1VLSA

Ligand binding domain of the wild-type aspartate receptor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
146
structure length
146
Chain Sequence
b'MNQQGFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE RECEPTOR
publication title High-resolution structures of the ligand binding domain of the wild-type bacterial aspartate receptor.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chemotaxis
total genus 54
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 1996-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1vlsA00
1JMWA 1VLTA 1WASA 2ASRA 2D4UA 2LIGA 4Z9JA 1VLSA 3T9OA 1WATA 4Z9IA 3ATPA 4H54A 4Z9HA 1LIHA
chains in the Genus database with same CATH superfamily
1CPQA 4YT5A 5E3AA 2HMQA 1NFNA 3HNLA 1YJGA 5TJ5E 3VRCA 5L0GA 2YRFA 4NTBA 2EILC 4OD5A 5JS5A 1LM3B 4CIHA 3O39A 4DJ9A 4XLNF 1Q0GA 4MTFA 4LDQA 1ZU5A 3QTHA 1Z7Qc 5GPGB 4IRUA 2LP4A 5L0IA 3RVYA 2PFDA 2I8BA 3K33A 1VK5A 2BC5A 3GORA 2JX0A 1JMWA 1C03A 4BJ5C 2ICWG 2QUPA 3GEHA 2P0NA 1M57C 3GM1A 4U5BE 4C3BA 3PHF2 2EPKX 2QE9A 3EHNA 4YL1A 4CS9A 3W2VA 1F1MA 3WODF 4YT2A 3K1IA 3CAXA 5FCLA 4NY3A 3S84A 3A11A 3L8IA 4IARA 5BQGA 4KNVA 2L9JA 4A2NB 4JIOA 1OCZC 2IXOA 1YZAA 2OEXA 5BUOA 3FAPB 4CIPA 3ZQYA 3AGTA 3UMHA 3S27A 4NCQA 5F5FA 1FR0A 3Q6MA 3QVZA 1ZHXA 1ZHTA 2CNWA 3JRMO 3UR3C 2A0UA 4RBNA 1ZZPA 1ORSC 2XLMA 3NYJA 4MQ9F 4MW8A 3VF0A 1BR4A 2YLGA 4ONSA 1ZHZA 4PACA 3U2MA 1YA7O 2XXAB 2UUHA 3IPMO 2XXAA 3NDBB 2AWCA 2J0WA 3W2WA 5A6BA 3FMSA 3RW0A 4XEFA 5B3IA 2IYLD 3KYJA 1AVOB 2EIKC 1S7ZA 3JSEO 3AQBA 3B0PA 2EPMX 3HLZA 4Z9HA 1HMOA 1RKEB 4CS7A 5DS4A 1M2VB 2E87A 1RKEA 2Z15A 3EH2A 4JCZA 4MW3A 5CIVA 2G3KA 3JT1A 1R4TA 3G4ZA 2XRHA 3HKKA 3QW1A 5JLIA 1IW7F 1YLMA 3G50A 5L0DA 1U89A 1I5NA 4PJNA 3AOUA 5L3VA 4OINF 4ANJA 4LLEA 1ORJA 4PJMA 1SF8A 3RFYA 3U3BA 4CDVA 3K7DA 2XLEA 1WTYA 3ASNC 1Z3IX 2J9VA 2J46A 2LQGA 4MVUA 4YK5A 2XS1A 4RDAA 2L6FA 3ASOC 3U8PA 1BZ4A 1O3UA 4BJ6A 3JYYA 1A0BA 3K1HA 3F46A 3IQ5A 2Y3DA 1S05A 2FFHA 2J7PA 4O6NA 1Z5ZA 2A0BA 4X0RA 2HZ8A 2ZXRA 4YT4A 1FNTc 3EHMA 3MFNA 3AQCA 1WOLA 3DXJF 3E9VA 4GYTA 1QLEC 4N6CA 3ZC4A 2R7OA 3POVA 3OEOA 1NG1A 2VCAA 3AG1C 4LDRA 1VYKA 3MX3A 2R7WA 3DAFA 5FZTA 2I15A 4MNDA 2P61A 2EPLX 4XPWA 5JVEA 2L81A 2IBFA 2MYSA 1QKRA 3JTLO 3LNMB 2R25A 1J8MF 1LE4A 2M4EA 4L6RA 5AC5A 1E2XA 3NRHA 5DQTA 2PBEA 1DOVA 4OIRF 3IQ6A 2W45A 3C18A 4R32A 3RH3A 5KYUB 5KYUA 4YL3A 2V3CC 256BA 3LJBA 4XEVA 2NPUA 1B68A 1RJ9B 1U6HA 1RJ9A 5COFA 1OXBA 5E2QA 3UGOA 4JZAA 1WASA 3UNGC 4XEKA 4KBLA 3HJCA 5BQIA 2A1DD 5L0CA 2W9YA 3WHNA 1OR2A 2Y3GA 1XZQA 2W4MA 3PCVA 2ASRA 2LFDA 4CS9C 4IB4A 2HJ3A 2KC3A 2KK1A 3K1IC 2M64A 3GM3A 1YVIA 3V5YA 2Y69C 3T4RA 4JC7A 4CSAA 1LVKA 2KJGA 2TMVP 3EPVA 2PNOA 4GQHA 4JEAA 2NSFA 3VM6A 2CNWD 2HKVA 1QQ3A 2Y39A 3BEHA 3LLKA 1ZHWA 2X51A 3FOOA 4ULVA 2J45A 1H9GA 1Y4CA 2IXPA 2YLIA 3C8ZA 1HMDA 1TWAA 1GQAA 1NSGB 2G62A 3KH2A 4DXWA 2R7UA 2V26A 3LLIA 1C02A 4PFOA 3AG3C 2WL8A 4PJLA 5A6BD 1I4ZA 4H54A 5IY5C 3FOPA 1J8YF 3M1CB 3SZRA 4OD4A 4DRIB 1EKYA 2QTVA 2ZPAA 3L8JA 1YA9A 1AEPA 1YZCA 2XLWA 4N4WA 4MS2A 1E83A 2LD6A 5COMA 1HY5A 1HW1A 3SYNA 5AC4A 3C8GA 4AK9A 4AL0A 1JRAA 2XL6A 4DBRA 1SR2A 2Q4FA 3VYWA 2X0CA 4E18A 1E85A 3M4BA 4EUKB 4NTAA 3ABMC 3B71A 1Q0FA 3US6A 5DVWA 2KYHA 3U3FA 4EBJA 1D1CA 2LFFA 3ZTZA 3HNJA 4Z9JA 4Z9IA 4XTKA 3MBGA 3OA1A 2Q9CA 2H7OA 4MVRA 2R7QA 3IEEA 2IXNA 2L6HA 1FFTC 1LPEA 1BR1A 1QVXA 3TQOA 5A6JA 3HNKA 4BJ6C 2B0JA 5JUAA 4J7TA 4CDYA 4EBKA 4MVSA 4ER9A 2J0XA 2OU6A 4MVQA 4K1OA 3S28A 5DS5A 4KC9A 1K04A 3CZ6A 2HMZA 2KW3C 1D0ZA 4MTGA 2YL1A 4DRJB 1D0XA 4LERA 2H8AA 1LS4A 2ZXPA 3JZ0A 4JE9A 1BR2A 4D4XA 2G3VA 1EQ1A 4CBEA 1MMAA 1OQCA 3DAGA 2DGJA 3EGDB 4NQFA 1APCA 2EIJC 1QZXA 1T6UA 1LS1A 2J8WA 3I5QA 3HNIA 3IHUA 4U5EE 3U5SA 2OG2A 3SXMA 4UDVA 2YL7A 3AJMA 5K0IA 1XZPA 1TR2A 3L1MA 1MNEA 2WZFA 3FAJA 4N06A 3U8VA 2RD9A 1Z63A 1SYQA 5KYYB 4C7OA 2L7AA 1M2VA 2CYDA 1YYXA 2L6GA 4D4NA 1VOMA 3QW0A 2R7VA 4I44A 2DI3A 2MWQA 1O5HA 2AWYA 4CS8A 3RKOF 5A6KA 1I4YA 2XLDA 3ZWIA 2EPOA 2GDCA 3KMIA 4ZLDA 4G0HA 4I1OB 1KNYA 1Q0DA 4EKWA 4XWJA 2NG1A 3GM2A 3EFOB 1A7DA 3QVYA 5JP7A 3RYLA 2PX3A 4J30B 2AU5A 2UUIA 2WB7A 3WG7C 1D1BA 1EI7A 1ORYA 2YWAA 3DM5A 3FVYA 4CSAC 3UMIA 3SNHA 5E3CA 5EGYA 4BJTA 2YEVA 3R7CA 4AX2A 3LNRA 5T3WA 1Z6AA 1G4WR 1LE2A 4LDKA 2NSGA 3LAYA 2HSBA 5JRAA 2NUPB 1FFHA 4G78A 4ZLCA 1VYIA 4FX5A 4JURI 4QI0A 2Y3BA 3I4UA 5KYWB 2P1AA 2R7TA 3KYIA 1ZW3A 3NYLA 3DM9B 3V7OA 1FAPB 3ABKC 1N1CA 3S9OA 3H65A 4JW1A 5KYNA 3SXYA 1FTSA 1JPNA 3CSKA 1ZW2A 3TULA 2OEVA 1YAUO 4ULWA 1LI5A 3DZAA 1YARO 3G4XA 3RIPA 3K66A 4BEJA 1CPRA 1TFOB 2JPUA 3AG4C 3GANA 3O10A 3C7JA 3C8GD 3DWWA 4N6HA 1OKKA 2ZXWC 2VB6A 3AGUA 5HSWA 1M6TA 2GAQA 1JOGA 2OOCA 3ZTMA 1IZMA 2IM8A 1NZEA 3E70C 4AL1A 3DE9A 1MMGA 1T6QA 3W8IA 3N24A 3I5PA 5A69A 2EPNA 1MMDA 4NTFA 4PK4A 4U9EA 3DD7A 5JSLA 4C3EA 4EBBA 2ZXOA 4A4AA 2A6HF 2Q00A 2H7VC 3ATPA 1LKXA 2ZD9A 3L0IA 3M79A 1M56C 4O6MA 3V5ZA 3ZVRA 4E0IA 5L3QA 1NLXA 3R2PA 2OCCC 3F47A 3T6GB 2AP3A 1V74B 3ZQVA 3PDMP 4WABA 3N0TA 1WWPA 4IGGA 1LI7A 3Q6NA 2XLVA 1JPJA 1T9KA 4OIQF 2EINC 4B6IA 2XL8A 3X2QC 4BEMJ 1VTMP 1A7EA 3IQTA 3L34A 1G8XA 1H9TA 4C7OB 5EHHA 3LESA 1Q0KA 4JEBA 3T6JA 4DOZA 3O55A 2PP4A 1PCXA 3JRTA 3NKEA 2JD3A 1RXQA 2NUTB 2Q3TA 3B29A 1HE9A 2R05A 4Q5SF 3LEVA 4YN0B 1OCCC 2KSFA 3GEIA 3S29A 5B3SC 1G4US 5E33A 1XWJA 4U5FE 2VASA 2BE5F 2OJED 4FWVA 4P9TA 4YT8A 3NKDA 3S0XA 3FXHA 4XPXA 4JKVA 3NYMA 3RQEA 4CJGA 4CS8C 1FMVA 2QLAA 3OWTA 4Q7CA 3RVZA 2J9UA 4K0DA 2HV7A 3JCUQ 2DYRC 3B9QA 3TJ6A 3DE8A 3N2ZB 2BL2A 3Q7GA 5KYXB 1FMWA 3MLGA 3GWNA 3UMKA 1WGWA 4P6IC 2DYSC 2YKZA 2A6EF 1K40A 2R9RB 2W4BA 2OKUA 4I1MA 3QZCA 3TOLA 2XM0A 4MTOA 4FAPB 2P6VA 4IWBA 4EHPA 3SXKA 4AE4B 4G7OF 1C17M 4AE4A 5D92A 4HE8D 1K05A 1CGOA 2VCCA 4LLCA 2CCYA 4PJJA 4KI2A 3V5XA 2YL0A 3RF3A 3U2LA 3Q7LA 2J7PD 4M63A 4PFPA 2PX0A 1RCPA 1OW8A 1Z23A 1ZU4A 3CQZA 3LS0A 3MYIA 5CI8A 4GEHA 5DQZA 1D1AA 3RQFA 4IAQA 2YZSA 1TFKB 3AG2C 4IJJA 2RSEB 3SXZA 1T01A 1VMAA 4F4BA 3EQLF 4U5DE 1V55C 3C62A 2Y3HA 2WZGA 4LACB 2LCHA 5EK0A 3M4CA 2FGYA 3T6BA 4NC3A 1RMVA 2J9WA 2LSEA 1BBHA 1MNDA 4DRHB 1OKKD 2XLHA 5A6AA 3EGDA 3W8HA 3IQCA 2B0HA 4I3MA 3GEEA 4JJFA 5CI9A 3DJNB 3LUTB 2XSEA 3EZHA 2HFIA 2PF4E 4CDAA 3LEOA 3TJ5A 2HUJA 5T3TA 4YWQA 2FAPB 4G7HF 1KTMA 5KYYA 2GFHA 2IOQA 1L7CA 3GODA 3CEXA 3WAQA 1EA8A 3X1OA 4O6YA 1TWGA 2P7VA 4YJWA 1UG7A 4BPMA 1SMYF 1AUEA 1MQVA 2F22A 4JJGA 4EIYA 1SZIA 1G5ZA 3KPHA 2D5RB 3EFOA 5F5HA 1PD1A 1QPUA 1CGNA 1YYJA 2YLDA 1VB5A 2DB4A 4XQ1A 2VH3A 1W2WA 3ZIBA 1TWCA 4DVYP 3DKAA 3EGXB 2C03A 4XPYA 1D0YA 3EGXA 2ETSA 2HS5A 1Y6DA 1JR8A 1ST6A 3JYHA 5L0JA 1HW2A 1NU7D 1CGME 2XLOA 5T1DB 2NUPA 4W8KA 1OCOC 4K7BA 1WATA 4W8PA 5KYWA 3PMRA 1M2OA 2Q9BA 2A68F 4P9FA 2R7RA 2WVQA 1H6GA 4MVOA 2GA0A 4XLPF 4JTDB 5B1BC 3FDQA 2YL3A 1ZHYA 3KL4A 1WN0A 4RD9A 3TD7A 2H7BA 3NG1A 3BRJA 3ECSA 1HE1A 4BJ5A 2R7SA 5DS6A 3TK0A 3EJNA 2HSQA 4MVZA 3NMIA 4MVMA 3ITFA 4JVSA 2OJQA 4U5GA 5DLJA 2O9XA 5BQHA 5L0FA 2Q9AA 1NFOA 2WZLA 3ZSUA 4QDLA 4DBQA 1NU9C 1KU2A 2R03A 4BG0A 4HEAJ 2HJMA 1A41A 2YQYA 4O79A 2KGOA 2IXMA 2AVKA 2XM4A 2CGEA 3T9OA 4G7ZF 4BJ1A 1MMNA 3B0VC 4CX9A 3O6XA 4HFFB 4JRZA 1OR3A 1VLTA 1YDIA 3EZIA 4CJOA 1BDJB 2Q7RA 3ABLC 4Q4ZF 3MYFA 3LS1A 3U9MA 5HV9A 4U9DA 1PV3A 3U9JA 3DI5A 4IAOA 1GGQA 1LIHA 2CW0F 3NMKA 1JAFA 2HV6A 2KQ9A 2YHSA 3EH1A 3K6BA 2MHRA 4QI2A 1ZVZA 4WJ0A 1GM5A 4OIOF 1QSPA 2WVNA 3VAYA 4FESA 1OXKA 2OQMA 1A7VA 2XS8A 3DJUB 3ZG1A 3J06A 4U5HA 3SEOA 4E17A 4YL0A 1GS9A 3A9CA 1ZYRF 2VC9A 3U0CA 2EIMC 4KNWA 3UGPA 3EG9B 2NUTA 1O87A 1OCRC 3EG9A 1T6IA 3RQGA 3QMKA 1DOWA 1R5ID 1OW6A 1VLSA 4JTAB 4JTCB 1H7IA 3B0UX 2J9BA 1V54C 4U5CE 5L0HA 3DMDA 5JT4A 2D4UA 1V4AA 5AGFA 1Q0MA 2A69F 4J32B 1TWHA 2KNHA 4C3DA 3W4YA 4EWCA 5B1AC 3JSZA 3ZDLA 3NMJA 1RKCA 3M15A 4J7YA 3KKBA 3H2VA 1TQGA 1TKNA 2QNLA 1OW7A 2VCBA 1L3PA 2C04A 4H4KC 5COGA 2YVKA 3HTKC 2CDQA 5KYXA 1NBBA 4O7GA 4WGYA 1E86A 1UFBA 4JCHA 3FHDA 1T5OA 2XL4A 3GWLA 3SP1A 3H2UA 4PR9A 2LK4A 5D91A 4HFKB 5F28E 3TOMA 4OIPF 1PD0A 2LIGA 2GWWA 2R02A 2WVOA 3C63A 1U0BB 2R7XA 2QY9A 4E0HA 4WGZA 4E7SA 3S90A 3C8GB 4E7ZA 4DVZA 1E84A
chains in the Genus database with same CATH topology
1JMWA 1VLTA 1WASA 2ASRA 2D4UA 2LIGA 4Z9JA 1VLSA 3T9OA 1WATA 4Z9IA 3ATPA 4H54A 4Z9HA 1LIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMW A;  1VLT A;  1WAS A;  2ASR A;  2D4U A;  2LIG A;  4Z9J A;  1VLS A;  3T9O A;  1WAT A;  4Z9I A;  3ATP A;  4H54 A;  4Z9H A;  1LIH A; 
#chains in the Genus database with same CATH topology
 1CPQ A;  4YT5 A;  5E3A A;  2HMQ A;  1NFN A;  3HNL A;  1YJG A;  5TJ5 E;  3VRC A;  5L0G A;  2YRF A;  4NTB A;  2EIL C;  4OD5 A;  5JS5 A;  1LM3 B;  4CIH A;  3O39 A;  4DJ9 A;  4XLN F;  1Q0G A;  4MTF A;  4LDQ A;  1ZU5 A;  3QTH A;  1Z7Q c;  5GPG B;  4IRU A;  2LP4 A;  5L0I A;  3RVY A;  2PFD A;  2I8B A;  3K33 A;  1VK5 A;  2BC5 A;  3GOR A;  2JX0 A;  1JMW A;  1C03 A;  4BJ5 C;  2ICW G;  2QUP A;  3GEH A;  2P0N A;  1M57 C;  3GM1 A;  4U5B E;  4C3B A;  3PHF 2;  2EPK X;  2QE9 A;  3EHN A;  4YL1 A;  4CS9 A;  3W2V A;  1F1M A;  3WOD F;  4YT2 A;  3K1I A;  3CAX A;  5FCL A;  4NY3 A;  3S84 A;  3A11 A;  3L8I A;  4IAR A;  5BQG A;  4KNV A;  2L9J A;  4A2N B;  4JIO A;  1OCZ C;  2IXO A;  1YZA A;  2OEX A;  5BUO A;  3FAP B;  4CIP A;  3ZQY A;  3AGT A;  3UMH A;  3S27 A;  4NCQ A;  5F5F A;  1FR0 A;  3Q6M A;  3QVZ A;  1ZHX A;  1ZHT A;  2CNW A;  3JRM O;  3UR3 C;  2A0U A;  4RBN A;  1ZZP A;  1ORS C;  2XLM A;  3NYJ A;  4MQ9 F;  4MW8 A;  3VF0 A;  1BR4 A;  2YLG A;  4ONS A;  1ZHZ A;  4PAC A;  3U2M A;  1YA7 O;  2XXA B;  2UUH A;  3IPM O;  2XXA A;  3NDB B;  2AWC A;  2J0W A;  3W2W A;  5A6B A;  3FMS A;  3RW0 A;  4XEF A;  5B3I A;  2IYL D;  3KYJ A;  1AVO B;  2EIK C;  1S7Z A;  3JSE O;  3AQB A;  3B0P A;  2EPM X;  3HLZ A;  4Z9H A;  1HMO A;  1RKE B;  4CS7 A;  5DS4 A;  1M2V B;  2E87 A;  1RKE A;  2Z15 A;  3EH2 A;  4JCZ A;  4MW3 A;  5CIV A;  2G3K A;  3JT1 A;  1R4T A;  3G4Z A;  2XRH A;  3HKK A;  3QW1 A;  5JLI A;  1IW7 F;  1YLM A;  3G50 A;  5L0D A;  1U89 A;  1I5N A;  4PJN A;  3AOU A;  5L3V A;  4OIN F;  4ANJ A;  4LLE A;  1ORJ A;  4PJM A;  1SF8 A;  3RFY A;  3U3B A;  4CDV A;  3K7D A;  2XLE A;  1WTY A;  3ASN C;  1Z3I X;  2J9V A;  2J46 A;  2LQG A;  4MVU A;  4YK5 A;  2XS1 A;  4RDA A;  2L6F A;  3ASO C;  3U8P A;  1BZ4 A;  1O3U A;  4BJ6 A;  3JYY A;  1A0B A;  3K1H A;  3F46 A;  3IQ5 A;  2Y3D A;  1S05 A;  2FFH A;  2J7P A;  4O6N A;  1Z5Z A;  2A0B A;  4X0R A;  2HZ8 A;  2ZXR A;  4YT4 A;  1FNT c;  3EHM A;  3MFN A;  3AQC A;  1WOL A;  3DXJ F;  3E9V A;  4GYT A;  1QLE C;  4N6C A;  3ZC4 A;  2R7O A;  3POV A;  3OEO A;  1NG1 A;  2VCA A;  3AG1 C;  4LDR A;  1VYK A;  3MX3 A;  2R7W A;  3DAF A;  5FZT A;  2I15 A;  4MND A;  2P61 A;  2EPL X;  4XPW A;  5JVE A;  2L81 A;  2IBF A;  2MYS A;  1QKR A;  3JTL O;  3LNM B;  2R25 A;  1J8M F;  1LE4 A;  2M4E A;  4L6R A;  5AC5 A;  1E2X A;  3NRH A;  5DQT A;  2PBE A;  1DOV A;  4OIR F;  3IQ6 A;  2W45 A;  3C18 A;  4R32 A;  3RH3 A;  5KYU B;  5KYU A;  4YL3 A;  2V3C C;  256B A;  3LJB A;  4XEV A;  2NPU A;  1B68 A;  1RJ9 B;  1U6H A;  1RJ9 A;  5COF A;  1OXB A;  5E2Q A;  3UGO A;  4JZA A;  1WAS A;  3UNG C;  4XEK A;  4KBL A;  3HJC A;  5BQI A;  2A1D D;  5L0C A;  2W9Y A;  3WHN A;  1OR2 A;  2Y3G A;  1XZQ A;  2W4M A;  3PCV A;  2ASR A;  2LFD A;  4CS9 C;  4IB4 A;  2HJ3 A;  2KC3 A;  2KK1 A;  3K1I C;  2M64 A;  3GM3 A;  1YVI A;  3V5Y A;  2Y69 C;  3T4R A;  4JC7 A;  4CSA A;  1LVK A;  2KJG A;  2TMV P;  3EPV A;  2PNO A;  4GQH A;  4JEA A;  2NSF A;  3VM6 A;  2CNW D;  2HKV A;  1QQ3 A;  2Y39 A;  3BEH A;  3LLK A;  1ZHW A;  2X51 A;  3FOO A;  4ULV A;  2J45 A;  1H9G A;  1Y4C A;  2IXP A;  2YLI A;  3C8Z A;  1HMD A;  1TWA A;  1GQA A;  1NSG B;  2G62 A;  3KH2 A;  4DXW A;  2R7U A;  2V26 A;  3LLI A;  1C02 A;  4PFO A;  3AG3 C;  2WL8 A;  4PJL A;  5A6B D;  1I4Z A;  4H54 A;  5IY5 C;  3FOP A;  1J8Y F;  3M1C B;  3SZR A;  4OD4 A;  4DRI B;  1EKY A;  2QTV A;  2ZPA A;  3L8J A;  1YA9 A;  1AEP A;  1YZC A;  2XLW A;  4N4W A;  4MS2 A;  1E83 A;  2LD6 A;  5COM A;  1HY5 A;  1HW1 A;  3SYN A;  5AC4 A;  3C8G A;  4AK9 A;  4AL0 A;  1JRA A;  2XL6 A;  4DBR A;  1SR2 A;  2Q4F A;  3VYW A;  2X0C A;  4E18 A;  1E85 A;  3M4B A;  4EUK B;  4NTA A;  3ABM C;  3B71 A;  1Q0F A;  3US6 A;  5DVW A;  2KYH A;  3U3F A;  4EBJ A;  1D1C A;  2LFF A;  3ZTZ A;  3HNJ A;  4Z9J A;  4Z9I A;  4XTK A;  3MBG A;  3OA1 A;  2Q9C A;  2H7O A;  4MVR A;  2R7Q A;  3IEE A;  2IXN A;  2L6H A;  1FFT C;  1LPE A;  1BR1 A;  1QVX A;  3TQO A;  5A6J A;  3HNK A;  4BJ6 C;  2B0J A;  5JUA A;  4J7T A;  4CDY A;  4EBK A;  4MVS A;  4ER9 A;  2J0X A;  2OU6 A;  4MVQ A;  4K1O A;  3S28 A;  5DS5 A;  4KC9 A;  1K04 A;  3CZ6 A;  2HMZ A;  2KW3 C;  1D0Z A;  4MTG A;  2YL1 A;  4DRJ B;  1D0X A;  4LER A;  2H8A A;  1LS4 A;  2ZXP A;  3JZ0 A;  4JE9 A;  1BR2 A;  4D4X A;  2G3V A;  1EQ1 A;  4CBE A;  1MMA A;  1OQC A;  3DAG A;  2DGJ A;  3EGD B;  4NQF A;  1APC A;  2EIJ C;  1QZX A;  1T6U A;  1LS1 A;  2J8W A;  3I5Q A;  3HNI A;  3IHU A;  4U5E E;  3U5S A;  2OG2 A;  3SXM A;  4UDV A;  2YL7 A;  3AJM A;  5K0I A;  1XZP A;  1TR2 A;  3L1M A;  1MNE A;  2WZF A;  3FAJ A;  4N06 A;  3U8V A;  2RD9 A;  1Z63 A;  1SYQ A;  5KYY B;  4C7O A;  2L7A A;  1M2V A;  2CYD A;  1YYX A;  2L6G A;  4D4N A;  1VOM A;  3QW0 A;  2R7V A;  4I44 A;  2DI3 A;  2MWQ A;  1O5H A;  2AWY A;  4CS8 A;  3RKO F;  5A6K A;  1I4Y A;  2XLD A;  3ZWI A;  2EPO A;  2GDC A;  3KMI A;  4ZLD A;  4G0H A;  4I1O B;  1KNY A;  1Q0D A;  4EKW A;  4XWJ A;  2NG1 A;  3GM2 A;  3EFO B;  1A7D A;  3QVY A;  5JP7 A;  3RYL A;  2PX3 A;  4J30 B;  2AU5 A;  2UUI A;  2WB7 A;  3WG7 C;  1D1B A;  1EI7 A;  1ORY A;  2YWA A;  3DM5 A;  3FVY A;  4CSA C;  3UMI A;  3SNH A;  5E3C A;  5EGY A;  4BJT A;  2YEV A;  3R7C A;  4AX2 A;  3LNR A;  5T3W A;  1Z6A A;  1G4W R;  1LE2 A;  4LDK A;  2NSG A;  3LAY A;  2HSB A;  5JRA A;  2NUP B;  1FFH A;  4G78 A;  4ZLC A;  1VYI A;  4FX5 A;  4JUR I;  4QI0 A;  2Y3B A;  3I4U A;  5KYW B;  2P1A A;  2R7T A;  3KYI A;  1ZW3 A;  3NYL A;  3DM9 B;  3V7O A;  1FAP B;  3ABK C;  1N1C A;  3S9O A;  3H65 A;  4JW1 A;  5KYN A;  3SXY A;  1FTS A;  1JPN A;  3CSK A;  1ZW2 A;  3TUL A;  2OEV A;  1YAU O;  4ULW A;  1LI5 A;  3DZA A;  1YAR O;  3G4X A;  3RIP A;  3K66 A;  4BEJ A;  1CPR A;  1TFO B;  2JPU A;  3AG4 C;  3GAN A;  3O10 A;  3C7J A;  3C8G D;  3DWW A;  4N6H A;  1OKK A;  2ZXW C;  2VB6 A;  3AGU A;  5HSW A;  1M6T A;  2GAQ A;  1JOG A;  2OOC A;  3ZTM A;  1IZM A;  2IM8 A;  1NZE A;  3E70 C;  4AL1 A;  3DE9 A;  1MMG A;  1T6Q A;  3W8I A;  3N24 A;  3I5P A;  5A69 A;  2EPN A;  1MMD A;  4NTF A;  4PK4 A;  4U9E A;  3DD7 A;  5JSL A;  4C3E A;  4EBB A;  2ZXO A;  4A4A A;  2A6H F;  2Q00 A;  2H7V C;  3ATP A;  1LKX A;  2ZD9 A;  3L0I A;  3M79 A;  1M56 C;  4O6M A;  3V5Z A;  3ZVR A;  4E0I A;  5L3Q A;  1NLX A;  3R2P A;  2OCC C;  3F47 A;  3T6G B;  2AP3 A;  1V74 B;  3ZQV A;  3PDM P;  4WAB A;  3N0T A;  1WWP A;  4IGG A;  1LI7 A;  3Q6N A;  2XLV A;  1JPJ A;  1T9K A;  4OIQ F;  2EIN C;  4B6I A;  2XL8 A;  3X2Q C;  4BEM J;  1VTM P;  1A7E A;  3IQT A;  3L34 A;  1G8X A;  1H9T A;  4C7O B;  5EHH A;  3LES A;  1Q0K A;  4JEB A;  3T6J A;  4DOZ A;  3O55 A;  2PP4 A;  1PCX A;  3JRT A;  3NKE A;  2JD3 A;  1RXQ A;  2NUT B;  2Q3T A;  3B29 A;  1HE9 A;  2R05 A;  4Q5S F;  3LEV A;  4YN0 B;  1OCC C;  2KSF A;  3GEI A;  3S29 A;  5B3S C;  1G4U S;  5E33 A;  1XWJ A;  4U5F E;  2VAS A;  2BE5 F;  2OJE D;  4FWV A;  4P9T A;  4YT8 A;  3NKD A;  3S0X A;  3FXH A;  4XPX A;  4JKV A;  3NYM A;  3RQE A;  4CJG A;  4CS8 C;  1FMV A;  2QLA A;  3OWT A;  4Q7C A;  3RVZ A;  2J9U A;  4K0D A;  2HV7 A;  3JCU Q;  2DYR C;  3B9Q A;  3TJ6 A;  3DE8 A;  3N2Z B;  2BL2 A;  3Q7G A;  5KYX B;  1FMW A;  3MLG A;  3GWN A;  3UMK A;  1WGW A;  4P6I C;  2DYS C;  2YKZ A;  2A6E F;  1K40 A;  2R9R B;  2W4B A;  2OKU A;  4I1M A;  3QZC A;  3TOL A;  2XM0 A;  4MTO A;  4FAP B;  2P6V A;  4IWB A;  4EHP A;  3SXK A;  4AE4 B;  4G7O F;  1C17 M;  4AE4 A;  5D92 A;  4HE8 D;  1K05 A;  1CGO A;  2VCC A;  4LLC A;  2CCY A;  4PJJ A;  4KI2 A;  3V5X A;  2YL0 A;  3RF3 A;  3U2L A;  3Q7L A;  2J7P D;  4M63 A;  4PFP A;  2PX0 A;  1RCP A;  1OW8 A;  1Z23 A;  1ZU4 A;  3CQZ A;  3LS0 A;  3MYI A;  5CI8 A;  4GEH A;  5DQZ A;  1D1A A;  3RQF A;  4IAQ A;  2YZS A;  1TFK B;  3AG2 C;  4IJJ A;  2RSE B;  3SXZ A;  1T01 A;  1VMA A;  4F4B A;  3EQL F;  4U5D E;  1V55 C;  3C62 A;  2Y3H A;  2WZG A;  4LAC B;  2LCH A;  5EK0 A;  3M4C A;  2FGY A;  3T6B A;  4NC3 A;  1RMV A;  2J9W A;  2LSE A;  1BBH A;  1MND A;  4DRH B;  1OKK D;  2XLH A;  5A6A A;  3EGD A;  3W8H A;  3IQC A;  2B0H A;  4I3M A;  3GEE A;  4JJF A;  5CI9 A;  3DJN B;  3LUT B;  2XSE A;  3EZH A;  2HFI A;  2PF4 E;  4CDA A;  3LEO A;  3TJ5 A;  2HUJ A;  5T3T A;  4YWQ A;  2FAP B;  4G7H F;  1KTM A;  5KYY A;  2GFH A;  2IOQ A;  1L7C A;  3GOD A;  3CEX A;  3WAQ A;  1EA8 A;  3X1O A;  4O6Y A;  1TWG A;  2P7V A;  4YJW A;  1UG7 A;  4BPM A;  1SMY F;  1AUE A;  1MQV A;  2F22 A;  4JJG A;  4EIY A;  1SZI A;  1G5Z A;  3KPH A;  2D5R B;  3EFO A;  5F5H A;  1PD1 A;  1QPU A;  1CGN A;  1YYJ A;  2YLD A;  1VB5 A;  2DB4 A;  4XQ1 A;  2VH3 A;  1W2W A;  3ZIB A;  1TWC A;  4DVY P;  3DKA A;  3EGX B;  2C03 A;  4XPY A;  1D0Y A;  3EGX A;  2ETS A;  2HS5 A;  1Y6D A;  1JR8 A;  1ST6 A;  3JYH A;  5L0J A;  1HW2 A;  1NU7 D;  1CGM E;  2XLO A;  5T1D B;  2NUP A;  4W8K A;  1OCO C;  4K7B A;  1WAT A;  4W8P A;  5KYW A;  3PMR A;  1M2O A;  2Q9B A;  2A68 F;  4P9F A;  2R7R A;  2WVQ A;  1H6G A;  4MVO A;  2GA0 A;  4XLP F;  4JTD B;  5B1B C;  3FDQ A;  2YL3 A;  1ZHY A;  3KL4 A;  1WN0 A;  4RD9 A;  3TD7 A;  2H7B A;  3NG1 A;  3BRJ A;  3ECS A;  1HE1 A;  4BJ5 A;  2R7S A;  5DS6 A;  3TK0 A;  3EJN A;  2HSQ A;  4MVZ A;  3NMI A;  4MVM A;  3ITF A;  4JVS A;  2OJQ A;  4U5G A;  5DLJ A;  2O9X A;  5BQH A;  5L0F A;  2Q9A A;  1NFO A;  2WZL A;  3ZSU A;  4QDL A;  4DBQ A;  1NU9 C;  1KU2 A;  2R03 A;  4BG0 A;  4HEA J;  2HJM A;  1A41 A;  2YQY A;  4O79 A;  2KGO A;  2IXM A;  2AVK A;  2XM4 A;  2CGE A;  3T9O A;  4G7Z F;  4BJ1 A;  1MMN A;  3B0V C;  4CX9 A;  3O6X A;  4HFF B;  4JRZ A;  1OR3 A;  1VLT A;  1YDI A;  3EZI A;  4CJO A;  1BDJ B;  2Q7R A;  3ABL C;  4Q4Z F;  3MYF A;  3LS1 A;  3U9M A;  5HV9 A;  4U9D A;  1PV3 A;  3U9J A;  3DI5 A;  4IAO A;  1GGQ A;  1LIH A;  2CW0 F;  3NMK A;  1JAF A;  2HV6 A;  2KQ9 A;  2YHS A;  3EH1 A;  3K6B A;  2MHR A;  4QI2 A;  1ZVZ A;  4WJ0 A;  1GM5 A;  4OIO F;  1QSP A;  2WVN A;  3VAY A;  4FES A;  1OXK A;  2OQM A;  1A7V A;  2XS8 A;  3DJU B;  3ZG1 A;  3J06 A;  4U5H A;  3SEO A;  4E17 A;  4YL0 A;  1GS9 A;  3A9C A;  1ZYR F;  2VC9 A;  3U0C A;  2EIM C;  4KNW A;  3UGP A;  3EG9 B;  2NUT A;  1O87 A;  1OCR C;  3EG9 A;  1T6I A;  3RQG A;  3QMK A;  1DOW A;  1R5I D;  1OW6 A;  1VLS A;  4JTA B;  4JTC B;  1H7I A;  3B0U X;  2J9B A;  1V54 C;  4U5C E;  5L0H A;  3DMD A;  5JT4 A;  2D4U A;  1V4A A;  5AGF A;  1Q0M A;  2A69 F;  4J32 B;  1TWH A;  2KNH A;  4C3D A;  3W4Y A;  4EWC A;  5B1A C;  3JSZ A;  3ZDL A;  3NMJ A;  1RKC A;  3M15 A;  4J7Y A;  3KKB A;  3H2V A;  1TQG A;  1TKN A;  2QNL A;  1OW7 A;  2VCB A;  1L3P A;  2C04 A;  4H4K C;  5COG A;  2YVK A;  3HTK C;  2CDQ A;  5KYX A;  1NBB A;  4O7G A;  4WGY A;  1E86 A;  1UFB A;  4JCH A;  3FHD A;  1T5O A;  2XL4 A;  3GWL A;  3SP1 A;  3H2U A;  4PR9 A;  2LK4 A;  5D91 A;  4HFK B;  5F28 E;  3TOM A;  4OIP F;  1PD0 A;  2LIG A;  2GWW A;  2R02 A;  2WVO A;  3C63 A;  1U0B B;  2R7X A;  2QY9 A;  4E0H A;  4WGZ A;  4E7S A;  3S90 A;  3C8G B;  4E7Z A;  4DVZ A;  1E84 A; 
#chains in the Genus database with same CATH homology
 1JMW A;  1VLT A;  1WAS A;  2ASR A;  2D4U A;  2LIG A;  4Z9J A;  1VLS A;  3T9O A;  1WAT A;  4Z9I A;  3ATP A;  4H54 A;  4Z9H A;  1LIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...