1VM9A

The x-ray structure of the cys84ala cys85ala double mutant of the [2fe-2s] ferredoxin subunit of toluene-4-monooxygenase from pseudomonas mendocina kr1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
b'SFEKICSLDDIWVGEMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein C
publication title Structure of T4moC, the Rieske-type ferredoxin component of toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Electron transport
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1vm9A00
1UUVA 2NUKA 3GCEA 3VMHD 1ULIA 2XSHA 3BCCE 2I7FA 3CXHE 1RFSA 2FYNC 1SQVE 2E4QA 4HM1A 4EMJB 2YFJA 4HJLA 3D89A 1O7GA 1RIEA 4U3FE 2JO6A 4QURA 1O7WA 3L71E 1PPJE 1JM1A 2XRXA 2XSOA 3L72E 1Q90C 2A06E 2CKFA 2YVJB 1ULJA 3VCAA 2E4PA 4H44D 3GZXA 2BCCE 4HM0A 3H1LE 4NBED 4HM6A 4QDFB 1G8KB 3H1HE 3TGUE 1VM9A 2E76D 4OGQD 1VCKA 2QPZA 3H1JE 2YIUC 1VF5D 4H13D 1NTME 4NBBD 1UUWA 1O7NA 4PD4E 5KLVE 4NBHD 4QDFA 1SQXE 3L75E 2YFLA 3H1KE 3CX5E 2E74D 4HKVA 3VMGD 4AIVA 2ZT9D 4AAYB 1O7HA 4QCKA 3EQQA 4H0LD 2NWFA 4HM8A 4PV1D 2BMOA 2NUMA 3GKEA 1BE3E 2ZYLA 3L70E 2QJPC 3GOBA 4QDCA 4NBDD 4QUQA 2JZAA 1P84E 4NBCD 2Q3WA 3DQYA 1EZVE 2HMJA 4HM5A 4NBFD 1BCCE 4NBGD 2D2CD 3GB4A 1NDOA 4P1CH 4HM4A 2DE5D 1FQTA 2NVGA 2IBZE 3N0QA 5BOKA 2XR8A 4QUPA 2YFIA 3C0DA 3VMID 2DE6D 2B1XA 1NTKE 1G8JB 1NU1E 3H1IE 2B24A 4QDDA 2QJYC 4HM3A 1L0LE 1ZRTE 3GZYA 4P1BH 3GL0A 2E75D 2FYUE 2BMQA 1SQPE 1NTZE 2QJKC 5CXMA 1SJGA 4HM7A 2HMMA 5AEWA 2NVFA 1WQLA 5HL4A 4NBAD 2HMKA 3GL2A 5AEUA 1O7MA 3GTSA 1NYKA 1SQBE 2DE7D 4NB8D 2HMOA 1L0NE 2HMLA 3GTEA 5KKZC 1O7PA 3L74E 3VCPA 5KLIC 2GBWA 1EG9A 3L73E 2HMNA 3EN1A 1KB9E 2BMRA 3CWBE 4HM2A 3FOUA 3AZCA 4NB9D 2GBXA 1SQQE 2NVEA 1KYOE 1PP9E
chains in the Genus database with same CATH superfamily
1UUVA 2NUKA 3GCEA 3VMHD 1ULIA 2XSHA 3BCCE 2I7FA 3CXHE 1RFSA 2FYNC 1SQVE 2E4QA 4HM1A 4EMJB 2YFJA 4HJLA 3D89A 1O7GA 1RIEA 4U3FE 2JO6A 4QURA 1O7WA 3L71E 1PPJE 1JM1A 2XRXA 2XSOA 3L72E 1Q90C 2A06E 2CKFA 2YVJB 1ULJA 3VCAA 2E4PA 4H44D 3GZXA 2BCCE 4HM0A 3H1LE 4NBED 4HM6A 4QDFB 1G8KB 3H1HE 3TGUE 1VM9A 2E76D 4OGQD 1VCKA 2QPZA 3H1JE 2YIUC 1VF5D 4H13D 1NTME 4NBBD 1UUWA 1O7NA 4PD4E 5KLVE 4NBHD 4QDFA 1SQXE 3L75E 2YFLA 3H1KE 3CX5E 2E74D 4HKVA 3VMGD 4AIVA 2ZT9D 4AAYB 1O7HA 4QCKA 3EQQA 4H0LD 2NWFA 4HM8A 4PV1D 2BMOA 2NUMA 3GKEA 1BE3E 2ZYLA 3L70E 2QJPC 3GOBA 4QDCA 4NBDD 4QUQA 2JZAA 1P84E 4NBCD 2Q3WA 3DQYA 1EZVE 2HMJA 4HM5A 4NBFD 1BCCE 4NBGD 2D2CD 3GB4A 1NDOA 4P1CH 4HM4A 2DE5D 1FQTA 2NVGA 2IBZE 3N0QA 5BOKA 2XR8A 4QUPA 2YFIA 3C0DA 3VMID 2DE6D 2B1XA 1NTKE 1G8JB 1NU1E 3H1IE 2B24A 4QDDA 2QJYC 4HM3A 1L0LE 1ZRTE 3GZYA 4P1BH 3GL0A 2E75D 2FYUE 2BMQA 1SQPE 1NTZE 2QJKC 5CXMA 1SJGA 4HM7A 2HMMA 5AEWA 2NVFA 1WQLA 5HL4A 4NBAD 2HMKA 3GL2A 5AEUA 1O7MA 3GTSA 1NYKA 1SQBE 2DE7D 4NB8D 2HMOA 1L0NE 2HMLA 3GTEA 5KKZC 1O7PA 3L74E 3VCPA 5KLIC 2GBWA 1EG9A 3L73E 2HMNA 3EN1A 1KB9E 2BMRA 3CWBE 4HM2A 3FOUA 3AZCA 4NB9D 2GBXA 1SQQE 2NVEA 1KYOE 1PP9E
chains in the Genus database with same CATH topology
1UUVA 2NUKA 3GCEA 3VMHD 1ULIA 2XSHA 3BCCE 2I7FA 3CXHE 1RFSA 2FYNC 1SQVE 2E4QA 4HM1A 4EMJB 2YFJA 4HJLA 3D89A 1O7GA 1RIEA 4U3FE 2JO6A 4QURA 1O7WA 3L71E 1PPJE 1JM1A 2XRXA 2XSOA 3L72E 1Q90C 2A06E 2CKFA 2YVJB 1ULJA 3VCAA 2E4PA 4H44D 3GZXA 2BCCE 4HM0A 3H1LE 4NBED 4HM6A 4QDFB 1G8KB 3H1HE 3TGUE 1VM9A 2E76D 4OGQD 1VCKA 2QPZA 3H1JE 2YIUC 1VF5D 4H13D 1NTME 4NBBD 1UUWA 1O7NA 4PD4E 5KLVE 4NBHD 4QDFA 1SQXE 3L75E 2YFLA 3H1KE 3CX5E 2E74D 4HKVA 3VMGD 4AIVA 2ZT9D 4AAYB 1O7HA 4QCKA 3EQQA 4H0LD 2NWFA 4HM8A 4PV1D 2BMOA 2NUMA 3GKEA 1BE3E 2ZYLA 3L70E 2QJPC 3GOBA 4QDCA 4NBDD 4QUQA 2JZAA 1P84E 4NBCD 2Q3WA 3DQYA 1EZVE 2HMJA 4HM5A 4NBFD 1BCCE 4NBGD 2D2CD 3GB4A 1NDOA 4P1CH 4HM4A 2DE5D 1FQTA 2NVGA 2IBZE 3N0QA 5BOKA 2XR8A 4QUPA 2YFIA 3C0DA 3VMID 2DE6D 2B1XA 1NTKE 1G8JB 1NU1E 3H1IE 2B24A 4QDDA 2QJYC 4HM3A 1L0LE 1ZRTE 3GZYA 4P1BH 3GL0A 2E75D 2FYUE 2BMQA 1SQPE 1NTZE 2QJKC 5CXMA 1SJGA 4HM7A 2HMMA 5AEWA 2NVFA 1WQLA 5HL4A 4NBAD 2HMKA 3GL2A 5AEUA 1O7MA 3GTSA 1NYKA 1SQBE 2DE7D 4NB8D 2HMOA 1L0NE 2HMLA 3GTEA 5KKZC 1O7PA 3L74E 3VCPA 5KLIC 2GBWA 1EG9A 3L73E 2HMNA 3EN1A 1KB9E 2BMRA 3CWBE 4HM2A 3FOUA 3AZCA 4NB9D 2GBXA 1SQQE 2NVEA 1KYOE 1PP9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UUV A;  2NUK A;  3GCE A;  3VMH D;  1ULI A;  2XSH A;  3BCC E;  2I7F A;  3CXH E;  1RFS A;  2FYN C;  1SQV E;  2E4Q A;  4HM1 A;  4EMJ B;  2YFJ A;  4HJL A;  3D89 A;  1O7G A;  1RIE A;  4U3F E;  2JO6 A;  4QUR A;  1O7W A;  3L71 E;  1PPJ E;  1JM1 A;  2XRX A;  2XSO A;  3L72 E;  1Q90 C;  2A06 E;  2CKF A;  2YVJ B;  1ULJ A;  3VCA A;  2E4P A;  4H44 D;  3GZX A;  2BCC E;  4HM0 A;  3H1L E;  4NBE D;  4HM6 A;  4QDF B;  1G8K B;  3H1H E;  3TGU E;  1VM9 A;  2E76 D;  4OGQ D;  1VCK A;  2QPZ A;  3H1J E;  2YIU C;  1VF5 D;  4H13 D;  1NTM E;  4NBB D;  1UUW A;  1O7N A;  4PD4 E;  5KLV E;  4NBH D;  4QDF A;  1SQX E;  3L75 E;  2YFL A;  3H1K E;  3CX5 E;  2E74 D;  4HKV A;  3VMG D;  4AIV A;  2ZT9 D;  4AAY B;  1O7H A;  4QCK A;  3EQQ A;  4H0L D;  2NWF A;  4HM8 A;  4PV1 D;  2BMO A;  2NUM A;  3GKE A;  1BE3 E;  2ZYL A;  3L70 E;  2QJP C;  3GOB A;  4QDC A;  4NBD D;  4QUQ A;  2JZA A;  1P84 E;  4NBC D;  2Q3W A;  3DQY A;  1EZV E;  2HMJ A;  4HM5 A;  4NBF D;  1BCC E;  4NBG D;  2D2C D;  3GB4 A;  1NDO A;  4P1C H;  4HM4 A;  2DE5 D;  1FQT A;  2NVG A;  2IBZ E;  3N0Q A;  5BOK A;  2XR8 A;  4QUP A;  2YFI A;  3C0D A;  3VMI D;  2DE6 D;  2B1X A;  1NTK E;  1G8J B;  1NU1 E;  3H1I E;  2B24 A;  4QDD A;  2QJY C;  4HM3 A;  1L0L E;  1ZRT E;  3GZY A;  4P1B H;  3GL0 A;  2E75 D;  2FYU E;  2BMQ A;  1SQP E;  1NTZ E;  2QJK C;  5CXM A;  1SJG A;  4HM7 A;  2HMM A;  5AEW A;  2NVF A;  1WQL A;  5HL4 A;  4NBA D;  2HMK A;  3GL2 A;  5AEU A;  1O7M A;  3GTS A;  1NYK A;  1SQB E;  2DE7 D;  4NB8 D;  2HMO A;  1L0N E;  2HML A;  3GTE A;  5KKZ C;  1O7P A;  3L74 E;  3VCP A;  5KLI C;  2GBW A;  1EG9 A;  3L73 E;  2HMN A;  3EN1 A;  1KB9 E;  2BMR A;  3CWB E;  4HM2 A;  3FOU A;  3AZC A;  4NB9 D;  2GBX A;  1SQQ E;  2NVE A;  1KYO E;  1PP9 E; 
#chains in the Genus database with same CATH topology
 1UUV A;  2NUK A;  3GCE A;  3VMH D;  1ULI A;  2XSH A;  3BCC E;  2I7F A;  3CXH E;  1RFS A;  2FYN C;  1SQV E;  2E4Q A;  4HM1 A;  4EMJ B;  2YFJ A;  4HJL A;  3D89 A;  1O7G A;  1RIE A;  4U3F E;  2JO6 A;  4QUR A;  1O7W A;  3L71 E;  1PPJ E;  1JM1 A;  2XRX A;  2XSO A;  3L72 E;  1Q90 C;  2A06 E;  2CKF A;  2YVJ B;  1ULJ A;  3VCA A;  2E4P A;  4H44 D;  3GZX A;  2BCC E;  4HM0 A;  3H1L E;  4NBE D;  4HM6 A;  4QDF B;  1G8K B;  3H1H E;  3TGU E;  1VM9 A;  2E76 D;  4OGQ D;  1VCK A;  2QPZ A;  3H1J E;  2YIU C;  1VF5 D;  4H13 D;  1NTM E;  4NBB D;  1UUW A;  1O7N A;  4PD4 E;  5KLV E;  4NBH D;  4QDF A;  1SQX E;  3L75 E;  2YFL A;  3H1K E;  3CX5 E;  2E74 D;  4HKV A;  3VMG D;  4AIV A;  2ZT9 D;  4AAY B;  1O7H A;  4QCK A;  3EQQ A;  4H0L D;  2NWF A;  4HM8 A;  4PV1 D;  2BMO A;  2NUM A;  3GKE A;  1BE3 E;  2ZYL A;  3L70 E;  2QJP C;  3GOB A;  4QDC A;  4NBD D;  4QUQ A;  2JZA A;  1P84 E;  4NBC D;  2Q3W A;  3DQY A;  1EZV E;  2HMJ A;  4HM5 A;  4NBF D;  1BCC E;  4NBG D;  2D2C D;  3GB4 A;  1NDO A;  4P1C H;  4HM4 A;  2DE5 D;  1FQT A;  2NVG A;  2IBZ E;  3N0Q A;  5BOK A;  2XR8 A;  4QUP A;  2YFI A;  3C0D A;  3VMI D;  2DE6 D;  2B1X A;  1NTK E;  1G8J B;  1NU1 E;  3H1I E;  2B24 A;  4QDD A;  2QJY C;  4HM3 A;  1L0L E;  1ZRT E;  3GZY A;  4P1B H;  3GL0 A;  2E75 D;  2FYU E;  2BMQ A;  1SQP E;  1NTZ E;  2QJK C;  5CXM A;  1SJG A;  4HM7 A;  2HMM A;  5AEW A;  2NVF A;  1WQL A;  5HL4 A;  4NBA D;  2HMK A;  3GL2 A;  5AEU A;  1O7M A;  3GTS A;  1NYK A;  1SQB E;  2DE7 D;  4NB8 D;  2HMO A;  1L0N E;  2HML A;  3GTE A;  5KKZ C;  1O7P A;  3L74 E;  3VCP A;  5KLI C;  2GBW A;  1EG9 A;  3L73 E;  2HMN A;  3EN1 A;  1KB9 E;  2BMR A;  3CWB E;  4HM2 A;  3FOU A;  3AZC A;  4NB9 D;  2GBX A;  1SQQ E;  2NVE A;  1KYO E;  1PP9 E; 
#chains in the Genus database with same CATH homology
 1UUV A;  2NUK A;  3GCE A;  3VMH D;  1ULI A;  2XSH A;  3BCC E;  2I7F A;  3CXH E;  1RFS A;  2FYN C;  1SQV E;  2E4Q A;  4HM1 A;  4EMJ B;  2YFJ A;  4HJL A;  3D89 A;  1O7G A;  1RIE A;  4U3F E;  2JO6 A;  4QUR A;  1O7W A;  3L71 E;  1PPJ E;  1JM1 A;  2XRX A;  2XSO A;  3L72 E;  1Q90 C;  2A06 E;  2CKF A;  2YVJ B;  1ULJ A;  3VCA A;  2E4P A;  4H44 D;  3GZX A;  2BCC E;  4HM0 A;  3H1L E;  4NBE D;  4HM6 A;  4QDF B;  1G8K B;  3H1H E;  3TGU E;  1VM9 A;  2E76 D;  4OGQ D;  1VCK A;  2QPZ A;  3H1J E;  2YIU C;  1VF5 D;  4H13 D;  1NTM E;  4NBB D;  1UUW A;  1O7N A;  4PD4 E;  5KLV E;  4NBH D;  4QDF A;  1SQX E;  3L75 E;  2YFL A;  3H1K E;  3CX5 E;  2E74 D;  4HKV A;  3VMG D;  4AIV A;  2ZT9 D;  4AAY B;  1O7H A;  4QCK A;  3EQQ A;  4H0L D;  2NWF A;  4HM8 A;  4PV1 D;  2BMO A;  2NUM A;  3GKE A;  1BE3 E;  2ZYL A;  3L70 E;  2QJP C;  3GOB A;  4QDC A;  4NBD D;  4QUQ A;  2JZA A;  1P84 E;  4NBC D;  2Q3W A;  3DQY A;  1EZV E;  2HMJ A;  4HM5 A;  4NBF D;  1BCC E;  4NBG D;  2D2C D;  3GB4 A;  1NDO A;  4P1C H;  4HM4 A;  2DE5 D;  1FQT A;  2NVG A;  2IBZ E;  3N0Q A;  5BOK A;  2XR8 A;  4QUP A;  2YFI A;  3C0D A;  3VMI D;  2DE6 D;  2B1X A;  1NTK E;  1G8J B;  1NU1 E;  3H1I E;  2B24 A;  4QDD A;  2QJY C;  4HM3 A;  1L0L E;  1ZRT E;  3GZY A;  4P1B H;  3GL0 A;  2E75 D;  2FYU E;  2BMQ A;  1SQP E;  1NTZ E;  2QJK C;  5CXM A;  1SJG A;  4HM7 A;  2HMM A;  5AEW A;  2NVF A;  1WQL A;  5HL4 A;  4NBA D;  2HMK A;  3GL2 A;  5AEU A;  1O7M A;  3GTS A;  1NYK A;  1SQB E;  2DE7 D;  4NB8 D;  2HMO A;  1L0N E;  2HML A;  3GTE A;  5KKZ C;  1O7P A;  3L74 E;  3VCP A;  5KLI C;  2GBW A;  1EG9 A;  3L73 E;  2HMN A;  3EN1 A;  1KB9 E;  2BMR A;  3CWB E;  4HM2 A;  3FOU A;  3AZC A;  4NB9 D;  2GBX A;  1SQQ E;  2NVE A;  1KYO E;  1PP9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...