1VMCA

Stroma cell-derived factor-1alpha (sdf-1alpha)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
RCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1
publication title Mapping the binding of the N-terminal extracellular tail of the CXCR4 receptor to stromal cell-derived factor-1alpha.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 9
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vmcA00
1Q3LA 1WTRA 2B2WC 3I8ZA 3I91A 4R9WA 1WD0A 4CJ1B 1WTQA 2KEEA 1B4OA 2N88A 2FJ2A 5D14A 2MGSA 2DY8A 1J9OA 4X3SA 1RTNA 1CA5A 3QO2A 1XX8A 1HUMA 3R93A 2B2VA 1BNZA 2H1EA 2KVMA 1PFMA 3IFDA 2K04A 3ONAB 1AZQA 1M8AA 1NCVA 4RAUC 5D65A 2JP1A 1B3AA 1WVLA 3MWYW 2X6GA 1EQTA 2IL8A 4HEDA 1NR2A 4O42A 5DNFA 1WTWA 1MSHA 5T1IA 1SDFA 1NR4A 2FHTA 1RTOA 4RA8A 1C8CA 4HAEA 2B2YC 2K1BA 1RODA 1U4PA 3GV3A 4QUCA 1AP0A 1HRJA 4X3UA 5EKIA 1B2TA 4IUTA 4CJ2C 5CORA 1TVXA 1WTVA 4HCSA 1G6ZA 4HSVA 1HFGA 2R3ZA 2KECA 1O7YA 1X3PA 1O7ZA 1MGSA 2BDNA 3N52A 1F2LA 3KBXA 2MP1A 4IUVA 2B2YA 3TN2A 2K28A 1PLFA 2SDFA 2Q8RE 4X3KA 5E4WC 2B2TC 3Q6SA 1RHPA 1G2TA 1F9SA 1AZPA 2XIWA 1F9QA 1JE4A 1SSOA 2JYOA 1PFBA 2B2WA 1B53A 1RJTA 1X32A 1F9PA 2HUGA 1BF4A 2EOTA 1PDQA 2L11A 1VMPA 1HHVA 2HCIA 4XT1B 2J7ZA 2MPMA 3DEPA 4R8IA 3D6WA 1E0BA 1XYIA 3UI2A 1LV9A 4MHEA 1KNAA 1B50A 1IKMA 1ILPA 2RSOA 2DY7A 1EIHA 4X3TA 2KEDA 1JICA 3P7JA 4UAIA 2FFKB 2RSNA 5EPKA 3TZDA 3I90A 1QE6A 2B2UC 2N55A 1HFNA 1J8IA 2RA4A 3SVMA 2EPBA 2EE1A 1ML0D 2NWGA 5COYA 5EJWA 1CM9A 1PFNA 3LWEA 1WD1A 2KUMA 2Q8TA 1WTPA 1DZ1A 2K05A 5JJZA 1MI2A 1QG7A 2K01A 2MJ8A 4QUFA 1DONA 4IUQA 1EL0A 1ESRA 1KNEA 2L12A 1BO0A 4IUUA 4OIKA 5AFWA 1X3QA 1ICWA 1VMCA 1ZXTA 2L9HA 2NYZD 3F2UA 3G7LA 4XDXA 1O80A 2NZ1D 1SAPA 1A15A 2HDMA 1DOMA 3DM1A 4IURA 1HA6A 2B2TA 5CBEE 1G2SA 5EPJA 4CJ0B 4ZKBB 1WTOA 3I3CA 1DOLA 3FPUB 3HP3A 4MN3A 1MSGA 2HDLA 2RVLA 1IL8A 4OIJA 4ZLTF 1QNKA 2KOLA 4IUPA 2FINB 2X6LA 1DOKA 2D9UA 2L1BA 2L4NA 1NAPA 1EOTA 3MTSA 1G91A 1HUNA 5EQ0A 5T1GA 1CA6A 1F9RA 1EIGA 1IKLA 1U4RA 3IL8A 3H91A 4U68A 4ZAIA 3DEOA 2X69A 1U4LA 2FMMA 1WTXA 4LMQD 4NW2A 4RWSC 3FDTA 4ZK9B 2VXWA 1GUWA 5E4XA 3GV6A 2K03A 1BBXC 3KUPA 5CMDA 2B2UA 2B2VC 1S4ZA 2CVRA 2HCCA 4XT3B 5EPLA 2M2LA 4ZKCB 1U4MA 4DN4M 5CBAE 1ILQA
chains in the Genus database with same CATH superfamily
2NVTB 4UPAA 2SEBD 5D14A 1ET6A 1XPRA 1HUMA 1BNZA 2MFIA 3F2DA 1M8AA 5CC4A 2IX3A 4RMFA 4A3BH 2ICEC 1B3AA 4HCEA 2MO0A 4YCWA 1UE5A 5GAHC 2KCNA 1F77A 1V8QA 2I5MX 5I9OA 4BWGB 1EYAA 1NR4A 4HJAA 1Q81C 1D5ZC 1BBWA 1KL9A 5CV9A 2KJXA 3TP6A 5IOCA 3HOXB 1XNQQ 3PIP3 1E2WA 1B44D 4IUTA 1JWSD 4AQYL 4R4QA 5JJLA 3GTLB 3GTQH 4DV6Q 2KECA 1KAAA 4IUVA 2JN4A 5C5MA 1M90C 1GOZA 3RUZA 1YJ9A 4B9XA 3S1QB 3C3LA 4BXXG 2NVQB 1BF4A 1D2BA 3VR2A 5IY0A 2NN6H 5ELDA 2JA9A 1PTOF 4LFBQ 2K6AA 1LM0A 2IW3A 3T1HQ 1EIHA 4K5VA 5C3EB 3TEHB 1OXUA 1W6KA 3A5UA 2N55A 3P20A 1R4PB 3CAMA 2R61A 1ML0D 1BCPD 1JC7A 1MHWC 2JQOA 3D4DA 1WD1A 2E75C 2GN5A 1EYDA 3CHBD 3KJPA 4JI8Q 2LKVA 3VYTA 4C3HB 1PH2A 5DEHA 1N34Q 4EX5A 4DR5Q 1DOMA 1GKHA 4N8FA 2AQ2B 1EY0A 1CKNA 2HDLA 2PQEA 5DM63 2NTTA 1X6OA 4RCNA 2FMCA 2UUAQ 2P5ZX 3H3VH 1H9RA 2F1MA 1S72A 3RZDH 2L5TA 3BYYB 2LY7A 2NVYB 1YITA 1SYGA 5M3FH 1S5BD 1L1OC 4LF5Q 1A3UA 2KBNA 2B63B 1PVOA 5K5PA 4H13C 3I70A 2F0TA 2YTXA 4B9WA 3JAME 1LLRD 3Q22A 1HQRD 5CR3A 1S5FD 2DY8A 1SJED 3LWUA 3NPPA 2KCTA 4X66Q 1JWMD 4KN7C 4OX9Q 1PFMA 1Q1EA 1ENFA 2VQFQ 1QILA 5D65A 1WCMH 3K5OA 1O7IA 3QR8A 3MWYW 4A3DB 2EYPA 1RKNA 2H4OA 3UE1A 3HOWG 3CCQA 4A3CG 4A3GG 4DR3Q 1KLGD 1BXTA 2PCFB 2DNEA 4LFCL 3K5LA 4BBSB 4NKLA 1PTOH 1X3PA 1O7ZA 4XQNA 1JT8A 3UDFA 5D3DA 4UDUC 4DNRB 5IODA 4NXNQ 3G6EA 5LL6X 3NTHA 4JI2L 2MPMA 2VW9A 4DV1L 4DR1Q 5KGUA 2E5LQ 3ZYYX 1LV9A 1FJGQ 1CFMA 4B3SQ 2K5WA 2V1CC 2JA7B 3P7JA 3TZDA 4QIWB 1Y1WG 2VS1A 1HFNA 5AJ3L 5C3XA 1K9MC 2MNAA 3OMCA 4ALPA 3TRZA 3S2HB 2NB0A 2ASBA 1SFOH 4NB3A 3VR6A 3PO3G 2JA6B 1TS2A 3Q23A 1VQAA 4KKTA 2JEAI 1A6XA 4PMBA 1Y1VG 5EBDA 4A3KH 1JCKB 3K0XA 2A8VA 5CV5A 3NXWA 3S14H 4OIJA 2ZTCA 1QNKA 3D6CA 3TP8A 1VQDA 1G91A 1H9JA 2UUBL 1EIGA 1SBBB 4HR7B 2EY5A 1ICFB 3ND8A 4LUVA 1WTXA 1U4LA 1V43A 3B6YA 4LMQD 3ND9A 4A3FB 3OW7A 5E4XA 1EOVA 1V1PA 2N3SA 3UDXA 4G7OC 2PW7A 2BE5C 4ID6A 5E7NA 1SE2A 5CGKA 5JJIA 3I8ZA 5KNDA 4CJ1B 4L5SA 4BA1I 5A2QE 3SK4A 3NTIA 3HOXG 1J9OA 3MXUA 2UUCL 1XX8A 1CZGA 4KTAA 4DR6L 1PFSA 1QZGA 2DJGC 1E2VA 2PI2E 2HIXA 5NUCA 2ZJRA 3DMUA 2IL8A 2BCOA 2NZOA 4L63B 1Q12A 4JI1Q 2FHTA 4JBJA 3DM3A 1FR3A 4RA8A 4F88A 1HR0L 1CHQD 4DKAC 4R4IA 4F7XA 4OXPA 3ERQA 1N9WA 1F2MA 4OL7A 1R4QB 1B7YB 1FYCA 5DLQE 1MD2D 1VQ4A 5C3EG 1EQQA 1VF5C 1HQMC 2AUJD 3J81i 1I4PA 1HHVA 3I4NH 4DV5L 4GLAC 1LTID 1B9MA 1I6HH 3HFZB 3CXCA 4RGNA 3QOJA 3HKZB 4C3JB 1ILPA 1S40A 2RSOA 1JJGA 1P8LA 4RCOA 4YWMA 4C3HG 1I4XA 1N33Q 4J6HA 1J8IA 4JI2Q 4DV1Q 5M5XH 4U673 1SMYC 3BYTB 2BOSA 5JJZA 4HIMA 2AHOB 1PHJA 3KBGA 4LAAA 2R7DA 2CH4W 1ESRA 4IUUA 5AJ3Q 3H0GB 3T1YL 1K8MA 1L1OB 4UP8A 3MAQA 5CBEE 2RDHA 5EPJA 1DOLA 3P75A 1BDOA 2RVLA 2QDBA 4PNYA 2B63G 3A56A 2JEBI 2K4KA 3I4OA 4LNQA 2JK8A 1KRSA 3IAYA 1Z6HA 3E9IA 4OWWB 1FNUA 2O4XA 2VNUD 3BVGA 2QGQA 1WYDA 3PUZA 5H1SE 4DPGA 2UUBQ 2M2LA 3SK6A 4A3DG 4DFAA 4JCVE 2NWGA 2JA5B 3OHXC 3S1RH 4LF8L 3FKIH 4XXEA 2K33A 1A3TA 4DAPA 1R9TB 1KHIA 5ISRA 3JC66 5CV8A 1VQ5A 3M9BA 3EROA 3GTOB 2XSCA 4BBSG 3NWSA 3K7AB 2JP1A 4DAYA 4BY7B 4DV4L 3O13A 1Q86C 1CKNB 1XTCD 1C7YA 3HOZG 3OIPA 1PH8A 1KD1C 2VQEQ 4DR6Q 4X3UA 4G4KA 5EKIA 1FL0A 3S1NH 1U9RA 4CDEC 3FEWX 3U9SA 3HRZC 4EQPA 4A3EH 1I94L 1A62A 3ZJYC 5HGTA 4DR7Q 3N52A 1F2LA 3ICEA 4X3KA 1D8LA 5E4WC 3Q8DA 3C1FA 1TWAB 2JA7G 1RHPA 4QJFA 1HNZQ 2FXQA 1RJTA 2F3IA 3U9OA 1PRTC 2PYKA 4FYDA 1EZ8A 1TKWB 4AYBE 1E0BA 2JA6G 4JK1C 3K7UC 4QMGA 3IRBA 4K6LA 2RSNA 4GZYC 5IGGA 4IPGA 4DV5Q 1SNCA 4IN3A 4WJ3M 1C0AA 1GD7A 4KY7A 2F3WA 4LUOA 1MI2A 1TWCB 3L7ZC 3KLSA 2NVXH 1FVIA 1SNMA 4BS9A 3BDLA 4UY8C 1SE4A 1EEID 3HG9A 3P1HA 1S5DD 4I65A 1JB3A 1II3A 2XTIA 1RL2A 3HOUB 1XWEA 4A3FG 3OMGA 2B2TA 5M3MH 2E74C 2R7ZH 1STBA 4FF1A 1SE8A 3KK7A 5IYDG 1NSNS 1YZ6A 2K50A 1DOKA 3SE0A 3K80C 3T1YQ 1NNXA 2EJMA 4K8IA 5I9PA 2M9VA 2ICIA 3IL8A 1JOOA 5FLMH 4DV7Q 2X69A 2F0IA 1TXYA 1W3SA 4ABNA 2JA8H 2H5XA 1QZHA 5CMDA 4ODGA 2B2VC 3Q0AA 4HN7A 2DGYA 2HCCA 3NHHA 5EPLA 1GO3E 5G3LF 3TMEA 5IGCA 3S17B 2F0GA 4JI0L 3K58A 2RBMA 3T53B 1LO5D 4FF2A 2BDOA 3SDZA 3C2PA 3IFDA 4ME5A 1NCVA 2CCZA 4O1NA 4XYOA 4LF8Q 1LTAD 3PIPA 1GHKA 4OO1I 3FVQA 1G291 3T4AC 3EQLC 4DV0L 4HAEA 1MJEA 2RDFA 1LTGD 1MJCA 4JOIA 4X62Q 1UE7A 5ELNA 1HTLD 2IHEA 4GNXA 3CU7A 1CKMA 2Q2HA 3EIVA 1WTVA 2EYLA 1EQRA 2PQAA 4HSVA 4GKJL 1HFGA 3PMFA 2A6HD 1QJOA 4R4TA 1AN8A 3HKZG 1V1PB 2AWOA 2MP1A 2IWHA 4C3JG 1GUTA 2B2TC 3BG3A 1E3PA 3CW2C 3PF4A 2PZWA 3CD6A 2K75A 1YJWA 3CRLC 5E1FA 1STAA 4GN3B 4X64L 2HUGA 1I94Q 3L2PA 5IWAL 2R93B 3J80L 3GTJH 3A74A 1KXLA 4FXDA 1NE3A 5KRUA 1XMQL 3R8BA 5C0XJ 3FP9A 4Q5VA 2AKWB 3I2ZA 1W6JA 1VQGA 3H0GG 5EPKA 1LTSD 1QE6A 5EAYA 1VQFA 3OWEB 4DXFA 5K36G 1JMCA 2EXZA 1IHZA 1JJ2A 4JYAL 2PPBC 5C6AA 4BXXH 4P71A 1N32L 4IOCA 3PUVA 2BA1A 2XRSD 2ZXOA 1AE2A 1ZXTA 3CCRA 4POGA 2YU9B 4FXKC 1VQJA 2RCFA 4DF7A 4HJ5A 4HJ8A 4C3IB 5JEAG 4YHHQ 3PIO3 4HMJA 2FINB 4K14A 5CYUA 5IGBA 2CH4A 1EOTA 3NQIA 4JOIC 3J81E 2JA5G 4LF6L 2K5DA 1VQNA 1PTOD 1F9RA 4GNXC 2E2IB 4FXGC 1IW7D 3DEOA 2FMMA 3RNUA 4H44C 1EY9A 1Y69U 4ZK9B 1TT2A 5IE8A 2D2CC 4BY7G 3U4ZA 1ILQA 2OT2A 4HIDA 4GKKL 4G7HC 1H9SA 3S15H 1RCVD 2C35B 2Q2TA 1U5KA 2ATWA 2A6ED 3F1ZA 3NBHA 5KYLA 2V4DA 3S2DH 3G6JB 4O42A 5BN3A 3L9AX 1X9NA 1OXSC 1CKOA 1BCPC 4X6AH 2F3VA 1PRTB 2CHBD 2G5DA 1AP0A 5IT9c 5C44B 2VUMG 3RLNA 2XWJB 3UDIA 1VCIA 3PV0A 5JEAJ 1G6ZA 3M3YH 3QB3A 2LSSA 4O0AA 1GHJA 3SXHA 4DV0Q 2K32A 1BKBA 2DNCA 1GUOA 4JW0A 1XXGA 2EJGC 2WAQE 1CQFA 2DN8A 2I0QA 1SSOA 2CFMA 2K52A 4DA2A 4GKJQ 1J6QA 1X3EA 2BH8A 4RKBA 3HOWH 4A3CH 1A63A 4A3GH 5IYBG 3MVVA 1DJRD 2F4VL 4GLVB 4MHEA 4NP5A 4R4CA 5GAEC 4HJ9A 4M1UB 1P16A 4DAYB 2Q2UA 2CW0D 2EJFC 2UU9Q 3AU7A 5I2YA 2EYOA 1YNXA 1ZEQX 2HQEA 5I6WA 1LUZA 3HOUG 1SYEA 5COYA 3S9WA 5IWAQ 4JC0A 1K8AC 1YBYA 1XMQQ 1KDAA 4QUFA 2L15A 3GTKB 4X65Q 1EUJA 1B9NA 4XIGS 2R92B 5J22A 3E9HA 4WORA 4ZCKA 4CJ0B 3TS2A 4Y52H 1Y1WH 3H15A 2EIFA 3ULJA 1HPCA 4DK6C 1IZ6A 4KD3A 4KHZA 3HOYH 1N36L 3L3OC 2L1BA 2B39A 4QF4A 1NAPA 1HUNA 2EYHA 1HR0W 1SRUA 3PO3H 1EFID 1EWIA 5BR8Q 1A0IA 1JWUD 3PO2B 3S16H 1QVCA 4R1JA 2WB1E 2GVBA 3FDTA 2VXWA 1NUCA 3T16A 3MEHA 1L2FA 2K03A 1SEBD 1C4QA 1ONLA 1Y1VH 4AH6A 4IUNA 3QOLA 3CCJA 3AFQA 1EYCA 2QILA 1UEAB 2HQLA 1A3VA 4A3MB 4FF3A 1B4OA 2N88A 1LTBD 1M4VA 2YYZA 1Q46A 3D3RA 2NVTH 1XTDA 4E6IA 1I4QA 2K04A 3MXNA 2F0WA 1SYFA 1SE3A 1YNJD 1YHAA 4Y7NB 3J7A5 1GUSA 4GKKQ 5FO8B 3I4LA 3I4MB 1WTWA 4C2MB 2HD3A 3GTPB 3C46A 3D4WA 4S3SA 2ENBA 3IKJA 1YI2A 1HRJA 4MIUA 5FKAC 4A3LG 3HOXH 1I3QB 2R93G 4LF4L 1PZJD 4NXML 3I73A 1TWGB 2RQXA 4A3IG 2RCNA 3GTLH 2XVSA 1Z47A 4B3RQ 5IT9L 4DNTB 1B53A 4BBRB 1PXUA 3I56A 1F9PA 4A3JB 3S1QH 4P73A 4XT1B 2J7ZA 1SYCA 1L0XB 2IX1A 3A8IE 4Z9CB 1K3BC 4OONA 1T5XD 2ZT9C 3OIQA 4WJ4A 1SNOA 1UUPA 4LF7L 2K5VA 1XJVA 3MFGA 2KA7A 1EFWA 2AQ3B 4P75A 3W1GA 5C3EH 4GN5A 4C3IG 3OTOL 2Z0SA 3MEFA 3HOZB 4AQYQ 4GNXB 3QIAA 2MJ8A 2E2JB 3BVZA 1EU4A 2E8GA 3RR5A 5I4DA 1EEFD 5KNBA 4C3HH 4PQXA 4PMCA 4ZKBB 3EBEA 1YEZA 3FPUB 2M00A 2HHHL 1S3OA 5EQ0A 1PH9A 4CKCA 4QL5A 1IKLA 2PW5A 2RDGA 4U68A 1TY2A 1UAPA 1K0SA 3S1MB 4JI4L 1EY4A 1GUWA 5FO9B 3RLOA 1K8GA 1U0LA 1SNQA 3PF5A 2NVYH 1ASZA 3JAMc 1BCPB 1PH4A 2YV5A 1ESFA 1X65A 2B63H 4V190 5C44G 1F2ZA 5ELBA 3NELA 4RH6A 4TRDA 2GA4B 1K73C 2LMCB 3G48A 3VYSA 2WACA 4A3DH 2LXJA 5C4HA 5TSSA 1CZWA 2IY5B 5C4JB 1KC8C 3NWTA 1BUVT 3CCEA 4QB4A 5ELEA 4BBSH 2B2YA 3A7AB 4CDDC 1K83B 2PNHA 3E0EA 1PYWD 1E7ZA 4IPDA 1IBKL 3TQYA 4CKEA 5BN4A 1H9SB 2EOTA 4LF4Q 4NXMQ 1XNRL 3R3OA 2HCIA 2KQ3A 2PNRC 1I4GA 5FJ8H 3I7FA 4MTKA 4HMIA 1FGUA 4L6TB 5L37A 2A1AA 4GN4B 4ZUJA 1VDZA 5HURA 3OYYA 2R92G 3R2TA 3M85A 3RZOB 4J8QA 2JA7H 2Z6KA 3OOCA 4I7ZC 3GTMB 2ZTEA 3AMUA 2XGTA 4EGVA 1DZ1A 2F52A 4LFCQ 2WIIB 3S2HH 1S5ED 1BO0A 2JA6H 2WKCA 1YNND 3F2UA 3PO2G 5M5WB 2E2HB 3OTOQ 4JG2A 2F0JA 3KLRA 1IBLL 1WTOA 4MN3A 2EY2A 3FPPA 4FNFA 2SOBA 3M4QA 2C9OA 2L4NA 1B1ZA 1UWVA 2CWPA 3SEBA 1W2BA 4A3MG 1C9OA 5I2XA 1B8AA 2XNAC 1IBML 4JBMA 4ZAIA 2B29A 1VQHA 5KYIA 2CQAA 2PMZB 2Y0SE 4LUZA 3GV6A 3DWPA 3W5OA 3KLWA 5KIXA 1BBXC 5M5YB 1LT3D 2D62A 2Z4IA 2OWOA 4A3FH 3BVMA 2B8GA 3MA2B 1VQ6A 2Z9HA 2VZAA 3I4MG 1C48A 5IYDH 4IO9A 4K2LA 4AYBB 3CRKC 4EQ5A 1DGSA 3KOJA 5JVG3 4JI4Q 1QVGA 1EU3A 4A93B 3ER0A 3HS0C 4GS3A 1PH7A 3TP7A 4P72A 4RAUC 3JAML 3J81j 2ZTDA 4B08A 3STBC 1G51A 5DNFA 2J0TD 5FO7B 2Z6KC 1C8CA 1RTOA 3FHWA 4OWTB 5ELCA 4BBRG 5C4XB 1QOHA 4A3JG 1RD9D 4A3KG 3KDFA 1KTKA 3K8AA 4JI7L 3D8GA 3SK8A 5LHY1 1KDBA 1NBWA 1I50B 1GXDC 4MTNA 1TWFB 3MXPA 2C5CA 5G3LD 2VL6A 5E3FA 1AZPA 1IL2A 2UXCL 1SROA 4F87A 3KJOA 4DV2L 4UHVA 1VQ9A 3A55A 2L11A 2MQHA 2F0OA 3M4OB 4R8IA 2UUCQ 3BU2A 3D6WA 3PSIA 1SYBA 1WTHA 2ZXRA 2RHSB 3NQTA 4B3ML 1IBKQ 2F0NA 3G4SA 4X3TA 2RKSA 4C3JH 4IALA 3KF8A 2NUCA 1YVCA 2RA4A 4P2CB 3J80c 1XMOL 1STNA 1ENCA 2KHJA 1HR0Q 3T56B 3K6OA 4RHRA 3HOVB 2KUMA 2Q8TA 5KEEA 2L55A 4WFN3 2VUMB 2WFWA 3CC2A 4Q0FA 2KHIA 1ENAA 1K3RA 1BQQT 5IGDA 5IP9G 5C0XI 3PIOA 1ICWA 1VMCA 1EWHA 1EY6A 3KFUA 3TBIB 1A15A 3K59A 4JV5L 1HA6A 4RGTA 1G2SA 3H0GH 2ZM6L 3AYHB 3BJUA 1B3QA 3STBD 5K36H 1EIYB 4P74A 4BY1B 4XYQA 2VB3X 1FNVA 3NSWA 1IBLQ 1A2UA 3A5ZB 4DXGA 2A6HC 1QB5D 4DUZL 1PYSB 1A8VA 1DXMA 2B2UA 1E24A 1S4ZA 3DXJC 4B3TL 4OO1H 2Q8IB 3LNNA 1HNWL 5JEAH 4NPSA 3H3VC 4LW1A 4KHPL 1CT1D 3GTGB 5GADC 3S24A 1WJJA 1Q8IA 3L0OA 3CQZB 2JA5H 2QKIC 1IYJB 2VB2X 1CA5A 1STHA 3R93A 1VQKA 4FP5D 2RHQB 3DUZA 2O5JC 2WV6D 3J7ZC 1R9TH 4CKBA 4QQBX 4DR4L 1Q7YC 4DNIA 3GTOH 1GM5A 1NR2A 1E1OA 1MSHA 2XN9C 3K7AH 5D3IB 4PZ6A 4BY7H 3RN5A 3GV3A 3RD4A 2O2LD 1RDPD 2XRQD 2Z8LA 4K6DA 1Q82C 3PCOB 4RG1A 1CQVA 5C0XG 2EVBA 2WKDA 2BH2A 1DD2A 1YHQA 1EIFA 3BZCA 3TN2A 3TREA 2SDFA 2Q8RE 1KRTA 3QWNA 5BN5A 3EJIA 4C1NK 1G2TA 5HY6A 4J1MA 1KAWA 1TWAH 3CCUA 4NDXA 1X32A 1TS3A 1E1TA 4FO2A 4YCUA 5CV7A 2QEXA 1PTOC 3PQIA 2JJQA 2QW7A 4M8AA 5FLXc 4ILWA 4KJNA 1QVFA 1IW7C 1NMFA 1AH9A 1I5FA 2KEDA 4DV4Q 1D6EC 2B2UC 4DK1A 4R8NA 2EE1A 5EJWA 3W3AA 1CM9A 3BZKA 2CWAA 3LWEA 3NP8A 2OF1A 3NEMA 5LMNW 2AQ1B 3M4YA 2I46A 1UNSA 1CUKA 5IYBH 2A6EC 3MC0B 2E2DC 3EVQA 1TWCH 2A5HA 5CV6A 4A3IB 3GO5A 3AFPA 2UXDL 4KV6A 3A8KE 4V0BA 4MNOA 2AWNA 3AEVA 3FRPB 3URYA 4A4IA 1V1QA 3HOUH 1IL8A 4O2DA 3GDEA 3V05A 5DM73 5ELFA 2CKZB 2Z6BA 4ZRZA 4NMZA 4AYBG 1EWCA 3VR5A 2ZM6Q 4A93G 2WAQB 1TWHB 4KKSA 4N9TA 4XT3B 1Y8NB 5IT9E 1PYBA 1WD0A 1WTQA 1QUQA 4POFA 3S17H 2OXPA 2OQKA 5IP7G 1T5EA 5C4XG 5FOBB 1RTNA 1PA6A 4LFBL 3GP7A 4A3BB 2I07B 1SN8A 4KK7A 5J3BA 1VQLA 4B3TQ 3ONAB 3W2DA 3I55A 1HNWQ 1STYA 3T1HL 5C5LA 4KHPQ 2F4IA 1N8RC 4WRDA 2CW0C 1TQOA 2ZJPA 1ET9A 1SDFA 4TQUS 4IJLA 1Q1BA 1X54A 1CTMA 3GTQB 3WDNA 3CMEA 4KLKA 5EKLA 4IPCA 1H95A 5F2DA 1OXTA 1JR0D 4JVZA 4HIKA 1N34L 4TSSA 2EY1A 1IYUA 4DR5L 5C3WA 2ZJQA 4PG3A 3Q6SA 5C4ZA 2Z4HA 4JI0Q 1M1KC 2HT1A 1NY4A 2WB1B 1SYDA 4G7ZC 1HNXL 3HOVG 4IFDI 4A3LH 3RLFA 1WOCA 2PZUA 4L5TA 2R93H 1Q90A 1NJIC 4PV1C 1LT5D 3RMHA 4LF9L 1D5MC 3SVMA 2MUYA 1SXTA 5LL6S 2O5IC 4KJOA 5FLXL 1G6PA 4BY1G 3NK9A 3Q24A 1D1KA 2K01A 3KDFB 4PMWA 1HXYD 4X66L 2F0UA 4CDCC 1KABA 2EYMA 3ITPA 4KD4A 4PZ7A 3G7LA 4EQOA 2VQFL 1SAPA 1YNJC 3K5MA 2YU9H 3NE5B 1AE3A 3NENA 4KY5A 3WOFA 3J81c 1D7QA 4X64Q 2F0HA 4C3IH 2N49A 4KKUA 3BS1A 4DR3L 3RZDB 3I72A 1H9KA 2UXDQ 1TIID 5M3FB 3KF6A 4NW2A 3NTKA 2E2IH 1ASYA 2K14A 3CCVA 3K5NA 3J80i 3KF8B 2NZHA 4JI3L 1U4MA 4DV3L 4AIMA 4JYAQ 3QG1A 3UDGA 4NXNL 4IFDG 1K8OA 4ZUIA 1N32Q 4ULLA 4DR1L 4X3SA 5IGEA 2E5LL 1WCMB 1L1OA 1FJGL 2A74C 4H0LC 4B3SL 3X3MA 1Z9FA 2PO4A 1WVLA 1EY8A 2E76C 4EQNA 4IQZA 3PGZA 3N6RA 4RHSA 3E3XA 4CGYB 1V9PA 1RODA 2OTJA 3GD7A 2A68D 4DUYL 4LF6Q 4LWCA 4LFAL 4QCLA 5CORA 1PTOB 1TVXA 4IJHA 5LMNL 1IYVA 1WFQA 4HCSA 5C44H 3VDYA 3PUWA 1O7YA 1HJPA 1MGSA 2QF7A 5EBCA 2BDNA 3DLLA 1ZKOA 4OHJA 4HJ7A 4JBWA 4YIJA 2IJ0A 2K5NA 4EVOA 2XIWA 1HA5A 1JB7A 3EA6A 3E5SA 1PDQA 2KCMA 2SNMA 1VMPA 3DWQA 3VYUA 5JVH3 1PH6A 1KIXA 3FMCA 1L0WA 3UI2A 1IKMA 2EDGA 1EY5A 4APVA 5HGQA 4RKLA 4IFDJ 3HKSA 4RFBA 1X3GA 3I90A 3SR1A 3E6ZX 2EPBA 3TP5A 1SFOB 1HNXQ 5M9OA 5A35A 1O7LA 1PMRA 1A2TA 2K05A 3K0YA 2NN6I 4JPBW 1ZYRC 1EL0A 1JOQA 4LF9Q 4XQQA 4A3KB 4OIKA 2K5HA 4XQJA 1X3QA 1J5EL 4UP9A 3GTKH 2HDMA 2NVQH 3S14B 3BDCA 1YIJA 5IYCG 2WAQG 3D4RA 2BA0A 3I3CA 2R92H 3HP3A 4JI1L 1MKHA 2X6LA 1K28A 3E0JA 3TS0A 4GOPA 1PV4A 1CA6A 2F4VQ 2I5LX 1O78A 1YHBA 4A3BG 1XPUA 3PO2H 2PQAB 4K8JA 1G8ZD 5DAUA 3J81L 4YY3L 3PUXA 2D0OA 1CHPD 3AB9A 2WINB 1Q3LA 1LT6D 3I91A 2FJ2A 3H3VI 3V96A 3LGJA 2F0FA 4A3MH 4K0KL 2MO1A 3QO2A 4FVMA 1EZ6A 2D5DA 2ES2A 4PZ8A 4JI3Q 4DV3Q 3CCLA 1VQBA 2PZTA 4DU9A 1AFPA 4A75A 3U50C 1OTCA 1N33L 1OXVA 4Y7NH 1V1OA 1BCPF 4QUCA 1N36Q 1PZID 3I4MH 4C2MH 1B2TA 3GTPH 4CHTB 2NN6G 2OQ0A 5J39A 3SHLA 2J4XA 3MHBA 3VA7A 3KYHC 4JI6L 2WB1G 1L0YB 1Y8OB 4K5XA 1ZYRD 1YNNC 2XWBB 3HOYG 3M7GA 1I3QH 2K28A 3R2IA 2R6GA 4DUYQ 1TWGH 1STGA 3MXGA 2IX0A 1RF2D 4LFAQ 3F2BA 4RGMA 3I4NB 2JYOA 5LMNQ 2B2WA 3CC7A 3VA5A 1I6HB 1QUQB 2QEJC 4TVAB 4GOPC 3DEPA 4BBRH 3J7AV 1BBUA 4A3JH 2Y0SB 1HZ9A 1B50A 3A54A 2F0MA 5M5XB 1LT4D 1EQVA 3CCSA 3W1BA 1VQCA 1I4HA 3T51B 4H02A 2N78A 1WTPA 5CV4A 3CKIB 1NMGA 1MIUA 3M7NA 3HOZH 4DK3C 1KNEA 1F2YA 1XYIA 2E2JH 5M3FG 1BR9A 1SJHD 1HCZA 3EN2A 4WJWA 3NBHB 4CDFC 1JQYD 2YTVA 1VQ7A 5IGFA 2KOLA 4IOAA 2VQEL 5KNCA 3MTSA 4R4OA 5JPNC 5JPMC 1J5EQ 2L0CA 3RN2A 2ID0A 3VR3A 1QWYA 1WCMG 5IP9H 2F0KA 4LF7Q 2KENA 4DR7L 1SNDA 4BA2I 2KCCA 2IHFA 4JBKA 3S1RB 3S1MH 2F0VA 4ZKCB 3FKIB 1HNZL 4DN4M 1DCZA 3D31A 4QIWE 1WTRA 2B2WC 5LMUL 2HIVA 1GUGA 3WOEA 2UXBL 1EY7A 4YY3Q 1Y14B 2H1EA 2KVMA 1VQPA 4J15A 4DAVA 3HGBA 4C56C 1VF7A 4ZQ3A 1EQTA 3NBIA 4KMUC 3J7AF 5T1IA 4K0KQ 2HHHQ 2B2YC 2K1BA 3S1NB 1STEA 4A3EB 1JE5A 2OCEA 3DHQA 2F03A 4K2KA 2OEOA 2R3ZA 4FDBA 4LK1C 3KF6B 4TKOB 2F0DA 4OELB 3AQQA 1D5XC 4JI5L 4L8JA 3V2TA 5C4JH 2TMPA 3J80E 2BE5D 1UEBA 2RF4A 1TS5A 3QJYA 1JJCB 2EYJA 1JE4A 3EFXD 1K83H 4JI6Q 1LYLA 2A69C 2AUKA 4QY7A 1X3FA 3A8JE 5GQOA 3T13A 2B3GA 4DV7L 1T9HA 1TR5A 2JXMB 3U4VA 5C0XH 1JICA 1WI5A 4HTHA 1LTTD 3H94A 3OSOA 1UE1A 1PFNA 2GVAA 4OWXB 3RZOH 2Q2IA 2NVXB 1SR3A 4I7AA 1CI3M 3GTMH 2G9HD 2EZVA 1DONA 2EYFA 5AFWA 3K57A 5M3MB 2R7ZB 4XDXA 2NZ1D 1DM0B 3C1EA 4ME3A 2CQOA 5FK9C 4YWKA 3MXNB 1I6VC 1MBYA 3IFTA 1TS4A 5M5WH 2E2HH 1Z7TA 1PZKD 2D9UA 1XNRQ 4X62L 3KLSX 1GJXA 3CP0A 1VQMA 3H09A 2JA8B 2Z1CA 2OTLA 2IPKD 4H7BA 1PH5A 1SLJA 1AW7A 2WP8J 3TZUA 1VQEA 1H9MA 2A19A 2IT1A 3HKZE 2MHVA 3CF5A 1KLUD 5FJ8G 5CBAE 5M5YH 1HZCA 1SMYD 2SNSA 4YCVA 2KHSA 4R9WA 3U58A 1CSQA 2KEEA 2LS01 5IIFA 4OEMB 1VQIA 2A69D 2AMCB 3SK5A 3A0JA 2B2VA 5ELOA 2TSSA 1AZQA 4N9PA 2PMZE 3SGIA 4XTCS 4A93H 2X6GA 3ERSX 2QCPX 5LMUQ 1I4RA 1E2ZA 1OO9B 4MZ9A 3OPOA 2UXBQ 3I4NG 4GOPB 3CC4A 5FLXE 1RIPA 1IBMQ 5IP7H 5C4XH 2B8FA 3NUCA 2Y0SG 4HSPA 1Y8PB 4A76A 3KBXA 1X55A 4HIOA 1PLFA 2QDLA 1I50H 2F0QA 4UP7A 3X3NA 4YHHL 1TWFH 3J7YW 2N8NA 5A2QL 3GTJB 4JI5Q 1D1IA 1HZAA 1HZBA 1CK1A 4KI0A 2K5QA 1KNAA 2YTYA 1JORA 3M4PA 3M4OH 1LTLA 1E22A 3GQBA 1QNUA 4UAIA 4DR2L 3ULLA 3HEJA 2EY6A 5JAVA 3PUYA 4DK0A 3MZ5A 3JAMi 1YJNA 2R7FA 1UE6A 4GLXA 2NBFA 3F8TA 3HOVH 1FNWA 4IUQA 3BDOA 4JI7Q 1JOKA 1IXRA 2L9HA 4LJZC 2NYZD 3F2CA 2VUMH 4N8X1 3UE0A 2NTSA 1VS0A 1AEXA 3CCMA 3TSSA 1OXXK 1MSGA 2UXCQ 4DV2Q 2F0EA 1PRTD 3FKIG 2F0LA 4F8MA 4L5QA 1DYQA 3VYRA 2JSOA 4BY1H 2DJFC 3DWAA 3H91A 1VQ8A 4B3MQ 3D0FA 1TU2B 4DAMA 2EXDA 3KUPA 2CVRA 5GAGC 2LFNA 1XMOQ 3HZXA 1PH1A 3CPFA 3S15B 3CPWA 2K7VA 3TDQA 3ULPA 1Q8KA 2PI2A 2VY3A 2MGSA 2A73B 5EGTA 1LTRD 4A3EG 3GTGH 4DGZA 5JOBA 3S2DB 4L5RC 3OW2A 1XNQL 3CQZH 2LXKA 4G57A 4QGUA 4JV5Q 1LABA 2UU9L 4DV6L 4HEDA 1FD7D 1NTGA 4ZYSA 4KN4C 1U4PA 5I6YA 2D0PA 1S5CD 1KQSA 3M3YB 4RGOS 4CJ2C 2G9DA 4IFDH 4CBVA 3VR4A 4X65L 1BVSA 3G71A 1LACA 4DUZQ 1HTPA 4OGQC 1XPOA 3HOWB 1F9SA 1F9QA 4A3GB 1PFBA 1K0RA 3H6MA 3A7LA 4FF4A 5EKKA 1GUNA 2I5HA 5BR8L 1SMXA 4OO1G 2F0PA 3CMAA 1B70B 4IPHA 2DY7A 2ALYB 5M3MG 4DR4Q 2FFKB 2R7ZG 4JI8L 3MFYA 1VQOA 2EQSA 4KY6A 1EYGA 5J1ZA 1KDCA 1QG7A 5FLMG 4IZ8A 3LX0A 4DR2Q 1PRTF 2L12A 2UUAL 2JA8G 1O80A 1Y1WB 1TY0A 2F0SA 3DM1A 4IURA 5GROA 2JE6I 3HOYB 2DUDA 1CSPA 1GVPA 5JJKA 1QCBD 4ZLTF 4A3IH 4IUPA 3PO3B 1SNPA 3OWFA 4LF5L 3S16B 4K5WA 2A68C 5T1GA 4YWLA 4C1NI 1U4RA 3WWVA 2ZXPA 1FGBD 1X56A 1Y1VB 4RWSC 2QA4A 3K81C 1PH3A 1BOSA 4KHVA 4B3RL 4OX9L 1HH2P 5IYCH 3BZDB 1TWHH
chains in the Genus database with same CATH topology
2NVTB 2SEBD 5D14A 1ET6A 1HUMA 1BNZA 1M8AA 5CC4A 2IX3A 2ICEC 1B3AA 4HCEA 2KCNA 1F77A 1V8QA 5I9OA 4BWGB 1EYAA 1NR4A 1D5ZC 5CV9A 2KJXA 3TP6A 5IOCA 3HOXB 3PIP3 1E2WA 1B44D 4IUTA 1JWSD 3GTLB 2KECA 1KAAA 4IUVA 5C5MA 1GOZA 3RUZA 4B9XA 3S1QB 3C3LA 2NVQB 1BF4A 1D2BA 3VR2A 2NN6H 5ELDA 1PTOF 2K6AA 2IW3A 1EIHA 4K5VA 5C3EB 1OXUA 1W6KA 2N55A 3P20A 1R4PB 2R61A 1ML0D 1BCPD 1JC7A 3D4DA 1WD1A 2E75C 1EYDA 3CHBD 2LKVA 3VYTA 4C3HB 5DEHA 1DOMA 2AQ2B 1EY0A 2HDLA 2PQEA 5DM63 2NTTA 4RCNA 2FMCA 1H9RA 2F1MA 2L5TA 3BYYB 2LY7A 2NVYB 1SYGA 1S5BD 1A3UA 2B63B 5K5PA 4H13C 3I70A 2F0TA 4B9WA 3JAME 1LLRD 3Q22A 1HQRD 5CR3A 1S5FD 2DY8A 1SJED 3LWUA 3NPPA 1JWMD 4KN7C 1PFMA 1Q1EA 1ENFA 1QILA 5D65A 3K5OA 3MWYW 4A3DB 2EYPA 1RKNA 2H4OA 1KLGD 1BXTA 2PCFB 2DNEA 3K5LA 4BBSB 4NKLA 1PTOH 1X3PA 1O7ZA 4XQNA 5D3DA 4UDUC 4DNRB 5IODA 5LL6X 3NTHA 2MPMA 5KGUA 3ZYYX 1LV9A 1CFMA 2K5WA 2JA7B 3P7JA 3TZDA 4QIWB 1HFNA 5C3XA 3OMCA 3S2HB 2NB0A 3VR6A 2JA6B 1TS2A 3Q23A 4KKTA 2JEAI 1A6XA 4PMBA 5EBDA 1JCKB 5CV5A 3NXWA 4OIJA 1QNKA 3D6CA 3TP8A 1G91A 1H9JA 1EIGA 1SBBB 4HR7B 2EY5A 3ND8A 1WTXA 1U4LA 1V43A 4LMQD 3ND9A 4A3FB 5E4XA 3OW7A 1V1PA 4G7OC 2PW7A 2BE5C 4ID6A 1SE2A 5CGKA 3I8ZA 5KNDA 4CJ1B 4BA1I 5A2QE 3SK4A 3NTIA 1J9OA 3MXUA 1XX8A 1CZGA 4KTAA 1E2VA 5NUCA 3DMUA 2IL8A 2BCOA 4L63B 1Q12A 2FHTA 4RA8A 4F88A 1FR3A 1CHQD 4F7XA 3ERQA 4OL7A 1F2MA 1R4QB 1FYCA 1MD2D 1VF5C 1HQMC 2AUJD 1I4PA 1HHVA 1LTID 1B9MA 4RGNA 3QOJA 3HKZB 4C3JB 1ILPA 2RSOA 4RCOA 4C3HG 1I4XA 4J6HA 1J8IA 4U673 1SMYC 3BYTB 2BOSA 5JJZA 3KBGA 4LAAA 1ESRA 4IUUA 3H0GB 1K8MA 3MAQA 5CBEE 2RDHA 5EPJA 1DOLA 3P75A 1BDOA 2RVLA 2QDBA 4PNYA 3A56A 2JEBI 3IAYA 1Z6HA 1FNUA 2O4XA 2VNUD 3BVGA 3PUZA 2M2LA 3SK6A 4DFAA 2NWGA 2JA5B 3OHXC 4XXEA 2K33A 1A3TA 4DAPA 1R9TB 5ISRA 5CV8A 3EROA 3GTOB 2XSCA 3NWSA 3K7AB 2JP1A 4DAYA 4BY7B 3O13A 1XTCD 3OIPA 4X3UA 4G4KA 5EKIA 1U9RA 3FEWX 3U9SA 3HRZC 4EQPA 5HGTA 3N52A 1F2LA 4X3KA 5E4WC 3C1FA 1TWAB 1RHPA 1RJTA 3U9OA 1PRTC 2PYKA 4FYDA 1EZ8A 1TKWB 1E0BA 4JK1C 4QMGA 4K6LA 2RSNA 4GZYC 5IGGA 1SNCA 4IN3A 4KY7A 2F3WA 1MI2A 1TWCB 3L7ZC 3KLSA 4BS9A 1SNMA 3BDLA 1SE4A 1EEID 3HG9A 3P1HA 1S5DD 4I65A 1JB3A 1II3A 3HOUB 1XWEA 3OMGA 2B2TA 2E74C 1STBA 4FF1A 3KK7A 1NSNS 1DOKA 3SE0A 4K8IA 2EJMA 5I9PA 2M9VA 2ICIA 3IL8A 1JOOA 2X69A 2F0IA 4ABNA 5CMDA 4ODGA 2B2VC 3Q0AA 4HN7A 3NHHA 2HCCA 5EPLA 5G3LF 5IGCA 3TMEA 3S17B 2F0GA 3K58A 2RBMA 3T53B 1LO5D 4FF2A 2BDOA 3SDZA 3C2PA 3IFDA 4ME5A 1NCVA 4O1NA 4XYOA 1LTAD 1GHKA 4OO1I 3FVQA 1G291 3T4AC 3EQLC 4HAEA 2RDFA 1LTGD 1HTLD 3CU7A 1WTVA 2EYLA 4HSVA 1HFGA 3PMFA 2A6HD 1QJOA 1AN8A 4C3JG 1V1PB 2AWOA 2MP1A 2IWHA 1GUTA 2B2TC 3BG3A 2PZWA 3CRLC 5E1FA 1STAA 2HUGA 2R93B 3J80L 4FXDA 5KRUA 3R8BA 5C0XJ 4Q5VA 1W6JA 5EPKA 1LTSD 1QE6A 3OWEB 4DXFA 5K36G 2EXZA 1IHZA 2PPBC 5C6AA 3PUVA 2BA1A 2XRSD 2ZXOA 1ZXTA 2YU9B 4FXKC 4DF7A 4C3IB 5JEAG 3PIO3 4HMJA 2FINB 4K14A 5CYUA 5IGBA 3NQIA 1EOTA 3J81E 2K5DA 1PTOD 1F9RA 2E2IB 4FXGC 1IW7D 3DEOA 2FMMA 4H44C 1EY9A 1Y69U 4ZK9B 1TT2A 2D2CC 1ILQA 2OT2A 4G7HC 1H9SA 1RCVD 2A6ED 3NBHA 5KYLA 2V4DA 3G6JB 4O42A 5BN3A 3L9AX 1OXSC 1BCPC 2F3VA 1PRTB 2CHBD 1AP0A 5C44B 2XWJB 1VCIA 3PV0A 5JEAJ 1G6ZA 3QB3A 1GHJA 3SXHA 2K32A 2DNCA 1GUOA 1XXGA 2EJGC 1CQFA 2DN8A 1SSOA 4DA2A 4RKBA 3MVVA 1DJRD 4MHEA 4NP5A 4M1UB 2CW0D 2EJFC 3AU7A 5I2YA 2EYOA 1ZEQX 2HQEA 5I6WA 1SYEA 5COYA 3S9WA 1KDAA 4QUFA 3GTKB 1B9NA 4XIGS 2R92B 5J22A 4WORA 4CJ0B 1HPCA 4KD3A 4KHZA 3L3OC 2L1BA 2B39A 4QF4A 1NAPA 1HUNA 2EYHA 1EFID 1JWUD 3PO2B 3FDTA 2VXWA 1NUCA 3T16A 3MEHA 2K03A 1SEBD 1C4QA 1ONLA 4IUNA 3QOLA 1EYCA 2QILA 1UEAB 4A3MB 1A3VA 4FF3A 1B4OA 2N88A 1LTBD 1M4VA 2YYZA 3D3RA 4E6IA 1I4QA 2K04A 3MXNA 2F0WA 1SYFA 1SE3A 1YNJD 4Y7NB 1GUSA 5FO8B 3I4LA 3I4MB 1WTWA 4C2MB 3GTPB 3C46A 3D4WA 4S3SA 2ENBA 3IKJA 1HRJA 4MIUA 5FKAC 1I3QB 1PZJD 3I73A 1TWGB 2RQXA 2XVSA 1Z47A 5IT9L 4DNTB 1B53A 4BBRB 1PXUA 1F9PA 4A3JB 4XT1B 2J7ZA 1SYCA 1L0XB 2IX1A 3A8IE 4Z9CB 1T5XD 2ZT9C 3OIQA 1SNOA 1UUPA 3MFGA 2KA7A 2AQ3B 4C3IG 3HOZB 3QIAA 2MJ8A 2E2JB 3BVZA 1EU4A 5I4DA 1EEFD 5KNBA 4PQXA 4PMCA 4ZKBB 3FPUB 2M00A 5EQ0A 4CKCA 1IKLA 2PW5A 2RDGA 4U68A 1TY2A 1UAPA 3S1MB 1EY4A 1GUWA 5FO9B 1SNQA 1BCPB 1ESFA 4V190 1F2ZA 5ELBA 4RH6A 4TRDA 2GA4B 2LMCB 3VYSA 2WACA 5C4HA 5TSSA 1CZWA 5C4JB 3NWTA 1BUVT 4QB4A 5ELEA 2B2YA 3A7AB 1K83B 1PYWD 4CKEA 5BN4A 1H9SB 2EOTA 3R3OA 2HCIA 2KQ3A 2PNRC 1I4GA 4HMIA 4L6TB 4ZUJA 1VDZA 5HURA 3R2TA 3M85A 3RZOB 4J8QA 3OOCA 4I7ZC 3GTMB 3AMUA 4EGVA 1DZ1A 2WIIB 1S5ED 1BO0A 2WKCA 1YNND 3F2UA 5M5WB 2E2HB 2F0JA 3KLRA 1WTOA 4MN3A 2EY2A 3FPPA 4FNFA 2SOBA 2C9OA 2L4NA 1B1ZA 3SEBA 5I2XA 2XNAC 4ZAIA 5KYIA 2CQAA 2PMZB 3GV6A 3DWPA 5KIXA 1BBXC 5M5YB 1LT3D 2D62A 2Z4IA 3BVMA 2B8GA 3MA2B 1C48A 4K2LA 4AYBB 3CRKC 5JVG3 1EU3A 4A93B 3HS0C 3TP7A 4RAUC 3JAML 4B08A 5DNFA 2J0TD 5FO7B 1C8CA 1RTOA 5ELCA 5C4XB 1QOHA 1RD9D 1KTKA 3D8GA 3SK8A 5LHY1 1KDBA 1I50B 1GXDC 1TWFB 3MXPA 2C5CA 5G3LD 5E3FA 1AZPA 4F87A 3A55A 2L11A 2F0OA 3M4OB 4R8IA 3D6WA 1SYBA 2ZXRA 3NQTA 2F0NA 4X3TA 2RKSA 4IALA 3KF8A 2NUCA 2RA4A 4P2CB 1STNA 1ENCA 3T56B 3K6OA 4RHRA 3HOVB 2KUMA 2Q8TA 5KEEA 2L55A 4WFN3 2VUMB 4Q0FA 1ENAA 1BQQT 5IGDA 5C0XI 1ICWA 1VMCA 1EWHA 1EY6A 3TBIB 1A15A 3K59A 1HA6A 4RGTA 1G2SA 5K36H 4BY1B 4XYQA 2VB3X 1FNVA 3NSWA 1A2UA 4DXGA 2A6HC 1QB5D 1DXMA 2B2UA 1S4ZA 3DXJC 4OO1H 2Q8IB 3LNNA 5JEAH 3H3VC 1CT1D 3GTGB 1Q8IA 3CQZB 2QKIC 1CA5A 2VB2X 1STHA 3R93A 4FP5D 3DUZA 2O5JC 2WV6D 4CKBA 1NR2A 1MSHA 2XN9C 5D3IB 3GV3A 3RD4A 2O2LD 1RDPD 2XRQD 2Z8LA 4K6DA 1CQVA 5C0XG 2EVBA 2WKDA 1DD2A 3TN2A 2SDFA 2Q8RE 3QWNA 5BN5A 3EJIA 4C1NK 1G2TA 4J1MA 4NDXA 1X32A 1TS3A 4FO2A 5CV7A 1PTOC 4M8AA 4ILWA 4KJNA 1IW7C 2KEDA 1D6EC 2B2UC 4DK1A 4R8NA 2EE1A 5EJWA 3W3AA 1CM9A 3LWEA 3NP8A 2OF1A 2AQ1B 3M4YA 2I46A 1UNSA 2A6EC 3MC0B 2E2DC 3EVQA 2A5HA 5CV6A 4A3IB 3GO5A 4KV6A 3A8KE 4V0BA 2AWNA 3FRPB 3URYA 1IL8A 5DM73 3V05A 5ELFA 4ZRZA 4NMZA 1EWCA 3VR5A 2WAQB 1TWHB 4KKSA 4N9TA 4XT3B 1Y8NB 5IT9E 1WD0A 1WTQA 2OXPA 1T5EA 5FOBB 1RTNA 3GP7A 4A3BB 2I07B 4KK7A 3ONAB 3W2DA 1STYA 5C5LA 2F4IA 4WRDA 2CW0C 1TQOA 1ET9A 1SDFA 4TQUS 1Q1BA 1CTMA 3GTQB 3WDNA 5EKLA 5F2DA 1OXTA 1JR0D 4TSSA 2EY1A 1IYUA 5C3WA 3Q6SA 5C4ZA 2Z4HA 2WB1B 1SYDA 4G7ZC 4IFDI 3RLFA 2PZUA 1Q90A 4PV1C 1LT5D 3RMHA 1D5MC 3SVMA 2MUYA 1SXTA 5LL6S 2O5IC 4KJOA 5FLXL 3NK9A 3Q24A 1D1KA 2K01A 4PMWA 1HXYD 2F0UA 1KABA 2EYMA 3ITPA 4KD4A 3G7LA 4EQOA 1SAPA 1YNJC 3K5MA 3NE5B 4KY5A 3WOFA 2F0HA 4KKUA 3BS1A 3RZDB 3I72A 1H9KA 1TIID 5M3FB 4NW2A 3NTKA 3K5NA 1U4MA 3QG1A 4IFDG 1K8OA 4ZUIA 4ULLA 4X3SA 5IGEA 1WCMB 2A74C 4H0LC 3X3MA 2PO4A 1WVLA 1EY8A 2E76C 4EQNA 4IQZA 3N6RA 4RHSA 4CGYB 1RODA 3GD7A 2A68D 4QCLA 5CORA 1PTOB 1TVXA 1IYVA 4HCSA 3PUWA 1O7YA 1MGSA 2QF7A 5EBCA 2BDNA 1ZKOA 4OHJA 4JBWA 4YIJA 2IJ0A 4EVOA 2XIWA 1HA5A 3EA6A 3E5SA 3VYUA 1PDQA 2SNMA 1VMPA 3DWQA 5JVH3 3FMCA 3UI2A 1IKMA 2EDGA 1EY5A 4RKLA 4IFDJ 4RFBA 3I90A 3SR1A 3E6ZX 2EPBA 3TP5A 1SFOB 5M9OA 5A35A 1O7LA 1PMRA 1A2TA 2K05A 3K0YA 2NN6I 1ZYRC 1EL0A 1JOQA 4XQQA 4A3KB 4OIKA 4XQJA 1X3QA 2HDMA 3S14B 3BDCA 3D4RA 2BA0A 3I3CA 3HP3A 2X6LA 3E0JA 1CA6A 1O78A 4K8JA 1G8ZD 5DAUA 3J81L 3PUXA 1CHPD 3AB9A 2WINB 1Q3LA 1LT6D 3I91A 2FJ2A 3V96A 2F0FA 3QO2A 4FVMA 1EZ6A 2D5DA 2PZTA 4DU9A 1AFPA 1OXVA 1V1OA 1BCPF 4QUCA 1PZID 1B2TA 4CHTB 2NN6G 5J39A 3SHLA 2J4XA 3MHBA 3VA7A 1L0YB 1Y8OB 4K5XA 1ZYRD 1YNNC 2XWBB 3M7GA 2K28A 3R2IA 2R6GA 1STGA 3MXGA 2IX0A 1RF2D 4RGMA 3I4NB 2JYOA 2B2WA 3VA5A 1I6HB 2QEJC 3DEPA 3J7AV 2Y0SB 1B50A 3A54A 2F0MA 5M5XB 1LT4D 1EQVA 3T51B 1I4HA 1WTPA 5CV4A 3CKIB 3M7NA 1KNEA 1F2YA 1XYIA 1BR9A 1SJHD 1HCZA 4WJWA 1JQYD 5IGFA 2KOLA 5KNCA 3MTSA 5JPNC 5JPMC 2L0CA 2ID0A 3VR3A 1QWYA 2F0KA 1SNDA 4BA2I 2KCCA 3S1RB 2F0VA 4ZKCB 3FKIB 4DN4M 1DCZA 3D31A 1WTRA 2B2WC 1GUGA 3WOEA 1EY7A 2H1EA 2KVMA 4DAVA 3HGBA 4C56C 1VF7A 4ZQ3A 1EQTA 3NBIA 4KMUC 3J7AF 5T1IA 2B2YC 2K1BA 3S1NB 1STEA 4A3EB 3DHQA 2F03A 4K2KA 2OEOA 2R3ZA 4LK1C 4TKOB 2F0DA 1D5XC 4L8JA 3V2TA 2TMPA 3J80E 2BE5D 1TS5A 3QJYA 2EYJA 1JE4A 3EFXD 2A69C 2AUKA 3A8JE 3T13A 5C0XH 1TR5A 2JXMB 1JICA 4HTHA 1LTTD 3H94A 3OSOA 1PFNA 2NVXB 1CI3M 2G9HD 2EZVA 1DONA 2EYFA 5AFWA 3K57A 5M3MB 2R7ZB 4XDXA 2NZ1D 1DM0B 3C1EA 5FK9C 1I6VC 1MBYA 3IFTA 1TS4A 1Z7TA 1PZKD 2D9UA 3KLSX 1GJXA 3H09A 2JA8B 2Z1CA 2IPKD 4H7BA 1AW7A 3TZUA 2WP8J 2IT1A 1H9MA 2MHVA 1KLUD 5CBAE 1SMYD 2SNSA 2KHSA 4R9WA 2KEEA 2LS01 5IIFA 2A69D 3SK5A 2B2VA 2TSSA 1AZQA 4N9PA 4XTCS 2X6GA 2QCPX 1I4RA 1E2ZA 1OO9B 3OPOA 5FLXE 2B8FA 3NUCA 4HSPA 1Y8PB 3KBXA 1PLFA 2F0QA 3X3NA 3J7YW 5A2QL 3GTJB 1D1IA 1CK1A 4KI0A 2K5QA 1KNAA 1JORA 3GQBA 1QNUA 4UAIA 3HEJA 2EY6A 5JAVA 3PUYA 4DK0A 3MZ5A 2NBFA 1FNWA 4IUQA 3BDOA 1JOKA 4LJZC 2L9HA 2NYZD 2NTSA 1AEXA 3TSSA 1OXXK 1MSGA 2F0EA 1PRTD 2F0LA 4F8MA 1DYQA 3VYRA 2JSOA 3DWAA 3H91A 1TU2B 3KUPA 2CVRA 2LFNA 3HZXA 3S15B 2K7VA 3TDQA 2MGSA 2A73B 5EGTA 1LTRD 4DGZA 5JOBA 3S2DB 4G57A 1LABA 4HEDA 1FD7D 4ZYSA 4KN4C 1U4PA 5I6YA 1S5CD 3M3YB 4RGOS 4CJ2C 2G9DA 4IFDH 4CBVA 3VR4A 1LACA 1HTPA 4OGQC 3HOWB 1F9SA 1F9QA 4A3GB 1PFBA 3H6MA 3A7LA 4FF4A 5EKKA 1GUNA 4OO1G 2F0PA 2DY7A 2FFKB 3MFYA 4KY6A 5J1ZA 1KDCA 1QG7A 4IZ8A 3LX0A 1PRTF 2L12A 1O80A 1Y1WB 1TY0A 2F0SA 3DM1A 4IURA 2JE6I 3HOYB 1QCBD 4ZLTF 4IUPA 3PO3B 1SNPA 3OWFA 3S16B 4K5WA 2A68C 5T1GA 4C1NI 1U4RA 2ZXPA 1FGBD 1Y1VB 4RWSC 1BOSA 4KHVA 3BZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3L A;  1WTR A;  2B2W C;  3I8Z A;  3I91 A;  4R9W A;  1WD0 A;  4CJ1 B;  1WTQ A;  2KEE A;  1B4O A;  2N88 A;  2FJ2 A;  5D14 A;  2MGS A;  2DY8 A;  1J9O A;  4X3S A;  1RTN A;  1CA5 A;  3QO2 A;  1XX8 A;  1HUM A;  3R93 A;  2B2V A;  1BNZ A;  2H1E A;  2KVM A;  1PFM A;  3IFD A;  2K04 A;  3ONA B;  1AZQ A;  1M8A A;  1NCV A;  4RAU C;  5D65 A;  2JP1 A;  1B3A A;  1WVL A;  3MWY W;  2X6G A;  1EQT A;  2IL8 A;  4HED A;  1NR2 A;  4O42 A;  5DNF A;  1WTW A;  1MSH A;  5T1I A;  1SDF A;  1NR4 A;  2FHT A;  1RTO A;  4RA8 A;  1C8C A;  4HAE A;  2B2Y C;  2K1B A;  1ROD A;  1U4P A;  3GV3 A;  4QUC A;  1AP0 A;  1HRJ A;  4X3U A;  5EKI A;  1B2T A;  4IUT A;  4CJ2 C;  5COR A;  1TVX A;  1WTV A;  4HCS A;  1G6Z A;  4HSV A;  1HFG A;  2R3Z A;  2KEC A;  1O7Y A;  1X3P A;  1O7Z A;  1MGS A;  2BDN A;  3N52 A;  1F2L A;  3KBX A;  2MP1 A;  4IUV A;  2B2Y A;  3TN2 A;  2K28 A;  1PLF A;  2SDF A;  2Q8R E;  4X3K A;  5E4W C;  2B2T C;  3Q6S A;  1RHP A;  1G2T A;  1F9S A;  1AZP A;  2XIW A;  1F9Q A;  1JE4 A;  1SSO A;  2JYO A;  1PFB A;  2B2W A;  1B53 A;  1RJT A;  1X32 A;  1F9P A;  2HUG A;  1BF4 A;  2EOT A;  1PDQ A;  2L11 A;  1VMP A;  1HHV A;  2HCI A;  4XT1 B;  2J7Z A;  2MPM A;  3DEP A;  4R8I A;  3D6W A;  1E0B A;  1XYI A;  3UI2 A;  1LV9 A;  4MHE A;  1KNA A;  1B50 A;  1IKM A;  1ILP A;  2RSO A;  2DY7 A;  1EIH A;  4X3T A;  2KED A;  1JIC A;  3P7J A;  4UAI A;  2FFK B;  2RSN A;  5EPK A;  3TZD A;  3I90 A;  1QE6 A;  2B2U C;  2N55 A;  1HFN A;  1J8I A;  2RA4 A;  3SVM A;  2EPB A;  2EE1 A;  1ML0 D;  2NWG A;  5COY A;  5EJW A;  1CM9 A;  1PFN A;  3LWE A;  1WD1 A;  2KUM A;  2Q8T A;  1WTP A;  1DZ1 A;  2K05 A;  5JJZ A;  1MI2 A;  1QG7 A;  2K01 A;  2MJ8 A;  4QUF A;  1DON A;  4IUQ A;  1EL0 A;  1ESR A;  1KNE A;  2L12 A;  1BO0 A;  4IUU A;  4OIK A;  5AFW A;  1X3Q A;  1ICW A;  1VMC A;  1ZXT A;  2L9H A;  2NYZ D;  3F2U A;  3G7L A;  4XDX A;  1O80 A;  2NZ1 D;  1SAP A;  1A15 A;  2HDM A;  1DOM A;  3DM1 A;  4IUR A;  1HA6 A;  2B2T A;  5CBE E;  1G2S A;  5EPJ A;  4CJ0 B;  4ZKB B;  1WTO A;  3I3C A;  1DOL A;  3FPU B;  3HP3 A;  4MN3 A;  1MSG A;  2HDL A;  2RVL A;  1IL8 A;  4OIJ A;  4ZLT F;  1QNK A;  2KOL A;  4IUP A;  2FIN B;  2X6L A;  1DOK A;  2D9U A;  2L1B A;  2L4N A;  1NAP A;  1EOT A;  3MTS A;  1G91 A;  1HUN A;  5EQ0 A;  5T1G A;  1CA6 A;  1F9R A;  1EIG A;  1IKL A;  1U4R A;  3IL8 A;  3H91 A;  4U68 A;  4ZAI A;  3DEO A;  2X69 A;  1U4L A;  2FMM A;  1WTX A;  4LMQ D;  4NW2 A;  4RWS C;  3FDT A;  4ZK9 B;  2VXW A;  1GUW A;  5E4X A;  3GV6 A;  2K03 A;  1BBX C;  3KUP A;  5CMD A;  2B2U A;  2B2V C;  1S4Z A;  2CVR A;  2HCC A;  4XT3 B;  5EPL A;  2M2L A;  4ZKC B;  1U4M A;  4DN4 M;  5CBA E;  1ILQ A; 
#chains in the Genus database with same CATH topology
 2NVT B;  4UPA A;  2SEB D;  5D14 A;  1ET6 A;  1XPR A;  1HUM A;  1BNZ A;  2MFI A;  3F2D A;  1M8A A;  5CC4 A;  2IX3 A;  4RMF A;  4A3B H;  2ICE C;  1B3A A;  4HCE A;  2MO0 A;  4YCW A;  1UE5 A;  5GAH C;  2KCN A;  1F77 A;  1V8Q A;  2I5M X;  5I9O A;  4BWG B;  1EYA A;  1NR4 A;  4HJA A;  1Q81 C;  1D5Z C;  1BBW A;  1KL9 A;  5CV9 A;  2KJX A;  3TP6 A;  5IOC A;  3HOX B;  1XNQ Q;  3PIP 3;  1E2W A;  1B44 D;  4IUT A;  1JWS D;  4AQY L;  4R4Q A;  5JJL A;  3GTL B;  3GTQ H;  4DV6 Q;  2KEC A;  1KAA A;  4IUV A;  2JN4 A;  5C5M A;  1M90 C;  1GOZ A;  3RUZ A;  1YJ9 A;  4B9X A;  3S1Q B;  3C3L A;  4BXX G;  2NVQ B;  1BF4 A;  1D2B A;  3VR2 A;  5IY0 A;  2NN6 H;  5ELD A;  2JA9 A;  1PTO F;  4LFB Q;  2K6A A;  1LM0 A;  2IW3 A;  3T1H Q;  1EIH A;  4K5V A;  5C3E B;  3TEH B;  1OXU A;  1W6K A;  3A5U A;  2N55 A;  3P20 A;  1R4P B;  3CAM A;  2R61 A;  1ML0 D;  1BCP D;  1JC7 A;  1MHW C;  2JQO A;  3D4D A;  1WD1 A;  2E75 C;  2GN5 A;  1EYD A;  3CHB D;  3KJP A;  4JI8 Q;  2LKV A;  3VYT A;  4C3H B;  1PH2 A;  5DEH A;  1N34 Q;  4EX5 A;  4DR5 Q;  1DOM A;  1GKH A;  4N8F A;  2AQ2 B;  1EY0 A;  1CKN A;  2HDL A;  2PQE A;  5DM6 3;  2NTT A;  1X6O A;  4RCN A;  2FMC A;  2UUA Q;  2P5Z X;  3H3V H;  1H9R A;  2F1M A;  1S72 A;  3RZD H;  2L5T A;  3BYY B;  2LY7 A;  2NVY B;  1YIT A;  1SYG A;  5M3F H;  1S5B D;  1L1O C;  4LF5 Q;  1A3U A;  2KBN A;  2B63 B;  1PVO A;  5K5P A;  4H13 C;  3I70 A;  2F0T A;  2YTX A;  4B9W A;  3JAM E;  1LLR D;  3Q22 A;  1HQR D;  5CR3 A;  1S5F D;  2DY8 A;  1SJE D;  3LWU A;  3NPP A;  2KCT A;  4X66 Q;  1JWM D;  4KN7 C;  4OX9 Q;  1PFM A;  1Q1E A;  1ENF A;  2VQF Q;  1QIL A;  5D65 A;  1WCM H;  3K5O A;  1O7I A;  3QR8 A;  3MWY W;  4A3D B;  2EYP A;  1RKN A;  2H4O A;  3UE1 A;  3HOW G;  3CCQ A;  4A3C G;  4A3G G;  4DR3 Q;  1KLG D;  1BXT A;  2PCF B;  2DNE A;  4LFC L;  3K5L A;  4BBS B;  4NKL A;  1PTO H;  1X3P A;  1O7Z A;  4XQN A;  1JT8 A;  3UDF A;  5D3D A;  4UDU C;  4DNR B;  5IOD A;  4NXN Q;  3G6E A;  5LL6 X;  3NTH A;  4JI2 L;  2MPM A;  2VW9 A;  4DV1 L;  4DR1 Q;  5KGU A;  2E5L Q;  3ZYY X;  1LV9 A;  1FJG Q;  1CFM A;  4B3S Q;  2K5W A;  2V1C C;  2JA7 B;  3P7J A;  3TZD A;  4QIW B;  1Y1W G;  2VS1 A;  1HFN A;  5AJ3 L;  5C3X A;  1K9M C;  2MNA A;  3OMC A;  4ALP A;  3TRZ A;  3S2H B;  2NB0 A;  2ASB A;  1SFO H;  4NB3 A;  3VR6 A;  3PO3 G;  2JA6 B;  1TS2 A;  3Q23 A;  1VQA A;  4KKT A;  2JEA I;  1A6X A;  4PMB A;  1Y1V G;  5EBD A;  4A3K H;  1JCK B;  3K0X A;  2A8V A;  5CV5 A;  3NXW A;  3S14 H;  4OIJ A;  2ZTC A;  1QNK A;  3D6C A;  3TP8 A;  1VQD A;  1G91 A;  1H9J A;  2UUB L;  1EIG A;  1SBB B;  4HR7 B;  2EY5 A;  1ICF B;  3ND8 A;  4LUV A;  1WTX A;  1U4L A;  1V43 A;  3B6Y A;  4LMQ D;  3ND9 A;  4A3F B;  3OW7 A;  5E4X A;  1EOV A;  1V1P A;  2N3S A;  3UDX A;  4G7O C;  2PW7 A;  2BE5 C;  4ID6 A;  5E7N A;  1SE2 A;  5CGK A;  5JJI A;  3I8Z A;  5KND A;  4CJ1 B;  4L5S A;  4BA1 I;  5A2Q E;  3SK4 A;  3NTI A;  3HOX G;  1J9O A;  3MXU A;  2UUC L;  1XX8 A;  1CZG A;  4KTA A;  4DR6 L;  1PFS A;  1QZG A;  2DJG C;  1E2V A;  2PI2 E;  2HIX A;  5NUC A;  2ZJR A;  3DMU A;  2IL8 A;  2BCO A;  2NZO A;  4L63 B;  1Q12 A;  4JI1 Q;  2FHT A;  4JBJ A;  3DM3 A;  1FR3 A;  4RA8 A;  4F88 A;  1HR0 L;  1CHQ D;  4DKA C;  4R4I A;  4F7X A;  4OXP A;  3ERQ A;  1N9W A;  1F2M A;  4OL7 A;  1R4Q B;  1B7Y B;  1FYC A;  5DLQ E;  1MD2 D;  1VQ4 A;  5C3E G;  1EQQ A;  1VF5 C;  1HQM C;  2AUJ D;  3J81 i;  1I4P A;  1HHV A;  3I4N H;  4DV5 L;  4GLA C;  1LTI D;  1B9M A;  1I6H H;  3HFZ B;  3CXC A;  4RGN A;  3QOJ A;  3HKZ B;  4C3J B;  1ILP A;  1S40 A;  2RSO A;  1JJG A;  1P8L A;  4RCO A;  4YWM A;  4C3H G;  1I4X A;  1N33 Q;  4J6H A;  1J8I A;  4JI2 Q;  4DV1 Q;  5M5X H;  4U67 3;  1SMY C;  3BYT B;  2BOS A;  5JJZ A;  4HIM A;  2AHO B;  1PHJ A;  3KBG A;  4LAA A;  2R7D A;  2CH4 W;  1ESR A;  4IUU A;  5AJ3 Q;  3H0G B;  3T1Y L;  1K8M A;  1L1O B;  4UP8 A;  3MAQ A;  5CBE E;  2RDH A;  5EPJ A;  1DOL A;  3P75 A;  1BDO A;  2RVL A;  2QDB A;  4PNY A;  2B63 G;  3A56 A;  2JEB I;  2K4K A;  3I4O A;  4LNQ A;  2JK8 A;  1KRS A;  3IAY A;  1Z6H A;  3E9I A;  4OWW B;  1FNU A;  2O4X A;  2VNU D;  3BVG A;  2QGQ A;  1WYD A;  3PUZ A;  5H1S E;  4DPG A;  2UUB Q;  2M2L A;  3SK6 A;  4A3D G;  4DFA A;  4JCV E;  2NWG A;  2JA5 B;  3OHX C;  3S1R H;  4LF8 L;  3FKI H;  4XXE A;  2K33 A;  1A3T A;  4DAP A;  1R9T B;  1KHI A;  5ISR A;  3JC6 6;  5CV8 A;  1VQ5 A;  3M9B A;  3ERO A;  3GTO B;  2XSC A;  4BBS G;  3NWS A;  3K7A B;  2JP1 A;  4DAY A;  4BY7 B;  4DV4 L;  3O13 A;  1Q86 C;  1CKN B;  1XTC D;  1C7Y A;  3HOZ G;  3OIP A;  1PH8 A;  1KD1 C;  2VQE Q;  4DR6 Q;  4X3U A;  4G4K A;  5EKI A;  1FL0 A;  3S1N H;  1U9R A;  4CDE C;  3FEW X;  3U9S A;  3HRZ C;  4EQP A;  4A3E H;  1I94 L;  1A62 A;  3ZJY C;  5HGT A;  4DR7 Q;  3N52 A;  1F2L A;  3ICE A;  4X3K A;  1D8L A;  5E4W C;  3Q8D A;  3C1F A;  1TWA B;  2JA7 G;  1RHP A;  4QJF A;  1HNZ Q;  2FXQ A;  1RJT A;  2F3I A;  3U9O A;  1PRT C;  2PYK A;  4FYD A;  1EZ8 A;  1TKW B;  4AYB E;  1E0B A;  2JA6 G;  4JK1 C;  3K7U C;  4QMG A;  3IRB A;  4K6L A;  2RSN A;  4GZY C;  5IGG A;  4IPG A;  4DV5 Q;  1SNC A;  4IN3 A;  4WJ3 M;  1C0A A;  1GD7 A;  4KY7 A;  2F3W A;  4LUO A;  1MI2 A;  1TWC B;  3L7Z C;  3KLS A;  2NVX H;  1FVI A;  1SNM A;  4BS9 A;  3BDL A;  4UY8 C;  1SE4 A;  1EEI D;  3HG9 A;  3P1H A;  1S5D D;  4I65 A;  1JB3 A;  1II3 A;  2XTI A;  1RL2 A;  3HOU B;  1XWE A;  4A3F G;  3OMG A;  2B2T A;  5M3M H;  2E74 C;  2R7Z H;  1STB A;  4FF1 A;  1SE8 A;  3KK7 A;  5IYD G;  1NSN S;  1YZ6 A;  2K50 A;  1DOK A;  3SE0 A;  3K80 C;  3T1Y Q;  1NNX A;  2EJM A;  4K8I A;  5I9P A;  2M9V A;  2ICI A;  3IL8 A;  1JOO A;  5FLM H;  4DV7 Q;  2X69 A;  2F0I A;  1TXY A;  1W3S A;  4ABN A;  2JA8 H;  2H5X A;  1QZH A;  5CMD A;  4ODG A;  2B2V C;  3Q0A A;  4HN7 A;  2DGY A;  2HCC A;  3NHH A;  5EPL A;  1GO3 E;  5G3L F;  3TME A;  5IGC A;  3S17 B;  2F0G A;  4JI0 L;  3K58 A;  2RBM A;  3T53 B;  1LO5 D;  4FF2 A;  2BDO A;  3SDZ A;  3C2P A;  3IFD A;  4ME5 A;  1NCV A;  2CCZ A;  4O1N A;  4XYO A;  4LF8 Q;  1LTA D;  3PIP A;  1GHK A;  4OO1 I;  3FVQ A;  1G29 1;  3T4A C;  3EQL C;  4DV0 L;  4HAE A;  1MJE A;  2RDF A;  1LTG D;  1MJC A;  4JOI A;  4X62 Q;  1UE7 A;  5ELN A;  1HTL D;  2IHE A;  4GNX A;  3CU7 A;  1CKM A;  2Q2H A;  3EIV A;  1WTV A;  2EYL A;  1EQR A;  2PQA A;  4HSV A;  4GKJ L;  1HFG A;  3PMF A;  2A6H D;  1QJO A;  4R4T A;  1AN8 A;  3HKZ G;  1V1P B;  2AWO A;  2MP1 A;  2IWH A;  4C3J G;  1GUT A;  2B2T C;  3BG3 A;  1E3P A;  3CW2 C;  3PF4 A;  2PZW A;  3CD6 A;  2K75 A;  1YJW A;  3CRL C;  5E1F A;  1STA A;  4GN3 B;  4X64 L;  2HUG A;  1I94 Q;  3L2P A;  5IWA L;  2R93 B;  3J80 L;  3GTJ H;  3A74 A;  1KXL A;  4FXD A;  1NE3 A;  5KRU A;  1XMQ L;  3R8B A;  5C0X J;  3FP9 A;  4Q5V A;  2AKW B;  3I2Z A;  1W6J A;  1VQG A;  3H0G G;  5EPK A;  1LTS D;  1QE6 A;  5EAY A;  1VQF A;  3OWE B;  4DXF A;  5K36 G;  1JMC A;  2EXZ A;  1IHZ A;  1JJ2 A;  4JYA L;  2PPB C;  5C6A A;  4BXX H;  4P71 A;  1N32 L;  4IOC A;  3PUV A;  2BA1 A;  2XRS D;  2ZXO A;  1AE2 A;  1ZXT A;  3CCR A;  4POG A;  2YU9 B;  4FXK C;  1VQJ A;  2RCF A;  4DF7 A;  4HJ5 A;  4HJ8 A;  4C3I B;  5JEA G;  4YHH Q;  3PIO 3;  4HMJ A;  2FIN B;  4K14 A;  5CYU A;  5IGB A;  2CH4 A;  1EOT A;  3NQI A;  4JOI C;  3J81 E;  2JA5 G;  4LF6 L;  2K5D A;  1VQN A;  1PTO D;  1F9R A;  4GNX C;  2E2I B;  4FXG C;  1IW7 D;  3DEO A;  2FMM A;  3RNU A;  4H44 C;  1EY9 A;  1Y69 U;  4ZK9 B;  1TT2 A;  5IE8 A;  2D2C C;  4BY7 G;  3U4Z A;  1ILQ A;  2OT2 A;  4HID A;  4GKK L;  4G7H C;  1H9S A;  3S15 H;  1RCV D;  2C35 B;  2Q2T A;  1U5K A;  2ATW A;  2A6E D;  3F1Z A;  3NBH A;  5KYL A;  2V4D A;  3S2D H;  3G6J B;  4O42 A;  5BN3 A;  3L9A X;  1X9N A;  1OXS C;  1CKO A;  1BCP C;  4X6A H;  2F3V A;  1PRT B;  2CHB D;  2G5D A;  1AP0 A;  5IT9 c;  5C44 B;  2VUM G;  3RLN A;  2XWJ B;  3UDI A;  1VCI A;  3PV0 A;  5JEA J;  1G6Z A;  3M3Y H;  3QB3 A;  2LSS A;  4O0A A;  1GHJ A;  3SXH A;  4DV0 Q;  2K32 A;  1BKB A;  2DNC A;  1GUO A;  4JW0 A;  1XXG A;  2EJG C;  2WAQ E;  1CQF A;  2DN8 A;  2I0Q A;  1SSO A;  2CFM A;  2K52 A;  4DA2 A;  4GKJ Q;  1J6Q A;  1X3E A;  2BH8 A;  4RKB A;  3HOW H;  4A3C H;  1A63 A;  4A3G H;  5IYB G;  3MVV A;  1DJR D;  2F4V L;  4GLV B;  4MHE A;  4NP5 A;  4R4C A;  5GAE C;  4HJ9 A;  4M1U B;  1P16 A;  4DAY B;  2Q2U A;  2CW0 D;  2EJF C;  2UU9 Q;  3AU7 A;  5I2Y A;  2EYO A;  1YNX A;  1ZEQ X;  2HQE A;  5I6W A;  1LUZ A;  3HOU G;  1SYE A;  5COY A;  3S9W A;  5IWA Q;  4JC0 A;  1K8A C;  1YBY A;  1XMQ Q;  1KDA A;  4QUF A;  2L15 A;  3GTK B;  4X65 Q;  1EUJ A;  1B9N A;  4XIG S;  2R92 B;  5J22 A;  3E9H A;  4WOR A;  4ZCK A;  4CJ0 B;  3TS2 A;  4Y52 H;  1Y1W H;  3H15 A;  2EIF A;  3ULJ A;  1HPC A;  4DK6 C;  1IZ6 A;  4KD3 A;  4KHZ A;  3HOY H;  1N36 L;  3L3O C;  2L1B A;  2B39 A;  4QF4 A;  1NAP A;  1HUN A;  2EYH A;  1HR0 W;  1SRU A;  3PO3 H;  1EFI D;  1EWI A;  5BR8 Q;  1A0I A;  1JWU D;  3PO2 B;  3S16 H;  1QVC A;  4R1J A;  2WB1 E;  2GVB A;  3FDT A;  2VXW A;  1NUC A;  3T16 A;  3MEH A;  1L2F A;  2K03 A;  1SEB D;  1C4Q A;  1ONL A;  1Y1V H;  4AH6 A;  4IUN A;  3QOL A;  3CCJ A;  3AFQ A;  1EYC A;  2QIL A;  1UEA B;  2HQL A;  1A3V A;  4A3M B;  4FF3 A;  1B4O A;  2N88 A;  1LTB D;  1M4V A;  2YYZ A;  1Q46 A;  3D3R A;  2NVT H;  1XTD A;  4E6I A;  1I4Q A;  2K04 A;  3MXN A;  2F0W A;  1SYF A;  1SE3 A;  1YNJ D;  1YHA A;  4Y7N B;  3J7A 5;  1GUS A;  4GKK Q;  5FO8 B;  3I4L A;  3I4M B;  1WTW A;  4C2M B;  2HD3 A;  3GTP B;  3C46 A;  3D4W A;  4S3S A;  2ENB A;  3IKJ A;  1YI2 A;  1HRJ A;  4MIU A;  5FKA C;  4A3L G;  3HOX H;  1I3Q B;  2R93 G;  4LF4 L;  1PZJ D;  4NXM L;  3I73 A;  1TWG B;  2RQX A;  4A3I G;  2RCN A;  3GTL H;  2XVS A;  1Z47 A;  4B3R Q;  5IT9 L;  4DNT B;  1B53 A;  4BBR B;  1PXU A;  3I56 A;  1F9P A;  4A3J B;  3S1Q H;  4P73 A;  4XT1 B;  2J7Z A;  1SYC A;  1L0X B;  2IX1 A;  3A8I E;  4Z9C B;  1K3B C;  4OON A;  1T5X D;  2ZT9 C;  3OIQ A;  4WJ4 A;  1SNO A;  1UUP A;  4LF7 L;  2K5V A;  1XJV A;  3MFG A;  2KA7 A;  1EFW A;  2AQ3 B;  4P75 A;  3W1G A;  5C3E H;  4GN5 A;  4C3I G;  3OTO L;  2Z0S A;  3MEF A;  3HOZ B;  4AQY Q;  4GNX B;  3QIA A;  2MJ8 A;  2E2J B;  3BVZ A;  1EU4 A;  2E8G A;  3RR5 A;  5I4D A;  1EEF D;  5KNB A;  4C3H H;  4PQX A;  4PMC A;  4ZKB B;  3EBE A;  1YEZ A;  3FPU B;  2M00 A;  2HHH L;  1S3O A;  5EQ0 A;  1PH9 A;  4CKC A;  4QL5 A;  1IKL A;  2PW5 A;  2RDG A;  4U68 A;  1TY2 A;  1UAP A;  1K0S A;  3S1M B;  4JI4 L;  1EY4 A;  1GUW A;  5FO9 B;  3RLO A;  1K8G A;  1U0L A;  1SNQ A;  3PF5 A;  2NVY H;  1ASZ A;  3JAM c;  1BCP B;  1PH4 A;  2YV5 A;  1ESF A;  1X65 A;  2B63 H;  4V19 0;  5C44 G;  1F2Z A;  5ELB A;  3NEL A;  4RH6 A;  4TRD A;  2GA4 B;  1K73 C;  2LMC B;  3G48 A;  3VYS A;  2WAC A;  4A3D H;  2LXJ A;  5C4H A;  5TSS A;  1CZW A;  2IY5 B;  5C4J B;  1KC8 C;  3NWT A;  1BUV T;  3CCE A;  4QB4 A;  5ELE A;  4BBS H;  2B2Y A;  3A7A B;  4CDD C;  1K83 B;  2PNH A;  3E0E A;  1PYW D;  1E7Z A;  4IPD A;  1IBK L;  3TQY A;  4CKE A;  5BN4 A;  1H9S B;  2EOT A;  4LF4 Q;  4NXM Q;  1XNR L;  3R3O A;  2HCI A;  2KQ3 A;  2PNR C;  1I4G A;  5FJ8 H;  3I7F A;  4MTK A;  4HMI A;  1FGU A;  4L6T B;  5L37 A;  2A1A A;  4GN4 B;  4ZUJ A;  1VDZ A;  5HUR A;  3OYY A;  2R92 G;  3R2T A;  3M85 A;  3RZO B;  4J8Q A;  2JA7 H;  2Z6K A;  3OOC A;  4I7Z C;  3GTM B;  2ZTE A;  3AMU A;  2XGT A;  4EGV A;  1DZ1 A;  2F52 A;  4LFC Q;  2WII B;  3S2H H;  1S5E D;  1BO0 A;  2JA6 H;  2WKC A;  1YNN D;  3F2U A;  3PO2 G;  5M5W B;  2E2H B;  3OTO Q;  4JG2 A;  2F0J A;  3KLR A;  1IBL L;  1WTO A;  4MN3 A;  2EY2 A;  3FPP A;  4FNF A;  2SOB A;  3M4Q A;  2C9O A;  2L4N A;  1B1Z A;  1UWV A;  2CWP A;  3SEB A;  1W2B A;  4A3M G;  1C9O A;  5I2X A;  1B8A A;  2XNA C;  1IBM L;  4JBM A;  4ZAI A;  2B29 A;  1VQH A;  5KYI A;  2CQA A;  2PMZ B;  2Y0S E;  4LUZ A;  3GV6 A;  3DWP A;  3W5O A;  3KLW A;  5KIX A;  1BBX C;  5M5Y B;  1LT3 D;  2D62 A;  2Z4I A;  2OWO A;  4A3F H;  3BVM A;  2B8G A;  3MA2 B;  1VQ6 A;  2Z9H A;  2VZA A;  3I4M G;  1C48 A;  5IYD H;  4IO9 A;  4K2L A;  4AYB B;  3CRK C;  4EQ5 A;  1DGS A;  3KOJ A;  5JVG 3;  4JI4 Q;  1QVG A;  1EU3 A;  4A93 B;  3ER0 A;  3HS0 C;  4GS3 A;  1PH7 A;  3TP7 A;  4P72 A;  4RAU C;  3JAM L;  3J81 j;  2ZTD A;  4B08 A;  3STB C;  1G51 A;  5DNF A;  2J0T D;  5FO7 B;  2Z6K C;  1C8C A;  1RTO A;  3FHW A;  4OWT B;  5ELC A;  4BBR G;  5C4X B;  1QOH A;  4A3J G;  1RD9 D;  4A3K G;  3KDF A;  1KTK A;  3K8A A;  4JI7 L;  3D8G A;  3SK8 A;  5LHY 1;  1KDB A;  1NBW A;  1I50 B;  1GXD C;  4MTN A;  1TWF B;  3MXP A;  2C5C A;  5G3L D;  2VL6 A;  5E3F A;  1AZP A;  1IL2 A;  2UXC L;  1SRO A;  4F87 A;  3KJO A;  4DV2 L;  4UHV A;  1VQ9 A;  3A55 A;  2L11 A;  2MQH A;  2F0O A;  3M4O B;  4R8I A;  2UUC Q;  3BU2 A;  3D6W A;  3PSI A;  1SYB A;  1WTH A;  2ZXR A;  2RHS B;  3NQT A;  4B3M L;  1IBK Q;  2F0N A;  3G4S A;  4X3T A;  2RKS A;  4C3J H;  4IAL A;  3KF8 A;  2NUC A;  1YVC A;  2RA4 A;  4P2C B;  3J80 c;  1XMO L;  1STN A;  1ENC A;  2KHJ A;  1HR0 Q;  3T56 B;  3K6O A;  4RHR A;  3HOV B;  2KUM A;  2Q8T A;  5KEE A;  2L55 A;  4WFN 3;  2VUM B;  2WFW A;  3CC2 A;  4Q0F A;  2KHI A;  1ENA A;  1K3R A;  1BQQ T;  5IGD A;  5IP9 G;  5C0X I;  3PIO A;  1ICW A;  1VMC A;  1EWH A;  1EY6 A;  3KFU A;  3TBI B;  1A15 A;  3K59 A;  4JV5 L;  1HA6 A;  4RGT A;  1G2S A;  3H0G H;  2ZM6 L;  3AYH B;  3BJU A;  1B3Q A;  3STB D;  5K36 H;  1EIY B;  4P74 A;  4BY1 B;  4XYQ A;  2VB3 X;  1FNV A;  3NSW A;  1IBL Q;  1A2U A;  3A5Z B;  4DXG A;  2A6H C;  1QB5 D;  4DUZ L;  1PYS B;  1A8V A;  1DXM A;  2B2U A;  1E24 A;  1S4Z A;  3DXJ C;  4B3T L;  4OO1 H;  2Q8I B;  3LNN A;  1HNW L;  5JEA H;  4NPS A;  3H3V C;  4LW1 A;  4KHP L;  1CT1 D;  3GTG B;  5GAD C;  3S24 A;  1WJJ A;  1Q8I A;  3L0O A;  3CQZ B;  2JA5 H;  2QKI C;  1IYJ B;  2VB2 X;  1CA5 A;  1STH A;  3R93 A;  1VQK A;  4FP5 D;  2RHQ B;  3DUZ A;  2O5J C;  2WV6 D;  3J7Z C;  1R9T H;  4CKB A;  4QQB X;  4DR4 L;  1Q7Y C;  4DNI A;  3GTO H;  1GM5 A;  1NR2 A;  1E1O A;  1MSH A;  2XN9 C;  3K7A H;  5D3I B;  4PZ6 A;  4BY7 H;  3RN5 A;  3GV3 A;  3RD4 A;  2O2L D;  1RDP D;  2XRQ D;  2Z8L A;  4K6D A;  1Q82 C;  3PCO B;  4RG1 A;  1CQV A;  5C0X G;  2EVB A;  2WKD A;  2BH2 A;  1DD2 A;  1YHQ A;  1EIF A;  3BZC A;  3TN2 A;  3TRE A;  2SDF A;  2Q8R E;  1KRT A;  3QWN A;  5BN5 A;  3EJI A;  4C1N K;  1G2T A;  5HY6 A;  4J1M A;  1KAW A;  1TWA H;  3CCU A;  4NDX A;  1X32 A;  1TS3 A;  1E1T A;  4FO2 A;  4YCU A;  5CV7 A;  2QEX A;  1PTO C;  3PQI A;  2JJQ A;  2QW7 A;  4M8A A;  5FLX c;  4ILW A;  4KJN A;  1QVF A;  1IW7 C;  1NMF A;  1AH9 A;  1I5F A;  2KED A;  4DV4 Q;  1D6E C;  2B2U C;  4DK1 A;  4R8N A;  2EE1 A;  5EJW A;  3W3A A;  1CM9 A;  3BZK A;  2CWA A;  3LWE A;  3NP8 A;  2OF1 A;  3NEM A;  5LMN W;  2AQ1 B;  3M4Y A;  2I46 A;  1UNS A;  1CUK A;  5IYB H;  2A6E C;  3MC0 B;  2E2D C;  3EVQ A;  1TWC H;  2A5H A;  5CV6 A;  4A3I B;  3GO5 A;  3AFP A;  2UXD L;  4KV6 A;  3A8K E;  4V0B A;  4MNO A;  2AWN A;  3AEV A;  3FRP B;  3URY A;  4A4I A;  1V1Q A;  3HOU H;  1IL8 A;  4O2D A;  3GDE A;  3V05 A;  5DM7 3;  5ELF A;  2CKZ B;  2Z6B A;  4ZRZ A;  4NMZ A;  4AYB G;  1EWC A;  3VR5 A;  2ZM6 Q;  4A93 G;  2WAQ B;  1TWH B;  4KKS A;  4N9T A;  4XT3 B;  1Y8N B;  5IT9 E;  1PYB A;  1WD0 A;  1WTQ A;  1QUQ A;  4POF A;  3S17 H;  2OXP A;  2OQK A;  5IP7 G;  1T5E A;  5C4X G;  5FOB B;  1RTN A;  1PA6 A;  4LFB L;  3GP7 A;  4A3B B;  2I07 B;  1SN8 A;  4KK7 A;  5J3B A;  1VQL A;  4B3T Q;  3ONA B;  3W2D A;  3I55 A;  1HNW Q;  1STY A;  3T1H L;  5C5L A;  4KHP Q;  2F4I A;  1N8R C;  4WRD A;  2CW0 C;  1TQO A;  2ZJP A;  1ET9 A;  1SDF A;  4TQU S;  4IJL A;  1Q1B A;  1X54 A;  1CTM A;  3GTQ B;  3WDN A;  3CME A;  4KLK A;  5EKL A;  4IPC A;  1H95 A;  5F2D A;  1OXT A;  1JR0 D;  4JVZ A;  4HIK A;  1N34 L;  4TSS A;  2EY1 A;  1IYU A;  4DR5 L;  5C3W A;  2ZJQ A;  4PG3 A;  3Q6S A;  5C4Z A;  2Z4H A;  4JI0 Q;  1M1K C;  2HT1 A;  1NY4 A;  2WB1 B;  1SYD A;  4G7Z C;  1HNX L;  3HOV G;  4IFD I;  4A3L H;  3RLF A;  1WOC A;  2PZU A;  4L5T A;  2R93 H;  1Q90 A;  1NJI C;  4PV1 C;  1LT5 D;  3RMH A;  4LF9 L;  1D5M C;  3SVM A;  2MUY A;  1SXT A;  5LL6 S;  2O5I C;  4KJO A;  5FLX L;  1G6P A;  4BY1 G;  3NK9 A;  3Q24 A;  1D1K A;  2K01 A;  3KDF B;  4PMW A;  1HXY D;  4X66 L;  2F0U A;  4CDC C;  1KAB A;  2EYM A;  3ITP A;  4KD4 A;  4PZ7 A;  3G7L A;  4EQO A;  2VQF L;  1SAP A;  1YNJ C;  3K5M A;  2YU9 H;  3NE5 B;  1AE3 A;  3NEN A;  4KY5 A;  3WOF A;  3J81 c;  1D7Q A;  4X64 Q;  2F0H A;  4C3I H;  2N49 A;  4KKU A;  3BS1 A;  4DR3 L;  3RZD B;  3I72 A;  1H9K A;  2UXD Q;  1TII D;  5M3F B;  3KF6 A;  4NW2 A;  3NTK A;  2E2I H;  1ASY A;  2K14 A;  3CCV A;  3K5N A;  3J80 i;  3KF8 B;  2NZH A;  4JI3 L;  1U4M A;  4DV3 L;  4AIM A;  4JYA Q;  3QG1 A;  3UDG A;  4NXN L;  4IFD G;  1K8O A;  4ZUI A;  1N32 Q;  4ULL A;  4DR1 L;  4X3S A;  5IGE A;  2E5L L;  1WCM B;  1L1O A;  1FJG L;  2A74 C;  4H0L C;  4B3S L;  3X3M A;  1Z9F A;  2PO4 A;  1WVL A;  1EY8 A;  2E76 C;  4EQN A;  4IQZ A;  3PGZ A;  3N6R A;  4RHS A;  3E3X A;  4CGY B;  1V9P A;  1ROD A;  2OTJ A;  3GD7 A;  2A68 D;  4DUY L;  4LF6 Q;  4LWC A;  4LFA L;  4QCL A;  5COR A;  1PTO B;  1TVX A;  4IJH A;  5LMN L;  1IYV A;  1WFQ A;  4HCS A;  5C44 H;  3VDY A;  3PUW A;  1O7Y A;  1HJP A;  1MGS A;  2QF7 A;  5EBC A;  2BDN A;  3DLL A;  1ZKO A;  4OHJ A;  4HJ7 A;  4JBW A;  4YIJ A;  2IJ0 A;  2K5N A;  4EVO A;  2XIW A;  1HA5 A;  1JB7 A;  3EA6 A;  3E5S A;  1PDQ A;  2KCM A;  2SNM A;  1VMP A;  3DWQ A;  3VYU A;  5JVH 3;  1PH6 A;  1KIX A;  3FMC A;  1L0W A;  3UI2 A;  1IKM A;  2EDG A;  1EY5 A;  4APV A;  5HGQ A;  4RKL A;  4IFD J;  3HKS A;  4RFB A;  1X3G A;  3I90 A;  3SR1 A;  3E6Z X;  2EPB A;  3TP5 A;  1SFO B;  1HNX Q;  5M9O A;  5A35 A;  1O7L A;  1PMR A;  1A2T A;  2K05 A;  3K0Y A;  2NN6 I;  4JPB W;  1ZYR C;  1EL0 A;  1JOQ A;  4LF9 Q;  4XQQ A;  4A3K B;  4OIK A;  2K5H A;  4XQJ A;  1X3Q A;  1J5E L;  4UP9 A;  3GTK H;  2HDM A;  2NVQ H;  3S14 B;  3BDC A;  1YIJ A;  5IYC G;  2WAQ G;  3D4R A;  2BA0 A;  3I3C A;  2R92 H;  3HP3 A;  4JI1 L;  1MKH A;  2X6L A;  1K28 A;  3E0J A;  3TS0 A;  4GOP A;  1PV4 A;  1CA6 A;  2F4V Q;  2I5L X;  1O78 A;  1YHB A;  4A3B G;  1XPU A;  3PO2 H;  2PQA B;  4K8J A;  1G8Z D;  5DAU A;  3J81 L;  4YY3 L;  3PUX A;  2D0O A;  1CHP D;  3AB9 A;  2WIN B;  1Q3L A;  1LT6 D;  3I91 A;  2FJ2 A;  3H3V I;  3V96 A;  3LGJ A;  2F0F A;  4A3M H;  4K0K L;  2MO1 A;  3QO2 A;  4FVM A;  1EZ6 A;  2D5D A;  2ES2 A;  4PZ8 A;  4JI3 Q;  4DV3 Q;  3CCL A;  1VQB A;  2PZT A;  4DU9 A;  1AFP A;  4A75 A;  3U50 C;  1OTC A;  1N33 L;  1OXV A;  4Y7N H;  1V1O A;  1BCP F;  4QUC A;  1N36 Q;  1PZI D;  3I4M H;  4C2M H;  1B2T A;  3GTP H;  4CHT B;  2NN6 G;  2OQ0 A;  5J39 A;  3SHL A;  2J4X A;  3MHB A;  3VA7 A;  3KYH C;  4JI6 L;  2WB1 G;  1L0Y B;  1Y8O B;  4K5X A;  1ZYR D;  1YNN C;  2XWB B;  3HOY G;  3M7G A;  1I3Q H;  2K28 A;  3R2I A;  2R6G A;  4DUY Q;  1TWG H;  1STG A;  3MXG A;  2IX0 A;  1RF2 D;  4LFA Q;  3F2B A;  4RGM A;  3I4N B;  2JYO A;  5LMN Q;  2B2W A;  3CC7 A;  3VA5 A;  1I6H B;  1QUQ B;  2QEJ C;  4TVA B;  4GOP C;  3DEP A;  4BBR H;  3J7A V;  1BBU A;  4A3J H;  2Y0S B;  1HZ9 A;  1B50 A;  3A54 A;  2F0M A;  5M5X B;  1LT4 D;  1EQV A;  3CCS A;  3W1B A;  1VQC A;  1I4H A;  3T51 B;  4H02 A;  2N78 A;  1WTP A;  5CV4 A;  3CKI B;  1NMG A;  1MIU A;  3M7N A;  3HOZ H;  4DK3 C;  1KNE A;  1F2Y A;  1XYI A;  2E2J H;  5M3F G;  1BR9 A;  1SJH D;  1HCZ A;  3EN2 A;  4WJW A;  3NBH B;  4CDF C;  1JQY D;  2YTV A;  1VQ7 A;  5IGF A;  2KOL A;  4IOA A;  2VQE L;  5KNC A;  3MTS A;  4R4O A;  5JPN C;  5JPM C;  1J5E Q;  2L0C A;  3RN2 A;  2ID0 A;  3VR3 A;  1QWY A;  1WCM G;  5IP9 H;  2F0K A;  4LF7 Q;  2KEN A;  4DR7 L;  1SND A;  4BA2 I;  2KCC A;  2IHF A;  4JBK A;  3S1R B;  3S1M H;  2F0V A;  4ZKC B;  3FKI B;  1HNZ L;  4DN4 M;  1DCZ A;  3D31 A;  4QIW E;  1WTR A;  2B2W C;  5LMU L;  2HIV A;  1GUG A;  3WOE A;  2UXB L;  1EY7 A;  4YY3 Q;  1Y14 B;  2H1E A;  2KVM A;  1VQP A;  4J15 A;  4DAV A;  3HGB A;  4C56 C;  1VF7 A;  4ZQ3 A;  1EQT A;  3NBI A;  4KMU C;  3J7A F;  5T1I A;  4K0K Q;  2HHH Q;  2B2Y C;  2K1B A;  3S1N B;  1STE A;  4A3E B;  1JE5 A;  2OCE A;  3DHQ A;  2F03 A;  4K2K A;  2OEO A;  2R3Z A;  4FDB A;  4LK1 C;  3KF6 B;  4TKO B;  2F0D A;  4OEL B;  3AQQ A;  1D5X C;  4JI5 L;  4L8J A;  3V2T A;  5C4J H;  2TMP A;  3J80 E;  2BE5 D;  1UEB A;  2RF4 A;  1TS5 A;  3QJY A;  1JJC B;  2EYJ A;  1JE4 A;  3EFX D;  1K83 H;  4JI6 Q;  1LYL A;  2A69 C;  2AUK A;  4QY7 A;  1X3F A;  3A8J E;  5GQO A;  3T13 A;  2B3G A;  4DV7 L;  1T9H A;  1TR5 A;  2JXM B;  3U4V A;  5C0X H;  1JIC A;  1WI5 A;  4HTH A;  1LTT D;  3H94 A;  3OSO A;  1UE1 A;  1PFN A;  2GVA A;  4OWX B;  3RZO H;  2Q2I A;  2NVX B;  1SR3 A;  4I7A A;  1CI3 M;  3GTM H;  2G9H D;  2EZV A;  1DON A;  2EYF A;  5AFW A;  3K57 A;  5M3M B;  2R7Z B;  4XDX A;  2NZ1 D;  1DM0 B;  3C1E A;  4ME3 A;  2CQO A;  5FK9 C;  4YWK A;  3MXN B;  1I6V C;  1MBY A;  3IFT A;  1TS4 A;  5M5W H;  2E2H H;  1Z7T A;  1PZK D;  2D9U A;  1XNR Q;  4X62 L;  3KLS X;  1GJX A;  3CP0 A;  1VQM A;  3H09 A;  2JA8 B;  2Z1C A;  2OTL A;  2IPK D;  4H7B A;  1PH5 A;  1SLJ A;  1AW7 A;  2WP8 J;  3TZU A;  1VQE A;  1H9M A;  2A19 A;  2IT1 A;  3HKZ E;  2MHV A;  3CF5 A;  1KLU D;  5FJ8 G;  5CBA E;  5M5Y H;  1HZC A;  1SMY D;  2SNS A;  4YCV A;  2KHS A;  4R9W A;  3U58 A;  1CSQ A;  2KEE A;  2LS0 1;  5IIF A;  4OEM B;  1VQI A;  2A69 D;  2AMC B;  3SK5 A;  3A0J A;  2B2V A;  5ELO A;  2TSS A;  1AZQ A;  4N9P A;  2PMZ E;  3SGI A;  4XTC S;  4A93 H;  2X6G A;  3ERS X;  2QCP X;  5LMU Q;  1I4R A;  1E2Z A;  1OO9 B;  4MZ9 A;  3OPO A;  2UXB Q;  3I4N G;  4GOP B;  3CC4 A;  5FLX E;  1RIP A;  1IBM Q;  5IP7 H;  5C4X H;  2B8F A;  3NUC A;  2Y0S G;  4HSP A;  1Y8P B;  4A76 A;  3KBX A;  1X55 A;  4HIO A;  1PLF A;  2QDL A;  1I50 H;  2F0Q A;  4UP7 A;  3X3N A;  4YHH L;  1TWF H;  3J7Y W;  2N8N A;  5A2Q L;  3GTJ B;  4JI5 Q;  1D1I A;  1HZA A;  1HZB A;  1CK1 A;  4KI0 A;  2K5Q A;  1KNA A;  2YTY A;  1JOR A;  3M4P A;  3M4O H;  1LTL A;  1E22 A;  3GQB A;  1QNU A;  4UAI A;  4DR2 L;  3ULL A;  3HEJ A;  2EY6 A;  5JAV A;  3PUY A;  4DK0 A;  3MZ5 A;  3JAM i;  1YJN A;  2R7F A;  1UE6 A;  4GLX A;  2NBF A;  3F8T A;  3HOV H;  1FNW A;  4IUQ A;  3BDO A;  4JI7 Q;  1JOK A;  1IXR A;  2L9H A;  4LJZ C;  2NYZ D;  3F2C A;  2VUM H;  4N8X 1;  3UE0 A;  2NTS A;  1VS0 A;  1AEX A;  3CCM A;  3TSS A;  1OXX K;  1MSG A;  2UXC Q;  4DV2 Q;  2F0E A;  1PRT D;  3FKI G;  2F0L A;  4F8M A;  4L5Q A;  1DYQ A;  3VYR A;  2JSO A;  4BY1 H;  2DJF C;  3DWA A;  3H91 A;  1VQ8 A;  4B3M Q;  3D0F A;  1TU2 B;  4DAM A;  2EXD A;  3KUP A;  2CVR A;  5GAG C;  2LFN A;  1XMO Q;  3HZX A;  1PH1 A;  3CPF A;  3S15 B;  3CPW A;  2K7V A;  3TDQ A;  3ULP A;  1Q8K A;  2PI2 A;  2VY3 A;  2MGS A;  2A73 B;  5EGT A;  1LTR D;  4A3E G;  3GTG H;  4DGZ A;  5JOB A;  3S2D B;  4L5R C;  3OW2 A;  1XNQ L;  3CQZ H;  2LXK A;  4G57 A;  4QGU A;  4JV5 Q;  1LAB A;  2UU9 L;  4DV6 L;  4HED A;  1FD7 D;  1NTG A;  4ZYS A;  4KN4 C;  1U4P A;  5I6Y A;  2D0P A;  1S5C D;  1KQS A;  3M3Y B;  4RGO S;  4CJ2 C;  2G9D A;  4IFD H;  4CBV A;  3VR4 A;  4X65 L;  1BVS A;  3G71 A;  1LAC A;  4DUZ Q;  1HTP A;  4OGQ C;  1XPO A;  3HOW B;  1F9S A;  1F9Q A;  4A3G B;  1PFB A;  1K0R A;  3H6M A;  3A7L A;  4FF4 A;  5EKK A;  1GUN A;  2I5H A;  5BR8 L;  1SMX A;  4OO1 G;  2F0P A;  3CMA A;  1B70 B;  4IPH A;  2DY7 A;  2ALY B;  5M3M G;  4DR4 Q;  2FFK B;  2R7Z G;  4JI8 L;  3MFY A;  1VQO A;  2EQS A;  4KY6 A;  1EYG A;  5J1Z A;  1KDC A;  1QG7 A;  5FLM G;  4IZ8 A;  3LX0 A;  4DR2 Q;  1PRT F;  2L12 A;  2UUA L;  2JA8 G;  1O80 A;  1Y1W B;  1TY0 A;  2F0S A;  3DM1 A;  4IUR A;  5GRO A;  2JE6 I;  3HOY B;  2DUD A;  1CSP A;  1GVP A;  5JJK A;  1QCB D;  4ZLT F;  4A3I H;  4IUP A;  3PO3 B;  1SNP A;  3OWF A;  4LF5 L;  3S16 B;  4K5W A;  2A68 C;  5T1G A;  4YWL A;  4C1N I;  1U4R A;  3WWV A;  2ZXP A;  1FGB D;  1X56 A;  1Y1V B;  4RWS C;  2QA4 A;  3K81 C;  1PH3 A;  1BOS A;  4KHV A;  4B3R L;  4OX9 L;  1HH2 P;  5IYC H;  3BZD B;  1TWH H; 
#chains in the Genus database with same CATH homology
 2NVT B;  2SEB D;  5D14 A;  1ET6 A;  1HUM A;  1BNZ A;  1M8A A;  5CC4 A;  2IX3 A;  2ICE C;  1B3A A;  4HCE A;  2KCN A;  1F77 A;  1V8Q A;  5I9O A;  4BWG B;  1EYA A;  1NR4 A;  1D5Z C;  5CV9 A;  2KJX A;  3TP6 A;  5IOC A;  3HOX B;  3PIP 3;  1E2W A;  1B44 D;  4IUT A;  1JWS D;  3GTL B;  2KEC A;  1KAA A;  4IUV A;  5C5M A;  1GOZ A;  3RUZ A;  4B9X A;  3S1Q B;  3C3L A;  2NVQ B;  1BF4 A;  1D2B A;  3VR2 A;  2NN6 H;  5ELD A;  1PTO F;  2K6A A;  2IW3 A;  1EIH A;  4K5V A;  5C3E B;  1OXU A;  1W6K A;  2N55 A;  3P20 A;  1R4P B;  2R61 A;  1ML0 D;  1BCP D;  1JC7 A;  3D4D A;  1WD1 A;  2E75 C;  1EYD A;  3CHB D;  2LKV A;  3VYT A;  4C3H B;  5DEH A;  1DOM A;  2AQ2 B;  1EY0 A;  2HDL A;  2PQE A;  5DM6 3;  2NTT A;  4RCN A;  2FMC A;  1H9R A;  2F1M A;  2L5T A;  3BYY B;  2LY7 A;  2NVY B;  1SYG A;  1S5B D;  1A3U A;  2B63 B;  5K5P A;  4H13 C;  3I70 A;  2F0T A;  4B9W A;  3JAM E;  1LLR D;  3Q22 A;  1HQR D;  5CR3 A;  1S5F D;  2DY8 A;  1SJE D;  3LWU A;  3NPP A;  1JWM D;  4KN7 C;  1PFM A;  1Q1E A;  1ENF A;  1QIL A;  5D65 A;  3K5O A;  3MWY W;  4A3D B;  2EYP A;  1RKN A;  2H4O A;  1KLG D;  1BXT A;  2PCF B;  2DNE A;  3K5L A;  4BBS B;  4NKL A;  1PTO H;  1X3P A;  1O7Z A;  4XQN A;  5D3D A;  4UDU C;  4DNR B;  5IOD A;  5LL6 X;  3NTH A;  2MPM A;  5KGU A;  3ZYY X;  1LV9 A;  1CFM A;  2K5W A;  2JA7 B;  3P7J A;  3TZD A;  4QIW B;  1HFN A;  5C3X A;  3OMC A;  3S2H B;  2NB0 A;  3VR6 A;  2JA6 B;  1TS2 A;  3Q23 A;  4KKT A;  2JEA I;  1A6X A;  4PMB A;  5EBD A;  1JCK B;  5CV5 A;  3NXW A;  4OIJ A;  1QNK A;  3D6C A;  3TP8 A;  1G91 A;  1H9J A;  1EIG A;  1SBB B;  4HR7 B;  2EY5 A;  3ND8 A;  1WTX A;  1U4L A;  1V43 A;  4LMQ D;  3ND9 A;  4A3F B;  5E4X A;  3OW7 A;  1V1P A;  4G7O C;  2PW7 A;  2BE5 C;  4ID6 A;  1SE2 A;  5CGK A;  3I8Z A;  5KND A;  4CJ1 B;  4BA1 I;  5A2Q E;  3SK4 A;  3NTI A;  1J9O A;  3MXU A;  1XX8 A;  1CZG A;  4KTA A;  1E2V A;  5NUC A;  3DMU A;  2IL8 A;  2BCO A;  4L63 B;  1Q12 A;  2FHT A;  4RA8 A;  4F88 A;  1FR3 A;  1CHQ D;  4F7X A;  3ERQ A;  4OL7 A;  1F2M A;  1R4Q B;  1FYC A;  1MD2 D;  1VF5 C;  1HQM C;  2AUJ D;  1I4P A;  1HHV A;  1LTI D;  1B9M A;  4RGN A;  3QOJ A;  3HKZ B;  4C3J B;  1ILP A;  2RSO A;  4RCO A;  4C3H G;  1I4X A;  4J6H A;  1J8I A;  4U67 3;  1SMY C;  3BYT B;  2BOS A;  5JJZ A;  3KBG A;  4LAA A;  1ESR A;  4IUU A;  3H0G B;  1K8M A;  3MAQ A;  5CBE E;  2RDH A;  5EPJ A;  1DOL A;  3P75 A;  1BDO A;  2RVL A;  2QDB A;  4PNY A;  3A56 A;  2JEB I;  3IAY A;  1Z6H A;  1FNU A;  2O4X A;  2VNU D;  3BVG A;  3PUZ A;  2M2L A;  3SK6 A;  4DFA A;  2NWG A;  2JA5 B;  3OHX C;  4XXE A;  2K33 A;  1A3T A;  4DAP A;  1R9T B;  5ISR A;  5CV8 A;  3ERO A;  3GTO B;  2XSC A;  3NWS A;  3K7A B;  2JP1 A;  4DAY A;  4BY7 B;  3O13 A;  1XTC D;  3OIP A;  4X3U A;  4G4K A;  5EKI A;  1U9R A;  3FEW X;  3U9S A;  3HRZ C;  4EQP A;  5HGT A;  3N52 A;  1F2L A;  4X3K A;  5E4W C;  3C1F A;  1TWA B;  1RHP A;  1RJT A;  3U9O A;  1PRT C;  2PYK A;  4FYD A;  1EZ8 A;  1TKW B;  1E0B A;  4JK1 C;  4QMG A;  4K6L A;  2RSN A;  4GZY C;  5IGG A;  1SNC A;  4IN3 A;  4KY7 A;  2F3W A;  1MI2 A;  1TWC B;  3L7Z C;  3KLS A;  4BS9 A;  1SNM A;  3BDL A;  1SE4 A;  1EEI D;  3HG9 A;  3P1H A;  1S5D D;  4I65 A;  1JB3 A;  1II3 A;  3HOU B;  1XWE A;  3OMG A;  2B2T A;  2E74 C;  1STB A;  4FF1 A;  3KK7 A;  1NSN S;  1DOK A;  3SE0 A;  4K8I A;  2EJM A;  5I9P A;  2M9V A;  2ICI A;  3IL8 A;  1JOO A;  2X69 A;  2F0I A;  4ABN A;  5CMD A;  4ODG A;  2B2V C;  3Q0A A;  4HN7 A;  3NHH A;  2HCC A;  5EPL A;  5G3L F;  5IGC A;  3TME A;  3S17 B;  2F0G A;  3K58 A;  2RBM A;  3T53 B;  1LO5 D;  4FF2 A;  2BDO A;  3SDZ A;  3C2P A;  3IFD A;  4ME5 A;  1NCV A;  4O1N A;  4XYO A;  1LTA D;  1GHK A;  4OO1 I;  3FVQ A;  1G29 1;  3T4A C;  3EQL C;  4HAE A;  2RDF A;  1LTG D;  1HTL D;  3CU7 A;  1WTV A;  2EYL A;  4HSV A;  1HFG A;  3PMF A;  2A6H D;  1QJO A;  1AN8 A;  4C3J G;  1V1P B;  2AWO A;  2MP1 A;  2IWH A;  1GUT A;  2B2T C;  3BG3 A;  2PZW A;  3CRL C;  5E1F A;  1STA A;  2HUG A;  2R93 B;  3J80 L;  4FXD A;  5KRU A;  3R8B A;  5C0X J;  4Q5V A;  1W6J A;  5EPK A;  1LTS D;  1QE6 A;  3OWE B;  4DXF A;  5K36 G;  2EXZ A;  1IHZ A;  2PPB C;  5C6A A;  3PUV A;  2BA1 A;  2XRS D;  2ZXO A;  1ZXT A;  2YU9 B;  4FXK C;  4DF7 A;  4C3I B;  5JEA G;  3PIO 3;  4HMJ A;  2FIN B;  4K14 A;  5CYU A;  5IGB A;  3NQI A;  1EOT A;  3J81 E;  2K5D A;  1PTO D;  1F9R A;  2E2I B;  4FXG C;  1IW7 D;  3DEO A;  2FMM A;  4H44 C;  1EY9 A;  1Y69 U;  4ZK9 B;  1TT2 A;  2D2C C;  1ILQ A;  2OT2 A;  4G7H C;  1H9S A;  1RCV D;  2A6E D;  3NBH A;  5KYL A;  2V4D A;  3G6J B;  4O42 A;  5BN3 A;  3L9A X;  1OXS C;  1BCP C;  2F3V A;  1PRT B;  2CHB D;  1AP0 A;  5C44 B;  2XWJ B;  1VCI A;  3PV0 A;  5JEA J;  1G6Z A;  3QB3 A;  1GHJ A;  3SXH A;  2K32 A;  2DNC A;  1GUO A;  1XXG A;  2EJG C;  1CQF A;  2DN8 A;  1SSO A;  4DA2 A;  4RKB A;  3MVV A;  1DJR D;  4MHE A;  4NP5 A;  4M1U B;  2CW0 D;  2EJF C;  3AU7 A;  5I2Y A;  2EYO A;  1ZEQ X;  2HQE A;  5I6W A;  1SYE A;  5COY A;  3S9W A;  1KDA A;  4QUF A;  3GTK B;  1B9N A;  4XIG S;  2R92 B;  5J22 A;  4WOR A;  4CJ0 B;  1HPC A;  4KD3 A;  4KHZ A;  3L3O C;  2L1B A;  2B39 A;  4QF4 A;  1NAP A;  1HUN A;  2EYH A;  1EFI D;  1JWU D;  3PO2 B;  3FDT A;  2VXW A;  1NUC A;  3T16 A;  3MEH A;  2K03 A;  1SEB D;  1C4Q A;  1ONL A;  4IUN A;  3QOL A;  1EYC A;  2QIL A;  1UEA B;  4A3M B;  1A3V A;  4FF3 A;  1B4O A;  2N88 A;  1LTB D;  1M4V A;  2YYZ A;  3D3R A;  4E6I A;  1I4Q A;  2K04 A;  3MXN A;  2F0W A;  1SYF A;  1SE3 A;  1YNJ D;  4Y7N B;  1GUS A;  5FO8 B;  3I4L A;  3I4M B;  1WTW A;  4C2M B;  3GTP B;  3C46 A;  3D4W A;  4S3S A;  2ENB A;  3IKJ A;  1HRJ A;  4MIU A;  5FKA C;  1I3Q B;  1PZJ D;  3I73 A;  1TWG B;  2RQX A;  2XVS A;  1Z47 A;  5IT9 L;  4DNT B;  1B53 A;  4BBR B;  1PXU A;  1F9P A;  4A3J B;  4XT1 B;  2J7Z A;  1SYC A;  1L0X B;  2IX1 A;  3A8I E;  4Z9C B;  1T5X D;  2ZT9 C;  3OIQ A;  1SNO A;  1UUP A;  3MFG A;  2KA7 A;  2AQ3 B;  4C3I G;  3HOZ B;  3QIA A;  2MJ8 A;  2E2J B;  3BVZ A;  1EU4 A;  5I4D A;  1EEF D;  5KNB A;  4PQX A;  4PMC A;  4ZKB B;  3FPU B;  2M00 A;  5EQ0 A;  4CKC A;  1IKL A;  2PW5 A;  2RDG A;  4U68 A;  1TY2 A;  1UAP A;  3S1M B;  1EY4 A;  1GUW A;  5FO9 B;  1SNQ A;  1BCP B;  1ESF A;  4V19 0;  1F2Z A;  5ELB A;  4RH6 A;  4TRD A;  2GA4 B;  2LMC B;  3VYS A;  2WAC A;  5C4H A;  5TSS A;  1CZW A;  5C4J B;  3NWT A;  1BUV T;  4QB4 A;  5ELE A;  2B2Y A;  3A7A B;  1K83 B;  1PYW D;  4CKE A;  5BN4 A;  1H9S B;  2EOT A;  3R3O A;  2HCI A;  2KQ3 A;  2PNR C;  1I4G A;  4HMI A;  4L6T B;  4ZUJ A;  1VDZ A;  5HUR A;  3R2T A;  3M85 A;  3RZO B;  4J8Q A;  3OOC A;  4I7Z C;  3GTM B;  3AMU A;  4EGV A;  1DZ1 A;  2WII B;  1S5E D;  1BO0 A;  2WKC A;  1YNN D;  3F2U A;  5M5W B;  2E2H B;  2F0J A;  3KLR A;  1WTO A;  4MN3 A;  2EY2 A;  3FPP A;  4FNF A;  2SOB A;  2C9O A;  2L4N A;  1B1Z A;  3SEB A;  5I2X A;  2XNA C;  4ZAI A;  5KYI A;  2CQA A;  2PMZ B;  3GV6 A;  3DWP A;  5KIX A;  1BBX C;  5M5Y B;  1LT3 D;  2D62 A;  2Z4I A;  3BVM A;  2B8G A;  3MA2 B;  1C48 A;  4K2L A;  4AYB B;  3CRK C;  5JVG 3;  1EU3 A;  4A93 B;  3HS0 C;  3TP7 A;  4RAU C;  3JAM L;  4B08 A;  5DNF A;  2J0T D;  5FO7 B;  1C8C A;  1RTO A;  5ELC A;  5C4X B;  1QOH A;  1RD9 D;  1KTK A;  3D8G A;  3SK8 A;  5LHY 1;  1KDB A;  1I50 B;  1GXD C;  1TWF B;  3MXP A;  2C5C A;  5G3L D;  5E3F A;  1AZP A;  4F87 A;  3A55 A;  2L11 A;  2F0O A;  3M4O B;  4R8I A;  3D6W A;  1SYB A;  2ZXR A;  3NQT A;  2F0N A;  4X3T A;  2RKS A;  4IAL A;  3KF8 A;  2NUC A;  2RA4 A;  4P2C B;  1STN A;  1ENC A;  3T56 B;  3K6O A;  4RHR A;  3HOV B;  2KUM A;  2Q8T A;  5KEE A;  2L55 A;  4WFN 3;  2VUM B;  4Q0F A;  1ENA A;  1BQQ T;  5IGD A;  5C0X I;  1ICW A;  1VMC A;  1EWH A;  1EY6 A;  3TBI B;  1A15 A;  3K59 A;  1HA6 A;  4RGT A;  1G2S A;  5K36 H;  4BY1 B;  4XYQ A;  2VB3 X;  1FNV A;  3NSW A;  1A2U A;  4DXG A;  2A6H C;  1QB5 D;  1DXM A;  2B2U A;  1S4Z A;  3DXJ C;  4OO1 H;  2Q8I B;  3LNN A;  5JEA H;  3H3V C;  1CT1 D;  3GTG B;  1Q8I A;  3CQZ B;  2QKI C;  1CA5 A;  2VB2 X;  1STH A;  3R93 A;  4FP5 D;  3DUZ A;  2O5J C;  2WV6 D;  4CKB A;  1NR2 A;  1MSH A;  2XN9 C;  5D3I B;  3GV3 A;  3RD4 A;  2O2L D;  1RDP D;  2XRQ D;  2Z8L A;  4K6D A;  1CQV A;  5C0X G;  2EVB A;  2WKD A;  1DD2 A;  3TN2 A;  2SDF A;  2Q8R E;  3QWN A;  5BN5 A;  3EJI A;  4C1N K;  1G2T A;  4J1M A;  4NDX A;  1X32 A;  1TS3 A;  4FO2 A;  5CV7 A;  1PTO C;  4M8A A;  4ILW A;  4KJN A;  1IW7 C;  2KED A;  1D6E C;  2B2U C;  4DK1 A;  4R8N A;  2EE1 A;  5EJW A;  3W3A A;  1CM9 A;  3LWE A;  3NP8 A;  2OF1 A;  2AQ1 B;  3M4Y A;  2I46 A;  1UNS A;  2A6E C;  3MC0 B;  2E2D C;  3EVQ A;  2A5H A;  5CV6 A;  4A3I B;  3GO5 A;  4KV6 A;  3A8K E;  4V0B A;  2AWN A;  3FRP B;  3URY A;  1IL8 A;  5DM7 3;  3V05 A;  5ELF A;  4ZRZ A;  4NMZ A;  1EWC A;  3VR5 A;  2WAQ B;  1TWH B;  4KKS A;  4N9T A;  4XT3 B;  1Y8N B;  5IT9 E;  1WD0 A;  1WTQ A;  2OXP A;  1T5E A;  5FOB B;  1RTN A;  3GP7 A;  4A3B B;  2I07 B;  4KK7 A;  3ONA B;  3W2D A;  1STY A;  5C5L A;  2F4I A;  4WRD A;  2CW0 C;  1TQO A;  1ET9 A;  1SDF A;  4TQU S;  1Q1B A;  1CTM A;  3GTQ B;  3WDN A;  5EKL A;  5F2D A;  1OXT A;  1JR0 D;  4TSS A;  2EY1 A;  1IYU A;  5C3W A;  3Q6S A;  5C4Z A;  2Z4H A;  2WB1 B;  1SYD A;  4G7Z C;  4IFD I;  3RLF A;  2PZU A;  1Q90 A;  4PV1 C;  1LT5 D;  3RMH A;  1D5M C;  3SVM A;  2MUY A;  1SXT A;  5LL6 S;  2O5I C;  4KJO A;  5FLX L;  3NK9 A;  3Q24 A;  1D1K A;  2K01 A;  4PMW A;  1HXY D;  2F0U A;  1KAB A;  2EYM A;  3ITP A;  4KD4 A;  3G7L A;  4EQO A;  1SAP A;  1YNJ C;  3K5M A;  3NE5 B;  4KY5 A;  3WOF A;  2F0H A;  4KKU A;  3BS1 A;  3RZD B;  3I72 A;  1H9K A;  1TII D;  5M3F B;  4NW2 A;  3NTK A;  3K5N A;  1U4M A;  3QG1 A;  4IFD G;  1K8O A;  4ZUI A;  4ULL A;  4X3S A;  5IGE A;  1WCM B;  2A74 C;  4H0L C;  3X3M A;  2PO4 A;  1WVL A;  1EY8 A;  2E76 C;  4EQN A;  4IQZ A;  3N6R A;  4RHS A;  4CGY B;  1ROD A;  3GD7 A;  2A68 D;  4QCL A;  5COR A;  1PTO B;  1TVX A;  1IYV A;  4HCS A;  3PUW A;  1O7Y A;  1MGS A;  2QF7 A;  5EBC A;  2BDN A;  1ZKO A;  4OHJ A;  4JBW A;  4YIJ A;  2IJ0 A;  4EVO A;  2XIW A;  1HA5 A;  3EA6 A;  3E5S A;  3VYU A;  1PDQ A;  2SNM A;  1VMP A;  3DWQ A;  5JVH 3;  3FMC A;  3UI2 A;  1IKM A;  2EDG A;  1EY5 A;  4RKL A;  4IFD J;  4RFB A;  3I90 A;  3SR1 A;  3E6Z X;  2EPB A;  3TP5 A;  1SFO B;  5M9O A;  5A35 A;  1O7L A;  1PMR A;  1A2T A;  2K05 A;  3K0Y A;  2NN6 I;  1ZYR C;  1EL0 A;  1JOQ A;  4XQQ A;  4A3K B;  4OIK A;  4XQJ A;  1X3Q A;  2HDM A;  3S14 B;  3BDC A;  3D4R A;  2BA0 A;  3I3C A;  3HP3 A;  2X6L A;  3E0J A;  1CA6 A;  1O78 A;  4K8J A;  1G8Z D;  5DAU A;  3J81 L;  3PUX A;  1CHP D;  3AB9 A;  2WIN B;  1Q3L A;  1LT6 D;  3I91 A;  2FJ2 A;  3V96 A;  2F0F A;  3QO2 A;  4FVM A;  1EZ6 A;  2D5D A;  2PZT A;  4DU9 A;  1AFP A;  1OXV A;  1V1O A;  1BCP F;  4QUC A;  1PZI D;  1B2T A;  4CHT B;  2NN6 G;  5J39 A;  3SHL A;  2J4X A;  3MHB A;  3VA7 A;  1L0Y B;  1Y8O B;  4K5X A;  1ZYR D;  1YNN C;  2XWB B;  3M7G A;  2K28 A;  3R2I A;  2R6G A;  1STG A;  3MXG A;  2IX0 A;  1RF2 D;  4RGM A;  3I4N B;  2JYO A;  2B2W A;  3VA5 A;  1I6H B;  2QEJ C;  3DEP A;  3J7A V;  2Y0S B;  1B50 A;  3A54 A;  2F0M A;  5M5X B;  1LT4 D;  1EQV A;  3T51 B;  1I4H A;  1WTP A;  5CV4 A;  3CKI B;  3M7N A;  1KNE A;  1F2Y A;  1XYI A;  1BR9 A;  1SJH D;  1HCZ A;  4WJW A;  1JQY D;  5IGF A;  2KOL A;  5KNC A;  3MTS A;  5JPN C;  5JPM C;  2L0C A;  2ID0 A;  3VR3 A;  1QWY A;  2F0K A;  1SND A;  4BA2 I;  2KCC A;  3S1R B;  2F0V A;  4ZKC B;  3FKI B;  4DN4 M;  1DCZ A;  3D31 A;  1WTR A;  2B2W C;  1GUG A;  3WOE A;  1EY7 A;  2H1E A;  2KVM A;  4DAV A;  3HGB A;  4C56 C;  1VF7 A;  4ZQ3 A;  1EQT A;  3NBI A;  4KMU C;  3J7A F;  5T1I A;  2B2Y C;  2K1B A;  3S1N B;  1STE A;  4A3E B;  3DHQ A;  2F03 A;  4K2K A;  2OEO A;  2R3Z A;  4LK1 C;  4TKO B;  2F0D A;  1D5X C;  4L8J A;  3V2T A;  2TMP A;  3J80 E;  2BE5 D;  1TS5 A;  3QJY A;  2EYJ A;  1JE4 A;  3EFX D;  2A69 C;  2AUK A;  3A8J E;  3T13 A;  5C0X H;  1TR5 A;  2JXM B;  1JIC A;  4HTH A;  1LTT D;  3H94 A;  3OSO A;  1PFN A;  2NVX B;  1CI3 M;  2G9H D;  2EZV A;  1DON A;  2EYF A;  5AFW A;  3K57 A;  5M3M B;  2R7Z B;  4XDX A;  2NZ1 D;  1DM0 B;  3C1E A;  5FK9 C;  1I6V C;  1MBY A;  3IFT A;  1TS4 A;  1Z7T A;  1PZK D;  2D9U A;  3KLS X;  1GJX A;  3H09 A;  2JA8 B;  2Z1C A;  2IPK D;  4H7B A;  1AW7 A;  3TZU A;  2WP8 J;  2IT1 A;  1H9M A;  2MHV A;  1KLU D;  5CBA E;  1SMY D;  2SNS A;  2KHS A;  4R9W A;  2KEE A;  2LS0 1;  5IIF A;  2A69 D;  3SK5 A;  2B2V A;  2TSS A;  1AZQ A;  4N9P A;  4XTC S;  2X6G A;  2QCP X;  1I4R A;  1E2Z A;  1OO9 B;  3OPO A;  5FLX E;  2B8F A;  3NUC A;  4HSP A;  1Y8P B;  3KBX A;  1PLF A;  2F0Q A;  3X3N A;  3J7Y W;  5A2Q L;  3GTJ B;  1D1I A;  1CK1 A;  4KI0 A;  2K5Q A;  1KNA A;  1JOR A;  3GQB A;  1QNU A;  4UAI A;  3HEJ A;  2EY6 A;  5JAV A;  3PUY A;  4DK0 A;  3MZ5 A;  2NBF A;  1FNW A;  4IUQ A;  3BDO A;  1JOK A;  4LJZ C;  2L9H A;  2NYZ D;  2NTS A;  1AEX A;  3TSS A;  1OXX K;  1MSG A;  2F0E A;  1PRT D;  2F0L A;  4F8M A;  1DYQ A;  3VYR A;  2JSO A;  3DWA A;  3H91 A;  1TU2 B;  3KUP A;  2CVR A;  2LFN A;  3HZX A;  3S15 B;  2K7V A;  3TDQ A;  2MGS A;  2A73 B;  5EGT A;  1LTR D;  4DGZ A;  5JOB A;  3S2D B;  4G57 A;  1LAB A;  4HED A;  1FD7 D;  4ZYS A;  4KN4 C;  1U4P A;  5I6Y A;  1S5C D;  3M3Y B;  4RGO S;  4CJ2 C;  2G9D A;  4IFD H;  4CBV A;  3VR4 A;  1LAC A;  1HTP A;  4OGQ C;  3HOW B;  1F9S A;  1F9Q A;  4A3G B;  1PFB A;  3H6M A;  3A7L A;  4FF4 A;  5EKK A;  1GUN A;  4OO1 G;  2F0P A;  2DY7 A;  2FFK B;  3MFY A;  4KY6 A;  5J1Z A;  1KDC A;  1QG7 A;  4IZ8 A;  3LX0 A;  1PRT F;  2L12 A;  1O80 A;  1Y1W B;  1TY0 A;  2F0S A;  3DM1 A;  4IUR A;  2JE6 I;  3HOY B;  1QCB D;  4ZLT F;  4IUP A;  3PO3 B;  1SNP A;  3OWF A;  3S16 B;  4K5W A;  2A68 C;  5T1G A;  4C1N I;  1U4R A;  2ZXP A;  1FGB D;  1Y1V B;  4RWS C;  1BOS A;  4KHV A;  3BZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...