1VMCA

Stroma cell-derived factor-1alpha (sdf-1alpha)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
b'RCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1
molecule tags Cytokine
source organism Homo sapiens
publication title Mapping the binding of the N-terminal extracellular tail of the CXCR4 receptor to stromal cell-derived factor-1alpha.
pubmed doi rcsb
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vmcA00
3I3CA 1GUWA 1E0BA 1IKLA 1ICWA 1SDFA 1F9PA 2B2VC 2KEDA 2N88A 1MI2A 3GV3A 5EPJA 4R9WA 5CBEE 1G91A 4ZK9B 4IUPA 4MN3A 1HUNA 1NAPA 2B2YA 1XYIA 2RA4A 2J7ZA 1Q3LA 1PFBA 2VXWA 5JJZA 1WTPA 3I8ZA 1X3PA 1U4PA 2R3ZA 1F9SA 1O80A 4RWSC 4UAIA 1CA5A 1NR4A 2X6LA 2B2WC 2HDMA 2M2LA 1ILQA 3MWYW 1DOLA 4ZAIA 1O7YA 1F9RA 1IKMA 1AZQA 5CBAE 1B4OA 2B2WA 4CJ2C 4CJ1B 1RJTA 2H1EA 2B2UA 1NCVA 1J9OA 4HAEA 1JICA 2B2TA 2FHTA 1A15A 4X3UA 3DM1A 1IL8A 2NYZD 1RTOA 2FINB 3DEPA 3R93A 1WTOA 2HCIA 1PDQA 3I90A 2X6GA 2L12A 1HRJA 1MSHA 4QUCA 1LV9A 1WTXA 1EL0A 3TZDA 4ZKCB 2KEEA 2BDNA 2K1BA 1B3AA 4X3TA 5EJWA 1C8CA 2DY8A 2IL8A 5EPLA 3F2UA 4IUVA 1DZ1A 3HP3A 4XT3B 2L11A 5DNFA 5AFWA 1EIGA 1RHPA 1RODA 1EOTA 2RVLA 2JYOA 1JE4A 1ILPA 1QNKA 1XX8A 1TVXA 3KUPA 3GV6A 4IUQA 4NW2A 1AZPA 1PFMA 1EQTA 3QO2A 1G2TA 1HFNA 2FJ2A 1SAPA 2K01A 2Q8RE 4HCSA 2L1BA 1B2TA 1WTWA 2EE1A 1KNAA 5COYA 4ZKBB 4RA8A 3I91A 2RSNA 1AP0A 4XT1B 5T1IA 1B53A 2CVRA 1F2LA 2L9HA 3LWEA 4OIKA 1G2SA 4OIJA 5EPKA 3TN2A 1J8IA 3DEOA 1WTQA 1ML0D 4O42A 1PFNA 2XIWA 3N52A 1DOKA 4HSVA 4LMQD 5D65A 1EIHA 2MP1A 4DN4M 2K28A 2FFKB 1U4MA 3IFDA 4R8IA 1WTVA 5T1GA 1WD0A 4QUFA 2K04A 4X3SA 3P7JA 2Q8TA 1CA6A 5EKIA 2X69A 2MJ8A 2KUMA 2HCCA 1BBXC 1SSOA 1NR2A 2B2YC 1HHVA 2K03A 2B2TC 5E4XA 2RSOA 5CORA 5EQ0A 1U4LA 1BF4A 2KECA 3KBXA 1PLFA 4CJ0B 3ONAB 4IUUA 1RTNA 2EOTA 1O7ZA 3Q6SA 1G6ZA 3MTSA 1WD1A 1DONA 1B50A 1QG7A 2HUGA 1DOMA 2NZ1D 4XDXA 5E4WC 1ESRA 1X3QA 1HFGA 5D14A 1F9QA 1VMPA 1ZXTA 2NWGA 4HEDA 2SDFA 4IUTA 2B2UC 4MHEA 4U68A 4X3KA 1WVLA 2FMMA 2DY7A 1S4ZA 3H91A 1QE6A 1CM9A 2N55A 1KNEA 2KVMA 3G7LA 4IURA 1MSGA 2JP1A 1HUMA 2L4NA 1HA6A 1X32A 2B2VA 1M8AA 1U4RA 2MPMA 4ZLTF 1BO0A 1BNZA 2D9UA 1MGSA 2EPBA 3FDTA 3UI2A 1VMCA 2HDLA 5CMDA 3D6WA 2KOLA 2MGSA 3IL8A 1WTRA 2K05A 3FPUB 3SVMA 4RAUC
chains in the Genus database with same CATH superfamily
4JOIC 5IP7G 2F4IA 1PXUA 2A69C 1B44D 3AB9A 1GM5A 5JEAG 3NTIA 2I5MX 4ZUIA 4BA1I 1J5EQ 1NAPA 3SDZA 1SLJA 2N78A 1O78A 3NQTA 4OO1I 4KKSA 2K50A 2B63G 4JI1Q 4QB4A 1BR9A 4IFDJ 1NR4A 2AHOB 2F0MA 1ILQA 2QGQA 1J6QA 1M4VA 2F0QA 5CV7A 3EQLC 1STYA 2A74C 4DXFA 4V190 1GJXA 5HY6A 4C3JG 5M3FB 2FHTA 1TWFB 5ELDA 2NYZD 1WTOA 4DV4Q 2F0HA 2WB1B 4POFA 1P8LA 1SNQA 1SYBA 3CCSA 1PZJD 4F87A 3TDQA 4J15A 3FVQA 4C1NK 3K0YA 4LF4L 3KF8A 4MTNA 5CV8A 1EQQA 1W6JA 2ATWA 4JBWA 2OQKA 3BU2A 1XX8A 2VW9A 1EFID 1A3TA 5JAVA 2CW0D 3GTMB 4UDUC 1VQFA 4DUZQ 1EYAA 2Q8RE 3TMEA 5AJ3Q 3F2CA 2F0UA 1XMQL 5C44B 4GN4B 4OIKA 1N32L 2K5QA 5GAGC 3DEOA 3PF4A 2OTLA 1PFNA 1JOQA 4HSVA 3PIPA 2CKZB 1PMRA 4A3LG 5IP9H 1BVSA 2MP1A 3R3OA 3IFDA 5AJ3L 1CFMA 5T1GA 3NELA 1PVOA 1UE7A 3CPFA 3Q23A 2A68C 1MD2D 2NZHA 1HJPA 2BA1A 1VQEA 4N9PA 3Q8DA 5GAEC 2VS1A 5EBCA 1VCIA 4HJ9A 1Y14B 3RR5A 1YBYA 2OXPA 3QG1A 3T1HQ 1D5ZC 4BY7B 1DONA 1RDPD 1I94Q 4QIWB 1A3VA 4ODGA 4MHEA 2BDOA 2Q8IB 4R4OA 5C4XH 1IW7D 1OO9B 2VQEQ 1M8AA 5I9OA 3FDTA 2VQFL 1AE3A 2HQEA 2LKVA 4ABNA 3T16A 4TVAB 1H9SB 2NN6I 3RN5A 4XYQA 1PA6A 1GUWA 1N9WA 1Y1WH 4RCOA 1HXYD 3MA2B 3E9IA 4R4TA 2NBFA 3K5OA 3I55A 1PH3A 1H9JA 5JJZA 2JA8G 1SN8A 4A3BG 1E22A 2ZM6Q 1O80A 1H9MA 1R4QB 1WCMB 4B08A 2F0EA 4FDBA 5DLQE 1SNMA 3ICEA 2VNUD 3F8TA 1JICA 1EWCA 2B8GA 1IL8A 3R2TA 4A3MH 1SRUA 3BYTB 2LSSA 3FHWA 4QUCA 3QR8A 1JMCA 2JE6I 1YVCA 3CHBD 3TRZA 1F2ZA 3D31A 2V1CC 1S5FD 5JPNC 3S1RH 1RHPA 1XNQQ 2EJFC 5C0XH 5ELBA 4LF9L 1E3PA 1UE6A 1Q81C 3S1MB 3HGBA 2EYOA 1SYEA 3ULLA 2ZJPA 1LTAD 2DGYA 4KK7A 5LL6S 3U9OA 5JJKA 2AQ2B 4NKLA 3S1MH 2Q2HA 3MZ5A 4L5RC 2L5TA 4C3IG 4YCUA 5JVH3 2OEOA 1EZ8A 1STGA 1HQMC 5C4HA 2F0KA 4EQPA 1KL9A 4DN4M 4R8IA 1NE3A 3S16B 3EROA 1VQBA 4ZUJA 5EKIA 2E74C 3BVMA 3N6RA 4OWWB 5IYCH 3URYA 2F0LA 2N8NA 1B9MA 2FXQA 2RCNA 3R8BA 1QWYA 2EYFA 3OW7A 2CFMA 1QCBD 3H09A 2VQEL 4POGA 4HEDA 4DV6L 4GKKQ 3DMUA 5FLXE 3EBEA 4X3KA 2PZWA 4JVZA 4XIGS 3KLSX 3UDXA 1EU3A 2L4NA 4EVOA 2B2VA 5C4XG 3DWPA 1I6HB 1AH9A 2F0TA 2A6EC 1I4HA 1JOKA 3OOCA 1E1OA 3GO5A 1ENAA 1HPCA 2SOBA 1I50B 4JBJA 3U50C 4PMBA 4OELB 3M4OH 2WB1E 4RAUC 5J3BA 1N34Q 3CW2C 2IX1A 1SDFA 1ICWA 1D5MC 1HA5A 1KTKA 1Q8IA 1VDZA 2CQAA 2NVXH 1RL2A 2CHBD 2F0SA 3C1EA 2E2JH 4IO9A 3PUZA 3GP7A 1QJOA 4KKUA 1S5DD 4A3KH 4DK1A 1I6HH 3STBD 2N3SA 1HNWQ 5A35A 1RJTA 1N32Q 2WACA 3U58A 5CV4A 2PCFB 2B2TA 4CDFC 4X3UA 1XPRA 2KJXA 4OO1H 2YTVA 2Z6KA 2B3GA 1LT5D 1SMYC 4RG1A 3SR1A 3J7YW 4JI3L 1YZ6A 3S15H 2K14A 1X3GA 2GVAA 5ELEA 1LTSD 2JJQA 3K0XA 4DV5L 1TWAH 3FPPA 3OTOL 4R8NA 1YI2A 1JB7A 1NTGA 4DK6C 4X62Q 2CWAA 3VR3A 1SE8A 4DV6Q 3HS0C 3CQZH 5CV6A 4A3CH 3GTLH 1G51A 1HNXL 2FJ2A 1SAPA 4KD3A 4Y7NB 3W1BA 1TY2A 1Y1VH 4G57A 2WV6D 4GNXA 2JSOA 4GLXA 2RBMA 1IZ6A 3S2DH 1TS5A 2K75A 3VR5A 5E3FA 3TN2A 5GAHC 2B8FA 4C3IH 1WTQA 1GUSA 2R61A 2RDGA 4HIDA 2OT2A 2G9HD 1BQQT 2XSCA 2ZTDA 4BBSH 3J80E 3ITPA 3CCVA 3A5ZB 3NEMA 1LUZA 3MXNA 1HNZL 3TS2A 4KHVA 1N36L 3FRPB 2B2YC 3E9HA 1GKHA 3GTJH 4AH6A 1F2MA 1H9RA 1GOZA 1EUJA 3OWEB 5C44H 1QG7A 2NZ1D 1DOMA 2RQXA 5C3EB 4QF4A 3L3OC 4U673 3G7LA 1E24A 1T5XD 2JP1A 4P2CB 1E7ZA 2XGTA 4A3CG 1JT8A 3A7AB 5M5XH 4F7XA 4GS3A 3UI2A 2FMCA 1OXUA 2F03A 3NE5B 3CCLA 1H9KA 3UDFA 1UUPA 5IGEA 5FOBB 3A5UA 1TIID 3QJYA 1I5FA 5LMNW 4IUPA 5D3IB 2F0DA 1YNJD 4UP8A 1EY9A 3UDIA 1KAWA 1WTPA 3PO3B 2A19A 4C56C 2GVBA 4OX9Q 1IKMA 3GQBA 5C3EG 3S2DB 1TWCH 4JK1C 4CJ1B 4YY3L 3PF5A 5C0XJ 2LY7A 2L12A 4MTKA 2VQFQ 4LFCL 4NMZA 1FJGL 2DJGC 4R4QA 1R9TB 1V1PA 4X62L 5C4JH 5IGBA 3EJIA 1H9SA 3OTOQ 3S1QB 1KLUD 3J81E 4DV5Q 1Y8OB 2PQEA 5M5YH 1HTPA 3J81c 1YHQA 1HFNA 4HTHA 1I4GA 1B2TA 4GOPC 3GTGB 3D4DA 3EIVA 3MXGA 1AP0A 3JAML 5T1IA 4P72A 1D6EC 4BY7G 2CH4W 1RKNA 1C48A 2JA9A 2RKSA 1EQVA 3NXWA 2WAQB 2NN6G 2L15A 4HJ5A 3R2IA 1EEID 3VDYA 3C3LA 4B3SL 2K28A 1ENCA 1UEBA 2K5DA 5C3EH 2NVYH 4AIMA 4A3MB 4A3EB 1TWHH 5IT9c 2B63H 2BH8A 1ZYRC 2F0IA 1I50H 2LXKA 5EAYA 1VQDA 4NP5A 1CKOA 2EYJA 4R4CA 3TP8A 2VUMG 5L37A 3NWTA 1LTGD 1XTDA 1O7ZA 1BCPD 5G3LF 1IBKL 3GDEA 2SNSA 5EBDA 1I6VC 4X66Q 2PZTA 1BXTA 4RCNA 3RMHA 4C3JB 1CM9A 2DNEA 1KNEA 2R7FA 5DEHA 3I73A 1S3OA 3GTKH 4LFCQ 1DCZA 5CMDA 1BDOA 3D4RA 2O5IC 4GZYC 1WTRA 1PFSA 2VB2X 3HOYH 3HOUG 3KF8B 3GTQH 3GTLB 2ZXRA 2A69D 3NTHA 3AEVA 1E0BA 1DYQA 1EQRA 1Z47A 2N88A 2B29A 3GV3A 4F88A 2KENA 4KD4A 4ZK9B 4P73A 4WFN3 1QUQA 1SBBB 5KEEA 2JN4A 2PMZB 4BY7H 4FF3A 4O1NA 4DK0A 4TKOB 2RCFA 4B9XA 4CDEC 2R92H 1EY5A 1V43A 1FYCA 4OHJA 2K5NA 2BA0A 1JCKB 3KJPA 4CDCC 1O7IA 3CU7A 1IXRA 1AW7A 1JJGA 3KLWA 4A3LH 1VQKA 1WTXA 3HOXB 4IZ8A 2M9VA 5M3FH 2BDNA 2BOSA 4X3TA 4A3DG 1XPUA 4LFBQ 5C5LA 2ZTEA 3NBIA 2F0WA 4FP5D 3I56A 3M3YH 5M3MG 1D5XC 1JE4A 3GD7A 1L1OC 2VUMB 3F2DA 2F0JA 3KYHC 4IUQA 4IALA 4FYDA 4DNIA 2I5HA 1PYWD 3CRKC 2NVXB 4ZKBB 5CC4A 3CC2A 2KHJA 2R6GA 1NUCA 4HIMA 1C4QA 5GROA 2F0VA 1LACA 4K5WA 1EFWA 2ZM6L 1U4MA 1JR0D 4JCVE 5IY0A 3TP7A 3GTQB 5GQOA 4PMWA 3T56B 3BZKA 1NR2A 2Z8LA 2EIFA 1BF4A 1VQGA 2JEAI 5KYIA 2KECA 3VA5A 2IY5B 3X3NA 4DR5L 3ONAB 2R92G 4A3BB 2NVQH 2F0GA 1HNXQ 2V4DA 4H02A 3T13A 1K3BC 5DAUA 3HOZH 5E4WC 3ULJA 1SFOB 4DV1L 3TEHB 2EZVA 2NWGA 2UUBL 5NUCA 1EIYB 1PTOB 1S4ZA 3H91A 4C2MH 4O0AA 5C44G 3T53B 3C2PA 1K83B 3SHLA 3PV0A 4RGMA 1F77A 3TZUA 3CXCA 4ALPA 3T1HL 1NY4A 4B3TL 4GKJL 2K5HA 5CV5A 2UXDL 3SVMA 4A4IA 5IIFA 3H15A 5LMNQ 2R93H 1F9PA 4R9WA 1MKHA 5BR8Q 2H5XA 2F4VL 3K7AB 4K0KQ 3OWFA 4UAIA 2EY5A 5I4DA 4YCWA 5JEAH 3UE1A 1V1QA 2K7VA 1PH7A 1TR5A 1OXXK 1NMGA 1L2FA 3RUZA 1NSNS 4JI7Q 1CKMA 2AQ1B 1WYDA 4G7HC 1N34L 2L55A 1PYBA 1LV9A 2NTTA 5K5PA 1D1KA 4ZKCB 3JC66 2K1BA 3WOFA 1VQ4A 2IL8A 2GN5A 2MQHA 1IBLL 1DZ1A 4A3DH 4QIWE 3NBHA 2CWPA 1N33L 1I4QA 2RVLA 3L7ZC 3PUWA 1GUNA 4C3HB 4GKKL 3A8KE 4LF4Q 2VY3A 1K0RA 2EYMA 3PCOB 5FO9B 2C35B 5G3LD 2K33A 5IGDA 4N8X1 5IE8A 1YITA 1JJ2A 3E6ZX 2D5DA 1EY8A 4ZYSA 2RSNA 4RFBA 3EA6A 2KCMA 2QDLA 4QCLA 4ZRZA 3M7NA 3QIAA 1LO5D 3DHQA 1STNA 5C4XB 4LMQD 1DOKA 1PRTD 2XN9C 4IFDH 1A3UA 3JAMc 3SK5A 3G6EA 3S15B 1GD7A 1PH5A 3K57A 1SMYD 3CCMA 2EYPA 3OYYA 3ZJYC 1J5EL 2NVTH 1MJCA 1SROA 2QCPX 4KHZA 1KRTA 4DNTB 5A2QL 4ZCKA 2NVQB 1XMOQ 1SYCA 2AWOA 1ET6A 4LF5L 2K32A 1TS3A 3H0GB 1F9QA 4HIOA 4LF9Q 1B1ZA 2B2UC 3LNNA 1XNQL 2WKCA 3A8IE 2KVMA 5KGUA 1HUMA 3ULPA 4LF7Q 2VUMH 4OO1G 3W2DA 4ULLA 3HOWG 1A6XA 4LF8L 3IKJA 5FO7B 3WDNA 1Q90A 5LMUQ 2JK8A 4KHPQ 1LT3D 4B3RQ 4A3GH 4KN7C 4O2DA 2ALYB 3Q0AA 4R4IA 4PMCA 1XXGA 2F0PA 1RIPA 4IQZA 2JA5G 1KD1C 3I4MG 3I4NG 4GN3B 2J4XA 2XTIA 4FVMA 1SYDA 1KDAA 1ONLA 3OMCA 1KLGD 1SE2A 5EKLA 2RF4A 4JI2L 1RTOA 1EOVA 2UXCL 4RGNA 2Q2IA 4LNQA 1HRJA 3S1NB 5EJWA 1SEBD 2WINB 1OTCA 1EWHA 3MXNB 3HOZB 2VB3X 3QOLA 4RHRA 4OEMB 5AFWA 1RODA 3HKZG 1XJVA 1STHA 5I2XA 4YWMA 2PZUA 1K83H 2BH2A 4A3MG 1SNCA 4DR4Q 1PTOH 4LJZC 2I46A 1D8LA 4A3JH 4JI5Q 4RHSA 5COYA 1HR0Q 3HRZC 4B9WA 2L9HA 3LWEA 1SR3A 2R7ZB 1H95A 3M4QA 3QB3A 4FF2A 4KJOA 2UU9Q 1CI3M 3N52A 5IYBH 3BG3A 1VS0A 3J80L 2FFKB 2F0NA 4FF1A 2MO1A 4V0BA 4GLVB 1V1OA 2AKWB 2A6HD 3I72A 1EWIA 2KUMA 1Q1EA 4H7BA 5EQ0A 3KBXA 3JAME 3Q22A 2YV5A 3U9SA 1RTNA 4DUZL 5KRUA 3J7AV 2EYLA 3S2HB 1CHPD 4L63B 1X9NA 2KCNA 4U68A 2E2HH 2R7ZG 1JORA 5IGFA 3VYUA 4X65Q 5GADC 3BVZA 3K8AA 3S1NH 4YIJA 1LTLA 2KOLA 2HIVA 3HOZG 1LABA 2QF7A 4DV4L 4G4KA 1FR3A 1Q1BA 2R7DA 4IURA 4HMJA 1FGUA 1MI2A 2F1MA 4EQNA 2WP8J 3OSOA 2PQAB 2UXBQ 2VXWA 3AU7A 4DV3L 2R3ZA 3RZDH 1FNUA 1HCZA 2KHSA 4JI1L 3B6YA 2IW3A 3PUVA 1DM0B 2DNCA 4DUYQ 3S17H 1CT1D 3G71A 2XNAC 1A15A 1FD7D 3CQZB 3TP5A 1SYFA 5M5WH 1VQ7A 4DV0Q 3MFGA 3SXHA 3K5NA 3CD6A 2A1AA 4GOPA 3PO2B 4QGUA 4DR1Q 2OQ0A 1QVFA 3K7AH 3KFUA 1EOTA 4LF6Q 2EY2A 1W6KA 3RZOB 3HEJA 3H0GH 1QNKA 1V9PA 3GV6A 2HHHL 3DWQA 1DJRD 2ICEC 5IT9E 2B63B 2C9OA 3CCUA 4R1JA 1T9HA 3VYTA 1PYSB 5TSSA 4A3FH 1TQOA 4CBVA 2UUAQ 3E5SA 5FLMG 4O42A 2XIWA 3KLSA 4DAYA 1OXVA 3J80c 2Y0SG 3CPWA 4DR7Q 3HKZB 4WJWA 2PYKA 2MUYA 1WD0A 4JI6Q 1L0WA 2CQOA 3PIO3 2ZJQA 2IT1A 5K36G 4AQYQ 4JI8Q 1L0YB 3A55A 4DR4L 1TKWB 4BBRB 3T1YL 1K8AC 5E4XA 5E7NA 4DV2L 5BN4A 4KKTA 1EZ6A 1VQAA 4A3BH 4YWKA 2QW7A 5IWAQ 3BDOA 4XDXA 1HFGA 2EJGC 1YNND 2WFWA 2DY7A 2N49A 2Z4HA 4L5TA 4M8AA 3OIQA 4HCEA 1JC7A 4JI8L 2IX3A 4DR2Q 3CC7A 2E76C 2UUCL 4JI6L 4N8FA 1FVIA 3PO2G 1HZCA 1E2WA 2IJ0A 1IBML 3BVGA 1XNRL 1KABA 3VYRA 4BBRG 2UUAL 2B2YA 4IOAA 2E2IB 1Q3LA 1CQVA 2BE5C 4B3RL 1GXDC 2JA6G 1IHZA 3RLFA 1O7YA 1WTHA 3AFPA 1B7YB 4DAPA 1B4OA 3KJOA 3CCEA 2K4KA 3KOJA 1PRTB 4PZ6A 3NTKA 2DUDA 1QNUA 2G5DA 3WOEA 4LF7L 1U5KA 1D1IA 1QZHA 1A63A 2FINB 4KN4C 3RNUA 2Y0SB 1PDQA 4BA2I 3W3AA 3T51B 2QKIC 2PNHA 2M00A 1S5BD 3TZDA 3U4ZA 2O4XA 1B9NA 4XQNA 1GHKA 1WCMH 4A3KG 5DNFA 1VQ9A 3FKIB 4BY1B 4M1UB 5FLXL 3L9AX 4ME5A 4JI0Q 1B70B 1QB5D 1PFMA 5IGCA 2DN8A 1LTID 4HCSA 1IYJB 4G7OC 2L1BA 3KF6B 1YJNA 2EE1A 1K8GA 3KF6A 3CP0A 1WJJA 2K6AA 4DV3Q 2CVRA 4I7ZC 2Z6KC 5EPKA 3CAMA 2O2LD 3I4LA 5I2YA 4DR3Q 1VQMA 1SMXA 4JV5Q 1VQ5A 2PNRC 1VQJA 1PH1A 1I4RA 5KNBA 5J39A 1VQOA 3D8GA 2HT1A 5IYDG 4Q5VA 4NXNQ 1C7YA 1Q46A 4JI0L 2L0CA 1BBUA 4LFAL 2TSSA 3C1FA 4JI4Q 3F1ZA 1L1OB 1G6ZA 2BCOA 2IX0A 1ESRA 1TWGB 3LGJA 1KDCA 1ZXTA 1Z9FA 2A5HA 2ZXOA 5FKAC 4H44C 2N55A 4ZQ3A 5JJIA 4KTAA 1LTTD 1VQ6A 1HA6A 4XTCS 4DAMA 4B3ML 2ASBA 1VQIA 1BNZA 4N9TA 1JB3A 4JG2A 3PSIA 1VMCA 2HDLA 3V96A 4LK1C 5D3DA 1IL2A 3IL8A 2K05A 3GTGH 2I07B 3SK8A 4RKBA 5M5YB 1E2VA 2KEDA 2LXJA 4LW1A 1FNWA 2UU9L 1EY7A 2J7ZA 4UP7A 4CDDC 3H3VC 1QZGA 3GTOB 1HR0L 2AMCB 2B2WC 1X3EA 2EVBA 3PUXA 2UUCQ 3Q24A 1G8ZD 1L1OA 2ZTCA 5CBAE 5BN5A 4DR2L 1VF5C 4X64Q 3KDFA 2ZT9C 1Q12A 2A73B 5I9PA 3OMGA 2E5LL 1CZGA 1SJHD 3D6CA 1DD2A 1L0XB 5CYUA 3W5OA 1PTOC 2HCIA 4JC0A 3GTMH 3I90A 4KI0A 3HOWB 1STAA 3CF5A 2KA7A 1Q86C 3M4OB 1STBA 1Q82C 3AMUA 4RGTA 3NHHA 2VZAA 3M4YA 5F2DA 1CKNA 2NB0A 4DV2Q 2MHVA 4PZ7A 4JI2Q 1OXTA 4BBSG 1S5ED 3K58A 2MFIA 4C3JH 1EYGA 4RA8A 2Z6BA 3GTKB 3NQIA 2EJMA 2EY6A 2D2CC 3DXJC 4X64L 3I4OA 3MXUA 1ML0D 3K59A 4BXXH 4A3DB 2O5JC 4K6LA 4E6IA 3A74A 3S14B 1TY0A 2EXDA 4F8MA 1WTVA 4YCVA 5KIXA 4AYBG 1SNOA 4DR6L 1EYCA 1CUKA 3J80i 3S17B 5JJLA 4C1NI 3TREA 1E1TA 3OHXC 3S14H 1KHIA 1BCPB 2IHEA 4A3IB 1BBXC 2IPKD 3OW2A 4LAAA 3GTPB 5C0XI 4IOCA 3GTJB 3RN2A 2ES2A 4DK3C 1K28A 1TU2B 3GTPH 1X3QA 2F3VA 1OXSC 4B3MQ 2SDFA 1SXTA 4YWLA 4OGQC 1AN8A 3I2ZA 2FMMA 5C4JB 2SEBD 2PO4A 4YHHQ 1XMOL 2TMPA 4C3IB 1X65A 2OCEA 5ELFA 2F3WA 1JJCB 1K8MA 4NXNL 1ICFB 5IYCG 1QOHA 3PQIA 3FPUB 4EQ5A 3G6JB 4L5SA 2Z0SA 2D0OA 5C3WA 4A3JG 1WTWA 2UXBL 2ICIA 4Q0FA 1SYGA 5FLMH 4QY7A 4P71A 1CSPA 1WI5A 4IPHA 2B39A 2A68D 2PMZE 4DXGA 4JV5L 1F9RA 3FEWX 1Q7YC 1CHQD 4HJAA 2YYZA 3PIOA 1NCVA 1PH2A 1JWUD 5J22A 2YTYA 4Y52H 1D2BA 2ENBA 4PNYA 4AYBB 4DAVA 2JA6H 4NDXA 1IBKQ 1UE1A 1SE4A 4JBMA 3ERSX 3J7AF 5KYLA 3P1HA 1I4XA 2C5CA 1LTBD 4UP9A 1ASYA 2JQOA 1TVXA 5HGTA 4JI7L 2PW5A 3T4AC 4DV7Q 1AZPA 3QO2A 1G2TA 1UEAB 1FNVA 1HZBA 3J81L 4Z9CB 3A8JE 2KQ3A 3I91A 2MNAA 3PO2H 1JWSD 3OIPA 4JYAQ 3PUYA 4A3FB 3K6OA 3HOXH 5BR8L 1LLRD 2E2DC 1YEZA 1XNRQ 3MHBA 4L5QA 1IBMQ 2CW0C 1WFQA 1ZKOA 4JI5L 2K04A 2Q8TA 2WAQE 2MJ8A 2RHQB 1PH6A 2HCCA 3D0FA 1G291 1QUQB 2B2TC 2K03A 4NXML 1GO3E 3HOUB 1UAPA 2JA5B 3NK9A 3BS1A 4IUUA 4A3GG 3IFTA 3K81C 2UUBQ 4OONA 2F3IA 1VQLA 4WJ4A 1FJGQ 4CKEA 1AE2A 3V2TA 3AFQA 4H13C 4IUTA 1RCVD 2XRSD 1P16A 2PQAA 4KLKA 1WOCA 2UXCQ 2Y0SE 3DM3A 4MIUA 3T1YQ 4NB3A 3M85A 4YY3Q 1FL0A 5ISRA 2I5LX 4EGVA 4IPCA 5M3FG 5DM63 1YNXA 4L8JA 5A2QE 5ELOA 1MHWC 4NXMQ 3HOWH 4A75A 3BJUA 3HOXG 5CGKA 1B8AA 2K5WA 2EYHA 1X3FA 2E75C 1SFOH 1TWCB 1X3PA 3FKIG 4BY1G 1F9SA 5M3MB 4DR7L 1EYDA 2SNMA 5LMUL 4LUVA 4DU9A 1DOLA 1PTOF 1EY0A 4JBKA 1JOOA 4J6HA 5C0XG 2AUJD 1XWEA 3PO3H 1K0SA 1UE5A 2B2UA 3HG9A 3I4MH 4HJ8A 3PMFA 3R93A 4DAYB 3WWVA 5K36H 2X6GA 3H94A 3RD4A 1JE5A 4WJ3M 1ASZA 2KEEA 1Q8KA 1LT4D 3X3MA 1VQ8A 4DV0L 1PH4A 1M1KC 1MIUA 4IUVA 4XT3B 5IOCA 1UWVA 3H3VH 4LF6L 4K8JA 4LWCA 1AEXA 3HZXA 3GTOH 5FO8B 4OXPA 2G9DA 5BN3A 4NW2A 3C46A 3D4WA 4DA2A 1K8OA 1EQTA 5HGQA 3CRLC 1NBWA 4K14A 3M4PA 3ZYYX 4CKCA 3CKIB 2A6ED 2R92B 4A76A 3PIP3 5FLXc 4LUOA 1F2LA 1G2SA 3S24A 3JAMi 4KY7A 5D65A 3RLNA 4J8QA 3CCQA 5I6WA 1BOSA 4X3SA 3P7JA 4QJFA 4DR3L 1C9OA 1N8RC 2YTXA 3HOUH 2NZOA 1HHVA 1JWMD 5CORA 1PZKD 2EOTA 2RHSB 3KDFB 3RZDB 4IPDA 4K2KA 2HUGA 3FMCA 1X55A 1K73C 4JI3Q 2JA8B 3QWNA 4IJHA 4I7AA 4HN7A 4GN5A 1MSGA 4K5VA 1Y1WG 3TSSA 2WB1G 2NTSA 3HOYB 1U4RA 4ZLTF 1CKNB 2EXZA 3G4SA 2JEBI 3CCJA 1EIFA 4FF4A 4QMGA 4K6DA 2Z4IA 1KIXA 4B3SQ 2JA7H 5IODA 4K0KL 3VR6A 1KAAA 3UE0A 5CBEE 5EPJA 1BBWA 1TT2A 3RZOH 1C0AA 4MN3A 2RA4A 2BE5D 4DR6Q 5JOBA 5M3MH 3I8ZA 1B3QA 4RWSC 3FKIH 4BY1H 4ZAIA 4GKJQ 3KK7A 1Y69U 3EVQA 1AZQA 4XXEA 1U9RA 1LT6D 1TS4A 4KY5A 1Y1VB 4GNXC 3KLRA 3W1GA 4UHVA 4FXGC 4HIKA 1HH2P 2PW7A 1LM0A 1MSHA 1SNPA 5ELNA 1DXMA 4PG3A 2DY8A 4P74A 4DGZA 4GNXB 2JA5H 4DPGA 4WRDA 1CSQA 3LX0A 1YHAA 3HP3A 3I4NH 4DR5Q 3MEFA 2RDFA 1YHBA 4JW0A 5EKKA 2AWNA 5IP7H 3VR2A 4P75A 1Z7TA 1BUVT 2D62A 3BYYB 3ER0A 4EX5A 1TS2A 3HFZB 5LL6X 2HQLA 3EFXD 3J7ZC 3HKZE 4XT1B 2E5LQ 3VR4A 3J7A5 4PV1C 3A0JA 5KNCA 2D0PA 1KDBA 1PRTC 5IP9G 1MBYA 4KHPL 1M90C 4IPGA 3CC4A 2LMCB 3S16H 2KBNA 3BZDB 1YJ9A 1K3RA 2YU9B 4UY8C 4JYAL 1SSOA 4TSSA 5CV9A 4BWGB 1V1PB 2A8VA 1U4LA 1MJEA 2P5ZX 3Q6SA 4OL7A 5JPMC 2JA6B 1X54A 3OPOA 3F2BA 1DGSA 1WD1A 3MAQA 1HTLD 1II3A 4DV7L 2HHHQ 3U4VA 3P75A 1YJWA 1HUNA 4HMIA 4LF5Q 2Z9HA 5FK9C 2QEJC 3SEBA 4HSPA 3HKSA 4DR1L 1IW7C 2XRQD 3RLOA 1NJIC 1BO0A 1ENFA 3DUZA 2ZXPA 3MXPA 4UPAA 1ESFA 4WORA 3VA7A 3E0JA 2AQ3B 5C5MA 4NPSA 4JI4L 1VQCA 3I3CA 4G7ZC 3M7GA 4LFAQ 4DFAA 4KV6A 1IKLA 4BBSB 4DUYL 4KY6A 3BZCA 4K2LA 4FO2A 4XYOA 3PGZA 1CA5A 2X6LA 4C3HG 1RD9D 1A2UA 3EN2A 5E1FA 5IT9L 1GUTA 1J9OA 2H4OA 4HAEA 1TWFH 3KBGA 5HURA 4BXXG 3DEPA 5FJ8H 1FGBD 2A6HC 2EDGA 4RKLA 4IFDI 1IBLQ 3NUCA 5C4ZA 1B3AA 1KXLA 4DNRB 2CH4A 1I94L 4JPBW 5EPLA 1VQHA 4A3IG 2KHIA 4FXKC 2L11A 2NN6H 3I7FA 4CKBA 4YHHL 1QVCA 4ME3A 3TQYA 2LFNA 4A3EH 3KUPA 5H1SE 5IYDH 4IUNA 1WCMG 1EY6A 1EEFD 1HNWL 1K9MC 3I4MB 2HIXA 1QVGA 3BDLA 1B53A 3IAYA 1NMFA 4QQBX 3S9WA 2K52A 2R7ZH 3HOVG 1CK1A 2QA4A 2PI2A 3FP9A 4S3SA 5JEAJ 1HQRD 1CZWA 3VYSA 2XVSA 3A56A 1PV4A 1W3SA 4QUFA 1CA6A 2X69A 2KCCA 4ILWA 5LMNL 2RSOA 1PLFA 1R9TH 2NVTB 3L2PA 1JQYD 2QDBA 4A3JB 3NENA 5IGGA 1HZAA 3D3RA 2E2IH 5D14A 1TXYA 3V05A 1WVLA 3I4NB 1ZYRD 3S1QH 3HOVB 1RF2D 4OWTB 1R4PB 1VQPA 1W2BA 2EPBA 5IWAL 2HD3A 2NUCA 3L0OA 1KRSA 3MVVA 1CQFA 1GHJA 1BKBA 3TP6A 2B2VC 4TRDA 4ID6A 1G91A 2QEXA 3MFYA 2EY1A 1PFBA 5LHY1 1TWAB 1U4PA 3NBHB 1GUGA 4MNOA 5C3XA 1TWHB 4IN3A 1U0LA 3DLLA 3H0GG 2B2WA 5DM73 4A3FG 2H1EA 2E2HB 4GLAC 1UNSA 3MC0B 3NP8A 2K5VA 2R93G 4KJNA 4LFBL 2JA7B 1GUOA 4LF8Q 3AQQA 3BDCA 2EQSA 3MEHA 5IYBG 1PH9A 2CCZA 1Y8PB 2XWBB 4A3IH 3SE0A 4Y7NH 2JYOA 1ILPA 1G6PA 2JXMB 4KMUC 1EY4A 4FXDA 1N36Q 1XPOA 2YU9H 4C2MB 1IYVA 1T5EA 1CTMA 1HR0W 1KNAA 1PRTF 3J81j 4HR7B 2VL6A 4J1MA 3SGIA 2RDHA 2PPBC 2F52A 4A93G 2JA7G 1J8IA 4GOPB 3HOVH 3ND8A 3K80C 4I65A 1S40A 1I4PA 3TS0A 4OWXB 3A54A 1Y1WB 1O7LA 3DWAA 3M9BA 3NPPA 3E0EA 1KQSA 2WKDA 3ND9A 3IRBA 4JOIA 3AYHB 3CMEA 1V8QA 1SJED 3I70A 4BBRH 4DF7A 4CJ0B 5JVG3 2F0OA 1SE3A 4XQQA 4HJ7A 1ET9A 1S72A 3STBC 2E8GA 2NVYB 5EGTA 2IHFA 2ZJRA 4IFDG 4X65L 1YNNC 3PO3G 4BS9A 3UDGA 2F0FA 1SNDA 4DKAC 3J81i 1N33Q 4EQOA 4X66L 3CCRA 1X32A 1STEA 1GVPA 5CR3A 1MGSA 3S1RB 4PQXA 3SK6A 2LS01 1PHJA 2MGSA 5C6AA 5KNDA 4X6AH 2Q2TA 1F2YA 5M5XB 2JA8H 3H3VI 4A3GB 1A62A 1A2TA 4AYBE 1NNXA 2E2JB 1IYUA 1XYIA 1KC8C 5I6YA 1YNJC 3TBIB 1XMQQ 1LYLA 2I0QA 4A93H 1A0IA 2HDMA 2M2LA 3MWYW 3P20A 2QILA 2F4VQ 1D7QA 4CJ2C 5M5WB 3K7UC 3K5LA 3ERQA 3DM1A 1TWGH 2UXDQ 3K5MA 1AFPA 3G48A 3HOYG 4H0LC 4B3TQ 4CHTB 1EU4A 5ELCA 4TQUS 1EL0A 2OWOA 1ZEQX 4K8IA 2IWHA 1C8CA 2AUKA 3H6MA 5FJ8G 3F2UA 2OTJA 3NSWA 1EIGA 1QILA 1LTRD 2J0TD 3SK4A 3O13A 4LUZA 4DV1Q 2Z1CA 4QL5A 4APVA 2K01A 2XWJB 2R93B 2OF1A 1YIJA 4PZ8A 1HZ9A 4FNFA 5M9OA 4OIJA 4AQYL 1X6OA 4RH6A 3E3XA 1Z6HA 4OX9L 4RMFA 1EIHA 1XTCD 2GA4B 3S2HH 2MO0A 4C3HH 3CMAA 3A7LA 1PTOD 3M3YB 4A3KB 1VF7A 2WIIB 1VQNA 2KCTA 1E2ZA 1PZID 3QOJA 3LWUA 2Q2UA 1Y8NB 4XQJA 3MTSA 4RGOS 4A93B 2DJFC 1BCPC 1I3QB 1B50A 4L6TB 5J1ZA 2ID0A 1VMPA 2WAQG 1X56A 1QE6A 1I3QH 1S5CD 4CGYB 4K5XA 2MPMA 4A3EG 2D9UA 1HNZQ 1Y1VG 3D6WA 3NWSA 1PH8A 4IJLA 4MZ9A 1BCPF 2PI2E 1A8VA
chains in the Genus database with same CATH topology
2F4IA 1PXUA 2A69C 1B44D 3AB9A 5JEAG 3NTIA 4ZUIA 4BA1I 1NAPA 3SDZA 1O78A 3NQTA 4OO1I 4KKSA 4QB4A 1BR9A 4IFDJ 1NR4A 2F0MA 1ILQA 1M4VA 2F0QA 5CV7A 3EQLC 1STYA 2A74C 4DXFA 4V190 1GJXA 4C3JG 5M3FB 2FHTA 1TWFB 5ELDA 2NYZD 1WTOA 2F0HA 2WB1B 1SNQA 1SYBA 1PZJD 4F87A 3TDQA 3FVQA 4C1NK 3K0YA 3KF8A 5CV8A 1W6JA 4JBWA 1XX8A 1EFID 1A3TA 5JAVA 2CW0D 3GTMB 4UDUC 1EYAA 2Q8RE 3TMEA 2F0UA 5C44B 4OIKA 2K5QA 3DEOA 1JOQA 1PFNA 4HSVA 1PMRA 2MP1A 3R3OA 3IFDA 1CFMA 5T1GA 3Q23A 2A68C 1MD2D 2BA1A 4N9PA 5EBCA 1VCIA 2OXPA 3QG1A 1D5ZC 4BY7B 1DONA 1RDPD 4QIWB 1A3VA 4ODGA 4MHEA 2BDOA 2Q8IB 1IW7D 1OO9B 1M8AA 5I9OA 3FDTA 2HQEA 2LKVA 4ABNA 3T16A 1H9SB 2NN6I 4XYQA 1GUWA 4RCOA 1HXYD 3MA2B 2NBFA 3K5OA 1H9JA 5JJZA 1O80A 1H9MA 1R4QB 1WCMB 4B08A 2F0EA 1SNMA 2VNUD 1JICA 1EWCA 2B8GA 1IL8A 3R2TA 3BYTB 4QUCA 2JE6I 3CHBD 1F2ZA 3D31A 1S5FD 5JPNC 1RHPA 2EJFC 5C0XH 5ELBA 3S1MB 3HGBA 2EYOA 1SYEA 1LTAD 4KK7A 5LL6S 3U9OA 2AQ2B 4NKLA 3MZ5A 2L5TA 4C3IG 5JVH3 2OEOA 1EZ8A 1STGA 1HQMC 5C4HA 2F0KA 4EQPA 4DN4M 4R8IA 3S16B 3EROA 4ZUJA 5EKIA 2E74C 3BVMA 3N6RA 3URYA 2F0LA 1B9MA 3R8BA 1QWYA 2EYFA 3OW7A 1QCBD 3H09A 4HEDA 3DMUA 5FLXE 4X3KA 2PZWA 4XIGS 3KLSX 1EU3A 2L4NA 4EVOA 2B2VA 3DWPA 1I6HB 2F0TA 2A6EC 1I4HA 1JOKA 3OOCA 3GO5A 1ENAA 1HPCA 2SOBA 1I50B 4PMBA 4RAUC 2IX1A 1SDFA 1ICWA 1D5MC 1HA5A 1KTKA 1Q8IA 1VDZA 2CQAA 2CHBD 2F0SA 3C1EA 3PUZA 3GP7A 1QJOA 4KKUA 1S5DD 4DK1A 5A35A 1RJTA 2WACA 5CV4A 2PCFB 2B2TA 4X3UA 2KJXA 4OO1H 1LT5D 1SMYC 3SR1A 3J7YW 5ELEA 1LTSD 3FPPA 4R8NA 3VR3A 3HS0C 5CV6A 2FJ2A 1SAPA 4KD3A 4Y7NB 1TY2A 4G57A 2WV6D 2JSOA 2RBMA 1TS5A 3VR5A 5E3FA 3TN2A 2B8FA 1WTQA 1GUSA 2R61A 2RDGA 2OT2A 2G9HD 1BQQT 2XSCA 3J80E 3ITPA 3MXNA 4KHVA 3FRPB 2B2YC 1F2MA 1H9RA 1GOZA 3OWEB 1QG7A 2NZ1D 1DOMA 2RQXA 5C3EB 4QF4A 3L3OC 4U673 3G7LA 1T5XD 2JP1A 4P2CB 3A7AB 4F7XA 3UI2A 2FMCA 1OXUA 2F03A 3NE5B 1H9KA 1UUPA 5IGEA 5FOBB 1TIID 3QJYA 4IUPA 5D3IB 2F0DA 1YNJD 1EY9A 3PO3B 1WTPA 4C56C 1IKMA 3GQBA 3S2DB 4JK1C 4CJ1B 5C0XJ 2LY7A 2L12A 4NMZA 1R9TB 1V1PA 5IGBA 3EJIA 1H9SA 3S1QB 1KLUD 3J81E 1Y8OB 2PQEA 1HTPA 1HFNA 4HTHA 1I4GA 1B2TA 3GTGB 3D4DA 3MXGA 1AP0A 3JAML 5T1IA 1D6EC 1RKNA 1C48A 2RKSA 1EQVA 3NXWA 2WAQB 2NN6G 3R2IA 1EEID 3C3LA 2K28A 1ENCA 2K5DA 4A3MB 4A3EB 1ZYRC 2F0IA 4NP5A 2EYJA 3TP8A 3NWTA 1LTGD 1O7ZA 1BCPD 5G3LF 2SNSA 5EBDA 1I6VC 2PZTA 1BXTA 4RCNA 3RMHA 4C3JB 1CM9A 2DNEA 1KNEA 5DEHA 3I73A 1DCZA 5CMDA 1BDOA 3D4RA 2O5IC 4GZYC 1WTRA 2VB2X 3GTLB 2ZXRA 2A69D 3NTHA 1E0BA 1DYQA 1Z47A 2N88A 3GV3A 4F88A 4KD4A 4ZK9B 4WFN3 1SBBB 5KEEA 2PMZB 4FF3A 4O1NA 4DK0A 4TKOB 4B9XA 1EY5A 1V43A 1FYCA 4OHJA 2BA0A 1JCKB 3CU7A 1AW7A 1WTXA 3HOXB 4IZ8A 2M9VA 2BDNA 2BOSA 4X3TA 5C5LA 3NBIA 2F0WA 4FP5D 1D5XC 1JE4A 3GD7A 2VUMB 2F0JA 4IUQA 4IALA 4FYDA 1PYWD 3CRKC 2NVXB 4ZKBB 5CC4A 2R6GA 1NUCA 1C4QA 2F0VA 1LACA 4K5WA 1U4MA 1JR0D 3TP7A 3GTQB 4PMWA 3T56B 1NR2A 2Z8LA 1BF4A 2JEAI 5KYIA 2KECA 3VA5A 3X3NA 4A3BB 3ONAB 2F0GA 2V4DA 3T13A 5DAUA 5E4WC 1SFOB 2EZVA 2NWGA 5NUCA 1PTOB 1S4ZA 3H91A 3T53B 3C2PA 1K83B 3SHLA 3PV0A 4RGMA 1F77A 3TZUA 5CV5A 3SVMA 5IIFA 1F9PA 4R9WA 3K7AB 3OWFA 4UAIA 2EY5A 5I4DA 5JEAH 2K7VA 1TR5A 1OXXK 3RUZA 1NSNS 2AQ1B 4G7HC 2L55A 1LV9A 2NTTA 5K5PA 1D1KA 4ZKCB 2K1BA 3WOFA 2IL8A 1DZ1A 3NBHA 1I4QA 2RVLA 3L7ZC 3PUWA 1GUNA 4C3HB 3A8KE 2EYMA 5FO9B 5G3LD 2K33A 5IGDA 3E6ZX 2D5DA 1EY8A 4ZYSA 2RSNA 4RFBA 3EA6A 4QCLA 4ZRZA 3M7NA 3QIAA 1LO5D 3DHQA 1STNA 5C4XB 4LMQD 1DOKA 1PRTD 2XN9C 4IFDH 1A3UA 3SK5A 3S15B 3K57A 1SMYD 2EYPA 2QCPX 4KHZA 4DNTB 5A2QL 2NVQB 1SYCA 2AWOA 1ET6A 2K32A 1TS3A 3H0GB 1F9QA 1B1ZA 2B2UC 3LNNA 2WKCA 3A8IE 2KVMA 5KGUA 1HUMA 4OO1G 3W2DA 4ULLA 1A6XA 3IKJA 5FO7B 3WDNA 1Q90A 1LT3D 4KN7C 3Q0AA 4PMCA 1XXGA 2F0PA 4IQZA 2J4XA 4FVMA 1SYDA 1KDAA 1ONLA 3OMCA 1KLGD 1SE2A 5EKLA 1RTOA 4RGNA 1HRJA 3S1NB 5EJWA 1SEBD 2WINB 1EWHA 3HOZB 2VB3X 3QOLA 4RHRA 5AFWA 1RODA 1STHA 5I2XA 2PZUA 1SNCA 1PTOH 4LJZC 2I46A 4RHSA 5COYA 3HRZC 4B9WA 2L9HA 3LWEA 2R7ZB 3QB3A 4FF2A 4KJOA 1CI3M 3N52A 3BG3A 3J80L 2FFKB 2F0NA 4FF1A 4V0BA 1V1OA 2A6HD 3I72A 2KUMA 1Q1EA 4H7BA 5EQ0A 3KBXA 3JAME 3Q22A 3U9SA 1RTNA 5KRUA 3J7AV 2EYLA 3S2HB 1CHPD 4L63B 2KCNA 4U68A 1JORA 5IGFA 3VYUA 3BVZA 4YIJA 2KOLA 1LABA 2QF7A 4G4KA 1FR3A 1Q1BA 4IURA 4HMJA 1MI2A 2F1MA 4EQNA 2WP8J 3OSOA 2VXWA 3AU7A 2R3ZA 1FNUA 1HCZA 2KHSA 2IW3A 3PUVA 1DM0B 2DNCA 1CT1D 2XNAC 1A15A 1FD7D 3CQZB 3TP5A 1SYFA 3MFGA 3SXHA 3K5NA 3PO2B 1EOTA 2EY2A 1W6KA 3RZOB 3HEJA 1QNKA 3GV6A 3DWQA 1DJRD 2ICEC 5IT9E 2B63B 2C9OA 3VYTA 5TSSA 1TQOA 4CBVA 3E5SA 4O42A 2XIWA 3KLSA 4DAYA 1OXVA 3HKZB 4WJWA 2PYKA 2MUYA 1WD0A 3PIO3 2IT1A 5K36G 1L0YB 3A55A 1TKWB 4BBRB 5E4XA 5BN4A 4KKTA 1EZ6A 3BDOA 4XDXA 1HFGA 2EJGC 1YNND 2DY7A 2Z4HA 4M8AA 3OIQA 4HCEA 1JC7A 2IX3A 2E76C 1E2WA 2IJ0A 3BVGA 1KABA 3VYRA 2B2YA 2E2IB 1Q3LA 1CQVA 2BE5C 1GXDC 1IHZA 3RLFA 1O7YA 4DAPA 1B4OA 1PRTB 3NTKA 1QNUA 3WOEA 1D1IA 2FINB 4KN4C 2Y0SB 1PDQA 4BA2I 3W3AA 3T51B 2QKIC 2M00A 1S5BD 3TZDA 2O4XA 1B9NA 4XQNA 1GHKA 5DNFA 3FKIB 4BY1B 4M1UB 5FLXL 3L9AX 4ME5A 1QB5D 1PFMA 5IGCA 2DN8A 1LTID 4HCSA 4G7OC 2L1BA 2EE1A 2K6AA 2CVRA 4I7ZC 5EPKA 3I4LA 2O2LD 5I2YA 2PNRC 1I4RA 5KNBA 5J39A 3D8GA 4Q5VA 2L0CA 2TSSA 3C1FA 1G6ZA 2BCOA 2IX0A 1ESRA 1TWGB 1KDCA 1ZXTA 2A5HA 2ZXOA 5FKAC 4H44C 2N55A 4ZQ3A 4KTAA 1LTTD 1HA6A 4XTCS 1BNZA 4N9TA 1JB3A 1VMCA 2HDLA 3V96A 4LK1C 5D3DA 3IL8A 2K05A 2I07B 3SK8A 4RKBA 5M5YB 1E2VA 2KEDA 1FNWA 1EY7A 2J7ZA 3H3VC 3GTOB 2B2WC 2EVBA 3PUXA 3Q24A 1G8ZD 5CBAE 5BN5A 1VF5C 2ZT9C 1Q12A 2A73B 5I9PA 3OMGA 1CZGA 1SJHD 3D6CA 1DD2A 1L0XB 5CYUA 1PTOC 2HCIA 3I90A 4KI0A 3HOWB 1STAA 2KA7A 3M4OB 1STBA 3AMUA 4RGTA 3NHHA 3M4YA 5F2DA 2NB0A 2MHVA 1OXTA 1S5ED 3K58A 4RA8A 3GTKB 3NQIA 2EJMA 2EY6A 2D2CC 3DXJC 3MXUA 1ML0D 3K59A 4A3DB 2O5JC 4K6LA 4E6IA 3S14B 1TY0A 4F8MA 1WTVA 5KIXA 1SNOA 1EYCA 3S17B 4C1NI 3OHXC 4A3IB 1BCPB 1BBXC 2IPKD 3GTPB 4LAAA 5C0XI 3GTJB 1TU2B 1X3QA 2F3VA 1OXSC 2SDFA 1SXTA 4OGQC 1AN8A 5C4JB 2FMMA 2SEBD 2PO4A 2TMPA 4C3IB 5ELFA 2F3WA 1K8MA 1QOHA 3FPUB 3G6JB 5C3WA 1WTWA 2ICIA 4Q0FA 1SYGA 2B39A 2A68D 4DXGA 1F9RA 3FEWX 1CHQD 2YYZA 1NCVA 1JWUD 5J22A 1D2BA 2ENBA 4PNYA 4AYBB 4DAVA 4NDXA 1SE4A 3J7AF 5KYLA 3P1HA 1I4XA 2C5CA 1LTBD 1TVXA 5HGTA 2PW5A 3T4AC 1AZPA 3QO2A 1G2TA 1UEAB 1FNVA 3J81L 4Z9CB 3A8JE 2KQ3A 3I91A 1JWSD 3OIPA 3PUYA 4A3FB 3K6OA 1LLRD 2E2DC 3MHBA 2CW0C 1ZKOA 2K04A 2Q8TA 2MJ8A 2HCCA 1G291 2K03A 2B2TC 3HOUB 1UAPA 2JA5B 3NK9A 3BS1A 4IUUA 3IFTA 4CKEA 3V2TA 4H13C 4IUTA 1RCVD 2XRSD 4MIUA 3M85A 5ISRA 4EGVA 5DM63 4L8JA 5A2QE 5CGKA 2K5WA 2EYHA 2E75C 1TWCB 1X3PA 5M3MB 1F9SA 1EYDA 2SNMA 4DU9A 1DOLA 1PTOF 1EY0A 1JOOA 4J6HA 5C0XG 2AUJD 1XWEA 3HG9A 2B2UA 3PMFA 3R93A 5K36H 2X6GA 3H94A 3RD4A 2KEEA 1LT4D 3X3MA 4IUVA 4XT3B 5IOCA 4K8JA 1AEXA 3HZXA 5FO8B 2G9DA 5BN3A 4NW2A 3C46A 3D4WA 4DA2A 1K8OA 1EQTA 3CRLC 4K14A 3ZYYX 4CKCA 3CKIB 2A6ED 2R92B 3PIP3 1F2LA 1G2SA 4KY7A 5D65A 4J8QA 5I6WA 1BOSA 4X3SA 3P7JA 1HHVA 1JWMD 5CORA 1PZKD 2EOTA 3RZDB 4K2KA 2HUGA 3FMCA 2JA8B 3QWNA 4HN7A 1MSGA 4K5VA 3TSSA 2NTSA 3HOYB 1U4RA 4ZLTF 2EXZA 2JEBI 4FF4A 4QMGA 4K6DA 2Z4IA 5IODA 3VR6A 1KAAA 5CBEE 5EPJA 1TT2A 4MN3A 2RA4A 2BE5D 5JOBA 3I8ZA 4RWSC 4ZAIA 3KK7A 1Y69U 3EVQA 1AZQA 4XXEA 1U9RA 1LT6D 1TS4A 4KY5A 1Y1VB 3KLRA 4FXGC 2PW7A 1MSHA 1SNPA 1DXMA 2DY8A 4DGZA 4WRDA 3LX0A 3HP3A 2RDFA 5EKKA 2AWNA 3VR2A 1Z7TA 1BUVT 2D62A 3BYYB 1TS2A 5LL6X 3EFXD 4XT1B 3VR4A 4PV1C 5KNCA 1KDBA 1PRTC 1MBYA 2LMCB 3BZDB 2YU9B 1SSOA 4TSSA 5CV9A 4BWGB 1V1PB 1U4LA 3Q6SA 4OL7A 5JPMC 2JA6B 3OPOA 1WD1A 3MAQA 1HTLD 1II3A 3P75A 1HUNA 4HMIA 5FK9C 2QEJC 3SEBA 4HSPA 1IW7C 2XRQD 1BO0A 1ENFA 3DUZA 2ZXPA 3MXPA 1ESFA 4WORA 3VA7A 3E0JA 2AQ3B 3I3CA 4G7ZC 3M7GA 4DFAA 4KV6A 1IKLA 4BBSB 4KY6A 4K2LA 4FO2A 4XYOA 1CA5A 2X6LA 4C3HG 1RD9D 1A2UA 5E1FA 5IT9L 1GUTA 1J9OA 2H4OA 4HAEA 3KBGA 5HURA 3DEPA 1FGBD 2A6HC 2EDGA 4RKLA 4IFDI 3NUCA 5C4ZA 1B3AA 4DNRB 5EPLA 4FXKC 2L11A 2NN6H 4CKBA 2LFNA 3KUPA 4IUNA 1EY6A 1EEFD 3I4MB 3BDLA 1B53A 3IAYA 3S9WA 1CK1A 4S3SA 5JEAJ 1HQRD 1CZWA 3VYSA 2XVSA 3A56A 4QUFA 1CA6A 2X69A 2KCCA 4ILWA 2RSOA 1PLFA 2NVTB 1JQYD 2QDBA 4A3JB 5IGGA 3D3RA 5D14A 3V05A 1WVLA 3I4NB 1ZYRD 3HOVB 1RF2D 1R4PB 2EPBA 2NUCA 3MVVA 1CQFA 1GHJA 3TP6A 2B2VC 4TRDA 4ID6A 1G91A 3MFYA 2EY1A 1PFBA 5LHY1 1TWAB 1U4PA 1GUGA 5C3XA 1TWHB 4IN3A 2B2WA 5DM73 2H1EA 2E2HB 1UNSA 3MC0B 3NP8A 4KJNA 2JA7B 1GUOA 3BDCA 3MEHA 1Y8PB 2XWBB 3SE0A 2JYOA 1ILPA 2JXMB 4KMUC 1EY4A 4FXDA 4C2MB 1IYVA 1T5EA 1CTMA 1KNAA 1PRTF 4HR7B 4J1MA 2RDHA 2PPBC 1J8IA 3ND8A 4I65A 1I4PA 3A54A 1Y1WB 1O7LA 3DWAA 3NPPA 2WKDA 3ND9A 1V8QA 1SJED 3I70A 4DF7A 4CJ0B 5JVG3 2F0OA 1SE3A 4XQQA 1ET9A 2NVYB 5EGTA 4IFDG 1YNNC 4BS9A 2F0FA 1SNDA 4EQOA 1X32A 1STEA 5CR3A 1MGSA 3S1RB 4PQXA 3SK6A 2LS01 2MGSA 5C6AA 5KNDA 1F2YA 5M5XB 4A3GB 1A2TA 2E2JB 1IYUA 1XYIA 5I6YA 1YNJC 3TBIB 2HDMA 2M2LA 3MWYW 3P20A 2QILA 4CJ2C 5M5WB 3K5LA 3ERQA 3DM1A 3K5MA 1AFPA 4H0LC 4CHTB 1EU4A 5ELCA 4TQUS 1EL0A 1ZEQX 4K8IA 2IWHA 1C8CA 2AUKA 3H6MA 3F2UA 3NSWA 1EIGA 1QILA 1LTRD 2J0TD 3SK4A 3O13A 2Z1CA 2K01A 2XWJB 2R93B 2OF1A 4FNFA 5M9OA 4OIJA 4RH6A 1Z6HA 1EIHA 1XTCD 2GA4B 3A7LA 1PTOD 3M3YB 4A3KB 1VF7A 2WIIB 1E2ZA 1PZID 3QOJA 3LWUA 1Y8NB 4XQJA 3MTSA 4RGOS 4A93B 1BCPC 1I3QB 1B50A 4L6TB 5J1ZA 2ID0A 1VMPA 1QE6A 1S5CD 4CGYB 4K5XA 2MPMA 2D9UA 3D6WA 3NWSA 1BCPF 5C5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3C A;  1GUW A;  1E0B A;  1IKL A;  1ICW A;  1SDF A;  1F9P A;  2B2V C;  2KED A;  2N88 A;  1MI2 A;  3GV3 A;  5EPJ A;  4R9W A;  5CBE E;  1G91 A;  4ZK9 B;  4IUP A;  4MN3 A;  1HUN A;  1NAP A;  2B2Y A;  1XYI A;  2RA4 A;  2J7Z A;  1Q3L A;  1PFB A;  2VXW A;  5JJZ A;  1WTP A;  3I8Z A;  1X3P A;  1U4P A;  2R3Z A;  1F9S A;  1O80 A;  4RWS C;  4UAI A;  1CA5 A;  1NR4 A;  2X6L A;  2B2W C;  2HDM A;  2M2L A;  1ILQ A;  3MWY W;  1DOL A;  4ZAI A;  1O7Y A;  1F9R A;  1IKM A;  1AZQ A;  5CBA E;  1B4O A;  2B2W A;  4CJ2 C;  4CJ1 B;  1RJT A;  2H1E A;  2B2U A;  1NCV A;  1J9O A;  4HAE A;  1JIC A;  2B2T A;  2FHT A;  1A15 A;  4X3U A;  3DM1 A;  1IL8 A;  2NYZ D;  1RTO A;  2FIN B;  3DEP A;  3R93 A;  1WTO A;  2HCI A;  1PDQ A;  3I90 A;  2X6G A;  2L12 A;  1HRJ A;  1MSH A;  4QUC A;  1LV9 A;  1WTX A;  1EL0 A;  3TZD A;  4ZKC B;  2KEE A;  2BDN A;  2K1B A;  1B3A A;  4X3T A;  5EJW A;  1C8C A;  2DY8 A;  2IL8 A;  5EPL A;  3F2U A;  4IUV A;  1DZ1 A;  3HP3 A;  4XT3 B;  2L11 A;  5DNF A;  5AFW A;  1EIG A;  1RHP A;  1ROD A;  1EOT A;  2RVL A;  2JYO A;  1JE4 A;  1ILP A;  1QNK A;  1XX8 A;  1TVX A;  3KUP A;  3GV6 A;  4IUQ A;  4NW2 A;  1AZP A;  1PFM A;  1EQT A;  3QO2 A;  1G2T A;  1HFN A;  2FJ2 A;  1SAP A;  2K01 A;  2Q8R E;  4HCS A;  2L1B A;  1B2T A;  1WTW A;  2EE1 A;  1KNA A;  5COY A;  4ZKB B;  4RA8 A;  3I91 A;  2RSN A;  1AP0 A;  4XT1 B;  5T1I A;  1B53 A;  2CVR A;  1F2L A;  2L9H A;  3LWE A;  4OIK A;  1G2S A;  4OIJ A;  5EPK A;  3TN2 A;  1J8I A;  3DEO A;  1WTQ A;  1ML0 D;  4O42 A;  1PFN A;  2XIW A;  3N52 A;  1DOK A;  4HSV A;  4LMQ D;  5D65 A;  1EIH A;  2MP1 A;  4DN4 M;  2K28 A;  2FFK B;  1U4M A;  3IFD A;  4R8I A;  1WTV A;  5T1G A;  1WD0 A;  4QUF A;  2K04 A;  4X3S A;  3P7J A;  2Q8T A;  1CA6 A;  5EKI A;  2X69 A;  2MJ8 A;  2KUM A;  2HCC A;  1BBX C;  1SSO A;  1NR2 A;  2B2Y C;  1HHV A;  2K03 A;  2B2T C;  5E4X A;  2RSO A;  5COR A;  5EQ0 A;  1U4L A;  1BF4 A;  2KEC A;  3KBX A;  1PLF A;  4CJ0 B;  3ONA B;  4IUU A;  1RTN A;  2EOT A;  1O7Z A;  3Q6S A;  1G6Z A;  3MTS A;  1WD1 A;  1DON A;  1B50 A;  1QG7 A;  2HUG A;  1DOM A;  2NZ1 D;  4XDX A;  5E4W C;  1ESR A;  1X3Q A;  1HFG A;  5D14 A;  1F9Q A;  1VMP A;  1ZXT A;  2NWG A;  4HED A;  2SDF A;  4IUT A;  2B2U C;  4MHE A;  4U68 A;  4X3K A;  1WVL A;  2FMM A;  2DY7 A;  1S4Z A;  3H91 A;  1QE6 A;  1CM9 A;  2N55 A;  1KNE A;  2KVM A;  3G7L A;  4IUR A;  1MSG A;  2JP1 A;  1HUM A;  2L4N A;  1HA6 A;  1X32 A;  2B2V A;  1M8A A;  1U4R A;  2MPM A;  4ZLT F;  1BO0 A;  1BNZ A;  2D9U A;  1MGS A;  2EPB A;  3FDT A;  3UI2 A;  1VMC A;  2HDL A;  5CMD A;  3D6W A;  2KOL A;  2MGS A;  3IL8 A;  1WTR A;  2K05 A;  3FPU B;  3SVM A;  4RAU C; 
#chains in the Genus database with same CATH topology
 4JOI C;  5IP7 G;  2F4I A;  1PXU A;  2A69 C;  1B44 D;  3AB9 A;  1GM5 A;  5JEA G;  3NTI A;  2I5M X;  4ZUI A;  4BA1 I;  1J5E Q;  1NAP A;  3SDZ A;  1SLJ A;  2N78 A;  1O78 A;  3NQT A;  4OO1 I;  4KKS A;  2K50 A;  2B63 G;  4JI1 Q;  4QB4 A;  1BR9 A;  4IFD J;  1NR4 A;  2AHO B;  2F0M A;  1ILQ A;  2QGQ A;  1J6Q A;  1M4V A;  2F0Q A;  5CV7 A;  3EQL C;  1STY A;  2A74 C;  4DXF A;  4V19 0;  1GJX A;  5HY6 A;  4C3J G;  5M3F B;  2FHT A;  1TWF B;  5ELD A;  2NYZ D;  1WTO A;  4DV4 Q;  2F0H A;  2WB1 B;  4POF A;  1P8L A;  1SNQ A;  1SYB A;  3CCS A;  1PZJ D;  4F87 A;  3TDQ A;  4J15 A;  3FVQ A;  4C1N K;  3K0Y A;  4LF4 L;  3KF8 A;  4MTN A;  5CV8 A;  1EQQ A;  1W6J A;  2ATW A;  4JBW A;  2OQK A;  3BU2 A;  1XX8 A;  2VW9 A;  1EFI D;  1A3T A;  5JAV A;  2CW0 D;  3GTM B;  4UDU C;  1VQF A;  4DUZ Q;  1EYA A;  2Q8R E;  3TME A;  5AJ3 Q;  3F2C A;  2F0U A;  1XMQ L;  5C44 B;  4GN4 B;  4OIK A;  1N32 L;  2K5Q A;  5GAG C;  3DEO A;  3PF4 A;  2OTL A;  1PFN A;  1JOQ A;  4HSV A;  3PIP A;  2CKZ B;  1PMR A;  4A3L G;  5IP9 H;  1BVS A;  2MP1 A;  3R3O A;  3IFD A;  5AJ3 L;  1CFM A;  5T1G A;  3NEL A;  1PVO A;  1UE7 A;  3CPF A;  3Q23 A;  2A68 C;  1MD2 D;  2NZH A;  1HJP A;  2BA1 A;  1VQE A;  4N9P A;  3Q8D A;  5GAE C;  2VS1 A;  5EBC A;  1VCI A;  4HJ9 A;  1Y14 B;  3RR5 A;  1YBY A;  2OXP A;  3QG1 A;  3T1H Q;  1D5Z C;  4BY7 B;  1DON A;  1RDP D;  1I94 Q;  4QIW B;  1A3V A;  4ODG A;  4MHE A;  2BDO A;  2Q8I B;  4R4O A;  5C4X H;  1IW7 D;  1OO9 B;  2VQE Q;  1M8A A;  5I9O A;  3FDT A;  2VQF L;  1AE3 A;  2HQE A;  2LKV A;  4ABN A;  3T16 A;  4TVA B;  1H9S B;  2NN6 I;  3RN5 A;  4XYQ A;  1PA6 A;  1GUW A;  1N9W A;  1Y1W H;  4RCO A;  1HXY D;  3MA2 B;  3E9I A;  4R4T A;  2NBF A;  3K5O A;  3I55 A;  1PH3 A;  1H9J A;  5JJZ A;  2JA8 G;  1SN8 A;  4A3B G;  1E22 A;  2ZM6 Q;  1O80 A;  1H9M A;  1R4Q B;  1WCM B;  4B08 A;  2F0E A;  4FDB A;  5DLQ E;  1SNM A;  3ICE A;  2VNU D;  3F8T A;  1JIC A;  1EWC A;  2B8G A;  1IL8 A;  3R2T A;  4A3M H;  1SRU A;  3BYT B;  2LSS A;  3FHW A;  4QUC A;  3QR8 A;  1JMC A;  2JE6 I;  1YVC A;  3CHB D;  3TRZ A;  1F2Z A;  3D31 A;  2V1C C;  1S5F D;  5JPN C;  3S1R H;  1RHP A;  1XNQ Q;  2EJF C;  5C0X H;  5ELB A;  4LF9 L;  1E3P A;  1UE6 A;  1Q81 C;  3S1M B;  3HGB A;  2EYO A;  1SYE A;  3ULL A;  2ZJP A;  1LTA D;  2DGY A;  4KK7 A;  5LL6 S;  3U9O A;  5JJK A;  2AQ2 B;  4NKL A;  3S1M H;  2Q2H A;  3MZ5 A;  4L5R C;  2L5T A;  4C3I G;  4YCU A;  5JVH 3;  2OEO A;  1EZ8 A;  1STG A;  1HQM C;  5C4H A;  2F0K A;  4EQP A;  1KL9 A;  4DN4 M;  4R8I A;  1NE3 A;  3S16 B;  3ERO A;  1VQB A;  4ZUJ A;  5EKI A;  2E74 C;  3BVM A;  3N6R A;  4OWW B;  5IYC H;  3URY A;  2F0L A;  2N8N A;  1B9M A;  2FXQ A;  2RCN A;  3R8B A;  1QWY A;  2EYF A;  3OW7 A;  2CFM A;  1QCB D;  3H09 A;  2VQE L;  4POG A;  4HED A;  4DV6 L;  4GKK Q;  3DMU A;  5FLX E;  3EBE A;  4X3K A;  2PZW A;  4JVZ A;  4XIG S;  3KLS X;  3UDX A;  1EU3 A;  2L4N A;  4EVO A;  2B2V A;  5C4X G;  3DWP A;  1I6H B;  1AH9 A;  2F0T A;  2A6E C;  1I4H A;  1JOK A;  3OOC A;  1E1O A;  3GO5 A;  1ENA A;  1HPC A;  2SOB A;  1I50 B;  4JBJ A;  3U50 C;  4PMB A;  4OEL B;  3M4O H;  2WB1 E;  4RAU C;  5J3B A;  1N34 Q;  3CW2 C;  2IX1 A;  1SDF A;  1ICW A;  1D5M C;  1HA5 A;  1KTK A;  1Q8I A;  1VDZ A;  2CQA A;  2NVX H;  1RL2 A;  2CHB D;  2F0S A;  3C1E A;  2E2J H;  4IO9 A;  3PUZ A;  3GP7 A;  1QJO A;  4KKU A;  1S5D D;  4A3K H;  4DK1 A;  1I6H H;  3STB D;  2N3S A;  1HNW Q;  5A35 A;  1RJT A;  1N32 Q;  2WAC A;  3U58 A;  5CV4 A;  2PCF B;  2B2T A;  4CDF C;  4X3U A;  1XPR A;  2KJX A;  4OO1 H;  2YTV A;  2Z6K A;  2B3G A;  1LT5 D;  1SMY C;  4RG1 A;  3SR1 A;  3J7Y W;  4JI3 L;  1YZ6 A;  3S15 H;  2K14 A;  1X3G A;  2GVA A;  5ELE A;  1LTS D;  2JJQ A;  3K0X A;  4DV5 L;  1TWA H;  3FPP A;  3OTO L;  4R8N A;  1YI2 A;  1JB7 A;  1NTG A;  4DK6 C;  4X62 Q;  2CWA A;  3VR3 A;  1SE8 A;  4DV6 Q;  3HS0 C;  3CQZ H;  5CV6 A;  4A3C H;  3GTL H;  1G51 A;  1HNX L;  2FJ2 A;  1SAP A;  4KD3 A;  4Y7N B;  3W1B A;  1TY2 A;  1Y1V H;  4G57 A;  2WV6 D;  4GNX A;  2JSO A;  4GLX A;  2RBM A;  1IZ6 A;  3S2D H;  1TS5 A;  2K75 A;  3VR5 A;  5E3F A;  3TN2 A;  5GAH C;  2B8F A;  4C3I H;  1WTQ A;  1GUS A;  2R61 A;  2RDG A;  4HID A;  2OT2 A;  2G9H D;  1BQQ T;  2XSC A;  2ZTD A;  4BBS H;  3J80 E;  3ITP A;  3CCV A;  3A5Z B;  3NEM A;  1LUZ A;  3MXN A;  1HNZ L;  3TS2 A;  4KHV A;  1N36 L;  3FRP B;  2B2Y C;  3E9H A;  1GKH A;  3GTJ H;  4AH6 A;  1F2M A;  1H9R A;  1GOZ A;  1EUJ A;  3OWE B;  5C44 H;  1QG7 A;  2NZ1 D;  1DOM A;  2RQX A;  5C3E B;  4QF4 A;  3L3O C;  4U67 3;  3G7L A;  1E24 A;  1T5X D;  2JP1 A;  4P2C B;  1E7Z A;  2XGT A;  4A3C G;  1JT8 A;  3A7A B;  5M5X H;  4F7X A;  4GS3 A;  3UI2 A;  2FMC A;  1OXU A;  2F03 A;  3NE5 B;  3CCL A;  1H9K A;  3UDF A;  1UUP A;  5IGE A;  5FOB B;  3A5U A;  1TII D;  3QJY A;  1I5F A;  5LMN W;  4IUP A;  5D3I B;  2F0D A;  1YNJ D;  4UP8 A;  1EY9 A;  3UDI A;  1KAW A;  1WTP A;  3PO3 B;  2A19 A;  4C56 C;  2GVB A;  4OX9 Q;  1IKM A;  3GQB A;  5C3E G;  3S2D B;  1TWC H;  4JK1 C;  4CJ1 B;  4YY3 L;  3PF5 A;  5C0X J;  2LY7 A;  2L12 A;  4MTK A;  2VQF Q;  4LFC L;  4NMZ A;  1FJG L;  2DJG C;  4R4Q A;  1R9T B;  1V1P A;  4X62 L;  5C4J H;  5IGB A;  3EJI A;  1H9S A;  3OTO Q;  3S1Q B;  1KLU D;  3J81 E;  4DV5 Q;  1Y8O B;  2PQE A;  5M5Y H;  1HTP A;  3J81 c;  1YHQ A;  1HFN A;  4HTH A;  1I4G A;  1B2T A;  4GOP C;  3GTG B;  3D4D A;  3EIV A;  3MXG A;  1AP0 A;  3JAM L;  5T1I A;  4P72 A;  1D6E C;  4BY7 G;  2CH4 W;  1RKN A;  1C48 A;  2JA9 A;  2RKS A;  1EQV A;  3NXW A;  2WAQ B;  2NN6 G;  2L15 A;  4HJ5 A;  3R2I A;  1EEI D;  3VDY A;  3C3L A;  4B3S L;  2K28 A;  1ENC A;  1UEB A;  2K5D A;  5C3E H;  2NVY H;  4AIM A;  4A3M B;  4A3E B;  1TWH H;  5IT9 c;  2B63 H;  2BH8 A;  1ZYR C;  2F0I A;  1I50 H;  2LXK A;  5EAY A;  1VQD A;  4NP5 A;  1CKO A;  2EYJ A;  4R4C A;  3TP8 A;  2VUM G;  5L37 A;  3NWT A;  1LTG D;  1XTD A;  1O7Z A;  1BCP D;  5G3L F;  1IBK L;  3GDE A;  2SNS A;  5EBD A;  1I6V C;  4X66 Q;  2PZT A;  1BXT A;  4RCN A;  3RMH A;  4C3J B;  1CM9 A;  2DNE A;  1KNE A;  2R7F A;  5DEH A;  3I73 A;  1S3O A;  3GTK H;  4LFC Q;  1DCZ A;  5CMD A;  1BDO A;  3D4R A;  2O5I C;  4GZY C;  1WTR A;  1PFS A;  2VB2 X;  3HOY H;  3HOU G;  3KF8 B;  3GTQ H;  3GTL B;  2ZXR A;  2A69 D;  3NTH A;  3AEV A;  1E0B A;  1DYQ A;  1EQR A;  1Z47 A;  2N88 A;  2B29 A;  3GV3 A;  4F88 A;  2KEN A;  4KD4 A;  4ZK9 B;  4P73 A;  4WFN 3;  1QUQ A;  1SBB B;  5KEE A;  2JN4 A;  2PMZ B;  4BY7 H;  4FF3 A;  4O1N A;  4DK0 A;  4TKO B;  2RCF A;  4B9X A;  4CDE C;  2R92 H;  1EY5 A;  1V43 A;  1FYC A;  4OHJ A;  2K5N A;  2BA0 A;  1JCK B;  3KJP A;  4CDC C;  1O7I A;  3CU7 A;  1IXR A;  1AW7 A;  1JJG A;  3KLW A;  4A3L H;  1VQK A;  1WTX A;  3HOX B;  4IZ8 A;  2M9V A;  5M3F H;  2BDN A;  2BOS A;  4X3T A;  4A3D G;  1XPU A;  4LFB Q;  5C5L A;  2ZTE A;  3NBI A;  2F0W A;  4FP5 D;  3I56 A;  3M3Y H;  5M3M G;  1D5X C;  1JE4 A;  3GD7 A;  1L1O C;  2VUM B;  3F2D A;  2F0J A;  3KYH C;  4IUQ A;  4IAL A;  4FYD A;  4DNI A;  2I5H A;  1PYW D;  3CRK C;  2NVX B;  4ZKB B;  5CC4 A;  3CC2 A;  2KHJ A;  2R6G A;  1NUC A;  4HIM A;  1C4Q A;  5GRO A;  2F0V A;  1LAC A;  4K5W A;  1EFW A;  2ZM6 L;  1U4M A;  1JR0 D;  4JCV E;  5IY0 A;  3TP7 A;  3GTQ B;  5GQO A;  4PMW A;  3T56 B;  3BZK A;  1NR2 A;  2Z8L A;  2EIF A;  1BF4 A;  1VQG A;  2JEA I;  5KYI A;  2KEC A;  3VA5 A;  2IY5 B;  3X3N A;  4DR5 L;  3ONA B;  2R92 G;  4A3B B;  2NVQ H;  2F0G A;  1HNX Q;  2V4D A;  4H02 A;  3T13 A;  1K3B C;  5DAU A;  3HOZ H;  5E4W C;  3ULJ A;  1SFO B;  4DV1 L;  3TEH B;  2EZV A;  2NWG A;  2UUB L;  5NUC A;  1EIY B;  1PTO B;  1S4Z A;  3H91 A;  4C2M H;  4O0A A;  5C44 G;  3T53 B;  3C2P A;  1K83 B;  3SHL A;  3PV0 A;  4RGM A;  1F77 A;  3TZU A;  3CXC A;  4ALP A;  3T1H L;  1NY4 A;  4B3T L;  4GKJ L;  2K5H A;  5CV5 A;  2UXD L;  3SVM A;  4A4I A;  5IIF A;  3H15 A;  5LMN Q;  2R93 H;  1F9P A;  4R9W A;  1MKH A;  5BR8 Q;  2H5X A;  2F4V L;  3K7A B;  4K0K Q;  3OWF A;  4UAI A;  2EY5 A;  5I4D A;  4YCW A;  5JEA H;  3UE1 A;  1V1Q A;  2K7V A;  1PH7 A;  1TR5 A;  1OXX K;  1NMG A;  1L2F A;  3RUZ A;  1NSN S;  4JI7 Q;  1CKM A;  2AQ1 B;  1WYD A;  4G7H C;  1N34 L;  2L55 A;  1PYB A;  1LV9 A;  2NTT A;  5K5P A;  1D1K A;  4ZKC B;  3JC6 6;  2K1B A;  3WOF A;  1VQ4 A;  2IL8 A;  2GN5 A;  2MQH A;  1IBL L;  1DZ1 A;  4A3D H;  4QIW E;  3NBH A;  2CWP A;  1N33 L;  1I4Q A;  2RVL A;  3L7Z C;  3PUW A;  1GUN A;  4C3H B;  4GKK L;  3A8K E;  4LF4 Q;  2VY3 A;  1K0R A;  2EYM A;  3PCO B;  5FO9 B;  2C35 B;  5G3L D;  2K33 A;  5IGD A;  4N8X 1;  5IE8 A;  1YIT A;  1JJ2 A;  3E6Z X;  2D5D A;  1EY8 A;  4ZYS A;  2RSN A;  4RFB A;  3EA6 A;  2KCM A;  2QDL A;  4QCL A;  4ZRZ A;  3M7N A;  3QIA A;  1LO5 D;  3DHQ A;  1STN A;  5C4X B;  4LMQ D;  1DOK A;  1PRT D;  2XN9 C;  4IFD H;  1A3U A;  3JAM c;  3SK5 A;  3G6E A;  3S15 B;  1GD7 A;  1PH5 A;  3K57 A;  1SMY D;  3CCM A;  2EYP A;  3OYY A;  3ZJY C;  1J5E L;  2NVT H;  1MJC A;  1SRO A;  2QCP X;  4KHZ A;  1KRT A;  4DNT B;  5A2Q L;  4ZCK A;  2NVQ B;  1XMO Q;  1SYC A;  2AWO A;  1ET6 A;  4LF5 L;  2K32 A;  1TS3 A;  3H0G B;  1F9Q A;  4HIO A;  4LF9 Q;  1B1Z A;  2B2U C;  3LNN A;  1XNQ L;  2WKC A;  3A8I E;  2KVM A;  5KGU A;  1HUM A;  3ULP A;  4LF7 Q;  2VUM H;  4OO1 G;  3W2D A;  4ULL A;  3HOW G;  1A6X A;  4LF8 L;  3IKJ A;  5FO7 B;  3WDN A;  1Q90 A;  5LMU Q;  2JK8 A;  4KHP Q;  1LT3 D;  4B3R Q;  4A3G H;  4KN7 C;  4O2D A;  2ALY B;  3Q0A A;  4R4I A;  4PMC A;  1XXG A;  2F0P A;  1RIP A;  4IQZ A;  2JA5 G;  1KD1 C;  3I4M G;  3I4N G;  4GN3 B;  2J4X A;  2XTI A;  4FVM A;  1SYD A;  1KDA A;  1ONL A;  3OMC A;  1KLG D;  1SE2 A;  5EKL A;  2RF4 A;  4JI2 L;  1RTO A;  1EOV A;  2UXC L;  4RGN A;  2Q2I A;  4LNQ A;  1HRJ A;  3S1N B;  5EJW A;  1SEB D;  2WIN B;  1OTC A;  1EWH A;  3MXN B;  3HOZ B;  2VB3 X;  3QOL A;  4RHR A;  4OEM B;  5AFW A;  1ROD A;  3HKZ G;  1XJV A;  1STH A;  5I2X A;  4YWM A;  2PZU A;  1K83 H;  2BH2 A;  4A3M G;  1SNC A;  4DR4 Q;  1PTO H;  4LJZ C;  2I46 A;  1D8L A;  4A3J H;  4JI5 Q;  4RHS A;  5COY A;  1HR0 Q;  3HRZ C;  4B9W A;  2L9H A;  3LWE A;  1SR3 A;  2R7Z B;  1H95 A;  3M4Q A;  3QB3 A;  4FF2 A;  4KJO A;  2UU9 Q;  1CI3 M;  3N52 A;  5IYB H;  3BG3 A;  1VS0 A;  3J80 L;  2FFK B;  2F0N A;  4FF1 A;  2MO1 A;  4V0B A;  4GLV B;  1V1O A;  2AKW B;  2A6H D;  3I72 A;  1EWI A;  2KUM A;  1Q1E A;  4H7B A;  5EQ0 A;  3KBX A;  3JAM E;  3Q22 A;  2YV5 A;  3U9S A;  1RTN A;  4DUZ L;  5KRU A;  3J7A V;  2EYL A;  3S2H B;  1CHP D;  4L63 B;  1X9N A;  2KCN A;  4U68 A;  2E2H H;  2R7Z G;  1JOR A;  5IGF A;  3VYU A;  4X65 Q;  5GAD C;  3BVZ A;  3K8A A;  3S1N H;  4YIJ A;  1LTL A;  2KOL A;  2HIV A;  3HOZ G;  1LAB A;  2QF7 A;  4DV4 L;  4G4K A;  1FR3 A;  1Q1B A;  2R7D A;  4IUR A;  4HMJ A;  1FGU A;  1MI2 A;  2F1M A;  4EQN A;  2WP8 J;  3OSO A;  2PQA B;  2UXB Q;  2VXW A;  3AU7 A;  4DV3 L;  2R3Z A;  3RZD H;  1FNU A;  1HCZ A;  2KHS A;  4JI1 L;  3B6Y A;  2IW3 A;  3PUV A;  1DM0 B;  2DNC A;  4DUY Q;  3S17 H;  1CT1 D;  3G71 A;  2XNA C;  1A15 A;  1FD7 D;  3CQZ B;  3TP5 A;  1SYF A;  5M5W H;  1VQ7 A;  4DV0 Q;  3MFG A;  3SXH A;  3K5N A;  3CD6 A;  2A1A A;  4GOP A;  3PO2 B;  4QGU A;  4DR1 Q;  2OQ0 A;  1QVF A;  3K7A H;  3KFU A;  1EOT A;  4LF6 Q;  2EY2 A;  1W6K A;  3RZO B;  3HEJ A;  3H0G H;  1QNK A;  1V9P A;  3GV6 A;  2HHH L;  3DWQ A;  1DJR D;  2ICE C;  5IT9 E;  2B63 B;  2C9O A;  3CCU A;  4R1J A;  1T9H A;  3VYT A;  1PYS B;  5TSS A;  4A3F H;  1TQO A;  4CBV A;  2UUA Q;  3E5S A;  5FLM G;  4O42 A;  2XIW A;  3KLS A;  4DAY A;  1OXV A;  3J80 c;  2Y0S G;  3CPW A;  4DR7 Q;  3HKZ B;  4WJW A;  2PYK A;  2MUY A;  1WD0 A;  4JI6 Q;  1L0W A;  2CQO A;  3PIO 3;  2ZJQ A;  2IT1 A;  5K36 G;  4AQY Q;  4JI8 Q;  1L0Y B;  3A55 A;  4DR4 L;  1TKW B;  4BBR B;  3T1Y L;  1K8A C;  5E4X A;  5E7N A;  4DV2 L;  5BN4 A;  4KKT A;  1EZ6 A;  1VQA A;  4A3B H;  4YWK A;  2QW7 A;  5IWA Q;  3BDO A;  4XDX A;  1HFG A;  2EJG C;  1YNN D;  2WFW A;  2DY7 A;  2N49 A;  2Z4H A;  4L5T A;  4M8A A;  3OIQ A;  4HCE A;  1JC7 A;  4JI8 L;  2IX3 A;  4DR2 Q;  3CC7 A;  2E76 C;  2UUC L;  4JI6 L;  4N8F A;  1FVI A;  3PO2 G;  1HZC A;  1E2W A;  2IJ0 A;  1IBM L;  3BVG A;  1XNR L;  1KAB A;  3VYR A;  4BBR G;  2UUA L;  2B2Y A;  4IOA A;  2E2I B;  1Q3L A;  1CQV A;  2BE5 C;  4B3R L;  1GXD C;  2JA6 G;  1IHZ A;  3RLF A;  1O7Y A;  1WTH A;  3AFP A;  1B7Y B;  4DAP A;  1B4O A;  3KJO A;  3CCE A;  2K4K A;  3KOJ A;  1PRT B;  4PZ6 A;  3NTK A;  2DUD A;  1QNU A;  2G5D A;  3WOE A;  4LF7 L;  1U5K A;  1D1I A;  1QZH A;  1A63 A;  2FIN B;  4KN4 C;  3RNU A;  2Y0S B;  1PDQ A;  4BA2 I;  3W3A A;  3T51 B;  2QKI C;  2PNH A;  2M00 A;  1S5B D;  3TZD A;  3U4Z A;  2O4X A;  1B9N A;  4XQN A;  1GHK A;  1WCM H;  4A3K G;  5DNF A;  1VQ9 A;  3FKI B;  4BY1 B;  4M1U B;  5FLX L;  3L9A X;  4ME5 A;  4JI0 Q;  1B70 B;  1QB5 D;  1PFM A;  5IGC A;  2DN8 A;  1LTI D;  4HCS A;  1IYJ B;  4G7O C;  2L1B A;  3KF6 B;  1YJN A;  2EE1 A;  1K8G A;  3KF6 A;  3CP0 A;  1WJJ A;  2K6A A;  4DV3 Q;  2CVR A;  4I7Z C;  2Z6K C;  5EPK A;  3CAM A;  2O2L D;  3I4L A;  5I2Y A;  4DR3 Q;  1VQM A;  1SMX A;  4JV5 Q;  1VQ5 A;  2PNR C;  1VQJ A;  1PH1 A;  1I4R A;  5KNB A;  5J39 A;  1VQO A;  3D8G A;  2HT1 A;  5IYD G;  4Q5V A;  4NXN Q;  1C7Y A;  1Q46 A;  4JI0 L;  2L0C A;  1BBU A;  4LFA L;  2TSS A;  3C1F A;  4JI4 Q;  3F1Z A;  1L1O B;  1G6Z A;  2BCO A;  2IX0 A;  1ESR A;  1TWG B;  3LGJ A;  1KDC A;  1ZXT A;  1Z9F A;  2A5H A;  2ZXO A;  5FKA C;  4H44 C;  2N55 A;  4ZQ3 A;  5JJI A;  4KTA A;  1LTT D;  1VQ6 A;  1HA6 A;  4XTC S;  4DAM A;  4B3M L;  2ASB A;  1VQI A;  1BNZ A;  4N9T A;  1JB3 A;  4JG2 A;  3PSI A;  1VMC A;  2HDL A;  3V96 A;  4LK1 C;  5D3D A;  1IL2 A;  3IL8 A;  2K05 A;  3GTG H;  2I07 B;  3SK8 A;  4RKB A;  5M5Y B;  1E2V A;  2KED A;  2LXJ A;  4LW1 A;  1FNW A;  2UU9 L;  1EY7 A;  2J7Z A;  4UP7 A;  4CDD C;  3H3V C;  1QZG A;  3GTO B;  1HR0 L;  2AMC B;  2B2W C;  1X3E A;  2EVB A;  3PUX A;  2UUC Q;  3Q24 A;  1G8Z D;  1L1O A;  2ZTC A;  5CBA E;  5BN5 A;  4DR2 L;  1VF5 C;  4X64 Q;  3KDF A;  2ZT9 C;  1Q12 A;  2A73 B;  5I9P A;  3OMG A;  2E5L L;  1CZG A;  1SJH D;  3D6C A;  1DD2 A;  1L0X B;  5CYU A;  3W5O A;  1PTO C;  2HCI A;  4JC0 A;  3GTM H;  3I90 A;  4KI0 A;  3HOW B;  1STA A;  3CF5 A;  2KA7 A;  1Q86 C;  3M4O B;  1STB A;  1Q82 C;  3AMU A;  4RGT A;  3NHH A;  2VZA A;  3M4Y A;  5F2D A;  1CKN A;  2NB0 A;  4DV2 Q;  2MHV A;  4PZ7 A;  4JI2 Q;  1OXT A;  4BBS G;  1S5E D;  3K58 A;  2MFI A;  4C3J H;  1EYG A;  4RA8 A;  2Z6B A;  3GTK B;  3NQI A;  2EJM A;  2EY6 A;  2D2C C;  3DXJ C;  4X64 L;  3I4O A;  3MXU A;  1ML0 D;  3K59 A;  4BXX H;  4A3D B;  2O5J C;  4K6L A;  4E6I A;  3A74 A;  3S14 B;  1TY0 A;  2EXD A;  4F8M A;  1WTV A;  4YCV A;  5KIX A;  4AYB G;  1SNO A;  4DR6 L;  1EYC A;  1CUK A;  3J80 i;  3S17 B;  5JJL A;  4C1N I;  3TRE A;  1E1T A;  3OHX C;  3S14 H;  1KHI A;  1BCP B;  2IHE A;  4A3I B;  1BBX C;  2IPK D;  3OW2 A;  4LAA A;  3GTP B;  5C0X I;  4IOC A;  3GTJ B;  3RN2 A;  2ES2 A;  4DK3 C;  1K28 A;  1TU2 B;  3GTP H;  1X3Q A;  2F3V A;  1OXS C;  4B3M Q;  2SDF A;  1SXT A;  4YWL A;  4OGQ C;  1AN8 A;  3I2Z A;  2FMM A;  5C4J B;  2SEB D;  2PO4 A;  4YHH Q;  1XMO L;  2TMP A;  4C3I B;  1X65 A;  2OCE A;  5ELF A;  2F3W A;  1JJC B;  1K8M A;  4NXN L;  1ICF B;  5IYC G;  1QOH A;  3PQI A;  3FPU B;  4EQ5 A;  3G6J B;  4L5S A;  2Z0S A;  2D0O A;  5C3W A;  4A3J G;  1WTW A;  2UXB L;  2ICI A;  4Q0F A;  1SYG A;  5FLM H;  4QY7 A;  4P71 A;  1CSP A;  1WI5 A;  4IPH A;  2B39 A;  2A68 D;  2PMZ E;  4DXG A;  4JV5 L;  1F9R A;  3FEW X;  1Q7Y C;  1CHQ D;  4HJA A;  2YYZ A;  3PIO A;  1NCV A;  1PH2 A;  1JWU D;  5J22 A;  2YTY A;  4Y52 H;  1D2B A;  2ENB A;  4PNY A;  4AYB B;  4DAV A;  2JA6 H;  4NDX A;  1IBK Q;  1UE1 A;  1SE4 A;  4JBM A;  3ERS X;  3J7A F;  5KYL A;  3P1H A;  1I4X A;  2C5C A;  1LTB D;  4UP9 A;  1ASY A;  2JQO A;  1TVX A;  5HGT A;  4JI7 L;  2PW5 A;  3T4A C;  4DV7 Q;  1AZP A;  3QO2 A;  1G2T A;  1UEA B;  1FNV A;  1HZB A;  3J81 L;  4Z9C B;  3A8J E;  2KQ3 A;  3I91 A;  2MNA A;  3PO2 H;  1JWS D;  3OIP A;  4JYA Q;  3PUY A;  4A3F B;  3K6O A;  3HOX H;  5BR8 L;  1LLR D;  2E2D C;  1YEZ A;  1XNR Q;  3MHB A;  4L5Q A;  1IBM Q;  2CW0 C;  1WFQ A;  1ZKO A;  4JI5 L;  2K04 A;  2Q8T A;  2WAQ E;  2MJ8 A;  2RHQ B;  1PH6 A;  2HCC A;  3D0F A;  1G29 1;  1QUQ B;  2B2T C;  2K03 A;  4NXM L;  1GO3 E;  3HOU B;  1UAP A;  2JA5 B;  3NK9 A;  3BS1 A;  4IUU A;  4A3G G;  3IFT A;  3K81 C;  2UUB Q;  4OON A;  2F3I A;  1VQL A;  4WJ4 A;  1FJG Q;  4CKE A;  1AE2 A;  3V2T A;  3AFQ A;  4H13 C;  4IUT A;  1RCV D;  2XRS D;  1P16 A;  2PQA A;  4KLK A;  1WOC A;  2UXC Q;  2Y0S E;  3DM3 A;  4MIU A;  3T1Y Q;  4NB3 A;  3M85 A;  4YY3 Q;  1FL0 A;  5ISR A;  2I5L X;  4EGV A;  4IPC A;  5M3F G;  5DM6 3;  1YNX A;  4L8J A;  5A2Q E;  5ELO A;  1MHW C;  4NXM Q;  3HOW H;  4A75 A;  3BJU A;  3HOX G;  5CGK A;  1B8A A;  2K5W A;  2EYH A;  1X3F A;  2E75 C;  1SFO H;  1TWC B;  1X3P A;  3FKI G;  4BY1 G;  1F9S A;  5M3M B;  4DR7 L;  1EYD A;  2SNM A;  5LMU L;  4LUV A;  4DU9 A;  1DOL A;  1PTO F;  1EY0 A;  4JBK A;  1JOO A;  4J6H A;  5C0X G;  2AUJ D;  1XWE A;  3PO3 H;  1K0S A;  1UE5 A;  2B2U A;  3HG9 A;  3I4M H;  4HJ8 A;  3PMF A;  3R93 A;  4DAY B;  3WWV A;  5K36 H;  2X6G A;  3H94 A;  3RD4 A;  1JE5 A;  4WJ3 M;  1ASZ A;  2KEE A;  1Q8K A;  1LT4 D;  3X3M A;  1VQ8 A;  4DV0 L;  1PH4 A;  1M1K C;  1MIU A;  4IUV A;  4XT3 B;  5IOC A;  1UWV A;  3H3V H;  4LF6 L;  4K8J A;  4LWC A;  1AEX A;  3HZX A;  3GTO H;  5FO8 B;  4OXP A;  2G9D A;  5BN3 A;  4NW2 A;  3C46 A;  3D4W A;  4DA2 A;  1K8O A;  1EQT A;  5HGQ A;  3CRL C;  1NBW A;  4K14 A;  3M4P A;  3ZYY X;  4CKC A;  3CKI B;  2A6E D;  2R92 B;  4A76 A;  3PIP 3;  5FLX c;  4LUO A;  1F2L A;  1G2S A;  3S24 A;  3JAM i;  4KY7 A;  5D65 A;  3RLN A;  4J8Q A;  3CCQ A;  5I6W A;  1BOS A;  4X3S A;  3P7J A;  4QJF A;  4DR3 L;  1C9O A;  1N8R C;  2YTX A;  3HOU H;  2NZO A;  1HHV A;  1JWM D;  5COR A;  1PZK D;  2EOT A;  2RHS B;  3KDF B;  3RZD B;  4IPD A;  4K2K A;  2HUG A;  3FMC A;  1X55 A;  1K73 C;  4JI3 Q;  2JA8 B;  3QWN A;  4IJH A;  4I7A A;  4HN7 A;  4GN5 A;  1MSG A;  4K5V A;  1Y1W G;  3TSS A;  2WB1 G;  2NTS A;  3HOY B;  1U4R A;  4ZLT F;  1CKN B;  2EXZ A;  3G4S A;  2JEB I;  3CCJ A;  1EIF A;  4FF4 A;  4QMG A;  4K6D A;  2Z4I A;  1KIX A;  4B3S Q;  2JA7 H;  5IOD A;  4K0K L;  3VR6 A;  1KAA A;  3UE0 A;  5CBE E;  5EPJ A;  1BBW A;  1TT2 A;  3RZO H;  1C0A A;  4MN3 A;  2RA4 A;  2BE5 D;  4DR6 Q;  5JOB A;  5M3M H;  3I8Z A;  1B3Q A;  4RWS C;  3FKI H;  4BY1 H;  4ZAI A;  4GKJ Q;  3KK7 A;  1Y69 U;  3EVQ A;  1AZQ A;  4XXE A;  1U9R A;  1LT6 D;  1TS4 A;  4KY5 A;  1Y1V B;  4GNX C;  3KLR A;  3W1G A;  4UHV A;  4FXG C;  4HIK A;  1HH2 P;  2PW7 A;  1LM0 A;  1MSH A;  1SNP A;  5ELN A;  1DXM A;  4PG3 A;  2DY8 A;  4P74 A;  4DGZ A;  4GNX B;  2JA5 H;  4DPG A;  4WRD A;  1CSQ A;  3LX0 A;  1YHA A;  3HP3 A;  3I4N H;  4DR5 Q;  3MEF A;  2RDF A;  1YHB A;  4JW0 A;  5EKK A;  2AWN A;  5IP7 H;  3VR2 A;  4P75 A;  1Z7T A;  1BUV T;  2D62 A;  3BYY B;  3ER0 A;  4EX5 A;  1TS2 A;  3HFZ B;  5LL6 X;  2HQL A;  3EFX D;  3J7Z C;  3HKZ E;  4XT1 B;  2E5L Q;  3VR4 A;  3J7A 5;  4PV1 C;  3A0J A;  5KNC A;  2D0P A;  1KDB A;  1PRT C;  5IP9 G;  1MBY A;  4KHP L;  1M90 C;  4IPG A;  3CC4 A;  2LMC B;  3S16 H;  2KBN A;  3BZD B;  1YJ9 A;  1K3R A;  2YU9 B;  4UY8 C;  4JYA L;  1SSO A;  4TSS A;  5CV9 A;  4BWG B;  1V1P B;  2A8V A;  1U4L A;  1MJE A;  2P5Z X;  3Q6S A;  4OL7 A;  5JPM C;  2JA6 B;  1X54 A;  3OPO A;  3F2B A;  1DGS A;  1WD1 A;  3MAQ A;  1HTL D;  1II3 A;  4DV7 L;  2HHH Q;  3U4V A;  3P75 A;  1YJW A;  1HUN A;  4HMI A;  4LF5 Q;  2Z9H A;  5FK9 C;  2QEJ C;  3SEB A;  4HSP A;  3HKS A;  4DR1 L;  1IW7 C;  2XRQ D;  3RLO A;  1NJI C;  1BO0 A;  1ENF A;  3DUZ A;  2ZXP A;  3MXP A;  4UPA A;  1ESF A;  4WOR A;  3VA7 A;  3E0J A;  2AQ3 B;  5C5M A;  4NPS A;  4JI4 L;  1VQC A;  3I3C A;  4G7Z C;  3M7G A;  4LFA Q;  4DFA A;  4KV6 A;  1IKL A;  4BBS B;  4DUY L;  4KY6 A;  3BZC A;  4K2L A;  4FO2 A;  4XYO A;  3PGZ A;  1CA5 A;  2X6L A;  4C3H G;  1RD9 D;  1A2U A;  3EN2 A;  5E1F A;  5IT9 L;  1GUT A;  1J9O A;  2H4O A;  4HAE A;  1TWF H;  3KBG A;  5HUR A;  4BXX G;  3DEP A;  5FJ8 H;  1FGB D;  2A6H C;  2EDG A;  4RKL A;  4IFD I;  1IBL Q;  3NUC A;  5C4Z A;  1B3A A;  1KXL A;  4DNR B;  2CH4 A;  1I94 L;  4JPB W;  5EPL A;  1VQH A;  4A3I G;  2KHI A;  4FXK C;  2L11 A;  2NN6 H;  3I7F A;  4CKB A;  4YHH L;  1QVC A;  4ME3 A;  3TQY A;  2LFN A;  4A3E H;  3KUP A;  5H1S E;  5IYD H;  4IUN A;  1WCM G;  1EY6 A;  1EEF D;  1HNW L;  1K9M C;  3I4M B;  2HIX A;  1QVG A;  3BDL A;  1B53 A;  3IAY A;  1NMF A;  4QQB X;  3S9W A;  2K52 A;  2R7Z H;  3HOV G;  1CK1 A;  2QA4 A;  2PI2 A;  3FP9 A;  4S3S A;  5JEA J;  1HQR D;  1CZW A;  3VYS A;  2XVS A;  3A56 A;  1PV4 A;  1W3S A;  4QUF A;  1CA6 A;  2X69 A;  2KCC A;  4ILW A;  5LMN L;  2RSO A;  1PLF A;  1R9T H;  2NVT B;  3L2P A;  1JQY D;  2QDB A;  4A3J B;  3NEN A;  5IGG A;  1HZA A;  3D3R A;  2E2I H;  5D14 A;  1TXY A;  3V05 A;  1WVL A;  3I4N B;  1ZYR D;  3S1Q H;  3HOV B;  1RF2 D;  4OWT B;  1R4P B;  1VQP A;  1W2B A;  2EPB A;  5IWA L;  2HD3 A;  2NUC A;  3L0O A;  1KRS A;  3MVV A;  1CQF A;  1GHJ A;  1BKB A;  3TP6 A;  2B2V C;  4TRD A;  4ID6 A;  1G91 A;  2QEX A;  3MFY A;  2EY1 A;  1PFB A;  5LHY 1;  1TWA B;  1U4P A;  3NBH B;  1GUG A;  4MNO A;  5C3X A;  1TWH B;  4IN3 A;  1U0L A;  3DLL A;  3H0G G;  2B2W A;  5DM7 3;  4A3F G;  2H1E A;  2E2H B;  4GLA C;  1UNS A;  3MC0 B;  3NP8 A;  2K5V A;  2R93 G;  4KJN A;  4LFB L;  2JA7 B;  1GUO A;  4LF8 Q;  3AQQ A;  3BDC A;  2EQS A;  3MEH A;  5IYB G;  1PH9 A;  2CCZ A;  1Y8P B;  2XWB B;  4A3I H;  3SE0 A;  4Y7N H;  2JYO A;  1ILP A;  1G6P A;  2JXM B;  4KMU C;  1EY4 A;  4FXD A;  1N36 Q;  1XPO A;  2YU9 H;  4C2M B;  1IYV A;  1T5E A;  1CTM A;  1HR0 W;  1KNA A;  1PRT F;  3J81 j;  4HR7 B;  2VL6 A;  4J1M A;  3SGI A;  2RDH A;  2PPB C;  2F52 A;  4A93 G;  2JA7 G;  1J8I A;  4GOP B;  3HOV H;  3ND8 A;  3K80 C;  4I65 A;  1S40 A;  1I4P A;  3TS0 A;  4OWX B;  3A54 A;  1Y1W B;  1O7L A;  3DWA A;  3M9B A;  3NPP A;  3E0E A;  1KQS A;  2WKD A;  3ND9 A;  3IRB A;  4JOI A;  3AYH B;  3CME A;  1V8Q A;  1SJE D;  3I70 A;  4BBR H;  4DF7 A;  4CJ0 B;  5JVG 3;  2F0O A;  1SE3 A;  4XQQ A;  4HJ7 A;  1ET9 A;  1S72 A;  3STB C;  2E8G A;  2NVY B;  5EGT A;  2IHF A;  2ZJR A;  4IFD G;  4X65 L;  1YNN C;  3PO3 G;  4BS9 A;  3UDG A;  2F0F A;  1SND A;  4DKA C;  3J81 i;  1N33 Q;  4EQO A;  4X66 L;  3CCR A;  1X32 A;  1STE A;  1GVP A;  5CR3 A;  1MGS A;  3S1R B;  4PQX A;  3SK6 A;  2LS0 1;  1PHJ A;  2MGS A;  5C6A A;  5KND A;  4X6A H;  2Q2T A;  1F2Y A;  5M5X B;  2JA8 H;  3H3V I;  4A3G B;  1A62 A;  1A2T A;  4AYB E;  1NNX A;  2E2J B;  1IYU A;  1XYI A;  1KC8 C;  5I6Y A;  1YNJ C;  3TBI B;  1XMQ Q;  1LYL A;  2I0Q A;  4A93 H;  1A0I A;  2HDM A;  2M2L A;  3MWY W;  3P20 A;  2QIL A;  2F4V Q;  1D7Q A;  4CJ2 C;  5M5W B;  3K7U C;  3K5L A;  3ERQ A;  3DM1 A;  1TWG H;  2UXD Q;  3K5M A;  1AFP A;  3G48 A;  3HOY G;  4H0L C;  4B3T Q;  4CHT B;  1EU4 A;  5ELC A;  4TQU S;  1EL0 A;  2OWO A;  1ZEQ X;  4K8I A;  2IWH A;  1C8C A;  2AUK A;  3H6M A;  5FJ8 G;  3F2U A;  2OTJ A;  3NSW A;  1EIG A;  1QIL A;  1LTR D;  2J0T D;  3SK4 A;  3O13 A;  4LUZ A;  4DV1 Q;  2Z1C A;  4QL5 A;  4APV A;  2K01 A;  2XWJ B;  2R93 B;  2OF1 A;  1YIJ A;  4PZ8 A;  1HZ9 A;  4FNF A;  5M9O A;  4OIJ A;  4AQY L;  1X6O A;  4RH6 A;  3E3X A;  1Z6H A;  4OX9 L;  4RMF A;  1EIH A;  1XTC D;  2GA4 B;  3S2H H;  2MO0 A;  4C3H H;  3CMA A;  3A7L A;  1PTO D;  3M3Y B;  4A3K B;  1VF7 A;  2WII B;  1VQN A;  2KCT A;  1E2Z A;  1PZI D;  3QOJ A;  3LWU A;  2Q2U A;  1Y8N B;  4XQJ A;  3MTS A;  4RGO S;  4A93 B;  2DJF C;  1BCP C;  1I3Q B;  1B50 A;  4L6T B;  5J1Z A;  2ID0 A;  1VMP A;  2WAQ G;  1X56 A;  1QE6 A;  1I3Q H;  1S5C D;  4CGY B;  4K5X A;  2MPM A;  4A3E G;  2D9U A;  1HNZ Q;  1Y1V G;  3D6W A;  3NWS A;  1PH8 A;  4IJL A;  4MZ9 A;  1BCP F;  2PI2 E;  1A8V A; 
#chains in the Genus database with same CATH homology
 2F4I A;  1PXU A;  2A69 C;  1B44 D;  3AB9 A;  5JEA G;  3NTI A;  4ZUI A;  4BA1 I;  1NAP A;  3SDZ A;  1O78 A;  3NQT A;  4OO1 I;  4KKS A;  4QB4 A;  1BR9 A;  4IFD J;  1NR4 A;  2F0M A;  1ILQ A;  1M4V A;  2F0Q A;  5CV7 A;  3EQL C;  1STY A;  2A74 C;  4DXF A;  4V19 0;  1GJX A;  4C3J G;  5M3F B;  2FHT A;  1TWF B;  5ELD A;  2NYZ D;  1WTO A;  2F0H A;  2WB1 B;  1SNQ A;  1SYB A;  1PZJ D;  4F87 A;  3TDQ A;  3FVQ A;  4C1N K;  3K0Y A;  3KF8 A;  5CV8 A;  1W6J A;  4JBW A;  1XX8 A;  1EFI D;  1A3T A;  5JAV A;  2CW0 D;  3GTM B;  4UDU C;  1EYA A;  2Q8R E;  3TME A;  2F0U A;  5C44 B;  4OIK A;  2K5Q A;  3DEO A;  1JOQ A;  1PFN A;  4HSV A;  1PMR A;  2MP1 A;  3R3O A;  3IFD A;  1CFM A;  5T1G A;  3Q23 A;  2A68 C;  1MD2 D;  2BA1 A;  4N9P A;  5EBC A;  1VCI A;  2OXP A;  3QG1 A;  1D5Z C;  4BY7 B;  1DON A;  1RDP D;  4QIW B;  1A3V A;  4ODG A;  4MHE A;  2BDO A;  2Q8I B;  1IW7 D;  1OO9 B;  1M8A A;  5I9O A;  3FDT A;  2HQE A;  2LKV A;  4ABN A;  3T16 A;  1H9S B;  2NN6 I;  4XYQ A;  1GUW A;  4RCO A;  1HXY D;  3MA2 B;  2NBF A;  3K5O A;  1H9J A;  5JJZ A;  1O80 A;  1H9M A;  1R4Q B;  1WCM B;  4B08 A;  2F0E A;  1SNM A;  2VNU D;  1JIC A;  1EWC A;  2B8G A;  1IL8 A;  3R2T A;  3BYT B;  4QUC A;  2JE6 I;  3CHB D;  1F2Z A;  3D31 A;  1S5F D;  5JPN C;  1RHP A;  2EJF C;  5C0X H;  5ELB A;  3S1M B;  3HGB A;  2EYO A;  1SYE A;  1LTA D;  4KK7 A;  5LL6 S;  3U9O A;  2AQ2 B;  4NKL A;  3MZ5 A;  2L5T A;  4C3I G;  5JVH 3;  2OEO A;  1EZ8 A;  1STG A;  1HQM C;  5C4H A;  2F0K A;  4EQP A;  4DN4 M;  4R8I A;  3S16 B;  3ERO A;  4ZUJ A;  5EKI A;  2E74 C;  3BVM A;  3N6R A;  3URY A;  2F0L A;  1B9M A;  3R8B A;  1QWY A;  2EYF A;  3OW7 A;  1QCB D;  3H09 A;  4HED A;  3DMU A;  5FLX E;  4X3K A;  2PZW A;  4XIG S;  3KLS X;  1EU3 A;  2L4N A;  4EVO A;  2B2V A;  3DWP A;  1I6H B;  2F0T A;  2A6E C;  1I4H A;  1JOK A;  3OOC A;  3GO5 A;  1ENA A;  1HPC A;  2SOB A;  1I50 B;  4PMB A;  4RAU C;  2IX1 A;  1SDF A;  1ICW A;  1D5M C;  1HA5 A;  1KTK A;  1Q8I A;  1VDZ A;  2CQA A;  2CHB D;  2F0S A;  3C1E A;  3PUZ A;  3GP7 A;  1QJO A;  4KKU A;  1S5D D;  4DK1 A;  5A35 A;  1RJT A;  2WAC A;  5CV4 A;  2PCF B;  2B2T A;  4X3U A;  2KJX A;  4OO1 H;  1LT5 D;  1SMY C;  3SR1 A;  3J7Y W;  5ELE A;  1LTS D;  3FPP A;  4R8N A;  3VR3 A;  3HS0 C;  5CV6 A;  2FJ2 A;  1SAP A;  4KD3 A;  4Y7N B;  1TY2 A;  4G57 A;  2WV6 D;  2JSO A;  2RBM A;  1TS5 A;  3VR5 A;  5E3F A;  3TN2 A;  2B8F A;  1WTQ A;  1GUS A;  2R61 A;  2RDG A;  2OT2 A;  2G9H D;  1BQQ T;  2XSC A;  3J80 E;  3ITP A;  3MXN A;  4KHV A;  3FRP B;  2B2Y C;  1F2M A;  1H9R A;  1GOZ A;  3OWE B;  1QG7 A;  2NZ1 D;  1DOM A;  2RQX A;  5C3E B;  4QF4 A;  3L3O C;  4U67 3;  3G7L A;  1T5X D;  2JP1 A;  4P2C B;  3A7A B;  4F7X A;  3UI2 A;  2FMC A;  1OXU A;  2F03 A;  3NE5 B;  1H9K A;  1UUP A;  5IGE A;  5FOB B;  1TII D;  3QJY A;  4IUP A;  5D3I B;  2F0D A;  1YNJ D;  1EY9 A;  3PO3 B;  1WTP A;  4C56 C;  1IKM A;  3GQB A;  3S2D B;  4JK1 C;  4CJ1 B;  5C0X J;  2LY7 A;  2L12 A;  4NMZ A;  1R9T B;  1V1P A;  5IGB A;  3EJI A;  1H9S A;  3S1Q B;  1KLU D;  3J81 E;  1Y8O B;  2PQE A;  1HTP A;  1HFN A;  4HTH A;  1I4G A;  1B2T A;  3GTG B;  3D4D A;  3MXG A;  1AP0 A;  3JAM L;  5T1I A;  1D6E C;  1RKN A;  1C48 A;  2RKS A;  1EQV A;  3NXW A;  2WAQ B;  2NN6 G;  3R2I A;  1EEI D;  3C3L A;  2K28 A;  1ENC A;  2K5D A;  4A3M B;  4A3E B;  1ZYR C;  2F0I A;  4NP5 A;  2EYJ A;  3TP8 A;  3NWT A;  1LTG D;  1O7Z A;  1BCP D;  5G3L F;  2SNS A;  5EBD A;  1I6V C;  2PZT A;  1BXT A;  4RCN A;  3RMH A;  4C3J B;  1CM9 A;  2DNE A;  1KNE A;  5DEH A;  3I73 A;  1DCZ A;  5CMD A;  1BDO A;  3D4R A;  2O5I C;  4GZY C;  1WTR A;  2VB2 X;  3GTL B;  2ZXR A;  2A69 D;  3NTH A;  1E0B A;  1DYQ A;  1Z47 A;  2N88 A;  3GV3 A;  4F88 A;  4KD4 A;  4ZK9 B;  4WFN 3;  1SBB B;  5KEE A;  2PMZ B;  4FF3 A;  4O1N A;  4DK0 A;  4TKO B;  4B9X A;  1EY5 A;  1V43 A;  1FYC A;  4OHJ A;  2BA0 A;  1JCK B;  3CU7 A;  1AW7 A;  1WTX A;  3HOX B;  4IZ8 A;  2M9V A;  2BDN A;  2BOS A;  4X3T A;  5C5L A;  3NBI A;  2F0W A;  4FP5 D;  1D5X C;  1JE4 A;  3GD7 A;  2VUM B;  2F0J A;  4IUQ A;  4IAL A;  4FYD A;  1PYW D;  3CRK C;  2NVX B;  4ZKB B;  5CC4 A;  2R6G A;  1NUC A;  1C4Q A;  2F0V A;  1LAC A;  4K5W A;  1U4M A;  1JR0 D;  3TP7 A;  3GTQ B;  4PMW A;  3T56 B;  1NR2 A;  2Z8L A;  1BF4 A;  2JEA I;  5KYI A;  2KEC A;  3VA5 A;  3X3N A;  4A3B B;  3ONA B;  2F0G A;  2V4D A;  3T13 A;  5DAU A;  5E4W C;  1SFO B;  2EZV A;  2NWG A;  5NUC A;  1PTO B;  1S4Z A;  3H91 A;  3T53 B;  3C2P A;  1K83 B;  3SHL A;  3PV0 A;  4RGM A;  1F77 A;  3TZU A;  5CV5 A;  3SVM A;  5IIF A;  1F9P A;  4R9W A;  3K7A B;  3OWF A;  4UAI A;  2EY5 A;  5I4D A;  5JEA H;  2K7V A;  1TR5 A;  1OXX K;  3RUZ A;  1NSN S;  2AQ1 B;  4G7H C;  2L55 A;  1LV9 A;  2NTT A;  5K5P A;  1D1K A;  4ZKC B;  2K1B A;  3WOF A;  2IL8 A;  1DZ1 A;  3NBH A;  1I4Q A;  2RVL A;  3L7Z C;  3PUW A;  1GUN A;  4C3H B;  3A8K E;  2EYM A;  5FO9 B;  5G3L D;  2K33 A;  5IGD A;  3E6Z X;  2D5D A;  1EY8 A;  4ZYS A;  2RSN A;  4RFB A;  3EA6 A;  4QCL A;  4ZRZ A;  3M7N A;  3QIA A;  1LO5 D;  3DHQ A;  1STN A;  5C4X B;  4LMQ D;  1DOK A;  1PRT D;  2XN9 C;  4IFD H;  1A3U A;  3SK5 A;  3S15 B;  3K57 A;  1SMY D;  2EYP A;  2QCP X;  4KHZ A;  4DNT B;  5A2Q L;  2NVQ B;  1SYC A;  2AWO A;  1ET6 A;  2K32 A;  1TS3 A;  3H0G B;  1F9Q A;  1B1Z A;  2B2U C;  3LNN A;  2WKC A;  3A8I E;  2KVM A;  5KGU A;  1HUM A;  4OO1 G;  3W2D A;  4ULL A;  1A6X A;  3IKJ A;  5FO7 B;  3WDN A;  1Q90 A;  1LT3 D;  4KN7 C;  3Q0A A;  4PMC A;  1XXG A;  2F0P A;  4IQZ A;  2J4X A;  4FVM A;  1SYD A;  1KDA A;  1ONL A;  3OMC A;  1KLG D;  1SE2 A;  5EKL A;  1RTO A;  4RGN A;  1HRJ A;  3S1N B;  5EJW A;  1SEB D;  2WIN B;  1EWH A;  3HOZ B;  2VB3 X;  3QOL A;  4RHR A;  5AFW A;  1ROD A;  1STH A;  5I2X A;  2PZU A;  1SNC A;  1PTO H;  4LJZ C;  2I46 A;  4RHS A;  5COY A;  3HRZ C;  4B9W A;  2L9H A;  3LWE A;  2R7Z B;  3QB3 A;  4FF2 A;  4KJO A;  1CI3 M;  3N52 A;  3BG3 A;  3J80 L;  2FFK B;  2F0N A;  4FF1 A;  4V0B A;  1V1O A;  2A6H D;  3I72 A;  2KUM A;  1Q1E A;  4H7B A;  5EQ0 A;  3KBX A;  3JAM E;  3Q22 A;  3U9S A;  1RTN A;  5KRU A;  3J7A V;  2EYL A;  3S2H B;  1CHP D;  4L63 B;  2KCN A;  4U68 A;  1JOR A;  5IGF A;  3VYU A;  3BVZ A;  4YIJ A;  2KOL A;  1LAB A;  2QF7 A;  4G4K A;  1FR3 A;  1Q1B A;  4IUR A;  4HMJ A;  1MI2 A;  2F1M A;  4EQN A;  2WP8 J;  3OSO A;  2VXW A;  3AU7 A;  2R3Z A;  1FNU A;  1HCZ A;  2KHS A;  2IW3 A;  3PUV A;  1DM0 B;  2DNC A;  1CT1 D;  2XNA C;  1A15 A;  1FD7 D;  3CQZ B;  3TP5 A;  1SYF A;  3MFG A;  3SXH A;  3K5N A;  3PO2 B;  1EOT A;  2EY2 A;  1W6K A;  3RZO B;  3HEJ A;  1QNK A;  3GV6 A;  3DWQ A;  1DJR D;  2ICE C;  5IT9 E;  2B63 B;  2C9O A;  3VYT A;  5TSS A;  1TQO A;  4CBV A;  3E5S A;  4O42 A;  2XIW A;  3KLS A;  4DAY A;  1OXV A;  3HKZ B;  4WJW A;  2PYK A;  2MUY A;  1WD0 A;  3PIO 3;  2IT1 A;  5K36 G;  1L0Y B;  3A55 A;  1TKW B;  4BBR B;  5E4X A;  5BN4 A;  4KKT A;  1EZ6 A;  3BDO A;  4XDX A;  1HFG A;  2EJG C;  1YNN D;  2DY7 A;  2Z4H A;  4M8A A;  3OIQ A;  4HCE A;  1JC7 A;  2IX3 A;  2E76 C;  1E2W A;  2IJ0 A;  3BVG A;  1KAB A;  3VYR A;  2B2Y A;  2E2I B;  1Q3L A;  1CQV A;  2BE5 C;  1GXD C;  1IHZ A;  3RLF A;  1O7Y A;  4DAP A;  1B4O A;  1PRT B;  3NTK A;  1QNU A;  3WOE A;  1D1I A;  2FIN B;  4KN4 C;  2Y0S B;  1PDQ A;  4BA2 I;  3W3A A;  3T51 B;  2QKI C;  2M00 A;  1S5B D;  3TZD A;  2O4X A;  1B9N A;  4XQN A;  1GHK A;  5DNF A;  3FKI B;  4BY1 B;  4M1U B;  5FLX L;  3L9A X;  4ME5 A;  1QB5 D;  1PFM A;  5IGC A;  2DN8 A;  1LTI D;  4HCS A;  4G7O C;  2L1B A;  2EE1 A;  2K6A A;  2CVR A;  4I7Z C;  5EPK A;  3I4L A;  2O2L D;  5I2Y A;  2PNR C;  1I4R A;  5KNB A;  5J39 A;  3D8G A;  4Q5V A;  2L0C A;  2TSS A;  3C1F A;  1G6Z A;  2BCO A;  2IX0 A;  1ESR A;  1TWG B;  1KDC A;  1ZXT A;  2A5H A;  2ZXO A;  5FKA C;  4H44 C;  2N55 A;  4ZQ3 A;  4KTA A;  1LTT D;  1HA6 A;  4XTC S;  1BNZ A;  4N9T A;  1JB3 A;  1VMC A;  2HDL A;  3V96 A;  4LK1 C;  5D3D A;  3IL8 A;  2K05 A;  2I07 B;  3SK8 A;  4RKB A;  5M5Y B;  1E2V A;  2KED A;  1FNW A;  1EY7 A;  2J7Z A;  3H3V C;  3GTO B;  2B2W C;  2EVB A;  3PUX A;  3Q24 A;  1G8Z D;  5CBA E;  5BN5 A;  1VF5 C;  2ZT9 C;  1Q12 A;  2A73 B;  5I9P A;  3OMG A;  1CZG A;  1SJH D;  3D6C A;  1DD2 A;  1L0X B;  5CYU A;  1PTO C;  2HCI A;  3I90 A;  4KI0 A;  3HOW B;  1STA A;  2KA7 A;  3M4O B;  1STB A;  3AMU A;  4RGT A;  3NHH A;  3M4Y A;  5F2D A;  2NB0 A;  2MHV A;  1OXT A;  1S5E D;  3K58 A;  4RA8 A;  3GTK B;  3NQI A;  2EJM A;  2EY6 A;  2D2C C;  3DXJ C;  3MXU A;  1ML0 D;  3K59 A;  4A3D B;  2O5J C;  4K6L A;  4E6I A;  3S14 B;  1TY0 A;  4F8M A;  1WTV A;  5KIX A;  1SNO A;  1EYC A;  3S17 B;  4C1N I;  3OHX C;  4A3I B;  1BCP B;  1BBX C;  2IPK D;  3GTP B;  4LAA A;  5C0X I;  3GTJ B;  1TU2 B;  1X3Q A;  2F3V A;  1OXS C;  2SDF A;  1SXT A;  4OGQ C;  1AN8 A;  5C4J B;  2FMM A;  2SEB D;  2PO4 A;  2TMP A;  4C3I B;  5ELF A;  2F3W A;  1K8M A;  1QOH A;  3FPU B;  3G6J B;  5C3W A;  1WTW A;  2ICI A;  4Q0F A;  1SYG A;  2B39 A;  2A68 D;  4DXG A;  1F9R A;  3FEW X;  1CHQ D;  2YYZ A;  1NCV A;  1JWU D;  5J22 A;  1D2B A;  2ENB A;  4PNY A;  4AYB B;  4DAV A;  4NDX A;  1SE4 A;  3J7A F;  5KYL A;  3P1H A;  1I4X A;  2C5C A;  1LTB D;  1TVX A;  5HGT A;  2PW5 A;  3T4A C;  1AZP A;  3QO2 A;  1G2T A;  1UEA B;  1FNV A;  3J81 L;  4Z9C B;  3A8J E;  2KQ3 A;  3I91 A;  1JWS D;  3OIP A;  3PUY A;  4A3F B;  3K6O A;  1LLR D;  2E2D C;  3MHB A;  2CW0 C;  1ZKO A;  2K04 A;  2Q8T A;  2MJ8 A;  2HCC A;  1G29 1;  2K03 A;  2B2T C;  3HOU B;  1UAP A;  2JA5 B;  3NK9 A;  3BS1 A;  4IUU A;  3IFT A;  4CKE A;  3V2T A;  4H13 C;  4IUT A;  1RCV D;  2XRS D;  4MIU A;  3M85 A;  5ISR A;  4EGV A;  5DM6 3;  4L8J A;  5A2Q E;  5CGK A;  2K5W A;  2EYH A;  2E75 C;  1TWC B;  1X3P A;  5M3M B;  1F9S A;  1EYD A;  2SNM A;  4DU9 A;  1DOL A;  1PTO F;  1EY0 A;  1JOO A;  4J6H A;  5C0X G;  2AUJ D;  1XWE A;  3HG9 A;  2B2U A;  3PMF A;  3R93 A;  5K36 H;  2X6G A;  3H94 A;  3RD4 A;  2KEE A;  1LT4 D;  3X3M A;  4IUV A;  4XT3 B;  5IOC A;  4K8J A;  1AEX A;  3HZX A;  5FO8 B;  2G9D A;  5BN3 A;  4NW2 A;  3C46 A;  3D4W A;  4DA2 A;  1K8O A;  1EQT A;  3CRL C;  4K14 A;  3ZYY X;  4CKC A;  3CKI B;  2A6E D;  2R92 B;  3PIP 3;  1F2L A;  1G2S A;  4KY7 A;  5D65 A;  4J8Q A;  5I6W A;  1BOS A;  4X3S A;  3P7J A;  1HHV A;  1JWM D;  5COR A;  1PZK D;  2EOT A;  3RZD B;  4K2K A;  2HUG A;  3FMC A;  2JA8 B;  3QWN A;  4HN7 A;  1MSG A;  4K5V A;  3TSS A;  2NTS A;  3HOY B;  1U4R A;  4ZLT F;  2EXZ A;  2JEB I;  4FF4 A;  4QMG A;  4K6D A;  2Z4I A;  5IOD A;  3VR6 A;  1KAA A;  5CBE E;  5EPJ A;  1TT2 A;  4MN3 A;  2RA4 A;  2BE5 D;  5JOB A;  3I8Z A;  4RWS C;  4ZAI A;  3KK7 A;  1Y69 U;  3EVQ A;  1AZQ A;  4XXE A;  1U9R A;  1LT6 D;  1TS4 A;  4KY5 A;  1Y1V B;  3KLR A;  4FXG C;  2PW7 A;  1MSH A;  1SNP A;  1DXM A;  2DY8 A;  4DGZ A;  4WRD A;  3LX0 A;  3HP3 A;  2RDF A;  5EKK A;  2AWN A;  3VR2 A;  1Z7T A;  1BUV T;  2D62 A;  3BYY B;  1TS2 A;  5LL6 X;  3EFX D;  4XT1 B;  3VR4 A;  4PV1 C;  5KNC A;  1KDB A;  1PRT C;  1MBY A;  2LMC B;  3BZD B;  2YU9 B;  1SSO A;  4TSS A;  5CV9 A;  4BWG B;  1V1P B;  1U4L A;  3Q6S A;  4OL7 A;  5JPM C;  2JA6 B;  3OPO A;  1WD1 A;  3MAQ A;  1HTL D;  1II3 A;  3P75 A;  1HUN A;  4HMI A;  5FK9 C;  2QEJ C;  3SEB A;  4HSP A;  1IW7 C;  2XRQ D;  1BO0 A;  1ENF A;  3DUZ A;  2ZXP A;  3MXP A;  1ESF A;  4WOR A;  3VA7 A;  3E0J A;  2AQ3 B;  3I3C A;  4G7Z C;  3M7G A;  4DFA A;  4KV6 A;  1IKL A;  4BBS B;  4KY6 A;  4K2L A;  4FO2 A;  4XYO A;  1CA5 A;  2X6L A;  4C3H G;  1RD9 D;  1A2U A;  5E1F A;  5IT9 L;  1GUT A;  1J9O A;  2H4O A;  4HAE A;  3KBG A;  5HUR A;  3DEP A;  1FGB D;  2A6H C;  2EDG A;  4RKL A;  4IFD I;  3NUC A;  5C4Z A;  1B3A A;  4DNR B;  5EPL A;  4FXK C;  2L11 A;  2NN6 H;  4CKB A;  2LFN A;  3KUP A;  4IUN A;  1EY6 A;  1EEF D;  3I4M B;  3BDL A;  1B53 A;  3IAY A;  3S9W A;  1CK1 A;  4S3S A;  5JEA J;  1HQR D;  1CZW A;  3VYS A;  2XVS A;  3A56 A;  4QUF A;  1CA6 A;  2X69 A;  2KCC A;  4ILW A;  2RSO A;  1PLF A;  2NVT B;  1JQY D;  2QDB A;  4A3J B;  5IGG A;  3D3R A;  5D14 A;  3V05 A;  1WVL A;  3I4N B;  1ZYR D;  3HOV B;  1RF2 D;  1R4P B;  2EPB A;  2NUC A;  3MVV A;  1CQF A;  1GHJ A;  3TP6 A;  2B2V C;  4TRD A;  4ID6 A;  1G91 A;  3MFY A;  2EY1 A;  1PFB A;  5LHY 1;  1TWA B;  1U4P A;  1GUG A;  5C3X A;  1TWH B;  4IN3 A;  2B2W A;  5DM7 3;  2H1E A;  2E2H B;  1UNS A;  3MC0 B;  3NP8 A;  4KJN A;  2JA7 B;  1GUO A;  3BDC A;  3MEH A;  1Y8P B;  2XWB B;  3SE0 A;  2JYO A;  1ILP A;  2JXM B;  4KMU C;  1EY4 A;  4FXD A;  4C2M B;  1IYV A;  1T5E A;  1CTM A;  1KNA A;  1PRT F;  4HR7 B;  4J1M A;  2RDH A;  2PPB C;  1J8I A;  3ND8 A;  4I65 A;  1I4P A;  3A54 A;  1Y1W B;  1O7L A;  3DWA A;  3NPP A;  2WKD A;  3ND9 A;  1V8Q A;  1SJE D;  3I70 A;  4DF7 A;  4CJ0 B;  5JVG 3;  2F0O A;  1SE3 A;  4XQQ A;  1ET9 A;  2NVY B;  5EGT A;  4IFD G;  1YNN C;  4BS9 A;  2F0F A;  1SND A;  4EQO A;  1X32 A;  1STE A;  5CR3 A;  1MGS A;  3S1R B;  4PQX A;  3SK6 A;  2LS0 1;  2MGS A;  5C6A A;  5KND A;  1F2Y A;  5M5X B;  4A3G B;  1A2T A;  2E2J B;  1IYU A;  1XYI A;  5I6Y A;  1YNJ C;  3TBI B;  2HDM A;  2M2L A;  3MWY W;  3P20 A;  2QIL A;  4CJ2 C;  5M5W B;  3K5L A;  3ERQ A;  3DM1 A;  3K5M A;  1AFP A;  4H0L C;  4CHT B;  1EU4 A;  5ELC A;  4TQU S;  1EL0 A;  1ZEQ X;  4K8I A;  2IWH A;  1C8C A;  2AUK A;  3H6M A;  3F2U A;  3NSW A;  1EIG A;  1QIL A;  1LTR D;  2J0T D;  3SK4 A;  3O13 A;  2Z1C A;  2K01 A;  2XWJ B;  2R93 B;  2OF1 A;  4FNF A;  5M9O A;  4OIJ A;  4RH6 A;  1Z6H A;  1EIH A;  1XTC D;  2GA4 B;  3A7L A;  1PTO D;  3M3Y B;  4A3K B;  1VF7 A;  2WII B;  1E2Z A;  1PZI D;  3QOJ A;  3LWU A;  1Y8N B;  4XQJ A;  3MTS A;  4RGO S;  4A93 B;  1BCP C;  1I3Q B;  1B50 A;  4L6T B;  5J1Z A;  2ID0 A;  1VMP A;  1QE6 A;  1S5C D;  4CGY B;  4K5X A;  2MPM A;  2D9U A;  3D6W A;  3NWS A;  1BCP F;  5C5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...