1VM0A

X-ray structure of gene product from arabidopsis thaliana at2g34160
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
93
Chain Sequence
KKNRIQVSNTKKPLFFYVNLAKRYMQQYNDVELSALGMAIATVVTVTEILKNNGFAVEKKIMTSIVDIKPVQKAKIEITLVKSEKFDELMAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-RAY STRUCTURE OF GENE PRODUCT FROM ARABIDOPSIS THALIANA AT2G34160
rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
molecule keywords unknown protein
total genus 26
structure length 93
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01918 Alba Alba
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.20 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Alba-like domain 1vm0A00
1NFHA 1NH9A 2Q3VA 1NFJA 2EK0A 2A2YA 1UDVA 3TOEA 2H9UA 2Z7CA 2BKYX 1H0YA 2EH1A 3IABB 1H0XA 1Y9XA 1VM0A 3IABA 3U6YA 3WBMA 4Z9EA
chains in the Genus database with same CATH superfamily
2L8YA 1NFHA 2LN3A 4NCXA 3DSCA 4FBQA 3DSDA 1S8EA 4NZRM 3TSQA 1JDQA 2H9UA 3ZIEA 2Y1BA 3LVJC 2Z7CA 4Q15A 1H0YA 2EH1A 4EO0A 4FCXA 4Z9EA 3VTIA 4FBKA 1Y2IA 3TSUA 4WI1A 1TIGA 3ZIHA 1NJ2A 2CRQA 1VR4A 1DCJA 4NZTM 3LVKB 1NFJA 2A2YA 4OLFA 4TWAA 3TSPA 2LXRA 3ZIIA 1H4SA 1H4TA 2IFEA 1RQ8A 1PAVA 3U6YA 3TTCA 4HD0A 1HC7A 4YKEA 3P04A 1NH9A 2Q3VA 2EK0A 3HZ7A 1NJ5A 1UDVA 1NJ1A 4K87A 3IABB 1Y9XA 1II7A 1VM0A 3IABA 2P9BA 2GTCA 4K86A 2M71A 4HVCA 3QKBA 3VTHA 1H4QA 3TTDA 1JE3A 3T1IA 3IALA 3TOEA 4YDQA 2BKYX 1H0XA 1LN4A 3ZIGA 3TTFA 4K88A 1NJ8A 1NJ6A 4FBWA 4HVZA 3WBMA 1JO0A 1XEZA
chains in the Genus database with same CATH topology
1NFHA 1NH9A 2Q3VA 1NFJA 2EK0A 2A2YA 1UDVA 3TOEA 2H9UA 2Z7CA 2BKYX 1H0YA 2EH1A 3IABB 1H0XA 1Y9XA 1VM0A 3IABA 3U6YA 3WBMA 4Z9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NFH A;  1NH9 A;  2Q3V A;  1NFJ A;  2EK0 A;  2A2Y A;  1UDV A;  3TOE A;  2H9U A;  2Z7C A;  2BKY X;  1H0Y A;  2EH1 A;  3IAB B;  1H0X A;  1Y9X A;  1VM0 A;  3IAB A;  3U6Y A;  3WBM A;  4Z9E A; 
#chains in the Genus database with same CATH topology
 2L8Y A;  1NFH A;  2LN3 A;  4NCX A;  3DSC A;  4FBQ A;  3DSD A;  1S8E A;  4NZR M;  3TSQ A;  1JDQ A;  2H9U A;  3ZIE A;  2Y1B A;  3LVJ C;  2Z7C A;  4Q15 A;  1H0Y A;  2EH1 A;  4EO0 A;  4FCX A;  4Z9E A;  3VTI A;  4FBK A;  1Y2I A;  3TSU A;  4WI1 A;  1TIG A;  3ZIH A;  1NJ2 A;  2CRQ A;  1VR4 A;  1DCJ A;  4NZT M;  3LVK B;  1NFJ A;  2A2Y A;  4OLF A;  4TWA A;  3TSP A;  2LXR A;  3ZII A;  1H4S A;  1H4T A;  2IFE A;  1RQ8 A;  1PAV A;  3U6Y A;  3TTC A;  4HD0 A;  1HC7 A;  4YKE A;  3P04 A;  1NH9 A;  2Q3V A;  2EK0 A;  3HZ7 A;  1NJ5 A;  1UDV A;  1NJ1 A;  4K87 A;  3IAB B;  1Y9X A;  1II7 A;  1VM0 A;  3IAB A;  2P9B A;  2GTC A;  4K86 A;  2M71 A;  4HVC A;  3QKB A;  3VTH A;  1H4Q A;  3TTD A;  1JE3 A;  3T1I A;  3IAL A;  3TOE A;  4YDQ A;  2BKY X;  1H0X A;  1LN4 A;  3ZIG A;  3TTF A;  4K88 A;  1NJ8 A;  1NJ6 A;  4FBW A;  4HVZ A;  3WBM A;  1JO0 A;  1XEZ A; 
#chains in the Genus database with same CATH homology
 1NFH A;  1NH9 A;  2Q3V A;  1NFJ A;  2EK0 A;  2A2Y A;  1UDV A;  3TOE A;  2H9U A;  2Z7C A;  2BKY X;  1H0Y A;  2EH1 A;  3IAB B;  1H0X A;  1Y9X A;  1VM0 A;  3IAB A;  3U6Y A;  3WBM A;  4Z9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...