1VM9A

The x-ray structure of the cys84ala cys85ala double mutant of the [2fe-2s] ferredoxin subunit of toluene-4-monooxygenase from pseudomonas mendocina kr1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
SFEKICSLDDIWVGEMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of T4moC, the Rieske-type ferredoxin component of toluene 4-monooxygenase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Electron transport
molecule keywords Toluene-4-monooxygenase system protein C
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2004-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1vm9A00
2JZAA 2FYNC 3GZXA 2YIUC 1KB9E 4QUPA 1FQTA 4AAYB 2ZYLA 1L0LE 3GCEA 5AEUA 4NBCD 2A06E 3GKEA 1G8KB 2YFLA 3BCCE 4PD4E 4QDDA 3L71E 5AEWA 5KLIC 4NBED 1O7WA 2IBZE 3VCAA 2HMJA 2GBXA 3GL0A 5BOKA 2BMOA 1BCCE 4NBGD 4NBBD 2E4PA 1NTZE 1SQVE 2FYUE 3H1HE 1ULIA 2GBWA 5CXMA 3FOUA 1VM9A 1O7NA 4EMJB 3GTEA 4H44D 3DQYA 3L72E 1NYKA 1NU1E 1EG9A 2YVJB 4H13D 2NUMA 1G8JB 3L70E 3AZCA 1SQPE 4HM2A 1SQQE 4NBAD 4QDFB 1WQLA 4HKVA 3H1JE 1O7HA 4HM0A 5KLVE 2NUKA 3VMHD 2DE7D 4QCKA 3C0DA 2QPZA 2YFIA 1VCKA 2HMKA 2NWFA 1NDOA 2HMLA 3CWBE 3D89A 2DE5D 3H1IE 1L0NE 3GZYA 3N0QA 4HM8A 2BMQA 1O7GA 2E75D 1NTME 4AIVA 2JO6A 3CX5E 1RFSA 2CKFA 1O7PA 2QJPC 2Q3WA 1ZRTE 2XSHA 4HM4A 2NVFA 3L75E 2B1XA 1P84E 3H1KE 4HM7A 4NBHD 2D2CD 1JM1A 4HM5A 2XSOA 4NB9D 3GL2A 4P1BH 1VF5D 4QURA 2QJYC 4QDCA 2XRXA 4HM1A 3EQQA 2HMNA 3VMGD 2BMRA 1PP9E 1SJGA 3GB4A 4NB8D 4U3FE 1SQBE 1EZVE 1ULJA 4P1CH 3H1LE 2QJKC 2XR8A 3EN1A 3VMID 1NTKE 1RIEA 2HMMA 2B24A 2ZT9D 3L73E 1Q90C 1PPJE 4HJLA 2E76D 5KKZC 1UUWA 4H0LD 2E4QA 1KYOE 2DE6D 4OGQD 3TGUE 1UUVA 4NBFD 1SQXE 1O7MA 4QDFA 5HL4A 4NBDD 3VCPA 3GTSA 2HMOA 2NVEA 4QUQA 1BE3E 4PV1D 2I7FA 2E74D 2NVGA 4HM3A 3CXHE 2YFJA 3GOBA 2BCCE 4HM6A 3L74E
chains in the Genus database with same CATH superfamily
2JZAA 2FYNC 3GZXA 2YIUC 1KB9E 4QUPA 1FQTA 4AAYB 2ZYLA 1L0LE 3GCEA 5AEUA 4NBCD 2A06E 3GKEA 1G8KB 2YFLA 3BCCE 4PD4E 4QDDA 3L71E 5AEWA 5KLIC 4NBED 1O7WA 2IBZE 3VCAA 2HMJA 2GBXA 3GL0A 5BOKA 2BMOA 1BCCE 4NBGD 4NBBD 2E4PA 1NTZE 1SQVE 2FYUE 3H1HE 1ULIA 2GBWA 5CXMA 3FOUA 1VM9A 1O7NA 4EMJB 3GTEA 4H44D 3DQYA 3L72E 1NYKA 1NU1E 1EG9A 2YVJB 4H13D 2NUMA 1G8JB 3L70E 3AZCA 1SQPE 4HM2A 1SQQE 4NBAD 4QDFB 1WQLA 4HKVA 3H1JE 1O7HA 4HM0A 5KLVE 2NUKA 3VMHD 2DE7D 4QCKA 3C0DA 2QPZA 2YFIA 1VCKA 2HMKA 2NWFA 1NDOA 2HMLA 3CWBE 3D89A 2DE5D 3H1IE 1L0NE 3GZYA 3N0QA 4HM8A 2BMQA 1O7GA 2E75D 1NTME 4AIVA 2JO6A 3CX5E 1RFSA 2CKFA 1O7PA 2QJPC 2Q3WA 1ZRTE 2XSHA 4HM4A 2NVFA 3L75E 2B1XA 1P84E 3H1KE 4HM7A 4NBHD 2D2CD 1JM1A 4HM5A 2XSOA 4NB9D 3GL2A 4P1BH 1VF5D 4QURA 2QJYC 4QDCA 2XRXA 4HM1A 3EQQA 2HMNA 3VMGD 2BMRA 1PP9E 1SJGA 3GB4A 4NB8D 4U3FE 1SQBE 1EZVE 1ULJA 4P1CH 3H1LE 2QJKC 2XR8A 3EN1A 3VMID 1NTKE 1RIEA 2HMMA 2B24A 2ZT9D 3L73E 1Q90C 1PPJE 4HJLA 2E76D 5KKZC 1UUWA 4H0LD 2E4QA 1KYOE 2DE6D 4OGQD 3TGUE 1UUVA 4NBFD 1SQXE 1O7MA 4QDFA 5HL4A 4NBDD 3VCPA 3GTSA 2HMOA 2NVEA 4QUQA 1BE3E 4PV1D 2I7FA 2E74D 2NVGA 4HM3A 3CXHE 2YFJA 3GOBA 2BCCE 4HM6A 3L74E
chains in the Genus database with same CATH topology
2JZAA 2FYNC 3GZXA 2YIUC 1KB9E 4QUPA 1FQTA 4AAYB 2ZYLA 1L0LE 3GCEA 5AEUA 4NBCD 2A06E 3GKEA 1G8KB 2YFLA 3BCCE 4PD4E 4QDDA 3L71E 5AEWA 5KLIC 4NBED 1O7WA 2IBZE 3VCAA 2HMJA 2GBXA 3GL0A 5BOKA 2BMOA 1BCCE 4NBGD 4NBBD 2E4PA 1NTZE 1SQVE 2FYUE 3H1HE 1ULIA 2GBWA 5CXMA 3FOUA 1VM9A 1O7NA 4EMJB 3GTEA 4H44D 3DQYA 3L72E 1NYKA 1NU1E 1EG9A 2YVJB 4H13D 2NUMA 1G8JB 3L70E 3AZCA 1SQPE 4HM2A 1SQQE 4NBAD 4QDFB 1WQLA 4HKVA 3H1JE 1O7HA 4HM0A 5KLVE 2NUKA 3VMHD 2DE7D 4QCKA 3C0DA 2QPZA 2YFIA 1VCKA 2HMKA 2NWFA 1NDOA 2HMLA 3CWBE 3D89A 2DE5D 3H1IE 1L0NE 3GZYA 3N0QA 4HM8A 2BMQA 1O7GA 2E75D 1NTME 4AIVA 2JO6A 3CX5E 1RFSA 2CKFA 1O7PA 2QJPC 2Q3WA 1ZRTE 2XSHA 4HM4A 2NVFA 3L75E 2B1XA 1P84E 3H1KE 4HM7A 4NBHD 2D2CD 1JM1A 4HM5A 2XSOA 4NB9D 3GL2A 4P1BH 1VF5D 4QURA 2QJYC 4QDCA 2XRXA 4HM1A 3EQQA 2HMNA 3VMGD 2BMRA 1PP9E 1SJGA 3GB4A 4NB8D 4U3FE 1SQBE 1EZVE 1ULJA 4P1CH 3H1LE 2QJKC 2XR8A 3EN1A 3VMID 1NTKE 1RIEA 2HMMA 2B24A 2ZT9D 3L73E 1Q90C 1PPJE 4HJLA 2E76D 5KKZC 1UUWA 4H0LD 2E4QA 1KYOE 2DE6D 4OGQD 3TGUE 1UUVA 4NBFD 1SQXE 1O7MA 4QDFA 5HL4A 4NBDD 3VCPA 3GTSA 2HMOA 2NVEA 4QUQA 1BE3E 4PV1D 2I7FA 2E74D 2NVGA 4HM3A 3CXHE 2YFJA 3GOBA 2BCCE 4HM6A 3L74E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZA A;  2FYN C;  3GZX A;  2YIU C;  1KB9 E;  4QUP A;  1FQT A;  4AAY B;  2ZYL A;  1L0L E;  3GCE A;  5AEU A;  4NBC D;  2A06 E;  3GKE A;  1G8K B;  2YFL A;  3BCC E;  4PD4 E;  4QDD A;  3L71 E;  5AEW A;  5KLI C;  4NBE D;  1O7W A;  2IBZ E;  3VCA A;  2HMJ A;  2GBX A;  3GL0 A;  5BOK A;  2BMO A;  1BCC E;  4NBG D;  4NBB D;  2E4P A;  1NTZ E;  1SQV E;  2FYU E;  3H1H E;  1ULI A;  2GBW A;  5CXM A;  3FOU A;  1VM9 A;  1O7N A;  4EMJ B;  3GTE A;  4H44 D;  3DQY A;  3L72 E;  1NYK A;  1NU1 E;  1EG9 A;  2YVJ B;  4H13 D;  2NUM A;  1G8J B;  3L70 E;  3AZC A;  1SQP E;  4HM2 A;  1SQQ E;  4NBA D;  4QDF B;  1WQL A;  4HKV A;  3H1J E;  1O7H A;  4HM0 A;  5KLV E;  2NUK A;  3VMH D;  2DE7 D;  4QCK A;  3C0D A;  2QPZ A;  2YFI A;  1VCK A;  2HMK A;  2NWF A;  1NDO A;  2HML A;  3CWB E;  3D89 A;  2DE5 D;  3H1I E;  1L0N E;  3GZY A;  3N0Q A;  4HM8 A;  2BMQ A;  1O7G A;  2E75 D;  1NTM E;  4AIV A;  2JO6 A;  3CX5 E;  1RFS A;  2CKF A;  1O7P A;  2QJP C;  2Q3W A;  1ZRT E;  2XSH A;  4HM4 A;  2NVF A;  3L75 E;  2B1X A;  1P84 E;  3H1K E;  4HM7 A;  4NBH D;  2D2C D;  1JM1 A;  4HM5 A;  2XSO A;  4NB9 D;  3GL2 A;  4P1B H;  1VF5 D;  4QUR A;  2QJY C;  4QDC A;  2XRX A;  4HM1 A;  3EQQ A;  2HMN A;  3VMG D;  2BMR A;  1PP9 E;  1SJG A;  3GB4 A;  4NB8 D;  4U3F E;  1SQB E;  1EZV E;  1ULJ A;  4P1C H;  3H1L E;  2QJK C;  2XR8 A;  3EN1 A;  3VMI D;  1NTK E;  1RIE A;  2HMM A;  2B24 A;  2ZT9 D;  3L73 E;  1Q90 C;  1PPJ E;  4HJL A;  2E76 D;  5KKZ C;  1UUW A;  4H0L D;  2E4Q A;  1KYO E;  2DE6 D;  4OGQ D;  3TGU E;  1UUV A;  4NBF D;  1SQX E;  1O7M A;  4QDF A;  5HL4 A;  4NBD D;  3VCP A;  3GTS A;  2HMO A;  2NVE A;  4QUQ A;  1BE3 E;  4PV1 D;  2I7F A;  2E74 D;  2NVG A;  4HM3 A;  3CXH E;  2YFJ A;  3GOB A;  2BCC E;  4HM6 A;  3L74 E; 
#chains in the Genus database with same CATH topology
 2JZA A;  2FYN C;  3GZX A;  2YIU C;  1KB9 E;  4QUP A;  1FQT A;  4AAY B;  2ZYL A;  1L0L E;  3GCE A;  5AEU A;  4NBC D;  2A06 E;  3GKE A;  1G8K B;  2YFL A;  3BCC E;  4PD4 E;  4QDD A;  3L71 E;  5AEW A;  5KLI C;  4NBE D;  1O7W A;  2IBZ E;  3VCA A;  2HMJ A;  2GBX A;  3GL0 A;  5BOK A;  2BMO A;  1BCC E;  4NBG D;  4NBB D;  2E4P A;  1NTZ E;  1SQV E;  2FYU E;  3H1H E;  1ULI A;  2GBW A;  5CXM A;  3FOU A;  1VM9 A;  1O7N A;  4EMJ B;  3GTE A;  4H44 D;  3DQY A;  3L72 E;  1NYK A;  1NU1 E;  1EG9 A;  2YVJ B;  4H13 D;  2NUM A;  1G8J B;  3L70 E;  3AZC A;  1SQP E;  4HM2 A;  1SQQ E;  4NBA D;  4QDF B;  1WQL A;  4HKV A;  3H1J E;  1O7H A;  4HM0 A;  5KLV E;  2NUK A;  3VMH D;  2DE7 D;  4QCK A;  3C0D A;  2QPZ A;  2YFI A;  1VCK A;  2HMK A;  2NWF A;  1NDO A;  2HML A;  3CWB E;  3D89 A;  2DE5 D;  3H1I E;  1L0N E;  3GZY A;  3N0Q A;  4HM8 A;  2BMQ A;  1O7G A;  2E75 D;  1NTM E;  4AIV A;  2JO6 A;  3CX5 E;  1RFS A;  2CKF A;  1O7P A;  2QJP C;  2Q3W A;  1ZRT E;  2XSH A;  4HM4 A;  2NVF A;  3L75 E;  2B1X A;  1P84 E;  3H1K E;  4HM7 A;  4NBH D;  2D2C D;  1JM1 A;  4HM5 A;  2XSO A;  4NB9 D;  3GL2 A;  4P1B H;  1VF5 D;  4QUR A;  2QJY C;  4QDC A;  2XRX A;  4HM1 A;  3EQQ A;  2HMN A;  3VMG D;  2BMR A;  1PP9 E;  1SJG A;  3GB4 A;  4NB8 D;  4U3F E;  1SQB E;  1EZV E;  1ULJ A;  4P1C H;  3H1L E;  2QJK C;  2XR8 A;  3EN1 A;  3VMI D;  1NTK E;  1RIE A;  2HMM A;  2B24 A;  2ZT9 D;  3L73 E;  1Q90 C;  1PPJ E;  4HJL A;  2E76 D;  5KKZ C;  1UUW A;  4H0L D;  2E4Q A;  1KYO E;  2DE6 D;  4OGQ D;  3TGU E;  1UUV A;  4NBF D;  1SQX E;  1O7M A;  4QDF A;  5HL4 A;  4NBD D;  3VCP A;  3GTS A;  2HMO A;  2NVE A;  4QUQ A;  1BE3 E;  4PV1 D;  2I7F A;  2E74 D;  2NVG A;  4HM3 A;  3CXH E;  2YFJ A;  3GOB A;  2BCC E;  4HM6 A;  3L74 E; 
#chains in the Genus database with same CATH homology
 2JZA A;  2FYN C;  3GZX A;  2YIU C;  1KB9 E;  4QUP A;  1FQT A;  4AAY B;  2ZYL A;  1L0L E;  3GCE A;  5AEU A;  4NBC D;  2A06 E;  3GKE A;  1G8K B;  2YFL A;  3BCC E;  4PD4 E;  4QDD A;  3L71 E;  5AEW A;  5KLI C;  4NBE D;  1O7W A;  2IBZ E;  3VCA A;  2HMJ A;  2GBX A;  3GL0 A;  5BOK A;  2BMO A;  1BCC E;  4NBG D;  4NBB D;  2E4P A;  1NTZ E;  1SQV E;  2FYU E;  3H1H E;  1ULI A;  2GBW A;  5CXM A;  3FOU A;  1VM9 A;  1O7N A;  4EMJ B;  3GTE A;  4H44 D;  3DQY A;  3L72 E;  1NYK A;  1NU1 E;  1EG9 A;  2YVJ B;  4H13 D;  2NUM A;  1G8J B;  3L70 E;  3AZC A;  1SQP E;  4HM2 A;  1SQQ E;  4NBA D;  4QDF B;  1WQL A;  4HKV A;  3H1J E;  1O7H A;  4HM0 A;  5KLV E;  2NUK A;  3VMH D;  2DE7 D;  4QCK A;  3C0D A;  2QPZ A;  2YFI A;  1VCK A;  2HMK A;  2NWF A;  1NDO A;  2HML A;  3CWB E;  3D89 A;  2DE5 D;  3H1I E;  1L0N E;  3GZY A;  3N0Q A;  4HM8 A;  2BMQ A;  1O7G A;  2E75 D;  1NTM E;  4AIV A;  2JO6 A;  3CX5 E;  1RFS A;  2CKF A;  1O7P A;  2QJP C;  2Q3W A;  1ZRT E;  2XSH A;  4HM4 A;  2NVF A;  3L75 E;  2B1X A;  1P84 E;  3H1K E;  4HM7 A;  4NBH D;  2D2C D;  1JM1 A;  4HM5 A;  2XSO A;  4NB9 D;  3GL2 A;  4P1B H;  1VF5 D;  4QUR A;  2QJY C;  4QDC A;  2XRX A;  4HM1 A;  3EQQ A;  2HMN A;  3VMG D;  2BMR A;  1PP9 E;  1SJG A;  3GB4 A;  4NB8 D;  4U3F E;  1SQB E;  1EZV E;  1ULJ A;  4P1C H;  3H1L E;  2QJK C;  2XR8 A;  3EN1 A;  3VMI D;  1NTK E;  1RIE A;  2HMM A;  2B24 A;  2ZT9 D;  3L73 E;  1Q90 C;  1PPJ E;  4HJL A;  2E76 D;  5KKZ C;  1UUW A;  4H0L D;  2E4Q A;  1KYO E;  2DE6 D;  4OGQ D;  3TGU E;  1UUV A;  4NBF D;  1SQX E;  1O7M A;  4QDF A;  5HL4 A;  4NBD D;  3VCP A;  3GTS A;  2HMO A;  2NVE A;  4QUQ A;  1BE3 E;  4PV1 D;  2I7F A;  2E74 D;  2NVG A;  4HM3 A;  3CXH E;  2YFJ A;  3GOB A;  2BCC E;  4HM6 A;  3L74 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...