4FNUA 3W7GA 1FXQA 4MUZA 2VEIA 1H63A 4U28A 4BF9A 1ME7A 3W1RA 3T78A 4Y90A 4CCEA 2DZUA 2QCCA 1A5CA 2Y7DA 4ICNA 4WX2A 4EF9A 4IPJA 2E68A 5FF2A 3P67A 4JGDA 3M1ZA 1KTNA 3DHFA 2LX3A 1H60A 3TMLA 3LLDA 1XBYA 4ZQNA 1QPNA 5HWNA 5LNSA 3UPBA 4K38A 1Q3NA 2QCMA 1BTMA 2DZPA 5GVJA 1N55A 1WBJA 4IMCA 1W5NA 1XKYA 1U5JA 4IQLA 3B0VC 3QM3A 5KZMA 1ZAIA 4O1AA 3CWOX 3M5YA 4N9EA 3BGGA 3LERA 5BMXA 1HO4A 1YTEA 1KV5A 1ZJIA 3SFKA 3PM6A 3TKFA 5DCDA 4ADUA 3B06A 3TC6A 4RX0A 4XWUA 1TQJA 5HUOA 5FI8A 8MSIA 2ZA2A 3KVKA 2YR1A 1SR9A 5EA9A 1PV8A 1LOSA 1TV7A 3C2FA 4FF7A 3BW3A 3FIGA 3NVTA 2XN2A 4LS0A 2YZRA 1XFBA 1GEQA 3LCFA 5CPNA 1H7RA 1OYBA 3DH7A 1KTBA 5EKYA 1SW7A 4BFAA 1YXCA 3I65A 3P7YA 4CQAA 2RDUA 1I2RA 2PC4A 4M19A 4N2YA 5EPDA 2CU0A 4Z0SA 3TW7A 1VQTA 2R14A 1E51A 4WOQA 1WOBA 3LGEA 4NU7A 2GJLA 3P5ZA 4S2BA 3VKJA 3EWYA 5LNWA 3OVRA 3WFAA 4A29A 3FOKA 1MSSA 3LI1A 1F74A 2CLOA 5FEXA 1TTJA 4MJMA 4QSHA 3NDOA 2CLHA 3IIPA 4O4WA 5KMYA 1T8XA 3L65A 2EKCA 4MY9A 1LYXA 2HMCA 1O60A 4UTTA 1VC4A 4UFIA 1P5BA 3P81A 5EY5A 1JVNA 5G5IA 2ISWA 1M6JA 5H2ZA 3P5YA 1GQNA 3HO8A 3L68A 3G22A 4LRTA 1MXSA 2Y63A 2EF9A 4K8EA 2RHGA 1S5VA 3LHVA 1XC4A 3O6CA 4IMEA 3NYZA 3NXFA 3QSRA 3KVJA 3EWUA 4DPPA 3O16A 1MSJA 4O1CA 4NXSA 5HULA 3M5VA 4QM1A 3NQCA 3I7SA 2RFGA 4RLIA 3QW3A 9AMEA 3MMTA 4GFSA 3HIJA 1TB3A 4O18A 1FCUA 2CW6A 1SZFA 4CCDA 1SQ7A 3HQ1A 3TC7A 3CEPA 3CEUA 1UUMA 4FNSA 1M7OA 3ANYA 5DCBA 1QPRA 2W6RA 2OT0A 4MFEA 1LRNA 3KRUA 4ZQPA 4YMZA 4ORMA 5K3VA 1U83A 3PVFA 1QO5A 3NPXA 4MPQA 2X1RA 1FDYA 7TIMA 4Q4KA 1L6YA 3FLUA 3C6CA 2DU2A 4ZMGA 3CIXA 2J9ZA 4AWUA 4C1LA 4CCCA 1B4EA 1HO1A 2YGYA 5D30A 4UC5A 3W1TA 4O28A 1RD5A 4M7TA 3C8FA 5C54A 1T0OA 2H90A 4IOTA 3S0CA 1MO0A 3GNNA 3LRMA 2ZDRA 3O8AA 2YPIA 1VYPX 2JKEA 5DELA 4BI6A 1EP3A 2MSJA 4NJGA 2ZCGA 1YDOA 3LTPA 3W6YA 4Z1CA 3W1AA 3HG5A 4Z1BA 3WJZA 3GXTA 2CZEA 3MP3A 2FB2A 3GDLA 3SJ3A 2Q8LA 1VLIA 3TR2A 2BLEA 1ONRA 3TX9A 2QF7A 5I3JA 3C2VA 2FJKA 1DHPA 1D9EA 3TUUA 3PBYA 1L2UA 3GDMA 3W86A 2Z0IA 5AHLA 5AHNA 1W0MA 4DF2A 1FQ0A 4OHQA 3HPSA 4O0KA 1SFJA 4Y96A 3M7WA 2BX7A 3PB0A 3R89A 3R13A 2TYSA 4UTLA 4JS3A 2QCEA 3G8EA 2ZBTA 5LNVA 2PURA 4KWWA 3TA6A 3TXZA 3QQ1A 4LNYA 3TK7A 1LRTA 1BEUA 2ZRZA 1LDCA 3G18A 4ZQCA 1R2RA 3PAJA 1FWTA 1B7JA 4JEQA 4NJJA 1DORA 2J27A 2NUXA 2PRLA 4RK8A 4RZ4A 4Y8FA 5TIMA 4YXGA 3A23A 3W1MA 3GDRA 3QFEA 1G4SA 1R2SA 4E38A 4OV4A 1ALDA 3MSIA 5HNRA 1B7IA 1Z44A 5D02A 4AAJA 1KFKA 4CQ8A 4YWIA 3W1NA 1L6WA 3UNDA 2OCZA 3L67A 3QH2A 2R91A 4DO5A 1BWKA 3EXSA 4HHPA 4QIUA 2NUWA 1W3TA 1TTIA 4NZFA 5A8GA 5D32A 1SW0A 4M7SA 4UFLA 5DY2A 3W7PA 4FHAA 2CLEA 1ZENA 2VOMA 3IEBA 2FPYA 3LLFA 3PG8A 5G2WA 1O94A 4LVBA 3LXAA 3EXTA 4GNJA 3W23A 4JX6A 2AQWA 3LRLA 1TRDA 1XDMA 3WK1A 3QPYA 3CT7A 3OBKA 4JTJA 3DXIA 1KM2A 3T4CA 4O8RA 3K30A 1YXYA 3G1HA 5K7JA 5IM51 1IXOA 4GRSA 3S1UA 1LM1A 4DXVA 3E9AA 4JTEA 3PBVA 4IJBA 1Q6QA 4UTWC 5D2TA 3MBFA 5E93A 1UB3A 4O57A 1DOSA 4UR7A 3RU6A 4UNKA 3W2LA 4OBTA 2ZZ7A 4NX0A 1LBFA 1R2TA 1TYGA 3L0NA 4JX4A 2LX2A 3DI0A 4O1DA 4N6EA 4X3ZA 3W7MA 3R5EA 2A7NA 4LU0A 5HJLA 4UTHA 5D33A 1XL9A 3V1PA 1A5BA 4ZL1A 2D73A 1J2WA 4ZQOA 1TPC1 4YL2A 4KFNA 3NM1A 2V2CA 1JUKA 2WO5A 4ZZ9A 3TFCA 2BZNA 2O7SA 3L0KA 4NNCA 4NNBA 3W88A 2A4AA 1FWSA 1PVNA 4IGHA 2A1YA 3RNDA 3BG3A 1W3NA 3LCWA 3JRKA 3GZ3A 1C29A 3N9SA 3NL2A 4GC4A 5CSRA 3ATYA 2YFNA 5K4XA 5LNUA 4K37A 4Y9AA 3UXAA 3V75A 1Y0EA 3RMJA 3G8RA 3GDTA 4JR5A 2RH9A 3L21A 3W7LA 1ME8A 1LBLA 4UMCA 5AOUA 3QMRA 1S3HA 1TV5A 1UASA 3LXBA 5DY3A 5D2VA 1A5AA 5D2XA 5I3GA 3DFNA 1LLZA 2E5BA 4FEZA 1K03A 2W79A 2A6LA 3EEGA 3EX6A 3UQNA 1KM6A 4XKYB 3A24A 5U7SA 1G4EA 2ZZ1A 4N9BA 1I8JA 3CHVA 1IXNA 4XKYA 3MO7A 2YYTA 2KZHA 2A2IA 2CFFA 2DP3A 2A6NA 4JTIA 1RQHA 1OFQA 3N2XA 3NQGA 4KKXA 4RKAA 1JCNA 2JGYA 3I7QA 2SPGA 1OHLA 1UJPA 2QCGA 5DN1A 4FX7A 1HG3A 2E6AA 5DXYA 3GKFA 4LC8A 2FPTA 4UR8A 3LHYA 2ABAA 2TRSA 1QOQA 3IGSA 4WQ6A 3N73A 5A5WA 3IGUA 4BWLA 2C18A 3WJWA 2HTMA 5HINA 1H51A 1WDWA 2G96A 5ABTA 4AHQA 3SGZA 3G1AA 2PE4A 2FPVA 4DBEA 3D0CA 5FF7A 1X1OA 5FF4A 3N19B 2CLMA 3GAKA 5D05A 3PY2A 5AYYA 3LHWA 1OX4A 1F05A 2DJLA 4PCFA 1FXPA 2H8ZA 3EKZA 3QQ0A 5HQEA 1JCXA 4DF1A 1KDEA 4GJ1A 4QNWA 8TIMA 3O63A 7AMEA 1GVOA 1GVQA 3FKKA 3PULA 2QDHA 1VCFA 3L5AA 1KM5A 3QYQA 4DO4A 1DV7A 4NNAA 3L5LA 4JY8A 4MZ1A 4U4MA 1ZNNA 2I9EA 1KV8A 3KXQA 3PBUA 1JUEA 2B7PA 3W7RA 4AVFA 1OFRA 3WK3A 2C3ZA 2DORA 3MYOA 2GUUA 3GAYA 1WV2A 2H6RA 3W3OA 5AYXA 4UTJA 1H62A 4WJEA 5H91A 2DJXA 4LVGA 4FO4A 4R7JA 3W87A 4KWVA 2A7RA 1A53A 4LUJA 1FCVA 3LX9A 2YYUA 1C9DA 3NEVA 3MJYA 5AC7A 3NZ1A 2QR6A 5I3KA 3W1PA 3SW6A 2X1UA 5D09A 1R30A 4GUFA 3VFLA 4GUGA 5DLCA 3LDVA 1H61A 3Q37A 2RDWA 4N9CA 1QR7A 4LUIA 1PHQA 2GQ8A 2EPHA 4PL1A 5G4EA 4LC6A 3PUEA 5KSWA 2E6FA 5DXXA 3W84A 3TJLA 3BW2A 1H1ZA 2AGKA 3B8DA 1KW1A 3EXRA 1VPXA 2B7NA 4UTIA 1QCWA 3BVJA 4JNMA 4N4QA 1OFOA 3G1VA 3L0GA 3HOJA 1I2PA 1FX6A 5EYWA 5F4XA 4J9JA 3HG3A 3NQEA 4H6KA 1TJPA 5L9FA 2NWRA 3LCGA 3DI1A 3CLMA 3PB2A 1G6CA 3NQ8A 4JIPA 3W7NA 5D38A 4UTUA 2ZZ5A 1WBHA 3A5FA 3LHTA 3JS3A 1SFLA 3F03K 4B5NA 6MSIA 5KINA 4UXDA 7MSIA 2ISVA 4Q32A 5AC6A 3FRNA 4XBKA 1S5WA 5HUPA 2ZQ0A 3F4WA 1VH7A 2V5BA 3P62A 1TTPA 3W7QA 4PH6A 2VEKA 3SI9A 1GZIA 2FDSA 3EWXA 3NPVA 5K9CA 5HWJA 1X8FA 5F2IA 5IBXA 3TFXA 1J5TA 3LOTA 4P2VA 1C8VA 1YYAA 4LVDA 3VE9A 1MEIA 3P8IA 4E2BA 4ZVJA 2Y62A 4MLJA 3VE7A 5MHBA 3DFSA 3FYPA 4HIBA 4UCGA 1JRBA 4MLRA 4O14A 1OF8A 2G5WA 4UR4A 2ZTKA 2ATSA 2Z6IA 3GNDA 3A5VA 4N02A 3G1XA 2E09A 3AO0A 1OK6A 5K2ZA 4AMEA 3IGXA 4LS1A 4HSOA 4A22A 1L9WA 3JR2A 1JR1A 2WJZA 4W9TA 4PC8A 2F84A 3W7OA 4OU1A 3NOEA 1ADOA 2CLLA 3E12A 1KBJA 4G1KA 5HR6A 3C3NA 5C2XA 4UTMA 4JTUA 4KFOA 3S6DA 1FWRA 2ZA3A 1Q6LA 4O16A 2X16A 4IXXA 3H53A 2A7PA 1IIGA 3BV4A 1RPXA 4OQVA 5CG7A 2GVLA 1OFBA 4JTFA 1CX9A 3MHGA 4UFJA 3THQA 1JQVA 4NJIA 2PRHA 2OZ0A 4MFDA 4HN4A 3KX6A 2GJNA 2QUUA 2Y7EA 1SUXA 3IIVA 2OJPA 1KA9F 1AMEA 1HUVA 3FJ6A 3HGOA 1A50A 3HBLA 1TRIA 3FYOA 4JIQA 3S9YA 2WNZA 1D3HA 2Y7GA 3NZRA 1PHWA 4R53A 1A5SA 3CB8A 3KFTA 4AWSA 2QCHA 3W1UA 1AW5A 1THFD 3T7VA 5I3HA 4I9AA 2C1HA 3R2GA 5CZJA 1EIXA 4POCA 1ZHAA 3NQDA 2VFIA 4LVAA 4PL2A 1AL7A 1OPSA 4E0CA 3R8RA 1EUNA 1LRQA 2PRMA 2JIAA 1FY6A 3SR7A 1N8FA 3B4UA 3TE9A 3ABQA 1I45A 3U8GA 1EWDA 5EBUA 4X22A 3W2JA 5HMSA 1LZOA 1NSJA 3NQ6A 3CQ0A 1OF6A 2QJHA 3G3MA 4TX9A 1QMLA 2QCLA 2RDTA 4JY9A 4RZ5A 4JDBA 3LTYA 2ISSA 4PTNA 1EA0A 3SSJA 2ZZ4A 2VKZG 1W31A 3MP5A 1Q45A 1IXQA 4FIRA 2AMEA 3TDFA 3LHUA 2VENA 2P10A 5C6MA 2FB3A 1ME9A 4EF8A 4UFHA 5I3FA 4JTGA 2QCNA 1EUAA 1QPOA 3B03A 2A21A 3A22A 4RV8A 5DCEA 3C2OA 2BSLA 3G3DA 5FEZA 4MJZA 3PS7A 4O12A 2P1FA 5CZ0A 1LORA 2ALDA 4MSIA 4DF0A 1ZFJA 1DKWA 5K9XA 5CKSA 1OX5A 2BTMA 2JKAA 3ABRA 3L66A 2CZ5A 3PSWA 2ATMA 3GR8A 4TU1A 3NLAA 5CZTA 4YCOA 3A9IA 1I4NA 2Y7FA 1AG1O 5LGZA 4RXGA 2I1OA 2DZWA 3M0ZA 3LHZA 4DBDA 3MP4A 3CWNA 2A0NA 2OX1A 3BGJA 2R94A 1P4CA 3BG9A 3MBDA 3PR2A 3G24A 3GDKA 3SZ8A 3EB2A 1H7OA 5CZSA 1K02A 3E49A 1WVOA 4WY0F 3FFSA 2ZZ2A 3NQMA 4O0ZA 3W2MA 3TAOA 1X6UA 1WXJA 4A2RA 3L5MA 2QCFA 5BNKA 4TIMA 2V5LA 3IVUA 1W5QA 2NUYA 2TSYA 2IQTA 3I68A 1C8AA 5LNRA 3SY5A 3LCLA 1JCJA 1XBVA 3HGSA 5AB3A 1Q6OA 1OVDA 4A3UA 1EP2A 3PG9A 1DJNA 3GX9A 3DHDA 2QJGA 3O15A 1B7KA 2YDAA 1F7BA 1WX0A 2XN0A 2DZXA 1VLWA 4AMAA 4QITA 2NX9A 4NUWA 4CNPA 1JUBA 5G2HA 3DFQA 3WJSA 1WQ5A 3M44A 1VHNA 4OGZA 2Q3RA 4LV4A 4BR1A 1H1YA 1HG7A 3CIWA 5AYZA 1ZCOA 3LI0A 3O6YX 3M41A 3ZWTA 1QFEA 2QUVA 1H7PA 3KVMA 2R8WA 4O54A 2BWGA 2A5HA 3OVQA 3W76A 3UPWA 3W2UA 1K8YA 1G4TA 3T55A 4OV9A 2WQPA 4QNEA 3RLUA 3BW4A 2C6QA 2HS8A 4GE8A 3QMTA 3NO5A 4AB4A 1K7EA 3BG5A 4BI7A 2X1TA 3KVLA 3N14A 1B57A 1OYCA 2WV8A 3DFTA 4S1FA 1KTCA 4WD0A 3W7HA 5F4SA 1H7XA 5TQLA 1XCFA 4XZ9A 3U6WA 3P84A 1SZNA 2VXNA 3M5ZA 3W2KA 2GOUA 3NR0A 4GBUA 2Y61A 3IIZA 3Q94A 3PSVA 1YPFA 5CPLA 4LTSA 1OX6A 1V7YA 5D04C 1NFBA 4NT0A 1LLWA 2DZSA 1JJKA 1QWGA 5F2LA 3F4NA 3LCIA 3WK0A 2I14A 3ZFHA 3UWWA 4M6PA 3HG4A 3HGJA 1TPB1 4O50A 3MI2A 5BOOA 2VFHA 1VS1A 4NQ1A 3WJYA 4DPQA 3STEA 4JTKA 4RCXA 4TR9A 4JTSA 2V82A 2C19A 2YXGA 3P74A 2Y88A 1JQXA 1YPIA 4JICA 2X2GA 1KBIA 3O6DA 1K7FA 4Z08A 4EOUA 2V2HA 5BRBA 1VCVA 3G0XA 1P0KA 4JD4A 1C89A 2J9YA 1K7XA 2GQAA 3ZWSA 4Y6GA 3TU9A 2WSYA 3N9RA 2Z6JA 3UWUA 4K7YA 1H7NA 4K8HA 4HNVA 2YFOA 2CLIA 3GXPA 1DQWA 5G2IA 3G1SA 3W1XA 4YCPA 1O5KA 3P61A 4CQ9A 4BI5A 4IPIA 3NNTA 3VCRA 3O1NA 2Z1BA 3PUOA 4GWEA 4IX2A 3C61A 5LSMA 2B4GA 4K39A 5FEWA 5D37A 3KRSA 1K3UA 1R47A 2YCEA 4MKNA 1P1XA 2Q3OA 4MY1A 2C13A 3P82A 2NX3A 1TPFA 2ZRVA 1QDSA 1DJQA 1ZY9A 1P0NA 4UTTC 2Q8ZA 4HPXA 1T96A 2E6YA 3QJAA 4JXCA 3OEXA 1LOQA 3LV5A 4NX5A 1NF7A 3IVTA 5AHEA 3STFA 4AH7A 1VHCA 2FLIA 4O11A 3TSDA 2H3DA 3KRZA 4LWWA 1B3OA 3BO9A 5KTLA 1FWWA 1OK4A 1YLVA 2QAFA 4AWTA 3M43A 4FXRA 4X9SA 1GJPA 3O05A 2VFGA 5F1UA 3LV6A 1PCWA 2VFEA 1TPVA 3OA3A 1TQXA 1YDVA 2J6XA 1JCMP 3N2MA 3STCA 2HSAA 3M16A 3W85A 4MYAA 4FNTA 4I7WA 3CTLA 1JRCA 2YW4A 1JULA 4ONVA 4L4MA 3QRHA 1XM3A 3RFAA 1J4EA 1TPDA 4O53A 3UYCA 2V0TA 9MSIA 4BK9A 3MW7A 3BLEA 3DU0A 1TREA 4DELA 2WPBA 4CLMA 1TIMA 4K36A 4CNNA 4HPJA 3USBA 1EWEA 3MHUA 3N3MA 2ZTJA 2ZA1A 3PBWA 1EB3A 3KAOA 2FTPA 4WOZA 5CGQA 1NVMA 2RKXA 3G1YA 5T26A 4HSNA 3EX2A 3VI2A 5E1QA 3GYEA 1GPWA 3UWYA 1O95A 2QDGA 4WY0B 3EX3A 1FBAA 1SZEA 2W0UA 5LGXA 1XXXA 4UTWA 4WY0A 1TPH1 1K8ZA 4D2JA 1G4PA 5HWMA 1WAUA 4A2SA 3Q58A 1DQXA 4IMFA 3MWAA 4KFPA 1W54A 1PE1A 3DFOA 3PUDA 5D2YA 3W71A 3ZR4A 1XUUA 3LCHA 5BMWA 3ABOA 4HT3A 4IXHA 4RXFA 3FEMA 2E6DA 4GUHA 3NG3A 4L4LA 4MZYA 3CU2A 5DBUA 4MZ8A 4GUIA 4JX5A 3DFPA 1TJRA 3NA8A 4DQWA 3NQAA 5G1TA 5SWUA 3C52A 4AEOA 1W37A 2VEMA 4K7VA 3H54A 4OWGA 3W7KA 1Z48A 3ELFA 1FWNA 2E1DA 4XBSA 3EWWA 1TSIA 4MVAA 4PA8A 2C0AA 3C2RA 2VFFA 4N4PA 1S5TA 2EGZA 3FS2A 3QSTA 1XI3A 3M9YA 1SO4A 3BK0A 3OHIA 2VEPA 1O5XA 3CM4A 4AXKA 3TCEA 3S5OA 1LBMA 1LOLA 4UIOA 3GLCA 2G97A 3MUXA 3U2OA 1XDLA 1YTKA 2V30A 4DEFA 4FIQA 5DBTA 1F6KA 5KZDA 1QO2A 3WK2A 3M47A 3HJZA 1UBSA 1GVFA 4P61A 4Z1DA 5AHIA 4M6VA 5FESA 1ZAHA 2ZRYA 5FEPA 3HF3A 3TIMA 1GYLA 1OYAA 4QJ1A 1W5PA 1F2JA 1KLYA 4K6AA 1QNVA 1FDJA 4JYEA 5LHEA 4QISA 1MZHA 4O19A 4S2CA 4LOCA 4UMBA 3LB0A 3F1QA 3N34A 4O10A 3VNDA 3BLFA 3W1QA 2QJIA 4YLWA 1JABA 2GQ9A 2H3BA 2ZZ3A 3DKLA 3LXCA 2NLIA 3C2EA 3L9CA 1OG0A 3UWQA 1IGSA 4O4VA 1MEHA 1XBXA 1ML1A 5KITA 4TMBA 3RK8A 1VR6A 2NZLA 3MI3A 4AHOA 2MSIA 3S1XA 1FUYA 1MEWA 2ABBA 1I2NA 3SIZA 1TTQA 5TBOA 4JDYA 2EAWA 3QF0A 1NEYA 3OIXA 3DBPA 4DO6A 1XUZA 3GXNA 2B7QA 3GK0A 1BWLA 1TV8A 3IIXA 1SZGA 4LW7A 2QAPA 3FA5A 1RR2A 3G1DA 3TSMA 3LM7A 4OE7A 2DZVA 1SO6A 5AC8A 2YSWA 1O4UA 2CZDA 3TH6A 5I3IA 1LP6A 2Y89A 3W7EA 4FNPA 4NZJA 1I2QA 3G0SA 3TW6A 2NX1A 1TMHA 3W7JA 3HPXA 4FNRA 4UUIA 1SSGA 1RV8A 4JTHA 1QAPA 3SGUA 6ALDA 4JTLA 3S42A 2WSQA 4MY8A 3QW4B 3OVPA 2XFWA 4I7VA 1Q6RA 3YPIA 3W70A 4H4IA 2FQIA 1QOPA 1QPQA 1G7VA 4AF0B 4JTTA 3RLVA 1W8SA 3W7IA 2A85A 3RF9A 3P60A 5KZEA 1KFLA 4AF0A 1WA3A 1KDFA 5K9DA 1GG0A 3BARA 3TQ0A 2OT1A 5EMUA 1EKLA 1VZWA 4OT7A 2VC6A 2NXHA 3GKAA 3S8HA 4QAIA 4R33A 1V5XA 1ICPA 4N9DA 1GT8A 1H5YA 2FIQA 1W5OA 1IF2A 2BXVA 5FF3A 1BKSA 4JYDA 4LV9A 1KFJA 5F1VA 1Z42A 3NL6A 4MYXA 4TO8A 5FF0A 4LT9A 1GOXA 5U4NA 3IRDA 4UNLA 1UCWA 2ZYFA 3CPRA 1I2OA 1SO3A 2CLFA 3S1VA 3DZ1A 4UR6A 1PS9A 4I7UA 4O52A 1GTHA 2WSRA 2TPSA 3GVGA 1ICSA 1CI1A 4HNTA 1KFEA
chains in the Genus database with same CATH superfamily
1VCGA 1EHNA 4AZIA 1VIZA 4GO8A 2CZFA 4O1BA 3H2FA 4Z0JA 3PPFA 4C7FA 1EPXA 4IM4A 2VNCA 3LBMA 1GKQA 5E09A 3EOOA 2J7EA 1GVRA 4O1FA 2WKGA 3NPUA 4KWSA 3BOLA 1XLDA 3AU2A 3BPWA 4L61A 1ICQA 1BYDA 1XLGA 3EAUA 3W22A 3QZ6A 3W24A 2WWCA 5GPRA 1V02A 3O07A 1AW2A 4BF5A 3NSMA 2G3NA 3ABSA 4DAIA 2D2GA 3I4EA 4F8XA 2FFIA 4QG9A 3T44A 2V2DA 3B8SA 1F73A 3C8NA 4U3AA 1KM4A 2NWSA 4S3KA 1W1ZA 4O17A 4A3YA 1C91A 4HA3A 1DE5A 1X6LA 1XJBA 1Q6FA 1CGWA 2FZ8A 4HZMA 4AC7C 2PMQA 3WF4A 1FWJC 3A3HA 1YNPA 3UY7A 4CGTA 1LUCB 2GK1A 1DVJA 3JU2A 2E25A 3KS5A 3B04A 2QNEA 1YNQA 1FHVA 4RE0A 1LUCA 2ZXBA 4B9ZA 1LF1A 1LCOA 3EKLA 5A6AA 3S1GA 3HPZA 2Y6ZA 3GR7A 3W74A 3CMFA 2ZVIA 3VMPA 1XISA 2J7BA 1SO5A 2ZXQA 1AZ1A 5DO8A 1J11A 3UJRA 4C91A 1VJIA 3VNMA 4H3DA 4IWWA 4HP5A 3RYSA 4PFMA 5CPSA 4NJKA 4FLRA 1FDZA 1H11A 4MIMA 3UG8A 4HK6A 3C0JA 4J28A 5M2FX 1RK5A 3TNOA 1HZYA 1W3JA 2F7FA 3DGRA 5EL1A 3FK4A 2H8XA 3VABA 1VF8A 3P14A 4ROQA 2ZRWA 2ZFAA 2VC9A 2DH2A 2V3DA 1AJ2A 3WEOA 4RJEA 1V3KA 4PMRA 3E02A 4QROA 3GXMA 4XTDA 4L56A 3CQKA 3ZJ6A 1NF0A 2OX4A 4DZ5A 4WXZA 1J0ZA 4JTQA 3LUTA 3TMQA 4AFYA 5AFDA 5G1YA 1U22A 2I17A 2VD9A 3I7RA 4IGMA 1L6SA 3AJXA 3HMJG 2J7FA 2WNWA 4B3LA 2XVGA 4HPGA 5IBXC 4XD6A 4ENLA 4X2RA 2E3ZA 4ALDA 4C6DA 2JKPA 2OSXA 1W3IA 1XRSA 1XW8A 1FCQA 3TQVA 3I4KA 2O9OA 4DJED 3TWAA 5D8WA 2V81A 2UY4A 1KFBA 4IL0A 5C55A 3EWZA 7PTDA 3UBPC 2XSBA 1ZZMA 4AD5A 1XH0A 1WNOA 1A49A 5HR7A 2ACQA 3VCNA 1G67A 3EWBX 3WBXA 4N42A 5E6YA 1W1IE 1S2CA 3BURA 5GJMA 4LS2A 1F5ZA 3OZYA 4IMGA 1F76A 3FEQA 1QNPA 2PGWA 6CGTA 2WKLA 1P0EA 3ANUA 4ICCX 3T42A 5M1TA 2NV2A 3ZQ9A 4HNNA 5C5YA 4MOZA 3W07A 4QJ4B 1HL2A 4FLQA 2R6OA 1XLIA 3SCSA 3WO8A 5CZKA 4R9XA 4ML9A 3GYCA 4Q33A 2VZVA 1LWHA 1KGXA 4XZWA 4PMXA 3CK5A 1AK5A 3IV3A 1SSDA 2J66A 3NQ7A 4ZXLA 2X09A 4EIVA 4TV5A 4OOUA 4CNOA 3NGJA 1VYSX 2PFHA 5I77A 3IARA 4F0HA 2MUCA 1UMLA 4OKDA 1SU5A 3SGGA 3T1GA 3W7GA 1FXQA 3HQOA 1H63A 5HXMA 4G7EA 4BF9A 3UCCA 1ME7A 3T78A 4Y90A 2DZUA 4ICNA 3LS9A 3GD6A 2E68A 1GYMA 4DWSD 1AD4A 3M1ZA 3U2ZA 3DHFA 3G5EA 1JDEA 5BXPA 1QBAA 2LX3A 1OIFA 2VTFA 3KWSA 5HDRA 2ADAA 1A3HA 2XGIA 1BTMA 3TTQA 2DZPA 4DJEA 4PGLA 1WBJA 1BRLB 4L4OA 4OUEA 3QM3A 5KZMA 3FSTA 3VIPA 2ISDA 1WXZA 2VT0A 4N9EA 3KCJA 1KXVA 5H8PA 5BMXA 1HO4A 3ISIX 1IE7C 1YTEA 3QC0A 1KV5A 3GIPA 3SFKA 4QDWA 3UG3A 4C5ZA 4U5IA 4XWUA 4AYSA 3GBEA 1E1EA 4GX9A 2YR1A 1X39A 1OD8A 2XVLA 2BY2A 1PV8A 4FF7A 2Q6ZA 3C2FA 3FIGA 4XAGA 3VNJA 4LS0A 2XG9A 3LCFA 5CPNA 3DH7A 3WNMA 4Q3MA 4B4HA 4URIA 2BB0A 1B3VA 3ITTA 2V5JA 1Q5MA 1P6WA 2PD5A 3WKZA 2RDUA 2PC4A 5EPDA 4PR4A 1OGSA 4H04A 4Z0SA 3TN3A 4H6QA 5C2CA 4S3FA 1ZQ5A 3F5JA 3UESA 3P5ZA 3CL7A 5FJTA 4IGNA 4EK7A 3WQ6A 3EWYA 5LNWA 4J4KA 4RE2A 1UKOA 3FOKA 1OC5A 2CLOA 4MJMA 2JQXA 5T91A 3BH4A 2ZUUA 2HPMA 1T8XA 4MY9A 4UTTA 2FZDA 3S6TA 3ORWA 1JAKA 3P81A 5EY5A 1SGJA 2ISWA 3P5YA 1GQNA 3NVDA 3L68A 2XU2A 3PWGA 4UBPC 3CPGA 1HKIA 3ZR5A 2YCKX 1JPKA 2ZXAA 3W6MA 4ACZB 4M8UA 3RM9A 3T0TA 3PZTA 4GQQA 3NXFA 3QSRA 3VAVA 3KVJA 4Q4MA 3QY8A 4ACZA 3QHMA 1TVLA 1Y5XA 4GZEA 4IPNB 4NXSA 5HULA 3VIGA 3AXHA 4RLIA 4W7UA 3PWIA 9AMEA 2OZTA 4GFSA 4O18A 2DSVA 4CCDA 3HQ1A 2ZUVA 3ANYA 5DCBA 1QPRA 3EKGA 2OT0A 1LRNA 4R5EA 4ES4A 1VEPA 6PTDA 3R79A 4YMZA 4DBSA 4ORMA 1X38A 1U83A 1EPVA 1YDYA 3PVFA 3NPXA 1V6XA 4MPQA 1XYLA 1FDYA 5A8MA 1L6YA 2DU2A 1FWHC 4CCCA 3RLHA 4D9PA 3LNMA 1IWPA 3SQMA 4DB7A 1HP5A 5D30A 4K1GA 4BCEA 4D6EA 3W1TA 1BXNA 1RD5A 4IOTA 4GCAA 1PDZA 4L6DA 4LB4A 2QV4A 2O4QA 2VZSA 2IPFA 1XD1A 2YPIA 2CBIA 4ZFMA 4LCRA 1SM9A 4GI8A 3H8AA 2IS7A 3WJZA 3WUGA 3SY8A 3CPUA 2XWDA 3KTCA 2WMFA 4XD4A 4AVNA 3DHUA 2WZMA 3SJ3A 1REQB 1RLCL 1WAWA 2QF7A 1REQA 1CLKA 2FJKA 1Q7MA 2NVAA 4QE5A 1N8IA 4DF2A 4OHQA 5HOSA 4XZIA 2VGFA 1MVYA 1SFJA 4Y96A 3PJXA 1WDQA 3R13A 4E4PA 2TYSA 4UTLA 2E4TA 4JS3A 1FH9A 4BHYA 2ZBTA 4A8LA 5REQB 4AXNA 2PSNA 1EJXC 4LNYA 5REQA 1CXKA 1EF2A 4MMWA 3CZKA 2J74A 1AH3A 3ES7A 2IPWA 3NTYA 4ASTA 2Y8UA 3J7HA 2PRLA 4GMEA 1GOOA 4Y8FA 1X6NA 4YXGA 3A23A 1J0IA 3QFEA 3TWBA 2W67A 4AAJA 1KFKA 3UPMA 4F48A 3UA4A 1D2KA 4ZA0A 1GUVA 4LAZA 3E2SA 4I9MA 5HMEA 4KESA 4LYRA 1KQYA 3QQWA 4M81A 1PTGA 4P8UA 3MCMA 4M7SA 3P0WA 1ZENA 1WKEA 2WVUA 3HFTA 2FPYA 3R8GA 4B5VA 2VZOA 4Q4QA 4P7RA 3LXAA 1BD0A 3E6EA 1UR3M 4GNJA 2ISFA 1V3IA 4PUDA 4JX6A 1TRDA 2Z1WA 4JQ1A 3D6NA 4CD7A 1QK0A 3CV2A 1CT5A 1VB9A 4QE1A 5EMKA 1W9UA 3NZQA 3OODA 3T4CA 3H4GA 1YXYA 4Q6JA 3G1HA 2VZUA 1O68A 1LM1A 3DYPA 1DXFA 5D2TA 1UB3A 1W3HA 3T0CA 1EOKA 4UR7A 4Z2IA 3RU6A 2AMGA 4UNKA 4AIUA 4CUCA 2OLAA 1LBFA 2EPNA 3N9KA 4JX4A 3DI0A 3QFWA 4YVVA 2WHJA 3R5EA 1RK6A 5EGRA 5MKGB 4UTHA 1GORA 1XL9A 1A5BA 1KRAC 2CC0A 1PZ0A 4EAYA 2V2CA 1JUKA 3ZXWA 5A2BA 3TFCA 2O7SA 4FMVA 4NNBA 1CLVA 4DNMA 4G7FA 1E3ZA 3WLSA 3SRKA 4IGHA 2A1YA 4AD3A 3LCWA 1JYNA 3KBVA 2FH6A 3N9SA 4L4PA 4GC4A 4MKVA 4K37A 4DXXA 1JZ7A 3RMJA 4JR5A 3L21A 1S2UA 4ZODA 3DN5A 1UOKA 2CHRA 2IPGA 4V15A 3LXBA 3S6OA 1B31A 1K03A 2W79A 1AMYA 3UQNA 4Z17A 4N9BA 4U10A 1L2QA 1XLLA 4JPGA 1S46A 2V3GA 3V36A 1XLFA 3PPCA 3KRBA 3K1DA 4RKAA 1JCNA 3SCPA 2JGYA 3ARVA 2SPGA 1UJPA 2QCGA 1HG3A 3BZJA 4TV6A 2RJHA 3GKFA 4J5NA 3SN4A 1DIEA 3ARYA 6XIAA 4OECA 2TRSA 3IGSA 4WDUA 6XIMA 4BWLA 4LYQA 2C18A 2EO7A 3FN9A 3U9IA 3UR7A 1H51A 1WDWA 1NDVA 3B9OA 4OTKA 4S3EA 5FF4A 2ESCA 1UD5A 3KUMA 3UA3A 1PWLA 1WE5A 1E1FA 3CO8A 1Q6CA 2H8ZA 3DCPA 3UERA 4JQ2A 1BKHA 2HXUA 5A95A 4DI9A 4GJ1A 4DUOA 7AMEA 5G4HC 1GVQA 3FKKA 2QDHA 1HP4A 4J3WA 3QYQA 1DV7A 3L5LA 4JY8A 1PTAA 2INFA 4U4MA 4US6A 5E9XA 3KXQA 4UQ9A 4DYJA 3PBUA 1JUEA 3NURA 3BAWA 2B7PA 2O56A 2P8BA 3QR0A 5XIMA 4LAUA 3MYOA 4FP1A 3WD2A 3BLPX 3GAYA 3W3OA 2BV9A 1XSIA 3EPNA 1H62A 2R24A 2VDIA 2P88A 3W87A 1C8QA 4Z2LA 3B40A 4HMDA 4J3UA 3SCUA 1MW3A 4OFCA 4M29A 5C7VA 1PKNA 2YYUA 2RAGA 2DFAA 1E4MM 2GFTA 5ECVA 3S2MA 1T5AA 6REQB 3QV6A 4BQ2A 4DZAA 4Z42C 3QR3A 4DNHA 5D09A 4GUFA 1E9ZB 4GO9A 6REQA 5JH2A 2BGNE 3MUY1 3ZO9A 3L4TA 2YXXA 5C9WA 1CGYA 2ZX8A 4LUIA 1RH9A 2ACUA 2GQ8A 5E70A 2PWEA 3VD9A 2EPHA 5G4EA 4HNOA 1POKA 5KSWA 1KQZA 3BW2A 1V6YA 5B7ZA 5C71A 2FVMA 1QCWA 1MDLA 3U4AA 3IS4A 2RDXA 1H0IA 3LZ3A 4N4QA 1MUWA 3HOJA 3I6EA 5F4XA 1OZQA 3NQEA 1F6YA 1TJPA 4CD6A 5JVLA 4A35A 3DI1A 2PPGA 4V1XA 4JIPA 3A5FA 3LHTA 3T2OA 4US5D 4ERGA 5KINA 1A5LC 3C0QA 3WIJA 7MSIA 1ITUA 1S5WA 3P62A 3W7QA 3W82A 4PH6A 3V18A 4D1IA 3FDGA 1S2AA 3NPVA 1FWEC 1J5TA 3SUWA 2FGZA 1C8VA 4GQGA 4XO7A 1JPMA 1MEIA 5FD0A 4E2BA 4KW2A 3DFSA 3FYPA 1JRBA 3OLEA 1XRTA 4YIWA 4MLRA 3CUZA 2VI0A 3SN0A 1WO2A 3GNDA 1K6AA 1J10A 3G1XA 2E09A 4QCFA 1OK6A 5K2ZA 1OT2A 3K8KA 4AMEA 1UQZA 1NTHA 3WD4A 4RNFA 3OIHA 3VCCA 1E5NA 3OVGA 3N18A 3ITGA 4QAWA 3W28A 1VFMA 4GG9A 5CPQA 4KFOA 3WN6A 2ZA3A 1POJA 4K68A 4IJRA 3GDBA 4HYVA 2W63A 4HQVA 1JPDX 4IZGA 4OQVA 4LEFA 2E9LA 2QS8A 5FL0A 3PZUA 3ZR6A 1CX9A 2C1GA 2E8YA 2ZC8A 3H2AA 3MHGA 3WSUA 1RJPA 3THQA 2IXVA 4D6IA 2BP1A 4JAWA 2HROA 3VZZA 4NJIA 5IDZA 2QMJA 3EA2A 1VKFA 1KGUA 3ZJKA 2GJNA 2ZVRA 4V33A 4QCEA 3MWCA 2Y7EA 1XF0A 5DRIA 2OJPA 4W84A 4F40A 3QXBA 4GH3A 1TZ9A 3CHFA 1EGMA 4YTQA 1DTUA 1L0PA 1QASA 3AALA 5AECA 1JZ3A 1D3HA 1S5NA 2WLZA 4R53A 2BVWA 1JNEA 1EZ2A 4PSRA 2PGRA 2C1HA 3E0FA 5PTDA 5I0DA 1BFNA 1RXOB 4US5A 4PL2A 1AL7A 4IL2A 1BHGA 5EB8A 1OPSA 1VFLA 1LRQA 3SR7A 4H8UA 1N8FA 3GSMA 1G0CA 1OIMA 1EWDA 3TCSA 3UYIA 2QF8A 1NSJA 3IJ6A 3GFYA 4ZOAA 3ZVHA 2Q02A 4GK8A 1YNYA 1FFQA 4GVIA 4AEFA 2RDTA 1A5KC 7A3HA 4C6OA 4RZ5A 2W61A 2WB5A 4GZ7A 4XZMX 1CDGA 2D1ZA 1WCGA 3GXIA 3DC0A 4GQ0A 3LHUA 4K1WA 4LY4A 1J18A 3N6QA 3R0DA 3NJ3A 1H3GA 2FB3A 2Z7KA 2ZOXA 4KRTA 4UFHA 3M6DA 2QDDA 3AHYA 1QOXA 4CU6A 3FY1A 4DRSA 2G4JA 3G3DA 5FEZA 3LEPA 1LORA 4GD0A 4BQ5A 2OR2A 1YX1A 5BU9A 1ZFJA 3WLKX 5K9XA 4G1NA 2L5HA 2E28A 2ZXDA 3NLAA 4OUIA 2W66A 3A9IA 4HPNA 5LGZA 4RXGA 3M0ZA 4WGHA 3CWNA 3N4FA 5DMMA 2OX1A 3GHUA 3KM8A 3BG9A 4IJCA 3G24A 5FJRA 3GDKA 3H2NA 2F2HA 3LG3A 5D9NA 3SZ8A 2YCIX 4LX4A 1J0KA 2XVPA 1WVOA 1SFSA 4LUTB 1GONA 2YL8A 4EPDC 1J2BA 5HATA 3FFSA 4RV3A 1MYRA 3OLDA 5ABFA 3TAOA 1F8MA 3L5MA 2TSYA 1SVDA 1UPMB 3VMNA 3EMZA 3K8LA 5LIKX 4PMZA 2DT3A 3RAOA 5GQBA 3PG9A 2ZWYA 2QJGA 2YDAA 1XV8A 1MQRA 2GJRA 2QPSA 2CBVA 2DZXA 2WK2A 4QITA 1O1HA 1JYWA 1OB0A 2GQ3A 2IPJA 1JUBA 4OGZA 4NAEB 3S9ZA 5AYZA 1ZCOA 3LI0A 3O6YX 3ZWTA 3KVMA 2R8WA 2A5HA 3UPWA 4NAEA 4RDVA 1K8YA 3JVAA 4OV9A 1KWKA 3RLUA 1AD1A 2NQHA 1A47A 3QMTA 1K7EA 1UH3A 3PJUA 3KVLA 4J27A 3N14A 1A0EA 4J35A 2GUBA 2WV8A 3V0TA 2BGSA 4S1FA 4WD0A 5TQLA 4DJEC 4WLCA 3P0XA 4XZ9A 4XISA 3U6WA 2VXNA 4PTDA 4PRRA 4GBUA 3BL3A 3KCLA 3Q94A 1HJWA 3TTOA 5CPLA 4L9YA 2DUZA 4UQEA 1XPYA 3PZIA 1NFBA 4GXPA 2X2YA 4WSHA 1LLWA 2DZSA 2YB1A 5F2LA 3LCIA 5TNVA 3HG4A 2Z1VA 3N29A 3WMCA 3TTYA 3HGJA 1TUFA 2X7WA 4H9VA 3STEA 2RJGA 4DPQA 1UH4A 4TR9A 2Y1HA 4FOKA 4JICA 3FNDA 4Q6XA 2X2GA 3W02A 3O6DA 3SCQA 3W38A 3DFHA 5A3HA 4MKSA 2CHNA 1DQUA 2ZUSA 4Y6GA 3THCA 3TU9A 1CBGA 2P8CA 2Z6JA 2YFOA 2CLIA 3GXPA 5G2IA 3WBYA 2DSKA 4JIHA 4FF5A 5TAOA 4GWEA 3VKAA 2F6XA 1K70A 3GHRA 1G01A 3EOLA 1EX1A 2GSJA 1B3ZA 1DJWA 4MKNA 1P1XA 4B5WA 3QLDA 4NIRA 2NX3A 3HV9A 1EYEA 2Z29A 1KXQA 4C6IA 2VQUA 3WZ0E 3N6JA 4GXWA 4UTTC 2E6YA 3KZSA 5FJJA 3QJAA 1AZ2A 2HE8A 3OEXA 1EGVA 3GTIA 3UT0A 4AH7A 3TSDA 3CUJA 3KRZA 1K9FA 5E6ZA 1JZ6A 3TP4A 4U3CA 3UGVA 3GY1A 4X9SA 4PUWA 3V5CA 2PTWA 3L4YA 1NOFA 3OYZA 1JCMP 4W5UA 2PZNA 4TTUA 2HSAA 2BBFA 4S3GA 5A1AA 3VIIA 4AD0A 4PBFA 3CV6A 4I7WA 3RIKA 1XIIA 4ONVA 1AQMA 4UZUA 3N1AA 3W25A 4AZBA 1XM3A 1TPDA 3MW7A 1JL8A 1J79A 3DU0A 2WPBA 1ITCA 4K36A 4HPJA 4I9JA 4CVUA 3A3WA 2V6AA 3MHUA 2CYGA 2ZA1A 3PBWA 3EB4A 4MM1A 1TMLA 2RKXA 4Q8UA 4AD2A 3VI2A 1V0MA 3AIBA 1E6ZA 2PWVA 4U5KA 3SJNA 1RCXB 3ARXA 4P7LA 1FKXA 1E4IA 4PTXA 3FHQA 3FGCA 1K8ZA 3GU2A 2XIQA 3C0LA 3Q58A 2FTWA 4EXBA 4IMFA 4PYSA 1JPHA 3DFOA 5D2YA 3W71A 2F61A 1C93A 5BMWA 1GHSA 3NG3A 3CU2A 3ARRA 3IV8A 1GQKA 3OQ8A 2FJUB 3DFPA 4GYJA 1LQ0A 3E38A 5G1TA 3MS8A 2VEMA 1A4LA 1CXHA 2BY3A 5HPOA 4PCSA 4MVAA 2G8ZA 7XIMA 2VFFA 1HN1A 2MNRA 1XI3A 3VOJA 4L5ZA 3BK0A 1XHGA 3OHIA 4GQRA 3BE7A 2VEPA 1O5XA 1K4GA 4AXKA 2W4XA 1CB7B 1NWSA 1LBMA 2WVVA 4H9TA 2VR4A 3WMLA 1YTKA 3AAMA 4FIQA 5DBTA 2C0HA 5KZDA 2Z2AA 3HJZA 5FESA 1ZAHA 4IFRA 3VM5A 1W5PA 1YPXA 1KLYA 3VGFA 4H9XA 1QNVA 2Z24A 3UXKA 5BOFA 4O19A 4UMBA 4IHCA 3VNDA 4MNLA 4PFHA 1R3RA 1WKYA 2J7GA 3DKLA 1XLKA 3C2EA 3S4TA 2D22A 2QW5A 4DXKA 4Q8TA 1UIOA 4DO7A 3CH0A 1XBXA 4XVDA 5KITA 4TMBA 1VR6A 3MI3A 4O1EA 1FUYA 3CBWA 4YJ5A 1DWAM 2EAWA 2OB3A 1QVBA 4DO6A 3AWOA 3GXNA 3K1GA 4Q4SA 3GK0A 2INEA 1Q8JA 4BQ4A 1RR2A 2PDBA 1X98A 3WNOA 2QJJA 3K5XA 1O4UA 2CZDA 3ZSTA 2DPEA 2AQVA 4IH3A 2P0IA 2VCBA 2NX1A 3APTA 2EKGA 2JF6A 3HPXA 3QOMA 3F2CA 4UUIA 4PUEA 1GZJA 3KTSA 2D2HA 6ALDA 1M41A 5CC5A 4I7VA 2NQZA 3W70A 2BVYA 4KF1A 2WMHA 1QOPA 1G7VA 3S9IA 2NQJA 1QI4A 3KBMA 4GC3A 4MNKA 1TWWA 4C65A 1KFLA 4GHRA 2FMOA 1WA3A 4REQB 3TQ0A 1UA3A 4JFVA 1V3JA 5EMUA 1NDWA 5J8LA 4B2DD 4JNYA 1EKLA 2VX6A 5BRPA 2XSXA 5FACA 4REQA 2OGYA 3AUJA 4W4QA 1KCXA 1YRRA 1ICPA 5I00A 1W5OA 4AX7A 3IUHA 3IRDA 2AL1A 3CPRA 2CLFA 1G5AA 4KEMA 1PS9A 1TV4A 3MVIA 1GTHA 3NUKA 3AIWA 2PTXA 1CI1A 3N2CA 2RGLA 3LENA 1BQCA 1UD8A 4KPLA 3BCDA 2E67A 4GVHA 4XSLA 3UJ2A 4HU3A 4NXKA 1MNZA 2XISA 1N7KA 3TROA 1RPKA 3OZOA 3WF2A 2C15A 2WZIA 3BJTA 1XBZA 4AHPA 1TUXA 3MV11 4NI8A 2W91A 4TMCA 1H7WA 5EFDA 3NQFA 4WXYA 2G95A 3UY8A 4UFKA 4BWLC 1SJCA 2Z1XA 2XH2A 3CB3A 3PC0A 3WH5A 3EPMA 3VGGA 5JIWA 4IFOA 2WMIA 2GYIA 1XRFA 4A21A 1DJYA 2ZRXA 3T9PA 4LFYA 1OWQA 3T05A 1NJJA 3PZQA 1V3LA 1PL9A 4LBRA 5K4ZA 2O7QA 2QLYA 3F4DA 4LNCA 5A6SA 1PJ9A 4AZHA 2CWNA 2QEZA 1D3GA 1AMKA 4UMAA 4PCNA 1YTDA 1Y8BA 3MY9A 3FKRA 4WUIA 3UW6A 2GJPA 3S5NA 2GLKA 3IVSA 4QQ3A 2YBTA 4DLMA 2Z2UA 4FXSA 4HMCA 2F6KA 3W7CA 3AYVA 1SJAA 3ABZA 2IMRA 1XFCA 1UP0A 4NF7A 1Z9AA 2PCQA 3NPWA 1M53A 2J24A 2JBMA 4C6JA 2YJQA 5FAGA 1B4KA 1V8EA 2CWXA 3NQ2A 4KT2A 1VYRA 3RPMA 2X30A 5HNNA 3ME3A 3FYYA 1TCDA 4HKPA 3GG7A 4R34A 4Z1AA 3S5ZA 3CQJA 3QGKC 4YYCA 5GNXA 1MQPA 3VKKA 1AVAA 3EDEA 3S2LA 3THAA 3RDNA 2F2KA 1J01A 3WH6A 2QJNA 2C16A 4BZYA 4JOMA 2EPMX 4M6QA 2BODX 4ORIA 4WDTA 1UCSA 1E40A 3C4UA 3EA3A 1WYIA 3NM3A 1JCYA 1XSKA 2JGQA 4EWND 3V1HA 4AG0A 1F07A 3DHPA 3WLHA 5FIPA 1KM1A 5L6UA 1BSLA 2YIHA 1GQIA 1GNXA 2VR2A 2GDVA 3QLLA 3CC1A 3LCXA 1ZAJA 1XGZA 3BSHA 2DDXA 1KRCC 1OFEA 3QF6A 2VQTA 3AS2A 3GFXA 5BWAA 1MI3A 2LLEA 3QR1A 5KEZA 1YIXA 4PUUA 1X96A 3CV7A 1ZBKA 2OYMA 1FWAC 4NYYA 1OG6A 3H23A 4ECLA 2QVNA 3JW7A 1TJ1A 3TJXA 3H2EA 2V3EA 4UTKA 3MANA 4PTVA 3P2VA 1U5VA 4QS6A 3UXDA 1W5MA 4FOJA 1QW7A 1JF5A 2ZUNA 1CIUA 4YHEA 1PIIA 3RGTA 1OABA 3E2QA 3DECA 1EP1A 1GYNA 1T6MA 1UR4A 1G94A 3VGHA 1R46A 4UQCA 3B05A 3OLGA 2HK0A 2WCAA 4NHVA 1UR2A 1ZALA 4JCLA 4E2DA 1V7AA 4NY6A 5CPMA 2WNQA 4NG3A 1SMAA 2CLPA 1PB0A 1BG4A 4UFMA 2YW3A 1HT6A 1I1XA 4B91A 2D0FA 5HJYA 1XLCA 2Z00A 5EBAA 1HFBA 2AAMA 4O15A 2V9DA 1E15A 1KRBC 1H5VA 2J47A 5D03A 4F2UA 1OFDA 1Q2RA 2BY1A 3VA8A 3GR4A 1TO3A 3OYXA 3T07A 4MWAE 1AQFA 2I9UA 3R12A 1ZUAX 3N04A 1XYFA 1W56A 3TSBA 6TIMA 1GKPA 3SN1A 4P8WA 3WEMA 1W3LA 1E6QM 3OU8A 1UZ4A 1YADA 1JG9A 2ZRUA 3MYPA 4GNVA 2WKJA 2FFCA 5AN7A 3ALGA 4GI6A 3TNBA 2NV9A 4ZO7A 4B90A 1HL8A 4JQAA 4D6CA 1JXKA 3M0XA 1GOQA 4WX2A 2GGGA 1R87A 3WLRA 1PIFA 3BCFA 4WSJA 3CYJA 4F2TA 3LLDA 1XBYA 4L65A 1QPNA 4ZQNA 5LNSA 2VEFA 1R6WA 2WLYA 2VR5A 4K38A 1Q3NA 3SCOA 2IXUA 3CUFA 3A47A 1W5NA 3HN3A 1XKYA 2G3MA 3NQBA 3WDPP 5EMYA 1ESWA 3TVAA 1ZAIA 1JCTA 1I6NA 3CWOX 3M5YA 3BGGA 3XIMA 1MXDA 1ZJIA 5DCDA 4ADUA 3VOFA 4RX0A 4NYUA 1KR1A 3QV7A 3LQGA 3U0HA 4Y7EA 2ZA2A 3KVKA 5EA9A 3NWRA 4U2YA 3BW3A 3TJIA 4DZIA 1XFBA 2FVKA 4H8NA 3PTQA 3TOPA 1MZRA 3POHA 1VPYA 3VNZA 4CQAA 3UJSA 3TW7A 2OWXA 6ENLA 4XBJA 1E51A 4IT1A 3VM7A 2QJMA 4NU7A 1IYXA 3UVAA 3N12A 1ZBWA 4GPNA 4GYFA 3VKJA 4PMUA 1Y5WA 4YYFA 2A3HA 5HBFA 3VIJA 1TTJA 3VIKA 5B7YA 1EC8A 2CLHA 3VUPA 3CS2A 4O4WA 3L65A 1J93A 2EKCA 3ARPA 1KCLA 1LYXA 4R27A 1O60A 4E2VA 1W9DM 4UFIA 3APGA 1NWUA 4YN5A 1JVNA 4J3XA 4YVPA 3G22A 1IQ8A 3QYSA 2Y63A 3DC8A 1S5VA 3LHVA 1QNSA 1XC4A 3H21A 4ZB0A 1JNDA 1DXEA 1OC7A 1W2VA 3EWUA 3SSZA 2I7GA 2F6UA 4AZ6A 4O1CA 4OVXA 3B0XA 1QWKA 3I7SA 2W62A 2CZVA 3QW3A 3EWCA 2YA2A 2OLHA 1FCUA 1SZFA 1E5JA 1EDTA 1Q4NX 3A13A 1MNSA 2BXZA 1UUMA 4FSAA 4FNSA 1HF6A 1M7OA 1JYXA 4DM2A 1XKJA 3N25A 1SZRA 1TWIA 5K3VA 3EDKA 2PP3A 1IEVA 4GY7A 4NZ1A 3BUVA 1ZBVA 3U2CA 3CIXA 4M80A 4AWUA 4C1LA 4C6QA 4UC5A 7ENLA 3RDKA 4M7TA 3COTA 5C54A 2H90A 1TFVA 1MO0A 1R3YA 2JF7A 1TV3A 3DX5A 3GNNA 3O8AA 2Y5EA 5M5DA 2JKEA 3EEZA 4NJGA 2J6VA 1EJVC 1WZMA 2ZCGA 1TX2A 3W1AA 3HG5A 3FAWA 4Z1BA 3WNKA 4XSMA 3A4JA 5CPTA 2Q8LA 2HPIA 3TR2A 4DUXA 2VMFA 5BYWA 1TELA 1ZPTA 1VP5A 2X42A 1JZ5A 4G56A 2ACRA 3CMGA 3TUUA 3CZ8A 3W86A 4PUMA 2Z0IA 1W9XA 4HOWA 3K3SA 1W0MA 3WLJA 4E4FA 1T7LA 2YLLA 3HPSA 3T09A 4O0KA 3RLGA 2WWDA 5D9MA 4HD5A 1KCZA 2BX7A 5AC5A 3APYA 1AH4A 1HKMA 3E1F1 2XPKA 3FA4A 4ZXOA 4CCZA 3SO7A 5LNVA 2PURA 4KWWA 3TA6A 3QQ1A 4DAFA 3CUIA 1UP2A 2Z27A 1H1NA 3GQYA 1BEUA 1J96A 4RL3A 1UWTA 5IHSA 3VC6A 3LSCA 2CBUA 1R2RA 4DY1A 1B7JA 4JEQA 4NJJA 3PPGA 1DORA 2W27A 2EEXA 1QHOA 1CGVA 2QQ6A 1W17A 1V0KA 3RG6A 3W1MA 1YEYA 3GDRA 1R3SA 2FZNA 2YKKA 3SCRA 2PI6A 4MB4A 4Y9MA 3HV8A 1UA7A 4J3ZA 3VIMA 5ENLA 1GGOA 3G2GA 1L6WA 2OCZA 3QH2A 2R91A 4HMNA 4HU0A 4QIUA 1W3TA 1TTIA 2QULA 3LPFA 1RVKA 2VOMA 3QZAA 3IEBA 3T8LA 3UP8A 4DJDD 1A4MA 2J25A 3H2OA 1FP8A 3ARTA 3LRLA 4NAFB 1XDMA 5DANA 3LBOA 3QPYA 3CT7A 4JTJA 4ZO9A 3PPHA 3DXIA 1KM2A 4I6KA 4NAFA 3WD1A 3F2BA 4IMAA 3K30A 3LLXA 5K7JA 2VJXA 1IXOA 4GRSA 4WCJA 1CXFA 3PBVA 4IJBA 5LA2A 3MBFA 4O57A 4CEXC 3VTRA 1DOSA 5I6SA 3W2LA 5DT7A 1QATA 5A8PA 5A6BD 1B1YA 3L0NA 3WH7A 4N6EA 3SUTA 3W7MA 4XB3A 3R0KA 2A7NA 1F3TA 3B9NA 4S3DA 4LU0A 5HJLA 1ITQA 3IJLA 3R43A 2D73A 1J2WA 4ZGYA 4ZQOA 4YL2A 4ZZ9A 5LIXX 2P50A 2PLMA 1JFHA 2A4AA 3KOYA 1FWSA 1BWVA 2IKIA 4TVDA 3GZ3A 4TOQA 3F5LA 1C29A 2PWGA 3ZIZA 2J8TA 4JBRA 3W37A 3UXAA 4DBUA 1Y0EA 4P8VA 3G8RA 3GDTA 3MDUA 3W7LA 1E0XA 4MG4A 4GH1A 5AOUA 3QMRA 1TV5A 4HGXA 1UASA 2X8RA 5DY3A 5D2VA 4JTAA 4Q8OA 2E5BA 3RCMA 1VBGA 1KM6A 4GX8A 4R85A 3A24A 4GVGA 5U7SA 1G4EA 3CHVA 4MHBA 4AC1X 1DJIA 3NEHA 2A2IA 4WDWA 3BTNA 4M1RA 1J8VA 3N2XA 2XIIA 3G6MA 3I7QA 4DJDA 2E6AA 5DXYA 5E5CA 4KGLA 2FPTA 1DTNA 1M7JA 4UR8A 1ECEA 4WQ6A 5LA0A 3ITLA 2EQDA 5HINA 2G96A 1PEZA 5ABTA 3L2MA 3SGZA 3G1AA 1OGBA 3N19B 3GAKA 3U2EA 3PY2A 1OX4A 3G1RA 4PCFA 2NW0A 2J8GA 3AXKA 1EXPA 1V51A 4DF1A 4C7DA 4QNWA 4ZR8A 3O63A 4HK5A 3PULA 3MQTA 4LB3A 2CNCA 2GDQA 2GGEA 1MUMA 1V77A 3T0AA 5DX7A 1R7OA 2C3ZA 2WPGA 3QV9A 5H91A 3OBEA 4FO4A 3MKVA 3OA5A 2OZ8A 3WFZA 4QTGA 1FCVA 1H41A 3N3TA 3TONA 9XIMA 3NEVA 5AC7A 3NZ1A 1D7FA 2QR6A 1NWRA 1XIJA 4QQUA 1OM0A 4GUGA 4LCQA 3WCZA 3BLDA 4M56A 4N9CA 4XAFA 5AVHA 1KC7A 1PHQA 4XKMA 1XLMA 5CSUA 3AMGA 1CTNA 4PL1A 4CKQA 2WCSA 3WL1A 4LC6A 1FP9A 1FHUA 4M3PA 1HGYA 3BOFA 3W84A 1VPXA 1V6TA 2B7NA 4MSSA 2OYKA 4I3GA 3UF9A 2IKJA 4HOXA 2I5GA 4J9JA 2HNHA 2DUXA 5L9FA 3ARWA 2NWRA 3AMCA 3PHAA 1G6CA 4AZ7A 5D38A 4UTUA 2ZZ5A 1Z3NA 2OOFA 1UD2A 1E73M 1SFLA 4QDPA 4B5NA 1KKRA 3VDAA 2ZUMA 2XZ7A 1ZJHA 1U1HA 5AC6A 3FRNA 2DUAA 5HUPA 2V5BA 1ZP3A 2VEKA 3SI9A 3PNUA 3SY1A 5HWJA 4I8DA 4ZB2A 2OWWA 4LVDA 2VDGA 3QPEA 5CSYA 3RPDA 1GJUA 4ZVJA 3GW3A 1E9YB 4IG2B 2I5QA 3VE7A 1W6TA 3OO2A 5LA1A 2OEJA 2JALA 2G5WA 4IG2A 3B97A 5D9PA 3AIEA 1UKQA 1F3XA 3AO0A 1BPLB 2MANA 4QLKA 3VOIA 3IGXA 4LS1A 3ITXA 3LM3A 3WLQA 1XIGA 4W9TA 4PC8A 3W7OA 3WLIA 2ZIDA 3NOEA 1EZWA 1ADOA 1C9WA 1KBJA 1XGEA 3R58A 4G1KA 4JTUA 3CTTA 1ENUA 3S6DA 4XO6A 2I57A 3WUEA 3H53A 4MNJA 3CHCA 1RCOB 1OFBA 4JTFA 3WX7A 1WP6A 4GKLA 5HNTA 3AZSA 3NO1A 1QBBA 1KXHA 3GU1A 4S3CA 3N2OA 5D8ZA 2NQ9A 2NT1A 3KX6A 3BMXA 4TUFA 1HVQA 1KA9F 4DIAA 4O8AA 3EYPA 1HUVA 3HBLA 5D4YA 1TRIA 3FYOA 1RD6A 1JD7A 2Y7GA 1Y5VA 3AS0A 3NZRA 3AWNA 4B5UA 4NSBA 1AW5A 4I9AA 1YMYA 3AOFA 1M1BA 3SCTA 4POCA 1ZHAA 4IIGA 3A4XA 3GNXA 2QUMA 3R8RA 1EUNA 3B4UA 5LXEA 4XZHA 4C1NB 3U8GA 1JZ8A 7REQB 3WF0A 3W2JA 1ISZA 1XH2A 2Q01A 4C1NA 4LJ3A 5JBDA 1LLOA 3WQ5A 2WC4A 2QCLA 2VGGA 2BXYA 3F5KA 4PRTA 3BQ6A 4DYEA 1AUSL 3BQ5A 2ISSA 4G5DA 1L6FA 1OT1A 2ZZ4A 1EJSC 3TYZA 1Q45A 4FS9A 2QPXA 2XIJA 5I3FA 3OQEA 3KP1A 5I02A 4P8XA 1O1ZA 3B03A 3A22A 3EBVA 3WL0A 2BSLA 3LQLA 4O12A 2P1FA 2CXGA 1VENA 4MSIA 3HQNA 4YTUA 2BVTA 1BAGA 1OX5A 2BTMA 2OPJA 3L66A 4FR1A 3M0KA 2NQLA 2YL9A 3I3EA 4PZVA 3TC3A 3STPA 4Q4PA 4YCOA 4S23A 4UOZA 1AJ0A 2I1OA 1GK8A 3N2BA 3VKCA 1GQLA 4NP7A 1H49A 2A0NA 1NFPA 3LU2A 3O9NA 2HVMA 2V67A 2G4FA 1M68A 4Q8WA 4H7CA 3V16A 3QOKA 1H7OA 2YCLB 4H83A 4X9YA 5C7HA 2WJDA 2ZZ2A 3W2MA 3HZ3A 1XD0A 2YCLA 4HU4A 4LANA 4TIMA 2V5LA 3IVUA 4JIEA 1B5TA 4QE4A 3I68A 5C2GA 4NRSA 5FAJA 3UCQA 5LNRA 4GCXA 3BC9A 3SY5A 3H24A 3IK2A 2XM2A 3LCLA 1XBVA 4JKKA 5EMJA 3HU7A 2GK1B 2HE5A 3KZPA 3VYLA 4ZO6A 3DHDA 5BOEA 4HPHA 2X7VA 3SURA 1WQ5A 4W85A 5AZ0A 4EANA 1QFEA 1BG9A 2QUVA 4O54A 3WEZA 2BWGA 5D9OA 2QT3A 4LSBA 3T55A 4MUPA 4AB4A 4F0SA 2V5KA 2X0YA 3DFTA 1LL4A 1KTCA 1CEOA 1CPUA 1XCFA 1Q6DA 3P84A 3M5ZA 2GOUA 5J04A 1NM9A 5JBEA 3SUUA 2WJFA 1OX6A 2QGYA 2V38A 4EX4A 3CL6A 1TVNA 4HOZA 1VFTA 2DGAA 4EKJA 4EWJA 3FW6A 4X0VA 3MZ2A 3WK0A 5A6MA 3UWWA 4C7GA 4XD3A 3FV9A 2Z26A 1TPB1 2D3LA 3MI2A 4X63A 3WQGA 4EE9A 4F79A 5BOOA 3WJYA 3OGVA 3ITCA 3WLNA 3TJ4A 4RCXA 3UEQA 2V82A 4B5XA 3VDGA 1BYCA 1ZBCA 2YXGA 3P74A 2YDRA 3FXGA 2V5DA 2Z7GA 3A12A 4Q4OA 5IRPA 2XYLA 1KBIA 1TIWA 1K7FA 5BRBA 4EOUA 2P76A 1P0KA 4JD4A 2J9YA 3ZWSA 4J7RA 4C6FA 1F4HA 3UWUA 2CXEA 2OKOA 2ZE0A 1V6UA 3W1XA 1XYBA 3P61A 4BI5A 3NNTA 3CGTA 3VCRA 3O1NA 1EIBA 1DYSA 3WDJA 2YCJA 3C61A 2AQOA 2FYMA 3GG8A 3KRSA 1W3KA 5IFTA 1OZMA 5GNYA 4TVCA 3WH9A 3O3RA 2R1KA 3WNPA 4JN7A 5HAOA 2ANUA 1QDSA 1DJQA 1ZY9A 1P0NA 3V0SA 5IFPA 4W93A 1T96A 1A0DA 2FHCA 2OQHA 4JXCA 1R3QA 4NX5A 3ENLA 3STFA 5AHEA 1VHCA 1B3XA 1NP0A 2FLIA 5IXEA 5T8GA 3R8HA 1XLJA 2QIIA 2ZX5A 1BLIA 2PP1A 3LA4A 5KTLA 4B3ZA 1T40A 2WCGA 3M43A 1GJPA 5ECUA 3U3HA 3O05A 3KEHA 1TR9A 1TQXA 3WYZA 2J6XA 1RHCA 3AXMA 3N2MA 3STCA 4E8GA 5I23A 3E3HA 2PDHA 3E5PA 1CXIA 1PZ2A 3GZAA 2W3ZA 2X40A 4JL1A 3VGBA 4C6BA 1V08A 4L4MA 4QJ3B 2DY3A 1J4EA 2QDEA 4MAZA 4YU1A 1X97A 1S2WA 4Q8NA 3UYCA 3E0LA 2DIKA 2QYGA 1DWJM 2PLJA 3VD3A 4DELA 5BXRA 1EDQA 4PCTA 1RLDA 3PP7A 4CNNA 3USBA 3IUDA 1MRQA 4G7EB 4R7OA 4TTGA 4MAVA 5CGQA 1E43A 1NVMA 5LIWX 2AOSA 5T26A 4HSNA 5E1QA 3GYEA 1O95A 2QDGA 4NZ5A 3PANA 3RMEA 1SZEA 3G77A 1U2YA 1MW2A 1XXXA 4PB5A 3W0KA 1G4PA 3OJGA 1WAUA 5HWMA 1E4LA 3M4HA 2X0HA 4A4AA 4CVWA 3MWAA 3ZYZA 3PUDA 3BAKA 4F9DA 4HT3A 4RDWA 3GBDA 1KFWA 3FEMA 3BAXA 5DBUA 4MZ8A 4LF1A 1M9HA 4GUIA 4JX5A 4KCVA 2V3FA 1W1B1 1NDZA 4FLSA 4I8YA 2R82A 4AEOA 1W37A 1YW1A 2CKSA 2VRKA 3H54A 4HTYA 2CPUA 1BVNP 3H26A 4XBSA 3R1ZA 4JZ5A 4EPEC 2DVTA 5HJXA 3MKKA 5HQLA 2ODOA 3EZ4A 3M64A 1ZLPA 3KOZA 3M9YA 2PWDA 2VGIA 1FRBA 3VVGA 3LPOA 3GLCA 2G97A 4IGSA 1VJSA 1LL6A 1RP8A 1XDLA 2V30A 3U2OA 3GNPA 4D6JA 3S47A 3TN4A 1QO2A 1VFUA 3ZMRA 5CJMA 1BVZA 2OKTA 3SB0A 1KD0A 3UXLA 5AHIA 3K4AA 2C71A 2ZRYA 5FEPA 1GYLA 4QJ1A 3SRDA 4JYEA 1EF3A 4S2CA 3QKEA 4LUSA 4LOCA 3F1QA 3BLFA 1XWYA 4YLWA 1JABA 2EPOA 2I5IA 4Z2GA 3LXCA 2NLIA 3SAZA 3W27A 1OG0A 2X0SA 4UOQA 3UWQA 5JIPA 4FK9A 1MEHA 2FH8A 1GOIA 2DW6A 4DWSB 4XAPA 3M0MA 3MCNA 4AHOA 2MSIA 1MEWA 2HEJA 4B5SA 1XIEA 2ABBA 1I2NA 5AVNA 1KO0A 4DWSA 3SIZA 4YPJA 3ZM8A 3OIXA 3ZLGA 5BCAA 1KCKA 1Q66A 4GY1A 5IDIA 4H01A 1BWLA 4LW7A 1ZSXA 3FA5A 3OZPA 3TSMA 5AC8A 1EOMA 4UZSA 5I3IA 2D69A 1BXBA 1FWFC 2DQWA 4NZJA 1I2QA 4D8AA 3TTEA 1QI2A 3G0SA 4C6LA 3TW6A 4H9ZA 4J2MA 2Y8KA 1R85A 4FNRA 1GOMA 2WVSA 4EP8C 2WMKA 3CAWA 3AZTA 4JTLA 3S42A 2WSQA 3OVPA 4F0KA 1Q6RA 3VOCA 1P0BA 3FXYA 1QPQA 4P5UA 3FJ4A 3VILA 3DESA 3RLVA 3W7IA 1D7KA 3P60A 1W9PA 2PU1A 5K9DA 3QBUA 1O7AA 4PBEA 2G37A 3PZVA 3F2DA 2HBVA 1VZWA 1WDSA 2VUYA 1EC7A 4OT7A 1EQCA 2VUNA 1BF2A 3CZJA 3WBEA 1IWAA 2ZC1A 2DZAA 1HW6A 4RPPA 1FH8A 5FF3A 1BKSA 4LV9A 1KFJA 1Z42A 3SRHA 1UQYA 2OSWA 3W29A 2XGBA 5U4NA 1GOXA 4UQAA 4UNLA 1UCWA 2ZYFA 3S1VA 2VWTA 3I6TA 4I7UA 4O52A 3O2LA 3CQIA 2TPSA 2OZ3A 1XIDA 3QTPA 4N0RA 3HA1A 2IUZA 4S3AA 1KFEA 2J62A 1NAL1 3K4WA 3UWVA 1TMQA 4LXFA 1HKJA 2GOKA 3H4XA 1GVSA 4UNIA 5EFFA 5IHRA 4GINA 4XG1A 3M0YA 3W72A 5ABHA 5KZ6A 3EMQA 4DJDC 4QG8A 3EX1A 4GGHA 3CLWA 3PAOA 4LYPA 4HMEA 2WOQA 4XTIA 1S38A 1PCKA 2XDFA 4XIMA 4WDXA 5F2MA 2I16A 3M46A 5M17A 4CD4A 3I10A 5LHFA 3TAKA 1W32A 1W91A 3AMKA 2OMAA 4G2DA 3PZOA 1BGGA 1AFSA 4QS5A 4LRSA 3TXVA 1CW2A 1UUQA 5J5DA 3W83A 3HB9A 3UGRA 5F2GA 4PBGA 2EHHA 5A8QA 1LTDA 5JBFA 3BDKA 2G0WA 1X1NA 4WJ8A 3N4AA 2DZTA 4PODA 2WM1A 5CSSA 1D3CA 4D6DA 5AYBA 4PMDA 3W75A 2GWGA 3PUGA 5DMLA 3VNLA 1EJ7L 1RQBA 2GPTA 4L9ZA 4LY8A 9XIAA 3ARUA 4E5TA 2E0PA 4C1KA 4JN6A 2OLSA 2VFDA 1U33A 4AZ5A 1P0DA 1M5WA 5H8UA 1VRDA 3E96A 6AMEA 1LROA 3GB6A 1IT7A 2HS6A 3QZEA 2Y70A 4LYKA 1E1CB 2HRWA 2QGHA 4JKLA 1GG1A 1LWIA 3LN3A 3XINA 2Z28A 1SJBA 4FI4A 2J9XA 4I5RA 1KBKA 3XISA 1E1CA 1V79A 1GZGA 3M0LA 1KM0A 4B92A 1B9BA 4CU8A 1P7TB 3V7PA 4ZQRA 4I5UA 3TYAA 3P80A 3BLIA 4XQ6A 3NAVA 4U2ZA 1P7TA 2XH0A 1QNRA 3B8TA 4AY1A 2DQXA 1MSIA 1DL3A 4N6FA 1CWYA 1WOAA 3AYTA 3JUGA 1R9XA 3OG2A 1J0HA 4JTCA 3EX4A 5CPOA 2E77A 4FALA 2C14A 4FX6M 1XGDA 2GVGA 4BEUA 1S1RA 1VAHA 1KM3A 2YBUA 2BOFX 2YB4A 2PBGA 1TPWA 3S5YA 3M6YA 3LNPA 4NJHA 3B0PA 2P0OA 3PF3A 3IACA 1FCBA 3HMCA 2A3BA 2YX0A 3WJXA 1NQ6A 5LZLA 2JIEA 4J3TA 2NXGA 2IQDA 4GXMA 3AS3A 4GKTA 1L8PA 3AIUA 4AISA 2DZBA 2TMDA 4HNUA 3B0UX 1DIDA 2BS9A 3B9DA 3L2IA 3CJPA 1QW8A 4FAMA 2YL5A 4RZBA 4O13A 5AHFA 3WBWA 5H1WA 4IMDA 3WF3A 2PDYA 2KX9A 4HSHA 3KHJA 3BAIA 2UV8G 2A3LA 3THDA 1GWJA 3IJ9A 1XG3A 1PX3A 4OBSA 3LRKA 4IUOA 4D8ZA 3TV8A 4NVTA 4WSKA 4XUYA 1W1PA 1HTIA 1A80A 1WDPA 1E70M 4AWEA 2ZZ6A 4C6KA 4MB3A 3ATZA 4M5PA 1W9BM 1DBTA 1E6XM 3OG3A 1VJZA 1Z41A 4XUGA 3VUSA 1KLZA 3E0IA 4AUBA 2PLCA 5FSDC 4DZHA 4KEVA 4JFUA 1SW3A 3MSGA 1VGAA 4K3ZA 1SPQA 3KBSA 3WFLA 4J3VA 4G8TA 3W2NA 1W9VA 3G1FA 3NL5A 1US3A 3WQ8A 1TZZA 1UUOA 5CEWA 2P53A 3W9ZA 3QMSA 4H2CA 2VELA 1QPKA 1D8CA 4JHOA 4W8LA 2PLKA 1XIHA 3A21A 1CLXA 4Q22A 1G69A 2B7OA 3C56A 2J75A 1U30A 3MPGA 4R9OA 2O9PA 4FNUA 4HB7A 3MSDA 2VCCA 4U28A 3F4VA 3W1RA 1W1YA 1QHPA 4EF9A 2QCCA 1A5CA 5GNZA 3MMWA 4AYGA 3IJ7A 4JGDA 1QRQA 3KL0A 3U48A 1KTNA 2EG8A 3TMLA 2ZX9A 3RR4A 1WZLA 1I0BA 3VK5A 3GVVA 5GVJA 1KBLA 4DLFA 2XIMA 3GH7A 3B0VC 3T2PA 1E0UA 1PTDA 4W7WA 1UZ1A 1W1VA 1JYVA 3TKFA 1FKWA 2VX7A 2WM0A 4EPKA 3ZOAA 2WZEA 1FWIC 3B06A 3ZT5A 5I06A 5HUOA 3AROA 5FI8A 1AJZA 2ZWZA 1LOSA 1TV7A 3LPPA 3NVTA 1RAKA 1ZRQA 2XN2A 3FVDA 1QXLA 1KTBA 1I75A 5EKYA 4BFAA 1VIWA 1YXCA 1ISVA 3I65A 3P7YA 1I2RA 4M19A 3GFZA 5M3WA 4ZSUA 3TW9A 4QXIA 1VQTA 4AZCA 1E0TA 5E0CA 1IR2A 4WOQA 1WOBA 3LGEA 3U5YA 2WANA 1OEPA 4S2BA 1UZDA 3BXWA 4LAOA 1O5QA 3WFAA 1UROA 3THUA 4PUNA 1NOWA 3EWDA 3LI1A 2FTYA 4QSHA 3MC5A 4H2HA 3OHMB 4ZOBA 3IIPA 3GC4A 3IJIA 3L12A 4QGCA 3RX2A 2HMCA 1K9EA 2D24A 4H9MA 1YHTA 3WQCA 1VC4A 1P5BA 3OBAA 1KB3A 3TYCA 5G5IA 1M6JA 5H2ZA 2PDFA 2UY3A 3E5BA 4LRTA 1GJWA 2EF9A 2ZX7A 3V5OA 3CV1A 1C3FA 3LPGA 4IMEA 2DIJA 3NYZA 2G41A 4PCPA 4F0MA 1IEWA 4DPPA 2HNEA 4F4RA 3SM0A 3O16A 3TLLA 3OP2A 1WZAA 3WBAA 1OBAA 5CCZA 1ITXA 3NQCA 4QFUA 1ZGDA 3AHZA 3MMTA 1DE6A 4DX3A 1ZTVA 2XVKA 1SQ7A 4IICA 4PMNA 4RE4A 2O9RA 3TC7A 3CEPA 3QY7A 2DVUA 3GNOA 4LPCA 1ZJBA 2W6RA 4MFEA 3T08A 2ZICA 1TWSA 3BICA 4D72A 2WVTA 2ZDSA 3S46A 1QO5A 2R1MA 4K2SA 4I90A 7TIMA 1K77A 4Q4KA 4E6MA 2PP0A 3AJ7A 3C6CA 4ZMGA 4QEHA 4IIHA 2J9ZA 1B4EA 2YGYA 1E71M 4TX6A 3BOXA 3C8FA 3S0CA 1EQPA 1GVYA 3OOQA 3LRMA 2HV5A 3GXDA 3ZVHB 2ZDRA 2A3EA 5DELA 3VIOA 2JEQA 2ALRA 1YDOA 4Z1CA 2J4GA 4L6OA 5I24A 4JFTA 3RXZA 2EG7A 2CZEA 3MP3A 4GNKB 3GDLA 3JZEA 1VLIA 3VIHA 1GW1A 3QKZA 1ONRA 2C79A 3KDNA 3ZZ1A 1EJUC 3AQUA 3TX9A 4H9YA 5I3JA 1D9EA 1OCJA 4Q8PA 1MUCA 1UWAA 5FSEC 5AHLA 4JEJA 5AHNA 1EJTC 3VZXA 3PK7A 1OSEA 1G9HA 2HJPA 3RHGA 3M7WA 2OVLA 4ACYA 4ZE5A 3LGGA 2QCEA 4IPLA 1S39A 2E8ZA 3REQB 1NFGA 3H7UA 4Y9NA 3TXZA 1Q13A 3TK7A 3REQA 3UVIA 4BF7A 1LRTA 1B3WA 1UYQA 2J7DA 3GH4A 3G18A 4ZQCA 3PAJA 4XAYA 1FWTA 2IKHA 3WENA 4XZBA 3CUGA 2YBVA 2NUXA 4RK8A 1A3XA 4W8BA 4RZ4A 3MJMA 1UC5A 5TIMA 2GZXA 2PDLA 5ABFB 4J3SA 3WNLA 4E38A 4OV4A 1ALDA 3MSIA 2VEGA 5HNRA 2AL2B 1Z32X 1Z44A 4XV0A 3MUAA 4YWIA 2AL2A 3KP0A 3UNDA 3L67A 3E2VA 1NARA 1WXYA 4EAMA 2YDQA 3EXSA 2Z1KA 2AAAA 4F2BA 5A8GA 3CO4A 2BNJA 1SW0A 5CC3A 4UFLA 3W7PA 4A3QA 4FHAA 2Y8VA 4B5TA 4RNJA 3T6CA 1E56A 5G2WA 1Y65A 1O94A 5A8OA 3EXTA 5A2CA 3POCA 3W23A 1PYFA 2OXNA 1UPPA 1ZS2A 5T9CE 3CMJA 3OBKA 2ZX6A 1V0NA 4AD1A 4O8RA 4P7QA 5IM51 3A6OA 3DG6A 4DXVA 2P3ZA 3RO8A 4WRHA 3ARSA 4D6FA 2ZZ7A 5I3DA 4NX0A 3V3WA 1R2TA 1NWTA 1TYGA 1PYMA 3MUZ1 3AXXA 1M7XA 4HCDA 4GBDA 3MSYA 1ODZA 4I6VA 2ZADA 3GC2A 3UR2A 5HANA 3KBWA 1BXCA 5D33A 3AICA 3V1PA 3PTKA 2WO5A 3NZGA 7ODCA 4D71A 1R38A 1F3EA 3KE0A 3LSBA 1ADSA 3IJ8A 5EMLA 1PVNA 3RNDA 1W3NA 4L6HA 2WJEA 2C1IA 2VCAA 1I1WA 2VM8A 3RRXA 2PDPA 2YFNA 5K4XA 3OPSA 3PTDA 4Y9AA 1WDDA 3V75A 1EJRC 4J2PA 2RH9A 1ME8A 1LBLA 4UMCA 1S3HA 4JTDA 4NKCA 3VC5A 1RY8A 1QI5A 1AQHA 5I3GA 1BYBA 3O7UA 4PMYA 2A6LA 3EEGA 3EX6A