1VLSA

Ligand binding domain of the wild-type aspartate receptor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
146
structure length
146
Chain Sequence
MNQQGFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of the ligand binding domain of the wild-type bacterial aspartate receptor.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chemotaxis
molecule keywords ASPARTATE RECEPTOR
total genus 54
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 1996-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1vlsA00
1WASA 1VLTA 3ATPA 3T9OA 4Z9JA 2ASRA 4H54A 4Z9HA 1LIHA 2LIGA 1JMWA 4Z9IA 1WATA 2D4UA 1VLSA
chains in the Genus database with same CATH superfamily
1C03A 1H7IA 1JPJA 1C02A 2DYRC 1SMYF 2R05A 3MLGA 3SYNA 1BR4A 2DYSC 4MS2A 4J32B 5EK0A 1GM5A 4C7OB 4PK4A 4H4KC 2L6FA 5FCLA 3QTHA 3JYYA 1H9GA 2WVNA 2XLVA 1TFOB 2L81A 4DRIB 5A6BA 4MVSA 5B1AC 4OIRF 1OCOC 4PJMA 5KYYB 4MVMA 4BEJA 1YYXA 1E84A 4E17A 2MWQA 2WZLA 2YL3A 4DXWA 1HY5A 2VCCA 1QVXA 3LLIA 4WGZA 1OXBA 4PR9A 2RD9A 4YL0A 2CW0F 3VM6A 3TJ5A 3VYWA 3FVYA 2LP4A 4G78A 3WAQA 2BL2A 3NYJA 3AJMA 2GA0A 2NSFA 5L3VA 4P6IC 3H2UA 2R9RB 3U9MA 5HSWA 3MYFA 3S27A 4PFOA 3ZG1A 5DVWA 4G7ZF 3GORA 2LD6A 1OQCA 4N6CA 1SF8A 3EQLF 4JTAB 1I4YA 1FNTc 1A7VA 2NUTA 2D4UA 4XPWA 1KU2A 4CDVA 1MQVA 1LKXA 3U5SA 5JP7A 3G4XA 4CX9A 3RQFA 2ZPAA 3DJUB 2XLWA 1U89A 1BR2A 2A6EF 3EJNA 3LS0A 4LDQA 3U3FA 2FFHA 2VASA 3GODA 3LS1A 3ZWIA 1A0BA 2W9YA 3RVYA 2GAQA 2VB6A 3QMKA 2J7PA 2YLIA 4JC7A 4XWJA 5B1BC 4XPYA 2Q00A 1VTMP 3EH2A 1RKCA 3UGOA 2J9BA 4I1OB 4Z9IA 5BQHA 2J0XA 2XLHA 3B0PA 1T9KA 1ZU4A 3Q7GA 1Z3IX 2OJED 1FR0A 3ZTZA 3DWWA 2BE5F 3L34A 3NKEA 2XLEA 3TULA 1JR8A 3OEOA 2G3KA 4YT8A 2NPUA 2XL4A 2YLDA 2YRFA 3DAGA 1VLTA 3HNIA 3S9OA 3W2WA 4J7TA 4D4XA 1DOWA 3EG9B 2CDQA 2XM4A 4PJLA 2E87A 4JVSA 4BJTA 4QI2A 4C7OA 5DS4A 1LI5A 1GS9A 2OKUA 1JAFA 3RH3A 2IXPA 2H8AA 3I4UA 1NZEA 1HW2A 2MHRA 4FX5A 4I1MA 2PP4A 3O39A 2YWAA 2H7BA 3FAJA 3CQZA 2XXAA 2W4MA 2XLOA 2HJMA 1GQAA 3PDMP 1VK5A 2P7VA 2ZD9A 3SNHA 1WWPA 1APCA 4X0RA 1A7EA 2OEXA 2JX0A 3JCUQ 3L1MA 2Y3HA 2KYHA 4OD4A 4D4NA 2QNLA 3N24A 2H7OA 4NY3A 1F1MA 2YZSA 2M4EA 2WZGA 3LAYA 3M1CB 4G0HA 2AWCA 3CSKA 1M2VB 5COGA 4CIPA 4N06A 2YEVA 4AL0A 3ITFA 3U2LA 4C3DA 4UDVA 2J9VA 1OCCC 1V74B 2HV6A 3CAXA 1SR2A 1YA7O 4MQ9F 3IQTA 4U5CE 1LIHA 2XLDA 1T01A 1NFOA 2LFDA 2UUHA 3DE9A 3F47A 3IQCA 3EGXB 3K7DA 2OU6A 2P0NA 5D92A 2IYLD 2AWYA 1UFBA 1CPRA 1K04A 3NMJA 2GDCA 3RYLA 3GM2A 3UR3C 5JLIA 3VAYA 3K6BA 3L8JA 1LVKA 4MVZA 2Y39A 4XQ1A 3HTKC 3T6BA 4U5BE 2WZFA 2Q7RA 3U3BA 2XL8A 2CYDA 3DE8A 1G5ZA 1OKKD 3VF0A 4BG0A 3Q6NA 4G7HF 1MNDA 3IPMO 5F5FA 1OR2A 5COMA 1CGME 1FFHA 1YVIA 4XLNF 3W8IA 3NMIA 4YT5A 1FMVA 3T6JA 3UMKA 1NFNA 2A1DD 2B0JA 2IXMA 3QVYA 5A6BD 3ABMC 1MMNA 3N0TA 2XLMA 2YHSA 1NBBA 4JJGA 3X2QC 1TKNA 4W8PA 1QLEC 1ST6A 2Q9CA 1FFTC 3AG3C 1RKEA 1TWCA 2RSEB 3DKAA 2ICWG 2LIGA 2Q3TA 4JURI 5L0GA 4YL1A 3B9QA 4IAQA 1A7DA 4XEKA 5L0FA 5KYWB 1OXKA 1YDIA 2W45A 4MTOA 1OW7A 1BR1A 5E3CA 3Q6MA 5A6JA 1Y4CA 1HMDA 4RDAA 4N6HA 1FMWA 3BRJA 3W2VA 1YZAA 2CNWD 2IOQA 2R7WA 3ECSA 4PJNA 1G4US 1Q0MA 3LEVA 4BJ6C 1TQGA 4OIPF 4E18A 1IZMA 3GM3A 1G8XA 1NG1A 2R7VA 4K7BA 4P9TA 3EFOA 4QDLA 1D0XA 4AX2A 3SP1A 3MYIA 1VB5A 3DM5A 2B0HA 5E33A 3T4RA 256BA 5DLJA 4BPMA 5DS6A 3DAFA 4NC3A 1IW7F 2XL6A 1LS1A 5DS5A 1VYIA 4A2NB 4OIQF 3NRHA 5KYXA 1TFKB 3GWNA 3TQOA 4B6IA 2G3VA 5AC5A 2WVQA 1QQ3A 3EPVA 3K1HA 1LE2A 1VMAA 2YVKA 1LM3B 4FWVA 2LSEA 1MNEA 2I15A 4O7GA 1AUEA 2IXNA 3SXMA 4LDRA 2OCCC 1ZW3A 1Z23A 4FAPB 1AEPA 4FESA 3RF3A 4BJ1A 4CSAC 2R7UA 1D1BA 1DOVA 3Q7LA 3ZQYA 1Z6AA 1XZPA 2EPKX 3C62A 3WG7C 2QUPA 1G4WR 2R7RA 2HUJA 4LLEA 4CS9A 2HFIA 3I5QA 4ANJA 3KPHA 2VH3A 1ZHZA 2VCBA 1QPUA 3U8PA 4CS8C 3JZ0A 4HFKB 1EA8A 4YT2A 4DJ9A 1JOGA 4IWBA 2D5RB 4KBLA 1CGOA 2FGYA 4BJ5A 2QE9A 3UGPA 1RJ9A 2A68F 2JPUA 3R7CA 3NDBB 5FZTA 2OQMA 4J7YA 5BUOA 4Z9JA 3T6GB 3EFOB 2KW3C 3ZTMA 2X51A 2CCYA 3KL4A 3G50A 4M63A 4MVQA 4QI0A 3EG9A 3AOUA 1ZHWA 4U5GA 3B0UX 3NYMA 1EKYA 4NTBA 5E3AA 2BC5A 4ER9A 3PHF2 1OW8A 2DB4A 4JCHA 3EHMA 3L0IA 1YA9A 4E0HA 2Y69C 1M56C 4EWCA 5KYYA 1D0YA 2UUIA 2KJGA 2XRHA 2ZXWC 3HJCA 2J9UA 4YJWA 5K0IA 2Q9BA 4AE4A 1WASA 2J9WA 2WVOA 2G62A 1OCZC 2XS1A 4U5FE 4J30B 2HZ8A 4MW3A 5E2QA 5HV9A 4W8KA 3FHDA 3VRCA 4ULWA 2X0CA 4MW8A 2EIJC 3DZAA 2AU5A 2DGJA 5B3IA 3UMIA 4HEAJ 2KSFA 3C8GD 2HMZA 3C7JA 3DJNB 3FMSA 4CDYA 1RJ9B 1HE9A 4XPXA 2YL1A 4AL1A 3JRTA 2KK1A 3S0XA 4JW1A 3QVZA 3EZIA 3ZQVA 3MBGA 3TOMA 4EBBA 1KTMA 1A41A 3V7OA 3AG4C 4IB4A 1H6GA 1T6IA 1O87A 1QSPA 2EILC 4I44A 1JRAA 3HNLA 4K1OA 4EBKA 3V5YA 5JS5A 3RQGA 5JT4A 2IXOA 2XXAB 1EQ1A 4XEVA 2EPMX 1V54C 2LK4A 3EGDA 3ASOC 4HE8D 4LLCA 4YWQA 2Y3DA 4E0IA 3GEEA 5T1DB 3US6A 1O5HA 2L7AA 4CJGA 4EHPA 4I3MA 5CI8A 1ORYA 1AVOB 3FXHA 3TD7A 5KYUB 3ASNC 1Q0DA 4MTFA 1ZHYA 2PFDA 4YL3A 4AE4B 3DD7A 4KC9A 4EKWA 1I4ZA 2DI3A 4F4BA 3SXYA 4ZLDA 1WGWA 3V5ZA 2QLAA 5JVEA 2L6GA 3AQBA 3C8GA 5KYNA 3QW0A 2FAPB 3N2ZB 4RD9A 5JSLA 3RQEA 4CSAA 3H65A 1SZIA 1LPEA 2GWWA 3B0VC 2PX3A 3ZSUA 1H9TA 4RBNA 1J8YF 1MMGA 1BBHA 3LLKA 5KYUA 1NLXA 4EBJA 3NG1A 3C18A 4KI2A 2PF4E 3SXKA 4C3BA 4PACA 4JTDB 4E7SA 3NMKA 1MMAA 4XEFA 4ZLCA 1E85A 1WOLA 2PBEA 3UNGC 2OJQA 5JUAA 2J46A 1RMVA 5COFA 4IAOA 3I5PA 3AQCA 2HSQA 4U5DE 4JIOA 3M4CA 3PMRA 3OA1A 3OWTA 2R7SA 1YAUO 5EGYA 4WJ0A 3W4YA 3K33A 3AG2C 5TJ5E 2ETSA 2NSGA 3HNKA 3KKBA 4NQFA 1JMWA 4ULVA 3ZIBA 4A4AA 1LI7A 2A69F 4CIHA 4P9FA 3T9OA 4AK9A 3NKDA 1YYJA 2ZXRA 3PCVA 2Z15A 4OD5A 3JSZA 1UG7A 3M79A 4IARA 4MVRA 3C63A 3C8ZA 4CS9C 1VOMA 2YL0A 3A11A 3M4BA 4JE9A 4PFPA 2Q4FA 4MNDA 1E83A 5T3TA 1ZW2A 2V3CC 3WHNA 4CS7A 2P1AA 4O6MA 1QZXA 2VC9A 3AGTA 4EUKB 5JRAA 3RIPA 1K05A 1HMOA 3ATPA 3JYHA 4KNVA 3SZRA 3U9JA 1OR3A 1YARO 2WL8A 4Z9HA 4XTKA 1R5ID 1ZYRF 1ORSC 1SYQA 2NUPA 4NCQA 2I8BA 1D0ZA 3K1IA 3KH2A 2EPLX 2R25A 3G4ZA 3S90A 3O55A 3LNMB 4XLPF 1OW6A 3JTLO 3S28A 3ZDLA 3RVZA 3GANA 2NUPB 1TWAA 4MVOA 5KYWA 5CIVA 4HFFB 1S7ZA 1RXQA 1ZHTA 4BEMJ 2M64A 4ONSA 4YN0B 3NYLA 3EGXA 4U9DA 3QW1A 3IQ6A 5DQTA 2NUTB 4LERA 4CDAA 1I5NA 5L0CA 4O6NA 4CJOA 1N1CA 1ORJA 3EZHA 1Z5ZA 5EHHA 3U0CA 1T6UA 4Q5SF 4LACB 3JT1A 5CI9A 2A0UA 2AVKA 3CZ6A 5KYXB 4O6YA 1LE4A 2HV7A 4NTFA 3GEIA 2C04A 3RFYA 1D1AA 1JPNA 1HW1A 1V55C 3KYJA 3MFNA 1M2VA 3R2PA 1Q0GA 2AP3A 1TR2A 3S84A 2IM8A 2R03A 1B68A 5T3WA 5A69A 2J0WA 1E2XA 2J7PD 2GFHA 2O9XA 2EIMC 4JTCB 1BDJB 2XM0A 2QY9A 3EHNA 4C3EA 1OCRC 3SEOA 2J8WA 2HKVA 2OEVA 3LJBA 4JRZA 3O6XA 4JEAA 1FTSA 3AG1C 2PX0A 4DBQA 2JD3A 5B3SC 3EH1A 3FAPB 1LS4A 1FAPB 1V4AA 1TWHA 2LFFA 3DM9B 4NTAA 5L0IA 1VLSA 3QZCA 1YZCA 2Y3GA 3M15A 2VCAA 4KNWA 1M57C 4OIOF 3F46A 4JKVA 1GGQA 1WN0A 1Q0KA 5AC4A 1R4TA 3J06A 3S29A 1YLMA 3GM1A 1L3PA 5DQZA 3TOLA 2P61A 3TK0A 2PNOA 2IBFA 4IRUA 1RKEB 2EPNA 4JJFA 2R7OA 1ZHXA 5F5HA 3LNRA 3RKOF 3K66A 4MTGA 4U5HA 4BJ6A 2R02A 4DBRA 3K1IC 1T5OA 2HSBA 3JRMO 3W8HA 3WODF 2YQYA 5L0DA 2H7VC 1VYKA 2YLGA 1YJGA 4IJJA 1QKRA 4Q4ZF 1D1CA 2EINC 3GEHA 4DVZA 4BJ5C 1ZU5A 4WGYA 1HE1A 4CS8A 5AGFA 3O10A 3IHUA 3RW0A 2R7QA 1CGNA 3KYIA 4JZAA 5BQIA 5L0HA 4U5EE 5L3QA 1K40A 3CEXA 3FOOA 4N4WA 2A0BA 1WTYA 2C03A 1Q0FA 1PD0A 2P6VA 4JEBA 3JSEO 1U0BB 3HLZA 4GQHA 4JCZA 4H54A 2W4BA 4IGGA 4DRJB 1PV3A 1OKKA 1BZ4A 3DMDA 3H2VA 3B29A 1Z7Qc 2Q9AA 3MX3A 1L7CA 2LCHA 3DI5A 4O79A 1TWGA 2NG1A 3HNJA 2R7XA 1Y6DA 3FDQA 3B71A 1M2OA 3LUTB 1ZZPA 1PCXA 2QTVA 4DOZA 1KNYA 2V26A 2KGOA 3AGUA 4G7OF 3HKKA 1W2WA 3ABKC 2R7TA 4K0DA 1CPQA 3E70C 1S05A 3IQ5A 1O3UA 3U8VA 3ZVRA 4E7ZA 3L8IA 5D91A 2J45A 1J8MF 3DXJF 2HJ3A 1C17M 2OG2A 2EPOA 2L9JA 2EIKC 1ZVZA 1NU9C 2HMQA 2MYSA 1MMDA 2XSEA 4DRHB 4PJJA 3IEEA 3LEOA 4MVUA 5IY5C 3E9VA 4L6RA 2ZXOA 3POVA 3ABLC 3SXZA 4WABA 5L0JA 1XWJA 1E86A 2Y3BA 1EI7A 1T6QA 2A6HF 4GEHA 4OINF 4CBEA 3V5XA 5GPGB 4DVYP 2ZXPA 3LESA 2KNHA 3FOPA 1U6HA 1NU7D 3EGDB 3KMIA 2CNWA 4LDKA 1WATA 3TJ6A 2L6HA 4Q7CA 3ZC4A 5F28E 2YKZA 2LQGA 3C8GB 1RCPA 2ASRA 3GWLA 3U2MA 3UMHA 5A6AA 2HS5A 2OOCA 3BEHA 4R32A 4EIYA 4YK5A 3A9CA 1Z63A 4GYTA 2WB7A 4YT4A 5A6KA 1PD1A 2KQ9A 5BQGA 1NSGB 2XS8A 2KC3A 2TMVP 4U9EA 2YL7A 1XZQA 2F22A 1M6TA 3X1OA 2CGEA
chains in the Genus database with same CATH topology
1WASA 1VLTA 3ATPA 3T9OA 4Z9JA 2ASRA 4H54A 4Z9HA 1LIHA 2LIGA 1JMWA 4Z9IA 1WATA 2D4UA 1VLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAS A;  1VLT A;  3ATP A;  3T9O A;  4Z9J A;  2ASR A;  4H54 A;  4Z9H A;  1LIH A;  2LIG A;  1JMW A;  4Z9I A;  1WAT A;  2D4U A;  1VLS A; 
#chains in the Genus database with same CATH topology
 1C03 A;  1H7I A;  1JPJ A;  1C02 A;  2DYR C;  1SMY F;  2R05 A;  3MLG A;  3SYN A;  1BR4 A;  2DYS C;  4MS2 A;  4J32 B;  5EK0 A;  1GM5 A;  4C7O B;  4PK4 A;  4H4K C;  2L6F A;  5FCL A;  3QTH A;  3JYY A;  1H9G A;  2WVN A;  2XLV A;  1TFO B;  2L81 A;  4DRI B;  5A6B A;  4MVS A;  5B1A C;  4OIR F;  1OCO C;  4PJM A;  5KYY B;  4MVM A;  4BEJ A;  1YYX A;  1E84 A;  4E17 A;  2MWQ A;  2WZL A;  2YL3 A;  4DXW A;  1HY5 A;  2VCC A;  1QVX A;  3LLI A;  4WGZ A;  1OXB A;  4PR9 A;  2RD9 A;  4YL0 A;  2CW0 F;  3VM6 A;  3TJ5 A;  3VYW A;  3FVY A;  2LP4 A;  4G78 A;  3WAQ A;  2BL2 A;  3NYJ A;  3AJM A;  2GA0 A;  2NSF A;  5L3V A;  4P6I C;  3H2U A;  2R9R B;  3U9M A;  5HSW A;  3MYF A;  3S27 A;  4PFO A;  3ZG1 A;  5DVW A;  4G7Z F;  3GOR A;  2LD6 A;  1OQC A;  4N6C A;  1SF8 A;  3EQL F;  4JTA B;  1I4Y A;  1FNT c;  1A7V A;  2NUT A;  2D4U A;  4XPW A;  1KU2 A;  4CDV A;  1MQV A;  1LKX A;  3U5S A;  5JP7 A;  3G4X A;  4CX9 A;  3RQF A;  2ZPA A;  3DJU B;  2XLW A;  1U89 A;  1BR2 A;  2A6E F;  3EJN A;  3LS0 A;  4LDQ A;  3U3F A;  2FFH A;  2VAS A;  3GOD A;  3LS1 A;  3ZWI A;  1A0B A;  2W9Y A;  3RVY A;  2GAQ A;  2VB6 A;  3QMK A;  2J7P A;  2YLI A;  4JC7 A;  4XWJ A;  5B1B C;  4XPY A;  2Q00 A;  1VTM P;  3EH2 A;  1RKC A;  3UGO A;  2J9B A;  4I1O B;  4Z9I A;  5BQH A;  2J0X A;  2XLH A;  3B0P A;  1T9K A;  1ZU4 A;  3Q7G A;  1Z3I X;  2OJE D;  1FR0 A;  3ZTZ A;  3DWW A;  2BE5 F;  3L34 A;  3NKE A;  2XLE A;  3TUL A;  1JR8 A;  3OEO A;  2G3K A;  4YT8 A;  2NPU A;  2XL4 A;  2YLD A;  2YRF A;  3DAG A;  1VLT A;  3HNI A;  3S9O A;  3W2W A;  4J7T A;  4D4X A;  1DOW A;  3EG9 B;  2CDQ A;  2XM4 A;  4PJL A;  2E87 A;  4JVS A;  4BJT A;  4QI2 A;  4C7O A;  5DS4 A;  1LI5 A;  1GS9 A;  2OKU A;  1JAF A;  3RH3 A;  2IXP A;  2H8A A;  3I4U A;  1NZE A;  1HW2 A;  2MHR A;  4FX5 A;  4I1M A;  2PP4 A;  3O39 A;  2YWA A;  2H7B A;  3FAJ A;  3CQZ A;  2XXA A;  2W4M A;  2XLO A;  2HJM A;  1GQA A;  3PDM P;  1VK5 A;  2P7V A;  2ZD9 A;  3SNH A;  1WWP A;  1APC A;  4X0R A;  1A7E A;  2OEX A;  2JX0 A;  3JCU Q;  3L1M A;  2Y3H A;  2KYH A;  4OD4 A;  4D4N A;  2QNL A;  3N24 A;  2H7O A;  4NY3 A;  1F1M A;  2YZS A;  2M4E A;  2WZG A;  3LAY A;  3M1C B;  4G0H A;  2AWC A;  3CSK A;  1M2V B;  5COG A;  4CIP A;  4N06 A;  2YEV A;  4AL0 A;  3ITF A;  3U2L A;  4C3D A;  4UDV A;  2J9V A;  1OCC C;  1V74 B;  2HV6 A;  3CAX A;  1SR2 A;  1YA7 O;  4MQ9 F;  3IQT A;  4U5C E;  1LIH A;  2XLD A;  1T01 A;  1NFO A;  2LFD A;  2UUH A;  3DE9 A;  3F47 A;  3IQC A;  3EGX B;  3K7D A;  2OU6 A;  2P0N A;  5D92 A;  2IYL D;  2AWY A;  1UFB A;  1CPR A;  1K04 A;  3NMJ A;  2GDC A;  3RYL A;  3GM2 A;  3UR3 C;  5JLI A;  3VAY A;  3K6B A;  3L8J A;  1LVK A;  4MVZ A;  2Y39 A;  4XQ1 A;  3HTK C;  3T6B A;  4U5B E;  2WZF A;  2Q7R A;  3U3B A;  2XL8 A;  2CYD A;  3DE8 A;  1G5Z A;  1OKK D;  3VF0 A;  4BG0 A;  3Q6N A;  4G7H F;  1MND A;  3IPM O;  5F5F A;  1OR2 A;  5COM A;  1CGM E;  1FFH A;  1YVI A;  4XLN F;  3W8I A;  3NMI A;  4YT5 A;  1FMV A;  3T6J A;  3UMK A;  1NFN A;  2A1D D;  2B0J A;  2IXM A;  3QVY A;  5A6B D;  3ABM C;  1MMN A;  3N0T A;  2XLM A;  2YHS A;  1NBB A;  4JJG A;  3X2Q C;  1TKN A;  4W8P A;  1QLE C;  1ST6 A;  2Q9C A;  1FFT C;  3AG3 C;  1RKE A;  1TWC A;  2RSE B;  3DKA A;  2ICW G;  2LIG A;  2Q3T A;  4JUR I;  5L0G A;  4YL1 A;  3B9Q A;  4IAQ A;  1A7D A;  4XEK A;  5L0F A;  5KYW B;  1OXK A;  1YDI A;  2W45 A;  4MTO A;  1OW7 A;  1BR1 A;  5E3C A;  3Q6M A;  5A6J A;  1Y4C A;  1HMD A;  4RDA A;  4N6H A;  1FMW A;  3BRJ A;  3W2V A;  1YZA A;  2CNW D;  2IOQ A;  2R7W A;  3ECS A;  4PJN A;  1G4U S;  1Q0M A;  3LEV A;  4BJ6 C;  1TQG A;  4OIP F;  4E18 A;  1IZM A;  3GM3 A;  1G8X A;  1NG1 A;  2R7V A;  4K7B A;  4P9T A;  3EFO A;  4QDL A;  1D0X A;  4AX2 A;  3SP1 A;  3MYI A;  1VB5 A;  3DM5 A;  2B0H A;  5E33 A;  3T4R A;  256B A;  5DLJ A;  4BPM A;  5DS6 A;  3DAF A;  4NC3 A;  1IW7 F;  2XL6 A;  1LS1 A;  5DS5 A;  1VYI A;  4A2N B;  4OIQ F;  3NRH A;  5KYX A;  1TFK B;  3GWN A;  3TQO A;  4B6I A;  2G3V A;  5AC5 A;  2WVQ A;  1QQ3 A;  3EPV A;  3K1H A;  1LE2 A;  1VMA A;  2YVK A;  1LM3 B;  4FWV A;  2LSE A;  1MNE A;  2I15 A;  4O7G A;  1AUE A;  2IXN A;  3SXM A;  4LDR A;  2OCC C;  1ZW3 A;  1Z23 A;  4FAP B;  1AEP A;  4FES A;  3RF3 A;  4BJ1 A;  4CSA C;  2R7U A;  1D1B A;  1DOV A;  3Q7L A;  3ZQY A;  1Z6A A;  1XZP A;  2EPK X;  3C62 A;  3WG7 C;  2QUP A;  1G4W R;  2R7R A;  2HUJ A;  4LLE A;  4CS9 A;  2HFI A;  3I5Q A;  4ANJ A;  3KPH A;  2VH3 A;  1ZHZ A;  2VCB A;  1QPU A;  3U8P A;  4CS8 C;  3JZ0 A;  4HFK B;  1EA8 A;  4YT2 A;  4DJ9 A;  1JOG A;  4IWB A;  2D5R B;  4KBL A;  1CGO A;  2FGY A;  4BJ5 A;  2QE9 A;  3UGP A;  1RJ9 A;  2A68 F;  2JPU A;  3R7C A;  3NDB B;  5FZT A;  2OQM A;  4J7Y A;  5BUO A;  4Z9J A;  3T6G B;  3EFO B;  2KW3 C;  3ZTM A;  2X51 A;  2CCY A;  3KL4 A;  3G50 A;  4M63 A;  4MVQ A;  4QI0 A;  3EG9 A;  3AOU A;  1ZHW A;  4U5G A;  3B0U X;  3NYM A;  1EKY A;  4NTB A;  5E3A A;  2BC5 A;  4ER9 A;  3PHF 2;  1OW8 A;  2DB4 A;  4JCH A;  3EHM A;  3L0I A;  1YA9 A;  4E0H A;  2Y69 C;  1M56 C;  4EWC A;  5KYY A;  1D0Y A;  2UUI A;  2KJG A;  2XRH A;  2ZXW C;  3HJC A;  2J9U A;  4YJW A;  5K0I A;  2Q9B A;  4AE4 A;  1WAS A;  2J9W A;  2WVO A;  2G62 A;  1OCZ C;  2XS1 A;  4U5F E;  4J30 B;  2HZ8 A;  4MW3 A;  5E2Q A;  5HV9 A;  4W8K A;  3FHD A;  3VRC A;  4ULW A;  2X0C A;  4MW8 A;  2EIJ C;  3DZA A;  2AU5 A;  2DGJ A;  5B3I A;  3UMI A;  4HEA J;  2KSF A;  3C8G D;  2HMZ A;  3C7J A;  3DJN B;  3FMS A;  4CDY A;  1RJ9 B;  1HE9 A;  4XPX A;  2YL1 A;  4AL1 A;  3JRT A;  2KK1 A;  3S0X A;  4JW1 A;  3QVZ A;  3EZI A;  3ZQV A;  3MBG A;  3TOM A;  4EBB A;  1KTM A;  1A41 A;  3V7O A;  3AG4 C;  4IB4 A;  1H6G A;  1T6I A;  1O87 A;  1QSP A;  2EIL C;  4I44 A;  1JRA A;  3HNL A;  4K1O A;  4EBK A;  3V5Y A;  5JS5 A;  3RQG A;  5JT4 A;  2IXO A;  2XXA B;  1EQ1 A;  4XEV A;  2EPM X;  1V54 C;  2LK4 A;  3EGD A;  3ASO C;  4HE8 D;  4LLC A;  4YWQ A;  2Y3D A;  4E0I A;  3GEE A;  5T1D B;  3US6 A;  1O5H A;  2L7A A;  4CJG A;  4EHP A;  4I3M A;  5CI8 A;  1ORY A;  1AVO B;  3FXH A;  3TD7 A;  5KYU B;  3ASN C;  1Q0D A;  4MTF A;  1ZHY A;  2PFD A;  4YL3 A;  4AE4 B;  3DD7 A;  4KC9 A;  4EKW A;  1I4Z A;  2DI3 A;  4F4B A;  3SXY A;  4ZLD A;  1WGW A;  3V5Z A;  2QLA A;  5JVE A;  2L6G A;  3AQB A;  3C8G A;  5KYN A;  3QW0 A;  2FAP B;  3N2Z B;  4RD9 A;  5JSL A;  3RQE A;  4CSA A;  3H65 A;  1SZI A;  1LPE A;  2GWW A;  3B0V C;  2PX3 A;  3ZSU A;  1H9T A;  4RBN A;  1J8Y F;  1MMG A;  1BBH A;  3LLK A;  5KYU A;  1NLX A;  4EBJ A;  3NG1 A;  3C18 A;  4KI2 A;  2PF4 E;  3SXK A;  4C3B A;  4PAC A;  4JTD B;  4E7S A;  3NMK A;  1MMA A;  4XEF A;  4ZLC A;  1E85 A;  1WOL A;  2PBE A;  3UNG C;  2OJQ A;  5JUA A;  2J46 A;  1RMV A;  5COF A;  4IAO A;  3I5P A;  3AQC A;  2HSQ A;  4U5D E;  4JIO A;  3M4C A;  3PMR A;  3OA1 A;  3OWT A;  2R7S A;  1YAU O;  5EGY A;  4WJ0 A;  3W4Y A;  3K33 A;  3AG2 C;  5TJ5 E;  2ETS A;  2NSG A;  3HNK A;  3KKB A;  4NQF A;  1JMW A;  4ULV A;  3ZIB A;  4A4A A;  1LI7 A;  2A69 F;  4CIH A;  4P9F A;  3T9O A;  4AK9 A;  3NKD A;  1YYJ A;  2ZXR A;  3PCV A;  2Z15 A;  4OD5 A;  3JSZ A;  1UG7 A;  3M79 A;  4IAR A;  4MVR A;  3C63 A;  3C8Z A;  4CS9 C;  1VOM A;  2YL0 A;  3A11 A;  3M4B A;  4JE9 A;  4PFP A;  2Q4F A;  4MND A;  1E83 A;  5T3T A;  1ZW2 A;  2V3C C;  3WHN A;  4CS7 A;  2P1A A;  4O6M A;  1QZX A;  2VC9 A;  3AGT A;  4EUK B;  5JRA A;  3RIP A;  1K05 A;  1HMO A;  3ATP A;  3JYH A;  4KNV A;  3SZR A;  3U9J A;  1OR3 A;  1YAR O;  2WL8 A;  4Z9H A;  4XTK A;  1R5I D;  1ZYR F;  1ORS C;  1SYQ A;  2NUP A;  4NCQ A;  2I8B A;  1D0Z A;  3K1I A;  3KH2 A;  2EPL X;  2R25 A;  3G4Z A;  3S90 A;  3O55 A;  3LNM B;  4XLP F;  1OW6 A;  3JTL O;  3S28 A;  3ZDL A;  3RVZ A;  3GAN A;  2NUP B;  1TWA A;  4MVO A;  5KYW A;  5CIV A;  4HFF B;  1S7Z A;  1RXQ A;  1ZHT A;  4BEM J;  2M64 A;  4ONS A;  4YN0 B;  3NYL A;  3EGX A;  4U9D A;  3QW1 A;  3IQ6 A;  5DQT A;  2NUT B;  4LER A;  4CDA A;  1I5N A;  5L0C A;  4O6N A;  4CJO A;  1N1C A;  1ORJ A;  3EZH A;  1Z5Z A;  5EHH A;  3U0C A;  1T6U A;  4Q5S F;  4LAC B;  3JT1 A;  5CI9 A;  2A0U A;  2AVK A;  3CZ6 A;  5KYX B;  4O6Y A;  1LE4 A;  2HV7 A;  4NTF A;  3GEI A;  2C04 A;  3RFY A;  1D1A A;  1JPN A;  1HW1 A;  1V55 C;  3KYJ A;  3MFN A;  1M2V A;  3R2P A;  1Q0G A;  2AP3 A;  1TR2 A;  3S84 A;  2IM8 A;  2R03 A;  1B68 A;  5T3W A;  5A69 A;  2J0W A;  1E2X A;  2J7P D;  2GFH A;  2O9X A;  2EIM C;  4JTC B;  1BDJ B;  2XM0 A;  2QY9 A;  3EHN A;  4C3E A;  1OCR C;  3SEO A;  2J8W A;  2HKV A;  2OEV A;  3LJB A;  4JRZ A;  3O6X A;  4JEA A;  1FTS A;  3AG1 C;  2PX0 A;  4DBQ A;  2JD3 A;  5B3S C;  3EH1 A;  3FAP B;  1LS4 A;  1FAP B;  1V4A A;  1TWH A;  2LFF A;  3DM9 B;  4NTA A;  5L0I A;  1VLS A;  3QZC A;  1YZC A;  2Y3G A;  3M15 A;  2VCA A;  4KNW A;  1M57 C;  4OIO F;  3F46 A;  4JKV A;  1GGQ A;  1WN0 A;  1Q0K A;  5AC4 A;  1R4T A;  3J06 A;  3S29 A;  1YLM A;  3GM1 A;  1L3P A;  5DQZ A;  3TOL A;  2P61 A;  3TK0 A;  2PNO A;  2IBF A;  4IRU A;  1RKE B;  2EPN A;  4JJF A;  2R7O A;  1ZHX A;  5F5H A;  3LNR A;  3RKO F;  3K66 A;  4MTG A;  4U5H A;  4BJ6 A;  2R02 A;  4DBR A;  3K1I C;  1T5O A;  2HSB A;  3JRM O;  3W8H A;  3WOD F;  2YQY A;  5L0D A;  2H7V C;  1VYK A;  2YLG A;  1YJG A;  4IJJ A;  1QKR A;  4Q4Z F;  1D1C A;  2EIN C;  3GEH A;  4DVZ A;  4BJ5 C;  1ZU5 A;  4WGY A;  1HE1 A;  4CS8 A;  5AGF A;  3O10 A;  3IHU A;  3RW0 A;  2R7Q A;  1CGN A;  3KYI A;  4JZA A;  5BQI A;  5L0H A;  4U5E E;  5L3Q A;  1K40 A;  3CEX A;  3FOO A;  4N4W A;  2A0B A;  1WTY A;  2C03 A;  1Q0F A;  1PD0 A;  2P6V A;  4JEB A;  3JSE O;  1U0B B;  3HLZ A;  4GQH A;  4JCZ A;  4H54 A;  2W4B A;  4IGG A;  4DRJ B;  1PV3 A;  1OKK A;  1BZ4 A;  3DMD A;  3H2V A;  3B29 A;  1Z7Q c;  2Q9A A;  3MX3 A;  1L7C A;  2LCH A;  3DI5 A;  4O79 A;  1TWG A;  2NG1 A;  3HNJ A;  2R7X A;  1Y6D A;  3FDQ A;  3B71 A;  1M2O A;  3LUT B;  1ZZP A;  1PCX A;  2QTV A;  4DOZ A;  1KNY A;  2V26 A;  2KGO A;  3AGU A;  4G7O F;  3HKK A;  1W2W A;  3ABK C;  2R7T A;  4K0D A;  1CPQ A;  3E70 C;  1S05 A;  3IQ5 A;  1O3U A;  3U8V A;  3ZVR A;  4E7Z A;  3L8I A;  5D91 A;  2J45 A;  1J8M F;  3DXJ F;  2HJ3 A;  1C17 M;  2OG2 A;  2EPO A;  2L9J A;  2EIK C;  1ZVZ A;  1NU9 C;  2HMQ A;  2MYS A;  1MMD A;  2XSE A;  4DRH B;  4PJJ A;  3IEE A;  3LEO A;  4MVU A;  5IY5 C;  3E9V A;  4L6R A;  2ZXO A;  3POV A;  3ABL C;  3SXZ A;  4WAB A;  5L0J A;  1XWJ A;  1E86 A;  2Y3B A;  1EI7 A;  1T6Q A;  2A6H F;  4GEH A;  4OIN F;  4CBE A;  3V5X A;  5GPG B;  4DVY P;  2ZXP A;  3LES A;  2KNH A;  3FOP A;  1U6H A;  1NU7 D;  3EGD B;  3KMI A;  2CNW A;  4LDK A;  1WAT A;  3TJ6 A;  2L6H A;  4Q7C A;  3ZC4 A;  5F28 E;  2YKZ A;  2LQG A;  3C8G B;  1RCP A;  2ASR A;  3GWL A;  3U2M A;  3UMH A;  5A6A A;  2HS5 A;  2OOC A;  3BEH A;  4R32 A;  4EIY A;  4YK5 A;  3A9C A;  1Z63 A;  4GYT A;  2WB7 A;  4YT4 A;  5A6K A;  1PD1 A;  2KQ9 A;  5BQG A;  1NSG B;  2XS8 A;  2KC3 A;  2TMV P;  4U9E A;  2YL7 A;  1XZQ A;  2F22 A;  1M6T A;  3X1O A;  2CGE A; 
#chains in the Genus database with same CATH homology
 1WAS A;  1VLT A;  3ATP A;  3T9O A;  4Z9J A;  2ASR A;  4H54 A;  4Z9H A;  1LIH A;  2LIG A;  1JMW A;  4Z9I A;  1WAT A;  2D4U A;  1VLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...