1VLSA

Ligand binding domain of the wild-type aspartate receptor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
146
structure length
146
Chain Sequence
MNQQGFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of the ligand binding domain of the wild-type bacterial aspartate receptor.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chemotaxis
molecule keywords ASPARTATE RECEPTOR
total genus 54
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 1996-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 1vlsA00
2ASRA 2D4UA 3T9OA 1VLSA 1JMWA 4H54A 1WASA 2LIGA 4Z9JA 1LIHA 4Z9IA 3ATPA 1WATA 1VLTA 4Z9HA
chains in the Genus database with same CATH superfamily
3EH2A 3M1CB 3SZRA 5DS6A 1VYIA 3FDQA 2Y3HA 3FMSA 3CQZA 1T9KA 3UR3C 4IB4A 3OEOA 4MVMA 3RF3A 4MW3A 1CPRA 2XLVA 2Q00A 3ZQVA 2NUTB 3ZWIA 2HJ3A 5DLJA 4EUKB 2QY9A 2HUJA 3B9QA 4NCQA 1F1MA 4CS9C 4CIHA 4I1MA 1KU2A 1A7VA 1HE9A 4XEFA 1Z3IX 2P61A 3GWNA 1QKRA 4JZAA 4KNWA 3T6BA 3RQGA 2C03A 3AOUA 2HMZA 1YYJA 2WZGA 3C8GA 3R7CA 1PV3A 4OD5A 5E2QA 2XLEA 2YLGA 4JIOA 3T6JA 2R7OA 3U8PA 3X2QC 1JAFA 1M2VB 3I5QA 3TULA 1NFNA 3KL4A 1I4YA 2I8BA 5CI9A 3H2UA 2R7UA 1A7DA 5E33A 3LS1A 2IBFA 3AGUA 1G4US 1VMAA 2VCAA 3HLZA 3JCUQ 2ZXOA 2P6VA 3E70C 5T1DB 4MTGA 1H9TA 1VLSA 3O39A 2R7VA 1QVXA 5F5FA 4H4KC 3N0TA 1DOWA 5A6BA 5KYXA 2DYSC 5JLIA 3AG1C 3DI5A 2BL2A 3QZCA 4HE8D 4JVSA 4NTBA 3FHDA 1Y6DA 5L0FA 5D91A 2YWAA 1BDJB 1YJGA 3DWWA 4P9FA 4K0DA 3OA1A 1LPEA 1M57C 2J0XA 3DAFA 2R25A 4WGYA 4IGGA 1O3UA 1C17M 3HNKA 5COMA 3VM6A 2J7PD 1WN0A 1CGNA 3G50A 4A2NB 2VC9A 1O87A 3M79A 4C3DA 3B71A 3DE9A 5KYWB 4EKWA 2W9YA 3T9OA 5JP7A 3F46A 3LLKA 1RMVA 1HMOA 2Q3TA 5B3IA 1OW8A 2A0UA 2IXPA 3QVYA 4U5HA 2OEVA 3K1HA 4IAOA 3M4BA 4CS9A 2HSQA 3KH2A 2IXOA 2Y69C 3AQCA 3JRMO 4MVRA 4U5EE 4B6IA 5L3VA 3CAXA 1Q0MA 3HNJA 4XQ1A 4BG0A 1VYKA 2XL8A 5A69A 1D0YA 2J9UA 3MYFA 1ZHWA 4IAQA 4BJTA 1OKKD 4A4AA 4Q4ZF 3ITFA 3MLGA 2W45A 4K7BA 3U3FA 3GORA 2EPOA 1NLXA 1WASA 1GQAA 2GAQA 3IQTA 1Y4CA 4XPXA 4CDVA 1BZ4A 3L34A 4W8PA 3U2LA 3KKBA 3GM1A 4E17A 1R4TA 2EPMX 1Q0KA 3ZQYA 4I3MA 2X51A 1OKKA 2YLIA 3LNMB 4RBNA 3Q6MA 4OIQF 1K40A 2BC5A 2ZPAA 3GEIA 4R32A 2R7XA 5EGYA 5JRAA 4I44A 4AE4B 4G7ZF 1WATA 2PFDA 1J8MF 1LE4A 4U9EA 3RVYA 4ANJA 5IY5C 2IM8A 1AEPA 5L0HA 3S90A 3NMKA 2GA0A 1ST6A 3VAYA 3C7JA 3ASNC 2G62A 1OQCA 1ZZPA 2A69F 1JMWA 4G7OF 4N6CA 4OINF 2XM4A 4HEAJ 4OD4A 4RDAA 1FTSA 2Y3BA 2PX3A 4MNDA 5B1AC 5BQIA 4QI2A 4PK4A 4G0HA 3I4UA 4QDLA 5KYYB 2R7RA 2H7OA 1H6GA 1N1CA 2A6EF 1YLMA 1ORYA 1L3PA 2L6HA 2OKUA 1PD0A 1SZIA 3EG9A 3LJBA 3LUTB 4GYTA 2NSGA 1NU9C 4MVQA 1RKCA 1RKEA 3A9CA 5DQZA 4YWQA 1ZW2A 2ETSA 5FCLA 1LI7A 4NC3A 2EIKC 3LAYA 2GDCA 3DMDA 1KNYA 2PBEA 3FAPB 4C3BA 5KYXB 2R7WA 2KK1A 1T6IA 2WVQA 4AL0A 3UGOA 2YL0A 1YZAA 2L9JA 4YT8A 2J9VA 4DBRA 1FR0A 2YVKA 3ABKC 3T4RA 4Q5SF 3UGPA 1ZYRF 3EGDB 3FOOA 4LERA 4JCHA 5KYYA 2E87A 5L0DA 3MX3A 2HV7A 3FVYA 3JSZA 3MFNA 4NTAA 2JD3A 3BEHA 1TWGA 2QE9A 3KYIA 2ZXWC 2P0NA 3AG4C 3M4CA 3TJ5A 4WGZA 2LCHA 2Z15A 3C8GB 2XLHA 1YDIA 4JRZA 4P9TA 2J46A 1BR1A 3C8GD 3S84A 1ORSC 1LS1A 3HKKA 3IQ5A 2D4UA 4GEHA 4IRUA 4JCZA 2YL3A 4BPMA 2CCYA 2EIMC 3EGXB 2IOQA 3A11A 1CGME 1EA8A 4FWVA 4EHPA 2FGYA 2CYDA 4LDRA 4D4XA 1HMDA 1QPUA 3B29A 3VRCA 1D1CA 1NFOA 1LS4A 2YL7A 3W8HA 3QMKA 5JS5A 2NUPA 2DGJA 1Z7Qc 2Q7RA 3LLIA 4KNVA 3ZG1A 2B0JA 3IHUA 4DVYP 4JEBA 4FAPB 2B0HA 2QLAA 1RJ9A 5D92A 3AQBA 3NDBB 5AC5A 1QQ3A 1VOMA 2OG2A 1D1BA 1V54C 3SYNA 2XLOA 4MQ9F 4YL0A 3R2PA 4F4BA 4E7ZA 3JZ0A 4ONSA 1IZMA 1EI7A 1G8XA 1WTYA 3CZ6A 1SMYF 3EPVA 3SP1A 4CSAA 3ABLC 2KYHA 1MNEA 4JTCB 2JPUA 4MVOA 2L6FA 2OCCC 1OXKA 2Q9BA 2I15A 2UUIA 3ECSA 3FXHA 3LESA 3EHNA 3G4ZA 3C8ZA 4IARA 4YJWA 3NYMA 3DAGA 4EBKA 2KJGA 1I4ZA 3UNGC 5L0GA 2Y3GA 3UMHA 1YVIA 1VTMP 3NRHA 1J8YF 2HZ8A 2HV6A 3WHNA 4C3EA 4DBQA 4H54A 2MYSA 1LIHA 3DJNB 5B3SC 3GM3A 2MHRA 4PJNA 4LDQA 2EPLX 4E0IA 3W8IA 3U8VA 2L7AA 3AG3C 2QNLA 3UMKA 4IJJA 3AGTA 2KSFA 3U9JA 4CS8A 1AVOB 4CIPA 5DS4A 2KQ9A 3JT1A 5AC4A 2XLWA 3DJUB 1ZU5A 1Q0FA 3WG7C 4OIOF 2XXAA 2DB4A 3L1MA 3NG1A 4ULVA 3KYJA 1B68A 4FESA 5K0IA 1XZPA 2LFFA 4JC7A 3OWTA 2NUTA 4E18A 5T3TA 4JURI 1ZW3A 3BRJA 3DD7A 2GWWA 1JPJA 1Q0DA 2MWQA 1GM5A 4PFOA 3VF0A 1K05A 1CPQA 2PX0A 4M63A 3W2WA 1TFOB 3CEXA 3PDMP 2XM0A 3ASOC 3MBGA 1OW7A 4YN0B 1Q0GA 1QLEC 4CX9A 1E86A 3SNHA 4N6HA 2LIGA 3B0VC 1E83A 1APCA 3QW0A 4J7YA 3S29A 3ZTMA 4LACB 4AL1A 4DRHB 3GODA 1M2VA 4OIPF 2XL6A 4PR9A 1S7ZA 4CS7A 5KYNA 3UMIA 2X0CA 2PF4E 1ZHXA 2IYLD 3U5SA 4CBEA 2QTVA 5TJ5E 4DVZA 2A1DD 2LQGA 3NMIA 4O6YA 2LP4A 4Z9HA 3J06A 4U5GA 2FAPB 3RH3A 4AX2A 4CSAC 3IEEA 4PJLA 3GANA 3DM5A 5A6JA 1XZQA 5L0CA 2CGEA 3EGXA 3H2VA 3C18A 3SXMA 3IPMO 1MMAA 2OQMA 2HSBA 2HFIA 1RCPA 1GGQA 1A7EA 4Z9IA 3S0XA 1MMNA 1SYQA 1C02A 1D0ZA 2R7QA 4G78A 4NQFA 4W8KA 2XRHA 5KYWA 2VCBA 3DM9B 1TQGA 2LSEA 5JSLA 1SR2A 5JT4A 3C63A 2HJMA 1T5OA 1U6HA 2VCCA 2A68F 1FMVA 1MNDA 5JVEA 1LE2A 4PJJA 4BJ5A 4L6RA 3U2MA 3TOMA 4Z9JA 1JOGA 4HFKB 4CS8C 4XEVA 1WWPA 3RIPA 3N24A 1YA9A 1MMGA 4EBJA 1BBHA 2WL8A 4JJFA 3WODF 2YRFA 5DVWA 3QW1A 1L7CA 2EIJC 3JSEO 3ATPA 3K66A 3CSKA 1FMWA 5EHHA 4WABA 1RKEB 1BR4A 2F22A 2HKVA 3NYJA 3O10A 3O55A 2H7VC 4MS2A 3TD7A 2ZXRA 2LFDA 2ZD9A 3JTLO 1Z5ZA 4LLCA 2CNWD 1ZHZA 2JX0A 2VH3A 2J0WA 4N4WA 2R7TA 4O79A 2XL4A 1VB5A 3SXZA 3TK0A 2PNOA 4LDKA 2V3CC 3S28A 3ZTZA 1QSPA 1YARO 4LLEA 2G3KA 4BEMJ 2ZXPA 3DKAA 3KMIA 4CDYA 2R03A 2BE5F 2WVNA 4JTAB 4RD9A 3L0IA 4KC9A 4MTOA 4X0RA 2W4BA 2UUHA 1MQVA 3U3BA 4MW8A 4O7GA 4DXWA 1A0BA 2J9BA 4O6MA 1LKXA 2AWCA 3RYLA 2WVOA 4P6IC 3JYHA 2R02A 5KYUA 2YKZA 2H8AA 1TWCA 3EJNA 1G5ZA 1I5NA 1T6UA 1G4WR 4ULWA 3F47A 3JRTA 3GEEA 1OR3A 2CDQA 1YZCA 3C62A 1FAPB 1IW7F 1YA7O 1Z23A 2DYRC 5COGA 1V55C 1KTMA 2NG1A 3EHMA 3HJCA 4YK5A 5BQGA 1T6QA 4AK9A 1BR2A 4CDAA 2YZSA 1DOVA 2H7BA 2YEVA 4MVUA 4MVSA 3RQFA 2NSFA 3GEHA 2J45A 4BJ5C 4U5BE 1TR2A 3EFOB 3LNRA 5F5HA 4XPYA 2D5RB 2W4MA 3DZAA 1UFBA 3MYIA 2DI3A 4J7TA 3TJ6A 3ZDLA 3EQLF 1SF8A 4XLNF 2ICWG 1OR2A 2FFHA 3NYLA 5HV9A 2Y39A 3N2ZB 1PCXA 2G3VA 3JYYA 2TMVP 3EZIA 3LEOA 3US6A 3VYWA 1K04A 4EBBA 5E3AA 3S27A 4EWCA 5CIVA 3V5XA 1A41A 4YT5A 1E85A 3RVZA 1NU7D 1HW1A 1HY5A 2L6GA 3QVZA 2P7VA 3RQEA 1OCCC 2NPUA 4ER9A 1MMDA 3FAJA 2IXMA 4JE9A 3RW0A 3V7OA 4YT4A 1W2WA 4OIRF 2KC3A 2R7SA 3LEVA 1RXQA 4U5CE 2EILC 5JUAA 3U0CA 2EPKX 2KGOA 5E3CA 3EZHA 4D4NA 1V4AA 2C04A 2Y3DA 4QI0A 2A6HF 1Z63A 3B0UX 4AE4A 1CGOA 1VK5A 5B1BC 2RD9A 1NZEA 2R05A 2WZLA 3T6GB 5HSWA 3QTHA 2M4EA 4MVZA 4PJMA 1QZXA 3W2VA 2L81A 4IWBA 3HTKC 4BJ6C 2OOCA 3O6XA 5CI8A 2OEXA 3X1OA 1OXBA 1GS9A 5BQHA 4U5DE 1VLTA 5EK0A 1TWHA 1D0XA 5BUOA 1RJ9B 2IXNA 3HNIA 2LK4A 2YQYA 4JJGA 4XPWA 1YAUO 2Q9AA 3NKDA 3DXJF 1M56C 4GQHA 2AU5A 5GPGB 1EQ1A 2XLMA 4U5FE 1NG1A 2HMQA 3RKOF 2XSEA 2WZFA 4O6NA 3ZSUA 3PCVA 1S05A 4NY3A 5L0JA 3G4XA 4DRIB 4E0HA 3EH1A 5KYUB 4C7OB 2WB7A 4UDVA 2PP4A 1R5ID 1UG7A 2O9XA 2RSEB 2XS1A 4YL1A 5A6AA 1C03A 1FNTc 4G7HF 3ZVRA 3H65A 3K1IC 2KNHA 4KI2A 2Q4FA 5L0IA 3NKEA 5T3WA 3GWLA 4U9DA 5AGFA 4J32B 3Q7GA 2J7PA 1ZVZA 1FFHA 1OCRC 1JR8A 4NTFA 3NMJA 4Q7CA 3PHF2 2M64A 3POVA 4WJ0A 1O5HA 5F28E 1M2OA 3GM2A 3AJMA 4YL3A 3RFYA 4CJOA 5L3QA 3EGDA 4J30B 2CW0F 4JW1A 2OJQA 4HFFB 3SXYA 2V26A 4E7SA 2YLDA 3L8JA 4XTKA 4JTDB 4K1OA 4DOZA 1WOLA 4XLPF 3SXKA 1AUEA 2VB6A 3V5YA 5A6BD 4ZLDA 1OCOC 1E2XA 3ZC4A 3B0PA 4DJ9A 1EKYA 4N06A 1OW6A 4JKVA 2HS5A 1U89A 1D1AA 1LI5A 1TWAA 2YL1A 3E9VA 3V5ZA 256BA 3EG9B 2XXAB 3S9OA 1M6TA 2OU6A 3K6BA 1ZU4A 2A0BA 2R9RB 3SEOA 3ZIBA 1V74B 4BJ6A 2CNWA 2J9WA 4KBLA 3Q6NA 3WAQA 1Z6AA 2Q9CA 3TQOA 3IQ6A 4YT2A 1FFTC 4ZLCA 2NUPB 1JRAA 2VASA 3W4YA 2XLDA 2P1AA 1HW2A 2OJED 2J8WA 1TFKB 1ZHTA 4I1OB 4PFPA 4BJ1A 3LS0A 2EPNA 1XWJA 2YHSA 1H9GA 4CJGA 5FZTA 1NBBA 4C7OA 2KW3C 5A6KA 3M15A 2AP3A 1WGWA 3K33A 3K7DA 1H7IA 4FX5A 3IQCA 5DQTA 3KPHA 1LVKA 4XEKA 2ASRA 3K1IA 3ABMC 2QUPA 3EFOA 1LM3B 3U9MA 2AVKA 3PMRA 2EINC 3L8IA 4JEAA 1NSGB 4PACA 1ZHYA 1U0BB 4XWJA 2LD6A 2GFHA 3FOPA 4BEJA 5COFA 1HE1A 3I5PA 4EIYA 3HNLA 1ORJA 1PD1A 4MTFA 3TOLA 3AG2C 1T01A 3Q7LA 1JPNA 2XS8A 1E84A 1YYXA 3DE8A 2AWYA 4DRJB 1TKNA 1OCZC 5DS5A
chains in the Genus database with same CATH topology
2ASRA 2D4UA 3T9OA 1VLSA 1JMWA 4H54A 1WASA 2LIGA 4Z9JA 1LIHA 4Z9IA 3ATPA 1WATA 1VLTA 4Z9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ASR A;  2D4U A;  3T9O A;  1VLS A;  1JMW A;  4H54 A;  1WAS A;  2LIG A;  4Z9J A;  1LIH A;  4Z9I A;  3ATP A;  1WAT A;  1VLT A;  4Z9H A; 
#chains in the Genus database with same CATH topology
 3EH2 A;  3M1C B;  3SZR A;  5DS6 A;  1VYI A;  3FDQ A;  2Y3H A;  3FMS A;  3CQZ A;  1T9K A;  3UR3 C;  4IB4 A;  3OEO A;  4MVM A;  3RF3 A;  4MW3 A;  1CPR A;  2XLV A;  2Q00 A;  3ZQV A;  2NUT B;  3ZWI A;  2HJ3 A;  5DLJ A;  4EUK B;  2QY9 A;  2HUJ A;  3B9Q A;  4NCQ A;  1F1M A;  4CS9 C;  4CIH A;  4I1M A;  1KU2 A;  1A7V A;  1HE9 A;  4XEF A;  1Z3I X;  2P61 A;  3GWN A;  1QKR A;  4JZA A;  4KNW A;  3T6B A;  3RQG A;  2C03 A;  3AOU A;  2HMZ A;  1YYJ A;  2WZG A;  3C8G A;  3R7C A;  1PV3 A;  4OD5 A;  5E2Q A;  2XLE A;  2YLG A;  4JIO A;  3T6J A;  2R7O A;  3U8P A;  3X2Q C;  1JAF A;  1M2V B;  3I5Q A;  3TUL A;  1NFN A;  3KL4 A;  1I4Y A;  2I8B A;  5CI9 A;  3H2U A;  2R7U A;  1A7D A;  5E33 A;  3LS1 A;  2IBF A;  3AGU A;  1G4U S;  1VMA A;  2VCA A;  3HLZ A;  3JCU Q;  2ZXO A;  2P6V A;  3E70 C;  5T1D B;  4MTG A;  1H9T A;  1VLS A;  3O39 A;  2R7V A;  1QVX A;  5F5F A;  4H4K C;  3N0T A;  1DOW A;  5A6B A;  5KYX A;  2DYS C;  5JLI A;  3AG1 C;  3DI5 A;  2BL2 A;  3QZC A;  4HE8 D;  4JVS A;  4NTB A;  3FHD A;  1Y6D A;  5L0F A;  5D91 A;  2YWA A;  1BDJ B;  1YJG A;  3DWW A;  4P9F A;  4K0D A;  3OA1 A;  1LPE A;  1M57 C;  2J0X A;  3DAF A;  2R25 A;  4WGY A;  4IGG A;  1O3U A;  1C17 M;  3HNK A;  5COM A;  3VM6 A;  2J7P D;  1WN0 A;  1CGN A;  3G50 A;  4A2N B;  2VC9 A;  1O87 A;  3M79 A;  4C3D A;  3B71 A;  3DE9 A;  5KYW B;  4EKW A;  2W9Y A;  3T9O A;  5JP7 A;  3F46 A;  3LLK A;  1RMV A;  1HMO A;  2Q3T A;  5B3I A;  1OW8 A;  2A0U A;  2IXP A;  3QVY A;  4U5H A;  2OEV A;  3K1H A;  4IAO A;  3M4B A;  4CS9 A;  2HSQ A;  3KH2 A;  2IXO A;  2Y69 C;  3AQC A;  3JRM O;  4MVR A;  4U5E E;  4B6I A;  5L3V A;  3CAX A;  1Q0M A;  3HNJ A;  4XQ1 A;  4BG0 A;  1VYK A;  2XL8 A;  5A69 A;  1D0Y A;  2J9U A;  3MYF A;  1ZHW A;  4IAQ A;  4BJT A;  1OKK D;  4A4A A;  4Q4Z F;  3ITF A;  3MLG A;  2W45 A;  4K7B A;  3U3F A;  3GOR A;  2EPO A;  1NLX A;  1WAS A;  1GQA A;  2GAQ A;  3IQT A;  1Y4C A;  4XPX A;  4CDV A;  1BZ4 A;  3L34 A;  4W8P A;  3U2L A;  3KKB A;  3GM1 A;  4E17 A;  1R4T A;  2EPM X;  1Q0K A;  3ZQY A;  4I3M A;  2X51 A;  1OKK A;  2YLI A;  3LNM B;  4RBN A;  3Q6M A;  4OIQ F;  1K40 A;  2BC5 A;  2ZPA A;  3GEI A;  4R32 A;  2R7X A;  5EGY A;  5JRA A;  4I44 A;  4AE4 B;  4G7Z F;  1WAT A;  2PFD A;  1J8M F;  1LE4 A;  4U9E A;  3RVY A;  4ANJ A;  5IY5 C;  2IM8 A;  1AEP A;  5L0H A;  3S90 A;  3NMK A;  2GA0 A;  1ST6 A;  3VAY A;  3C7J A;  3ASN C;  2G62 A;  1OQC A;  1ZZP A;  2A69 F;  1JMW A;  4G7O F;  4N6C A;  4OIN F;  2XM4 A;  4HEA J;  4OD4 A;  4RDA A;  1FTS A;  2Y3B A;  2PX3 A;  4MND A;  5B1A C;  5BQI A;  4QI2 A;  4PK4 A;  4G0H A;  3I4U A;  4QDL A;  5KYY B;  2R7R A;  2H7O A;  1H6G A;  1N1C A;  2A6E F;  1YLM A;  1ORY A;  1L3P A;  2L6H A;  2OKU A;  1PD0 A;  1SZI A;  3EG9 A;  3LJB A;  3LUT B;  4GYT A;  2NSG A;  1NU9 C;  4MVQ A;  1RKC A;  1RKE A;  3A9C A;  5DQZ A;  4YWQ A;  1ZW2 A;  2ETS A;  5FCL A;  1LI7 A;  4NC3 A;  2EIK C;  3LAY A;  2GDC A;  3DMD A;  1KNY A;  2PBE A;  3FAP B;  4C3B A;  5KYX B;  2R7W A;  2KK1 A;  1T6I A;  2WVQ A;  4AL0 A;  3UGO A;  2YL0 A;  1YZA A;  2L9J A;  4YT8 A;  2J9V A;  4DBR A;  1FR0 A;  2YVK A;  3ABK C;  3T4R A;  4Q5S F;  3UGP A;  1ZYR F;  3EGD B;  3FOO A;  4LER A;  4JCH A;  5KYY A;  2E87 A;  5L0D A;  3MX3 A;  2HV7 A;  3FVY A;  3JSZ A;  3MFN A;  4NTA A;  2JD3 A;  3BEH A;  1TWG A;  2QE9 A;  3KYI A;  2ZXW C;  2P0N A;  3AG4 C;  3M4C A;  3TJ5 A;  4WGZ A;  2LCH A;  2Z15 A;  3C8G B;  2XLH A;  1YDI A;  4JRZ A;  4P9T A;  2J46 A;  1BR1 A;  3C8G D;  3S84 A;  1ORS C;  1LS1 A;  3HKK A;  3IQ5 A;  2D4U A;  4GEH A;  4IRU A;  4JCZ A;  2YL3 A;  4BPM A;  2CCY A;  2EIM C;  3EGX B;  2IOQ A;  3A11 A;  1CGM E;  1EA8 A;  4FWV A;  4EHP A;  2FGY A;  2CYD A;  4LDR A;  4D4X A;  1HMD A;  1QPU A;  3B29 A;  3VRC A;  1D1C A;  1NFO A;  1LS4 A;  2YL7 A;  3W8H A;  3QMK A;  5JS5 A;  2NUP A;  2DGJ A;  1Z7Q c;  2Q7R A;  3LLI A;  4KNV A;  3ZG1 A;  2B0J A;  3IHU A;  4DVY P;  4JEB A;  4FAP B;  2B0H A;  2QLA A;  1RJ9 A;  5D92 A;  3AQB A;  3NDB B;  5AC5 A;  1QQ3 A;  1VOM A;  2OG2 A;  1D1B A;  1V54 C;  3SYN A;  2XLO A;  4MQ9 F;  4YL0 A;  3R2P A;  4F4B A;  4E7Z A;  3JZ0 A;  4ONS A;  1IZM A;  1EI7 A;  1G8X A;  1WTY A;  3CZ6 A;  1SMY F;  3EPV A;  3SP1 A;  4CSA A;  3ABL C;  2KYH A;  1MNE A;  4JTC B;  2JPU A;  4MVO A;  2L6F A;  2OCC C;  1OXK A;  2Q9B A;  2I15 A;  2UUI A;  3ECS A;  3FXH A;  3LES A;  3EHN A;  3G4Z A;  3C8Z A;  4IAR A;  4YJW A;  3NYM A;  3DAG A;  4EBK A;  2KJG A;  1I4Z A;  3UNG C;  5L0G A;  2Y3G A;  3UMH A;  1YVI A;  1VTM P;  3NRH A;  1J8Y F;  2HZ8 A;  2HV6 A;  3WHN A;  4C3E A;  4DBQ A;  4H54 A;  2MYS A;  1LIH A;  3DJN B;  5B3S C;  3GM3 A;  2MHR A;  4PJN A;  4LDQ A;  2EPL X;  4E0I A;  3W8I A;  3U8V A;  2L7A A;  3AG3 C;  2QNL A;  3UMK A;  4IJJ A;  3AGT A;  2KSF A;  3U9J A;  4CS8 A;  1AVO B;  4CIP A;  5DS4 A;  2KQ9 A;  3JT1 A;  5AC4 A;  2XLW A;  3DJU B;  1ZU5 A;  1Q0F A;  3WG7 C;  4OIO F;  2XXA A;  2DB4 A;  3L1M A;  3NG1 A;  4ULV A;  3KYJ A;  1B68 A;  4FES A;  5K0I A;  1XZP A;  2LFF A;  4JC7 A;  3OWT A;  2NUT A;  4E18 A;  5T3T A;  4JUR I;  1ZW3 A;  3BRJ A;  3DD7 A;  2GWW A;  1JPJ A;  1Q0D A;  2MWQ A;  1GM5 A;  4PFO A;  3VF0 A;  1K05 A;  1CPQ A;  2PX0 A;  4M63 A;  3W2W A;  1TFO B;  3CEX A;  3PDM P;  2XM0 A;  3ASO C;  3MBG A;  1OW7 A;  4YN0 B;  1Q0G A;  1QLE C;  4CX9 A;  1E86 A;  3SNH A;  4N6H A;  2LIG A;  3B0V C;  1E83 A;  1APC A;  3QW0 A;  4J7Y A;  3S29 A;  3ZTM A;  4LAC B;  4AL1 A;  4DRH B;  3GOD A;  1M2V A;  4OIP F;  2XL6 A;  4PR9 A;  1S7Z A;  4CS7 A;  5KYN A;  3UMI A;  2X0C A;  2PF4 E;  1ZHX A;  2IYL D;  3U5S A;  4CBE A;  2QTV A;  5TJ5 E;  4DVZ A;  2A1D D;  2LQG A;  3NMI A;  4O6Y A;  2LP4 A;  4Z9H A;  3J06 A;  4U5G A;  2FAP B;  3RH3 A;  4AX2 A;  4CSA C;  3IEE A;  4PJL A;  3GAN A;  3DM5 A;  5A6J A;  1XZQ A;  5L0C A;  2CGE A;  3EGX A;  3H2V A;  3C18 A;  3SXM A;  3IPM O;  1MMA A;  2OQM A;  2HSB A;  2HFI A;  1RCP A;  1GGQ A;  1A7E A;  4Z9I A;  3S0X A;  1MMN A;  1SYQ A;  1C02 A;  1D0Z A;  2R7Q A;  4G78 A;  4NQF A;  4W8K A;  2XRH A;  5KYW A;  2VCB A;  3DM9 B;  1TQG A;  2LSE A;  5JSL A;  1SR2 A;  5JT4 A;  3C63 A;  2HJM A;  1T5O A;  1U6H A;  2VCC A;  2A68 F;  1FMV A;  1MND A;  5JVE A;  1LE2 A;  4PJJ A;  4BJ5 A;  4L6R A;  3U2M A;  3TOM A;  4Z9J A;  1JOG A;  4HFK B;  4CS8 C;  4XEV A;  1WWP A;  3RIP A;  3N24 A;  1YA9 A;  1MMG A;  4EBJ A;  1BBH A;  2WL8 A;  4JJF A;  3WOD F;  2YRF A;  5DVW A;  3QW1 A;  1L7C A;  2EIJ C;  3JSE O;  3ATP A;  3K66 A;  3CSK A;  1FMW A;  5EHH A;  4WAB A;  1RKE B;  1BR4 A;  2F22 A;  2HKV A;  3NYJ A;  3O10 A;  3O55 A;  2H7V C;  4MS2 A;  3TD7 A;  2ZXR A;  2LFD A;  2ZD9 A;  3JTL O;  1Z5Z A;  4LLC A;  2CNW D;  1ZHZ A;  2JX0 A;  2VH3 A;  2J0W A;  4N4W A;  2R7T A;  4O79 A;  2XL4 A;  1VB5 A;  3SXZ A;  3TK0 A;  2PNO A;  4LDK A;  2V3C C;  3S28 A;  3ZTZ A;  1QSP A;  1YAR O;  4LLE A;  2G3K A;  4BEM J;  2ZXP A;  3DKA A;  3KMI A;  4CDY A;  2R03 A;  2BE5 F;  2WVN A;  4JTA B;  4RD9 A;  3L0I A;  4KC9 A;  4MTO A;  4X0R A;  2W4B A;  2UUH A;  1MQV A;  3U3B A;  4MW8 A;  4O7G A;  4DXW A;  1A0B A;  2J9B A;  4O6M A;  1LKX A;  2AWC A;  3RYL A;  2WVO A;  4P6I C;  3JYH A;  2R02 A;  5KYU A;  2YKZ A;  2H8A A;  1TWC A;  3EJN A;  1G5Z A;  1I5N A;  1T6U A;  1G4W R;  4ULW A;  3F47 A;  3JRT A;  3GEE A;  1OR3 A;  2CDQ A;  1YZC A;  3C62 A;  1FAP B;  1IW7 F;  1YA7 O;  1Z23 A;  2DYR C;  5COG A;  1V55 C;  1KTM A;  2NG1 A;  3EHM A;  3HJC A;  4YK5 A;  5BQG A;  1T6Q A;  4AK9 A;  1BR2 A;  4CDA A;  2YZS A;  1DOV A;  2H7B A;  2YEV A;  4MVU A;  4MVS A;  3RQF A;  2NSF A;  3GEH A;  2J45 A;  4BJ5 C;  4U5B E;  1TR2 A;  3EFO B;  3LNR A;  5F5H A;  4XPY A;  2D5R B;  2W4M A;  3DZA A;  1UFB A;  3MYI A;  2DI3 A;  4J7T A;  3TJ6 A;  3ZDL A;  3EQL F;  1SF8 A;  4XLN F;  2ICW G;  1OR2 A;  2FFH A;  3NYL A;  5HV9 A;  2Y39 A;  3N2Z B;  1PCX A;  2G3V A;  3JYY A;  2TMV P;  3EZI A;  3LEO A;  3US6 A;  3VYW A;  1K04 A;  4EBB A;  5E3A A;  3S27 A;  4EWC A;  5CIV A;  3V5X A;  1A41 A;  4YT5 A;  1E85 A;  3RVZ A;  1NU7 D;  1HW1 A;  1HY5 A;  2L6G A;  3QVZ A;  2P7V A;  3RQE A;  1OCC C;  2NPU A;  4ER9 A;  1MMD A;  3FAJ A;  2IXM A;  4JE9 A;  3RW0 A;  3V7O A;  4YT4 A;  1W2W A;  4OIR F;  2KC3 A;  2R7S A;  3LEV A;  1RXQ A;  4U5C E;  2EIL C;  5JUA A;  3U0C A;  2EPK X;  2KGO A;  5E3C A;  3EZH A;  4D4N A;  1V4A A;  2C04 A;  2Y3D A;  4QI0 A;  2A6H F;  1Z63 A;  3B0U X;  4AE4 A;  1CGO A;  1VK5 A;  5B1B C;  2RD9 A;  1NZE A;  2R05 A;  2WZL A;  3T6G B;  5HSW A;  3QTH A;  2M4E A;  4MVZ A;  4PJM A;  1QZX A;  3W2V A;  2L81 A;  4IWB A;  3HTK C;  4BJ6 C;  2OOC A;  3O6X A;  5CI8 A;  2OEX A;  3X1O A;  1OXB A;  1GS9 A;  5BQH A;  4U5D E;  1VLT A;  5EK0 A;  1TWH A;  1D0X A;  5BUO A;  1RJ9 B;  2IXN A;  3HNI A;  2LK4 A;  2YQY A;  4JJG A;  4XPW A;  1YAU O;  2Q9A A;  3NKD A;  3DXJ F;  1M56 C;  4GQH A;  2AU5 A;  5GPG B;  1EQ1 A;  2XLM A;  4U5F E;  1NG1 A;  2HMQ A;  3RKO F;  2XSE A;  2WZF A;  4O6N A;  3ZSU A;  3PCV A;  1S05 A;  4NY3 A;  5L0J A;  3G4X A;  4DRI B;  4E0H A;  3EH1 A;  5KYU B;  4C7O B;  2WB7 A;  4UDV A;  2PP4 A;  1R5I D;  1UG7 A;  2O9X A;  2RSE B;  2XS1 A;  4YL1 A;  5A6A A;  1C03 A;  1FNT c;  4G7H F;  3ZVR A;  3H65 A;  3K1I C;  2KNH A;  4KI2 A;  2Q4F A;  5L0I A;  3NKE A;  5T3W A;  3GWL A;  4U9D A;  5AGF A;  4J32 B;  3Q7G A;  2J7P A;  1ZVZ A;  1FFH A;  1OCR C;  1JR8 A;  4NTF A;  3NMJ A;  4Q7C A;  3PHF 2;  2M64 A;  3POV A;  4WJ0 A;  1O5H A;  5F28 E;  1M2O A;  3GM2 A;  3AJM A;  4YL3 A;  3RFY A;  4CJO A;  5L3Q A;  3EGD A;  4J30 B;  2CW0 F;  4JW1 A;  2OJQ A;  4HFF B;  3SXY A;  2V26 A;  4E7S A;  2YLD A;  3L8J A;  4XTK A;  4JTD B;  4K1O A;  4DOZ A;  1WOL A;  4XLP F;  3SXK A;  1AUE A;  2VB6 A;  3V5Y A;  5A6B D;  4ZLD A;  1OCO C;  1E2X A;  3ZC4 A;  3B0P A;  4DJ9 A;  1EKY A;  4N06 A;  1OW6 A;  4JKV A;  2HS5 A;  1U89 A;  1D1A A;  1LI5 A;  1TWA A;  2YL1 A;  3E9V A;  3V5Z A;  256B A;  3EG9 B;  2XXA B;  3S9O A;  1M6T A;  2OU6 A;  3K6B A;  1ZU4 A;  2A0B A;  2R9R B;  3SEO A;  3ZIB A;  1V74 B;  4BJ6 A;  2CNW A;  2J9W A;  4KBL A;  3Q6N A;  3WAQ A;  1Z6A A;  2Q9C A;  3TQO A;  3IQ6 A;  4YT2 A;  1FFT C;  4ZLC A;  2NUP B;  1JRA A;  2VAS A;  3W4Y A;  2XLD A;  2P1A A;  1HW2 A;  2OJE D;  2J8W A;  1TFK B;  1ZHT A;  4I1O B;  4PFP A;  4BJ1 A;  3LS0 A;  2EPN A;  1XWJ A;  2YHS A;  1H9G A;  4CJG A;  5FZT A;  1NBB A;  4C7O A;  2KW3 C;  5A6K A;  3M15 A;  2AP3 A;  1WGW A;  3K33 A;  3K7D A;  1H7I A;  4FX5 A;  3IQC A;  5DQT A;  3KPH A;  1LVK A;  4XEK A;  2ASR A;  3K1I A;  3ABM C;  2QUP A;  3EFO A;  1LM3 B;  3U9M A;  2AVK A;  3PMR A;  2EIN C;  3L8I A;  4JEA A;  1NSG B;  4PAC A;  1ZHY A;  1U0B B;  4XWJ A;  2LD6 A;  2GFH A;  3FOP A;  4BEJ A;  5COF A;  1HE1 A;  3I5P A;  4EIY A;  3HNL A;  1ORJ A;  1PD1 A;  4MTF A;  3TOL A;  3AG2 C;  1T01 A;  3Q7L A;  1JPN A;  2XS8 A;  1E84 A;  1YYX A;  3DE8 A;  2AWY A;  4DRJ B;  1TKN A;  1OCZ C;  5DS5 A; 
#chains in the Genus database with same CATH homology
 2ASR A;  2D4U A;  3T9O A;  1VLS A;  1JMW A;  4H54 A;  1WAS A;  2LIG A;  4Z9J A;  1LIH A;  4Z9I A;  3ATP A;  1WAT A;  1VLT A;  4Z9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...