1VMGA

Crystal structure of mazg nucleotide pyrophosphohydrolase (13816655) from sulfolobus solfataricus at 1.46 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
83
structure length
83
Chain Sequence
MDLELKELQSKMKEMYFEKDSQRGIYATFTWLVEEVGELAEALLSNNLDSIQEELADVIAWTVSIANLEGIDIEEALKKKYKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MazG nucleotide pyrophosphohydrolase (13816655) from Sulfolobus solfataricus at 1.46 A resolution
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
molecule keywords Hypothetical protein SSO3215
total genus 32
structure length 83
sequence length 83
ec nomenclature ec 3.6.1.-:
pdb deposition date 2004-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 1vmgA00
2P06A 2Q9LA 1VMGA 1YXBA 3CRCA 4QGPA 2Q73A 2OIEA 5IE9A 2A7WA 2Q4PA 1YVWA 1Y6XA 3CRAA 2GTAA 2OIGA 2YXHA 2A3QA 2Q5ZA 3C90A
chains in the Genus database with same CATH superfamily
4CS3A 4NVPA 3SR2C 3AEIA 4QPKA 1PM9A 1XL4A 2WSSG 3VQVA 4LWSB 5LBQA 1OCRC 2RJZA 1U97A 5EZYB 1FFTB 5IYDO 2PI5A 4FLZA 2CK3G 2UUAB 2A3QA 3JALB 1TA8A 1AJNA 3RYCA 2ODMA 4JTAB 2P4VA 1HWYA 1FPOA 3SJCC 1RFYA 5EBMC 3ZJZA 1R3JC 4I55B 1V55C 3JATB 4UCTA 1Q7YW 2Q5ZA 1UPGA 4NXMB 1H2GA 5JVDB 3B2EE 4GKJO 1Q6UA 4B08A 3KG2A 3K5LA 4NTXA 1CEZA 5BZBA 4ASUG 3CCLV 1ZWIC 3WG7B 3E8FA 5C93A 1F23A 3U0ZA 1GO3F 3JCUZ 4C7UA 5IWAO 2A9HA 2Q9LA 3ZX6A 2JVDA 3SDLA 1EBOA 4MVQA 3JAWB 3AG4B 1QLEC 2QM8A 4P9OA 1AB3A 1YJNV 3BA9A 3CC7V 4O2AB 1YDXA 4QNHB 3JD0A 4WCEV 2OCCB 2QSAA 2X7RB 5J2TB 1ENVA 4UB6Z 3CCSV 3N2KA 4MVOA 4YIPA 5CBFA 4LF4O 2UU9O 5EYPA 1EN5A 4X20B 5LHIA 1EN4A 1HNWB 5FLXN 3E35A 2K1EA 2QM4A 5IYCO 4DR1B 3F5TA 2JDIG 2NR5A 2Q7GA 4MVMA 1AROP 2YIBA 4JI3B 2D2CB 4PI0A 3H1IH 1GN6A 4TQDA 2GUZA 5LP6C 4CH4A 2EULA 2QDOA 1D5NA 5LGUA 4I4TA 1LR1A 2GUZB 2L6LA 4QPJA 4XDLA 1K34A 4LWSA 1IXMA 4JPRA 2A0LA 5J2UB 3KCYA 1T5EA 3A0BZ 1TUEB 3ZHVA 5DM6V 1AR4A 3S3XA 1DTOA 3O9OA 1H2LA 3VQYA 2GTAA 4TOIA 2VRZA 1XMOO 4BAYA 2EIJB 2R72A 4DR3B 2HJDA 1IBLB 3CD6V 4UVAA 1MG1A 2NN4A 2KG7B 2Q68A 1IZ3A 3JD4A 2UXCO 2G38A 3AG2B 2M7WA 3CEIA 3CXHF 2XASA 2FMLA 1KECA 1IBMB 2X6BA 1KUQA 4LF7B 4TSFG 1RSOB 1TVKA 2ZR3A 2EBOA 4LF6B 2DMXA 1FJGB 2YEVA 4X1IB 3L74H 3E22B 5EIBD 2F66C 3Q4HB 1QVFU 4LF8O 3LNMB 2GSMB 2JGDB 4J7JA 2CGOA 2DWDC 3Q4HA 3ZRWA 5IYZB 2CTPA 4NXMO 4PDVA 2YIDA 4JYAB 1G4YB 5LA6A 1K8AW 5L3CA 2VWJA 5CA1B 3AG2C 3MDSA 4PELA 2QWPB 1B06A 3UQ8A 1PP9H 2EIJC 2Q0OC 4IGGA 1QU7A 5IJ0A 1M56B 1VQ7V 1VQOV 4YHHB 3CCVV 2Y69C 3OAAG 3IC9A 5JWPA 1IXBA 4WBNB 2JS5A 1AP5A 3HB3B 3JYCA 1Y6XA 1YI2V 4NR1A 1YITV 2B1GA 4IIJB 3H01A 2IU3A 3T4DA 3ZCCA 4PV1B 3O65A 2BOBC 4JI6B 1VEWA 4FLXA 3T1YO 1I0HA 4DW1A 1N32B 5CN0A 2GTSA 3OEHG 2BTQB 5LXTA 1HNXB 4LFCB 4FZ1A 3ZN0A 1H8EG 4HZ3A 3K57A 3SJQC 4KFMA 1XMQB 1GK9A 2B5UA 1JCHA 1PNMA 1XREA 2BTQA 2KG7A 4OX9B 2P4KA 4GKKB 4ZI7A 1JPXA 4JASA 4R50A 1P7GA 4ZHQA 4IYHA 5FPRA 3CYOA 1Q82W 2CTQA 1TUBA 4KHPO 1OCZC 2LW7A 4LF5O 1GM7A 3QNEA 2QA4V 4OGQB 2EINC 1FYJA 3B40A 5KAIZ 3JAKA 1L1FA 1QLEB 4DUZB 1HNZO 2JEXA 2N05A 5CA0A 2ZDIA 4HNAB 3OUFA 1GN4A 2EILB 4X20A 5GTHZ 2HLDG 5GONA 1JOYA 3I55V 2OYQA 4DR5O 1BCCH 4DW0A 2PTMA 5KMGB 3SPJA 3J80N 2Q7EA 3SYOA 1F4MA 2YIAA 3SPHA 5KLVH 2ZCEA 3FYIB 2UXBB 4CC5A 3OEEG 1XNRB 2H3OA 3ZS8C 1HNXO 3OMNB 3N2GA 4I9WA 3ZIAG 4Z2WA 3D36C 3U10A 4TV8A 1S0VA 2DQ3A 3RYCB 4G27B 4DR6O 1H38A 2KKWA 2QM7A 4X1KA 1K3EA 4DRXA 1K4DC 1M5IA 4LNUB 2H8PC 3VBBA 1KMIZ 3AG7A 2JK5C 1V54C 4Q6GA 4Z1VA 3ZMZA 5BMVA 1SZTA 2OTJV 1ZUQA 2CE4A 2LQTA 3E83A 1I7FA 4FK5C 4PA7A 1IBKB 4BW9A 2B9ZA 2YC0A 3K59A 3CP1A 2Q6AA 3LNNA 3ZRWB 2AZ0A 4R8CA 3B4SA 4X66O 3CE2A 4H0LB 3QO8A 4YIOA 1VQ5V 2JGDA 3K0GA 2ZINA 3B8NA 1AJPA 4OXSA 5IJ9A 5LMNO 3ZRVA 1S77D 4RUEA 1P84F 3THOA 3FFQA 2FKXA 3W7TA 4LBEC 3SYAA 2UUCO 3P3PA 3STLC 5LL6Y 1Q90D 2JGUA 2W6IG 3APQA 2WAMA 3QF7A 1CP9A 1ZLZA 2BSKA 1OZ0A 1MSDA 4B3TO 2R9IA 1ROPA 2DW4A 3X2QB 4WF9V 5KMGA 3OR6C 1N0NA 2IBZH 2RNBA 4B3RB 1Q6HA 1RM1B 2QR4A 2OT5A 3B77A 2XAFA 4BIUA 4JYYA 1M56C 2ZE5A 4JV5O 5B1BB 4LFAB 3ZRSA 4DV1B 4JI0O 1S5LZ 1VF6A 2XAQA 1L0LH 2EJ7A 5LGTA 1XI1A 3OFNG 1QQCA 3E8GA 4TQFA 4JI8B 1Y74A 1E1QG 2X6CA 4FJCC 1X59A 3CCUV 1S76D 4FM2A 5B1BC 2IH3C 1SF9A 3TXQA 1S5JA 3UT5B 5JH7A 4JV5B 2JJ2G 1P4RA 1URFA 5IE9A 1EFRG 1RSOA 4WFHA 1K92A 3WB2A 2PYJA 4K0KB 3ZMVA 1XEQA 4IT5A 1IURA 5KHGA 2MK3A 3UT5A 5JH7B 3HKBB 5CA0B 2WLKA 4GLXA 2YEVB 3RYFB 3CMEV 1N36O 4NXNO 2KSDA 2AGAA 1TVKB 2FYUH 5FL7G 5JQGB 2P5OA 1SQGA 3HKBA 1WP8A 1XNQO 2LJ2A 3K79A 3QVNA 4X65O 2QWQB 2E75B 4ICGA 1DK1A 4LF9B 1JFFA 4J7KA 2R9RB 4YJ2B 4B7KA 4DV5B 5D5PA 1H8HG 1COWG 5CA1A 3K06A 1AR5A 1VQLV 4RO2A 1MOFA 1E79G 5KA6A 1MZEA 3AG1B 5B3SB 3GVMA 1K5QA 4CH5A 2F4VO 2ZE6A 5IY5C 4UXNA 1H2KA 3JALA 3SJAC 1VQKV 4DV6O 5LYJB 4U3JA 2HKOA 1OCOB 2WLIB 3EXAA 1FXKA 2HR3A 4JTCB 4JI5B 5CMUA 1RM1C 5LMUO 1L0NH 2WLIA 3CS5A 2GBOA 3EFFK 1SA0A 1I5XA 4XDKA 3H9VA 3AK2A 1XNQB 4G2KA 3RVZA 2QKCA 2ZM6O 5LP6B 1YTFD 4B7EA 1B3QA 5BY1A 1O9HA 1R3IC 2RCVA 4P30A 3G71V 1PL4A 5B1AB 2DWEC 3ZMSA 4X9QA 3CPWU 1MNGA 1MSWD 5A9GA 2V4DA 1YZBA 1QCEA 5BR8B 1NQTA 2XOKG 2DE0X 2AXTZ 3LUTB 4PI2A 1Y76B 1MA1A 3ZN1A 5DECA 5B5EZ 1IDSA 2DN9A 2WLJA 4AI8A 5H2FZ 5KA5A 2UXDO 2Q4PA 4LFCO 3OUSA 2Y4UA 3ZHRA 3HKCA 1CXZB 1IBMO 3CRRA 2E76B 5BXZA 3FAVB 1XHXA 3WFVA 1SZXA 3FYEB 4IHJB 1WN7A 2GHYA 4DK0A 1Q81W 4EFEA 5DEDA 4OPHA 1K7DA 1ORQC 5JJJB 4O4LB 2Y48A 3CCJV 1XNRO 3T1CA 3RN4A 2Q69A 1PNKA 2KB1A 2DYRB 3N27A 3SPIA 4UV9A 2VQFO 5L3GA 1GN2A 4YY3B 4B3SB 4DV3B 4DV5O 3FKSG 3A0HZ 5H5NA 4DV3O 5J2UA 1XBLA 2PY5A 4GYCB 2UXNA 4P2ZA 5LOVA 4W4KA 3UO2A 2YDEA 1WA8A 3TETA 4X1YB 3RYIB 3K5NA 3B8MA 4U3JB 4I0XA 2IJIA 4JI7B 4BWAA 3K3WA 2Z5UA 2E74B 1AP6A 5HFLA 2AHYA 1GM8A 2ZE8A 1JJ2U 1N36B 1JVMA 2R9AA 4MW3A 1SC5B 4IL6Z 4H33A 5TISZ 5B66Z 1WJZA 4XDJA 4A5UB 1ZL8A 4NTYA 1VF5B 3SPCA 2W6JG 1W0KG 3T2MA 1Z5WA 1M93A 1AILA 3WB1A 5J2TA 1ZX3A 1SQBH 3ZHQA 1FKAO 4O2AA 2CGNA 3KZIZ 2ATKC 1K73W 3ZHSA 1NBMG 3HR0A 4QIWF 3CXCU 1KB9F 1US6A 3GWKC 5KAFZ 5IJ9B 2BSKB 3BA8A 1UJWB 4JI1O 1NU1H 5K1XA 4JI6O 3BPZA 3DC5A 4H44B 3TJTA 1GKFA 4WBNA 2OTLV 1U96A 5IYBO 1XILA 1SQFA 1SRYA 3LSQA 3IGAC 1FAFA 2YI8A 1S5HC 1WB7A 3KKYA 4UVBA 3CC4V 3HKDA 4LF7O 5D5QA 5L3DA 5B1NA 2N74A 4PA9A 2FTKA 4MTXA 3UO3A 3BHPA 3W7UA 1F51A 3M8AA 4DV7O 1QLNA 1XHZA 2Y0PA 4MVRA 4KHPB 2XUMA 4QGPA 3DC6A 3DTUB 3IFXA 2YIBD 2P90A 3W7WA 1SQQH 2C2AA 1HNWO 4Z1MG 5H9CA 4BR6A 3P30A 4MS2A 4EFBA 5L3EA 1NH2D 4DR7O 3CRAA 4RAIA 1H2SB 1ZAUA 4ZHQB 2HJFC 1R6TA 5HFMA 1HR0O 1GM9A 3P3NA 3RYIA 3ETEA 4KL1A 1VARA 4O4JA 5EBWC 4AILC 2LO1A 1VP7A 3ABLC 2QJ1A 3QTCA 1YVWA 2LFRA 1S3JA 4DV1O 3L75H 2WLNA 4KXRA 2JS3A 4UB8Z 2IJKA 1NT2B 4DV6B 5A2QN 4LH6A 3ASNB 4F4LA 4ZIBA 5B1AC 1M57B 3H1JH 3ZMUA 4MSWC 4IHJA 4O4HB 3MHHC 1BZKA 3ABLB 4PA6A 1QHTA 1NH2B 1KU9A 4FPPA 1BQ0A 2JJ1G 1Q86W 1NR1A 2GV9A 1WPXA 3OD4A 1W59A 2VWKA 4F6RB 4K0KO 2IW5A 4LFBO 3CB2A 2HP8A 3G6BA 5JCOA 3APOA 5EZYA 2PGGA 3LDDA 1NTMH 1J5EB 3CJHB 3OR7C 2EZPA 4TV9B 2IH1C 3CMAV 4X1KB 3K04A 3UCSC 4LP8A 1O9GA 2OIGA 1N8RW 1G6UA 1AJQA 4Q20A 1VQ9V 4CBCA 2ZNJA 1K9MW 5KHIA 4X1YA 5JVDA 1OCCB 1RPOA 4X64B 4DRXB 3K5OA 3J7AU 4GKJB 4J9YB 3QO5A 2EIMB 3RGBA 1VQ4V 2YUAA 4JYCA 4JGSA 4I50B 4DV7B 5KHJA 2VQEB 1R6NA 4YJ3B 4CC6A 3G80A 4CS2A 2UU9B 4FZ0A 4L87A 4DR4B 3ASOC 2CAZC 2YXLA 1CPYA 2EILC 3FB8C 3CRMA 1G1XB 1PD3A 2A7WA 1NJIW 1VF6C 1F7YA 1PL0A 2IJHA 3BY6A 4QE9A 1K33A 2DYSB 1Y4MA 1SS3A 3CCMV 1A32A 2F1MA 4BW5A 4MTGA 1H2NA 1NS1A 2DOSA 5B1OA 1JA8A 2EIKB 4KUMA 2F43G 1SETA 2XAJA 1VQ6V 1V55B 3OTFA 4GT1A 2ZXWC 4TT3G 4X62O 1K97A 3AG3C 3HKDB 2WWWA 1P7BA 4GUNA 2QGNA 3JSLA 1FS0G 3RT3C 2QTSA 4J7ZA 3G4SV 2CDYA 1BE3H 2EJRA 2ITDC 1GH6A 5CBHA 1B04A 1N33B 3WB0A 1GTOA 4FIPC 4EKWA 2X6AA 1XL6A 4CZZA 4D6TH 3CSXA 3RYHB 5KHHA 1SQVH 4NXNB 3PJSK 3SYCA 2M6YA 4ZBMA 3SPGA 2OCHA 3ASOB 3LSSA 4I55A 5EC1C 5FNVA 1BMFG 4DR3O 1IBLO 1OCOC 4JI1B 3X2QC 4DO2A 3JASB 4QJFB 4WFAV 1Z2GA 5FNVB 4ZI7B 4WFGA 5KHKA 1AVMA 4ABMA 1N34O 5EIBC 4MTOA 3K08A 3DXRB 3TK1A 1NVPD 4X62B 4P9PA 3JSNA 4DR7B 3BEHA 2DYRC 2Q73A 2PUSA 3D3QA 4U7OA 1FJGO 3ETQA 1KBHA 4TUYB 1NI8A 5E79Z 3ABUA 1NZ6A 4GX5A 4RQEA 1FD9A 4MVUA 5E1AC 4KP4A 4PDMA 4DR4O 3ZRXA 1VQ8V 3WU2Z 3JARA 3TGUH 3ABTA 4CS4A 1XOUA 5EC2C 5CBGA 1Q3EA 4DK1A 4UCOA 3MAQA 1E1RG 4DV0O 1NVPB 1SQPH 4YY3O 2E5LB 3IC7A 4RUFA 1J5EO 4E4EA 5L3FA 4DYLA 2BE3A 3QO7A 4PD4F 2CTWA 4MVZA 3CCRV 1VF7A 1X4TA 3AG4C 5IJ0B 3ABMB 3CJHA 2L35A 2YSUB 4LFBB 1V54B 1FXKB 1GN3A 4TV9A 1IVSA 3L9DA 4OPAA 2XAHA 4DUZO 3VOUA 2VQFB 1K5SA 3VQWA 3OGCC 3C3TA 4BIZA 2LP7A 1JR9A 4MT8A 4GX0A 2XHBA 1P49A 1OV9A 1YJ9V 3E86A 4JF3A 3I5DA 1AR1B 3OM3B 4FM0A 4RQFA 2QWOB 1M4UA 3GB7C 2PYLA 3T1YB 2IJJA 2FB5A 3OE7G 1N33O 3CCEV 1AI7A 4LR3A 2ZR2A 3OMIB 4JYAO 2EIKC 2QEXV 4ZKIA 4MVSA 1XUQA 5F2VO 4ZOLA 1TUBB 2R70A 1BHAA 1QR8A 4DV2B 1S72V 3CC2V 1WNSA 1AI6A 3JASA 5K1PA 1HR0B 5EK0A 4JI2O 4N23A 4HAMA 1W2BU 4U3FH 2XNDG 2GDSA 2AHZA 3FB6C 1YIJV 4BIOA 3HKEA 4LF5B 2XT9A 2DQ0A 4NYKA 4UCVA 2ZIMA 3UM7A 3CWBH 2B1IA 3AG1C 5B3SC 3D8CA 2Z3YA 1K4CC 1YTFB 3QG5A 3JAMN 4O4HA 3OTOB 1ZSPA 4F6RA 5JQGA 4DR5B 1XMOB 5IYZA 1UFIA 2F95B 3JD3A 4JAVA 5JJNB 2WA3A 5CB4B 3A0RA 3FAVA 1N32O 5CB4A 3GWOA 1I5YA 3K9SA 3W7SA 1YSCA 1OHHG 2ZDIC 4UVCA 4GX1A 2ZD9A 5FPOA 3EHBB 4JAUA 1Z5VA 2E5LO 2QWRB 3JD1A 1B6QA 3AK1A 2VS0A 3F7VC 4WFBV 2ZNIA 3ABMC 4I5SA 2E3CA 1VQMV 4FLWA 1YF2A 3H1HH 1N34B 2OCCC 4LNUA 2P22C 3JATA 3D36A 4I9QA 4X64O 2P6JA 4I0XB 5IDJA 3C90A 3T1HO 4JI3O 4R7CA 5H6RA 4YJ3A 2JRIA 3DSQA 4EB6A 4NB5A 1EZJA 2ZM6B 1QVGU 2IU0A 1BSMA 3OT7A 3L71H 3JAWA 1D2DA 4X66B 5KX5B 4K3AA 3E8HA 3SYQA 4X88A 1ZL8B 5LA6B 4B3MB 3W7XA 1HW7A 4PA3A 2BTOA 1FXHA 3OGIB 1NR7A 3L72H 3E89A 1BGYH 1Y76A 4HBNA 1V9PA 1WPBA 2ADPA 3NR7A 2RQ6A 3OMAB 4E2LA 4JZGA 3ICXA 1M9NA 4PJ0Z 3SGIA 5EYPB 1AI5A 3J81N 4J80A 2UXCB 1Y67A 1ZTEA 4HNAA 4FM1A 3FB7C 3ABKB 1PPJH 2HFEC 3E8BA 2D3OW 5ITZA 2FL4A 1HDJA 2JIZG 1VQNV 2PF4E 3PN1A 2QKSA 4I4TB 1R3KC 1I08A 1J95A 4TWKA 4IIJA 5ITZB 3ZBHA 5JJEB 1SQXH 4O2BB 3FB5C 4PDLA 4LFAO 1RP3B 1SA0B 1GAXA 4D7TA 4JI4B 4JI4O 1L8DA 1JJOA 2EINB 1JQ0A 4K8ZA 5JCOC 4I7ZB 4DUYB 4AQYO 1RPRA 2A06H 4PDRA 4JI5O 2IM9A 3ZMTA 4NKGB 1WAZA 4D7SA 1H2MA 2Q0AA 1Y74B 4QE7A 3VQXA 2RDCA 4ZOLB 3ETGA 1HP8A 3AG3B 4J11A 4J42A 1FFXB 1F4NA 4JAAA 3ASNC 1KP2A 4NTWA 3LSUA 4WFEA 3I56V 4GZRB 3HKEB 4UCRA 5LHGA 3EVKA 2LGQA 3ABKC 4B3SO 3U11A 2ILMA 3JARB 4OX9O 4GX2A 4FLYA 4DR6B 2VQEO 3A8TA 1PKXA 2ADQB 5GONB 4FFBB 3RYFA 2Q67A 3RBZA 2LGWA 4YJ2A 5CA3A 1LUWA 3OW2U 2OWOA 4X89A 4H13B 1EN6A 3D3IA 3BRCA 3K5MA 1HNZB 3LDCA 3P32A 2Y0IA 1KC8W 1VIBA 3K58A 1BL8A 5H6QA 3T1HB 2W0XA 4N21A 2EZOA 3L70H 2CH7A 2Q7HA 4FMTA 2P06A 2WPDG 3BVOA 3M99B 2OIEA 2CH7B 4W4LA 5IWAB 1DGSA 3H1LH 2XTAA 1VQPV 2UXBO 2X0LA 1KD1W 4JI7O 1OCCC 3ML0A 1IX9A 1Q6IA 2HHHB 2EX3A 1EM1A 2P7TC 2HEPA 3JCZA 5KUMA 2ZQMA 3IJ4A 5BMVB 4DXWA 2PZSA 4B3RO 3CCQV 3UKMA 4UV8A 5LP6A 4I50A 3CRCA 4DV4B 3BAAA 4DV4O 2YI9A 1GRJA 1KP3A 4J10A 4LH7A 1GMGA 3MHSC 2YXHA 5L3BA 4L8JA 1JX9A 3NXSA 4WFFA 2QE7G 1I94O 1FXKC 3K0DA 2N04A 2WLMA 4K35A 1QNMA 1BS3A 2WA4A 1N4CA 2ZT9B 1WLEA 3KCXA 2QTOA 4RWUA 4YXWG 4GCZA 3M7MX 1EZVH 3BABA 2ZXWB 3RFRA 2ZKOA 4DR2O 4CH3A 4JI0B 1KKCA 2DJVA 2PI4A 1YCIA 3R65A 5GTIZ 2YXYA 5GW7A 1W0JG 1R6KA 4CH6A 2UUBO 3E2EA 4XBFA 2CTRA 1I94B 4UCUA 4IYIA 4O4LA 4H37A 1JMKC 5BR8O 2ZIOA 1R3LC 1Q5OA 1NTKH 4O4IA 1KQSU 4GKKO 2WLLB 1M57C 1NTZH 2QWNB 2RN9A 4YHHO 1MMMA 4DR2B 2ETNA 3B09A 1SESA 2HVJC 4JTDB 2EIMC 4MTFA 1N0JA 5LOVB 4FVMA 2ITCC 1R73A 1M1KW 3K03A 1WP7A 4R6ZA 4TV8B 3MD0A 5LMNB 4LC1A 1BQZA 4FLVA 2Q8VA 2WLHA 3RYHA 2A79B 1XQ8A 1D5AA 3H1KH 1DF5A 2RMKB 3BCCH 3DXRA 3RW0A 3BFRA 1AI4A 3F7YC 5DN6G 3SJBC 3F5WC 4J9ZB 2QKAA 4AQYB 1LUVA 2K9PA 3S3WA 4B3TB 1PV0A 1WA8B 3G67A 2F23A 3C3SA 3T4ZA 4G28B 4LF6O 3AK3A 2BCCH 2V1DA 4JI8O 5EBLC 3E22A 1WB8A 4DV2O 1SERA 4MW8A 4FLUA 5KX5A 4FLTA 3JD2A 4JZ2A 3TXSA 2ARHA 2Z0AA 1THZA 2BOCC 1KKDA 4EB6B 5LGNA 4X65B 2Y4TA 1VMGA 1G8MA 1Y66A 5C8YA 2JEUA 3CHXA 4FFBA 4J41A 1XDCA 2O57A 5C8YB 1M90W 1FXVA 2Y69B 1TGOA 3L73H 1YXBA 2YICA 3DGEA 1Q8IA 2UXXA 1PNLA 1DLBA 5IY5B 1JFFB 3N2KB 4HYOA 3ZHUA 3IAYA 1IBKO 3FX7A 2H94A 3HKCB 4UFZA 5AG2A 2ZE7A 3SYPA 1LNQA 3R66A 4LCUC 2P67A 4U7NA 4LF9O 1YJWV 2UUBB 1MABG 1TAEA 5LYJA 2WLLA 4UCSA 1MZFA 1YHQV 4JI2B 1QBZA 1OJHA 3TCUA 4FFKA 3STZC 2DYSC 3ZEDA 2UUCB 3WG7C 3G6EV 3CRQA 2LFSA 4O2BA 2XAGA 3K9AA 2F93B 4EEQA 2YS8A 2HVKC 5LXTB 1Q43A 2AZ2A 3FD9A 5IT9N 3A2FA 4O4JB 4DR1O 4DV0B 3HPLC 2MW2B 3ETDA 5J9PC 3OTOO 1DF4A 2NLJC 1YEWA 2NNUA 1BT8A 1QR9A 4LF4B 3ZHTA 1BHBA 3JAKB 1OCRB 1R1BA 4PA4A 3LDEA 2AW9A 2CUGA 1FFXA 4X1IA 2HHHO 1NKDA 1SKVA 3RVYA 5LHHA 4B3MO 4DUYO 5KUKA 4K8XA 1XMQO 5LMUB 4JYBA 2LW1A 4TUYA 2UUAO 2KQXA 2V7QG 2HG5C 4UUJC 1KYOF 4AHCA 2W0FC 4LF8B 3RWRD 3CX5F 4X8AA 2F4VB 2UXDB 4O4IB 3N2GB 4PHZA 1OCZB 4F6EA
chains in the Genus database with same CATH topology
2P06A 2Q9LA 1VMGA 1YXBA 3CRCA 4QGPA 2Q73A 2OIEA 5IE9A 2A7WA 2Q4PA 1YVWA 1Y6XA 3CRAA 2GTAA 2OIGA 2YXHA 2A3QA 2Q5ZA 3C90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P06 A;  2Q9L A;  1VMG A;  1YXB A;  3CRC A;  4QGP A;  2Q73 A;  2OIE A;  5IE9 A;  2A7W A;  2Q4P A;  1YVW A;  1Y6X A;  3CRA A;  2GTA A;  2OIG A;  2YXH A;  2A3Q A;  2Q5Z A;  3C90 A; 
#chains in the Genus database with same CATH topology
 4CS3 A;  4NVP A;  3SR2 C;  3AEI A;  4QPK A;  1PM9 A;  1XL4 A;  2WSS G;  3VQV A;  4LWS B;  5LBQ A;  1OCR C;  2RJZ A;  1U97 A;  5EZY B;  1FFT B;  5IYD O;  2PI5 A;  4FLZ A;  2CK3 G;  2UUA B;  2A3Q A;  3JAL B;  1TA8 A;  1AJN A;  3RYC A;  2ODM A;  4JTA B;  2P4V A;  1HWY A;  1FPO A;  3SJC C;  1RFY A;  5EBM C;  3ZJZ A;  1R3J C;  4I55 B;  1V55 C;  3JAT B;  4UCT A;  1Q7Y W;  2Q5Z A;  1UPG A;  4NXM B;  1H2G A;  5JVD B;  3B2E E;  4GKJ O;  1Q6U A;  4B08 A;  3KG2 A;  3K5L A;  4NTX A;  1CEZ A;  5BZB A;  4ASU G;  3CCL V;  1ZWI C;  3WG7 B;  3E8F A;  5C93 A;  1F23 A;  3U0Z A;  1GO3 F;  3JCU Z;  4C7U A;  5IWA O;  2A9H A;  2Q9L A;  3ZX6 A;  2JVD A;  3SDL A;  1EBO A;  4MVQ A;  3JAW B;  3AG4 B;  1QLE C;  2QM8 A;  4P9O A;  1AB3 A;  1YJN V;  3BA9 A;  3CC7 V;  4O2A B;  1YDX A;  4QNH B;  3JD0 A;  4WCE V;  2OCC B;  2QSA A;  2X7R B;  5J2T B;  1ENV A;  4UB6 Z;  3CCS V;  3N2K A;  4MVO A;  4YIP A;  5CBF A;  4LF4 O;  2UU9 O;  5EYP A;  1EN5 A;  4X20 B;  5LHI A;  1EN4 A;  1HNW B;  5FLX N;  3E35 A;  2K1E A;  2QM4 A;  5IYC O;  4DR1 B;  3F5T A;  2JDI G;  2NR5 A;  2Q7G A;  4MVM A;  1ARO P;  2YIB A;  4JI3 B;  2D2C B;  4PI0 A;  3H1I H;  1GN6 A;  4TQD A;  2GUZ A;  5LP6 C;  4CH4 A;  2EUL A;  2QDO A;  1D5N A;  5LGU A;  4I4T A;  1LR1 A;  2GUZ B;  2L6L A;  4QPJ A;  4XDL A;  1K34 A;  4LWS A;  1IXM A;  4JPR A;  2A0L A;  5J2U B;  3KCY A;  1T5E A;  3A0B Z;  1TUE B;  3ZHV A;  5DM6 V;  1AR4 A;  3S3X A;  1DTO A;  3O9O A;  1H2L A;  3VQY A;  2GTA A;  4TOI A;  2VRZ A;  1XMO O;  4BAY A;  2EIJ B;  2R72 A;  4DR3 B;  2HJD A;  1IBL B;  3CD6 V;  4UVA A;  1MG1 A;  2NN4 A;  2KG7 B;  2Q68 A;  1IZ3 A;  3JD4 A;  2UXC O;  2G38 A;  3AG2 B;  2M7W A;  3CEI A;  3CXH F;  2XAS A;  2FML A;  1KEC A;  1IBM B;  2X6B A;  1KUQ A;  4LF7 B;  4TSF G;  1RSO B;  1TVK A;  2ZR3 A;  2EBO A;  4LF6 B;  2DMX A;  1FJG B;  2YEV A;  4X1I B;  3L74 H;  3E22 B;  5EIB D;  2F66 C;  3Q4H B;  1QVF U;  4LF8 O;  3LNM B;  2GSM B;  2JGD B;  4J7J A;  2CGO A;  2DWD C;  3Q4H A;  3ZRW A;  5IYZ B;  2CTP A;  4NXM O;  4PDV A;  2YID A;  4JYA B;  1G4Y B;  5LA6 A;  1K8A W;  5L3C A;  2VWJ A;  5CA1 B;  3AG2 C;  3MDS A;  4PEL A;  2QWP B;  1B06 A;  3UQ8 A;  1PP9 H;  2EIJ C;  2Q0O C;  4IGG A;  1QU7 A;  5IJ0 A;  1M56 B;  1VQ7 V;  1VQO V;  4YHH B;  3CCV V;  2Y69 C;  3OAA G;  3IC9 A;  5JWP A;  1IXB A;  4WBN B;  2JS5 A;  1AP5 A;  3HB3 B;  3JYC A;  1Y6X A;  1YI2 V;  4NR1 A;  1YIT V;  2B1G A;  4IIJ B;  3H01 A;  2IU3 A;  3T4D A;  3ZCC A;  4PV1 B;  3O65 A;  2BOB C;  4JI6 B;  1VEW A;  4FLX A;  3T1Y O;  1I0H A;  4DW1 A;  1N32 B;  5CN0 A;  2GTS A;  3OEH G;  2BTQ B;  5LXT A;  1HNX B;  4LFC B;  4FZ1 A;  3ZN0 A;  1H8E G;  4HZ3 A;  3K57 A;  3SJQ C;  4KFM A;  1XMQ B;  1GK9 A;  2B5U A;  1JCH A;  1PNM A;  1XRE A;  2BTQ A;  2KG7 A;  4OX9 B;  2P4K A;  4GKK B;  4ZI7 A;  1JPX A;  4JAS A;  4R50 A;  1P7G A;  4ZHQ A;  4IYH A;  5FPR A;  3CYO A;  1Q82 W;  2CTQ A;  1TUB A;  4KHP O;  1OCZ C;  2LW7 A;  4LF5 O;  1GM7 A;  3QNE A;  2QA4 V;  4OGQ B;  2EIN C;  1FYJ A;  3B40 A;  5KAI Z;  3JAK A;  1L1F A;  1QLE B;  4DUZ B;  1HNZ O;  2JEX A;  2N05 A;  5CA0 A;  2ZDI A;  4HNA B;  3OUF A;  1GN4 A;  2EIL B;  4X20 A;  5GTH Z;  2HLD G;  5GON A;  1JOY A;  3I55 V;  2OYQ A;  4DR5 O;  1BCC H;  4DW0 A;  2PTM A;  5KMG B;  3SPJ A;  3J80 N;  2Q7E A;  3SYO A;  1F4M A;  2YIA A;  3SPH A;  5KLV H;  2ZCE A;  3FYI B;  2UXB B;  4CC5 A;  3OEE G;  1XNR B;  2H3O A;  3ZS8 C;  1HNX O;  3OMN B;  3N2G A;  4I9W A;  3ZIA G;  4Z2W A;  3D36 C;  3U10 A;  4TV8 A;  1S0V A;  2DQ3 A;  3RYC B;  4G27 B;  4DR6 O;  1H38 A;  2KKW A;  2QM7 A;  4X1K A;  1K3E A;  4DRX A;  1K4D C;  1M5I A;  4LNU B;  2H8P C;  3VBB A;  1KMI Z;  3AG7 A;  2JK5 C;  1V54 C;  4Q6G A;  4Z1V A;  3ZMZ A;  5BMV A;  1SZT A;  2OTJ V;  1ZUQ A;  2CE4 A;  2LQT A;  3E83 A;  1I7F A;  4FK5 C;  4PA7 A;  1IBK B;  4BW9 A;  2B9Z A;  2YC0 A;  3K59 A;  3CP1 A;  2Q6A A;  3LNN A;  3ZRW B;  2AZ0 A;  4R8C A;  3B4S A;  4X66 O;  3CE2 A;  4H0L B;  3QO8 A;  4YIO A;  1VQ5 V;  2JGD A;  3K0G A;  2ZIN A;  3B8N A;  1AJP A;  4OXS A;  5IJ9 A;  5LMN O;  3ZRV A;  1S77 D;  4RUE A;  1P84 F;  3THO A;  3FFQ A;  2FKX A;  3W7T A;  4LBE C;  3SYA A;  2UUC O;  3P3P A;  3STL C;  5LL6 Y;  1Q90 D;  2JGU A;  2W6I G;  3APQ A;  2WAM A;  3QF7 A;  1CP9 A;  1ZLZ A;  2BSK A;  1OZ0 A;  1MSD A;  4B3T O;  2R9I A;  1ROP A;  2DW4 A;  3X2Q B;  4WF9 V;  5KMG A;  3OR6 C;  1N0N A;  2IBZ H;  2RNB A;  4B3R B;  1Q6H A;  1RM1 B;  2QR4 A;  2OT5 A;  3B77 A;  2XAF A;  4BIU A;  4JYY A;  1M56 C;  2ZE5 A;  4JV5 O;  5B1B B;  4LFA B;  3ZRS A;  4DV1 B;  4JI0 O;  1S5L Z;  1VF6 A;  2XAQ A;  1L0L H;  2EJ7 A;  5LGT A;  1XI1 A;  3OFN G;  1QQC A;  3E8G A;  4TQF A;  4JI8 B;  1Y74 A;  1E1Q G;  2X6C A;  4FJC C;  1X59 A;  3CCU V;  1S76 D;  4FM2 A;  5B1B C;  2IH3 C;  1SF9 A;  3TXQ A;  1S5J A;  3UT5 B;  5JH7 A;  4JV5 B;  2JJ2 G;  1P4R A;  1URF A;  5IE9 A;  1EFR G;  1RSO A;  4WFH A;  1K92 A;  3WB2 A;  2PYJ A;  4K0K B;  3ZMV A;  1XEQ A;  4IT5 A;  1IUR A;  5KHG A;  2MK3 A;  3UT5 A;  5JH7 B;  3HKB B;  5CA0 B;  2WLK A;  4GLX A;  2YEV B;  3RYF B;  3CME V;  1N36 O;  4NXN O;  2KSD A;  2AGA A;  1TVK B;  2FYU H;  5FL7 G;  5JQG B;  2P5O A;  1SQG A;  3HKB A;  1WP8 A;  1XNQ O;  2LJ2 A;  3K79 A;  3QVN A;  4X65 O;  2QWQ B;  2E75 B;  4ICG A;  1DK1 A;  4LF9 B;  1JFF A;  4J7K A;  2R9R B;  4YJ2 B;  4B7K A;  4DV5 B;  5D5P A;  1H8H G;  1COW G;  5CA1 A;  3K06 A;  1AR5 A;  1VQL V;  4RO2 A;  1MOF A;  1E79 G;  5KA6 A;  1MZE A;  3AG1 B;  5B3S B;  3GVM A;  1K5Q A;  4CH5 A;  2F4V O;  2ZE6 A;  5IY5 C;  4UXN A;  1H2K A;  3JAL A;  3SJA C;  1VQK V;  4DV6 O;  5LYJ B;  4U3J A;  2HKO A;  1OCO B;  2WLI B;  3EXA A;  1FXK A;  2HR3 A;  4JTC B;  4JI5 B;  5CMU A;  1RM1 C;  5LMU O;  1L0N H;  2WLI A;  3CS5 A;  2GBO A;  3EFF K;  1SA0 A;  1I5X A;  4XDK A;  3H9V A;  3AK2 A;  1XNQ B;  4G2K A;  3RVZ A;  2QKC A;  2ZM6 O;  5LP6 B;  1YTF D;  4B7E A;  1B3Q A;  5BY1 A;  1O9H A;  1R3I C;  2RCV A;  4P30 A;  3G71 V;  1PL4 A;  5B1A B;  2DWE C;  3ZMS A;  4X9Q A;  3CPW U;  1MNG A;  1MSW D;  5A9G A;  2V4D A;  1YZB A;  1QCE A;  5BR8 B;  1NQT A;  2XOK G;  2DE0 X;  2AXT Z;  3LUT B;  4PI2 A;  1Y76 B;  1MA1 A;  3ZN1 A;  5DEC A;  5B5E Z;  1IDS A;  2DN9 A;  2WLJ A;  4AI8 A;  5H2F Z;  5KA5 A;  2UXD O;  2Q4P A;  4LFC O;  3OUS A;  2Y4U A;  3ZHR A;  3HKC A;  1CXZ B;  1IBM O;  3CRR A;  2E76 B;  5BXZ A;  3FAV B;  1XHX A;  3WFV A;  1SZX A;  3FYE B;  4IHJ B;  1WN7 A;  2GHY A;  4DK0 A;  1Q81 W;  4EFE A;  5DED A;  4OPH A;  1K7D A;  1ORQ C;  5JJJ B;  4O4L B;  2Y48 A;  3CCJ V;  1XNR O;  3T1C A;  3RN4 A;  2Q69 A;  1PNK A;  2KB1 A;  2DYR B;  3N27 A;  3SPI A;  4UV9 A;  2VQF O;  5L3G A;  1GN2 A;  4YY3 B;  4B3S B;  4DV3 B;  4DV5 O;  3FKS G;  3A0H Z;  5H5N A;  4DV3 O;  5J2U A;  1XBL A;  2PY5 A;  4GYC B;  2UXN A;  4P2Z A;  5LOV A;  4W4K A;  3UO2 A;  2YDE A;  1WA8 A;  3TET A;  4X1Y B;  3RYI B;  3K5N A;  3B8M A;  4U3J B;  4I0X A;  2IJI A;  4JI7 B;  4BWA A;  3K3W A;  2Z5U A;  2E74 B;  1AP6 A;  5HFL A;  2AHY A;  1GM8 A;  2ZE8 A;  1JJ2 U;  1N36 B;  1JVM A;  2R9A A;  4MW3 A;  1SC5 B;  4IL6 Z;  4H33 A;  5TIS Z;  5B66 Z;  1WJZ A;  4XDJ A;  4A5U B;  1ZL8 A;  4NTY A;  1VF5 B;  3SPC A;  2W6J G;  1W0K G;  3T2M A;  1Z5W A;  1M93 A;  1AIL A;  3WB1 A;  5J2T A;  1ZX3 A;  1SQB H;  3ZHQ A;  1FKA O;  4O2A A;  2CGN A;  3KZI Z;  2ATK C;  1K73 W;  3ZHS A;  1NBM G;  3HR0 A;  4QIW F;  3CXC U;  1KB9 F;  1US6 A;  3GWK C;  5KAF Z;  5IJ9 B;  2BSK B;  3BA8 A;  1UJW B;  4JI1 O;  1NU1 H;  5K1X A;  4JI6 O;  3BPZ A;  3DC5 A;  4H44 B;  3TJT A;  1GKF A;  4WBN A;  2OTL V;  1U96 A;  5IYB O;  1XIL A;  1SQF A;  1SRY A;  3LSQ A;  3IGA C;  1FAF A;  2YI8 A;  1S5H C;  1WB7 A;  3KKY A;  4UVB A;  3CC4 V;  3HKD A;  4LF7 O;  5D5Q A;  5L3D A;  5B1N A;  2N74 A;  4PA9 A;  2FTK A;  4MTX A;  3UO3 A;  3BHP A;  3W7U A;  1F51 A;  3M8A A;  4DV7 O;  1QLN A;  1XHZ A;  2Y0P A;  4MVR A;  4KHP B;  2XUM A;  4QGP A;  3DC6 A;  3DTU B;  3IFX A;  2YIB D;  2P90 A;  3W7W A;  1SQQ H;  2C2A A;  1HNW O;  4Z1M G;  5H9C A;  4BR6 A;  3P30 A;  4MS2 A;  4EFB A;  5L3E A;  1NH2 D;  4DR7 O;  3CRA A;  4RAI A;  1H2S B;  1ZAU A;  4ZHQ B;  2HJF C;  1R6T A;  5HFM A;  1HR0 O;  1GM9 A;  3P3N A;  3RYI A;  3ETE A;  4KL1 A;  1VAR A;  4O4J A;  5EBW C;  4AIL C;  2LO1 A;  1VP7 A;  3ABL C;  2QJ1 A;  3QTC A;  1YVW A;  2LFR A;  1S3J A;  4DV1 O;  3L75 H;  2WLN A;  4KXR A;  2JS3 A;  4UB8 Z;  2IJK A;  1NT2 B;  4DV6 B;  5A2Q N;  4LH6 A;  3ASN B;  4F4L A;  4ZIB A;  5B1A C;  1M57 B;  3H1J H;  3ZMU A;  4MSW C;  4IHJ A;  4O4H B;  3MHH C;  1BZK A;  3ABL B;  4PA6 A;  1QHT A;  1NH2 B;  1KU9 A;  4FPP A;  1BQ0 A;  2JJ1 G;  1Q86 W;  1NR1 A;  2GV9 A;  1WPX A;  3OD4 A;  1W59 A;  2VWK A;  4F6R B;  4K0K O;  2IW5 A;  4LFB O;  3CB2 A;  2HP8 A;  3G6B A;  5JCO A;  3APO A;  5EZY A;  2PGG A;  3LDD A;  1NTM H;  1J5E B;  3CJH B;  3OR7 C;  2EZP A;  4TV9 B;  2IH1 C;  3CMA V;  4X1K B;  3K04 A;  3UCS C;  4LP8 A;  1O9G A;  2OIG A;  1N8R W;  1G6U A;  1AJQ A;  4Q20 A;  1VQ9 V;  4CBC A;  2ZNJ A;  1K9M W;  5KHI A;  4X1Y A;  5JVD A;  1OCC B;  1RPO A;  4X64 B;  4DRX B;  3K5O A;  3J7A U;  4GKJ B;  4J9Y B;  3QO5 A;  2EIM B;  3RGB A;  1VQ4 V;  2YUA A;  4JYC A;  4JGS A;  4I50 B;  4DV7 B;  5KHJ A;  2VQE B;  1R6N A;  4YJ3 B;  4CC6 A;  3G80 A;  4CS2 A;  2UU9 B;  4FZ0 A;  4L87 A;  4DR4 B;  3ASO C;  2CAZ C;  2YXL A;  1CPY A;  2EIL C;  3FB8 C;  3CRM A;  1G1X B;  1PD3 A;  2A7W A;  1NJI W;  1VF6 C;  1F7Y A;  1PL0 A;  2IJH A;  3BY6 A;  4QE9 A;  1K33 A;  2DYS B;  1Y4M A;  1SS3 A;  3CCM V;  1A32 A;  2F1M A;  4BW5 A;  4MTG A;  1H2N A;  1NS1 A;  2DOS A;  5B1O A;  1JA8 A;  2EIK B;  4KUM A;  2F43 G;  1SET A;  2XAJ A;  1VQ6 V;  1V55 B;  3OTF A;  4GT1 A;  2ZXW C;  4TT3 G;  4X62 O;  1K97 A;  3AG3 C;  3HKD B;  2WWW A;  1P7B A;  4GUN A;  2QGN A;  3JSL A;  1FS0 G;  3RT3 C;  2QTS A;  4J7Z A;  3G4S V;  2CDY A;  1BE3 H;  2EJR A;  2ITD C;  1GH6 A;  5CBH A;  1B04 A;  1N33 B;  3WB0 A;  1GTO A;  4FIP C;  4EKW A;  2X6A A;  1XL6 A;  4CZZ A;  4D6T H;  3CSX A;  3RYH B;  5KHH A;  1SQV H;  4NXN B;  3PJS K;  3SYC A;  2M6Y A;  4ZBM A;  3SPG A;  2OCH A;  3ASO B;  3LSS A;  4I55 A;  5EC1 C;  5FNV A;  1BMF G;  4DR3 O;  1IBL O;  1OCO C;  4JI1 B;  3X2Q C;  4DO2 A;  3JAS B;  4QJF B;  4WFA V;  1Z2G A;  5FNV B;  4ZI7 B;  4WFG A;  5KHK A;  1AVM A;  4ABM A;  1N34 O;  5EIB C;  4MTO A;  3K08 A;  3DXR B;  3TK1 A;  1NVP D;  4X62 B;  4P9P A;  3JSN A;  4DR7 B;  3BEH A;  2DYR C;  2Q73 A;  2PUS A;  3D3Q A;  4U7O A;  1FJG O;  3ETQ A;  1KBH A;  4TUY B;  1NI8 A;  5E79 Z;  3ABU A;  1NZ6 A;  4GX5 A;  4RQE A;  1FD9 A;  4MVU A;  5E1A C;  4KP4 A;  4PDM A;  4DR4 O;  3ZRX A;  1VQ8 V;  3WU2 Z;  3JAR A;  3TGU H;  3ABT A;  4CS4 A;  1XOU A;  5EC2 C;  5CBG A;  1Q3E A;  4DK1 A;  4UCO A;  3MAQ A;  1E1R G;  4DV0 O;  1NVP B;  1SQP H;  4YY3 O;  2E5L B;  3IC7 A;  4RUF A;  1J5E O;  4E4E A;  5L3F A;  4DYL A;  2BE3 A;  3QO7 A;  4PD4 F;  2CTW A;  4MVZ A;  3CCR V;  1VF7 A;  1X4T A;  3AG4 C;  5IJ0 B;  3ABM B;  3CJH A;  2L35 A;  2YSU B;  4LFB B;  1V54 B;  1FXK B;  1GN3 A;  4TV9 A;  1IVS A;  3L9D A;  4OPA A;  2XAH A;  4DUZ O;  3VOU A;  2VQF B;  1K5S A;  3VQW A;  3OGC C;  3C3T A;  4BIZ A;  2LP7 A;  1JR9 A;  4MT8 A;  4GX0 A;  2XHB A;  1P49 A;  1OV9 A;  1YJ9 V;  3E86 A;  4JF3 A;  3I5D A;  1AR1 B;  3OM3 B;  4FM0 A;  4RQF A;  2QWO B;  1M4U A;  3GB7 C;  2PYL A;  3T1Y B;  2IJJ A;  2FB5 A;  3OE7 G;  1N33 O;  3CCE V;  1AI7 A;  4LR3 A;  2ZR2 A;  3OMI B;  4JYA O;  2EIK C;  2QEX V;  4ZKI A;  4MVS A;  1XUQ A;  5F2V O;  4ZOL A;  1TUB B;  2R70 A;  1BHA A;  1QR8 A;  4DV2 B;  1S72 V;  3CC2 V;  1WNS A;  1AI6 A;  3JAS A;  5K1P A;  1HR0 B;  5EK0 A;  4JI2 O;  4N23 A;  4HAM A;  1W2B U;  4U3F H;  2XND G;  2GDS A;  2AHZ A;  3FB6 C;  1YIJ V;  4BIO A;  3HKE A;  4LF5 B;  2XT9 A;  2DQ0 A;  4NYK A;  4UCV A;  2ZIM A;  3UM7 A;  3CWB H;  2B1I A;  3AG1 C;  5B3S C;  3D8C A;  2Z3Y A;  1K4C C;  1YTF B;  3QG5 A;  3JAM N;  4O4H A;  3OTO B;  1ZSP A;  4F6R A;  5JQG A;  4DR5 B;  1XMO B;  5IYZ A;  1UFI A;  2F95 B;  3JD3 A;  4JAV A;  5JJN B;  2WA3 A;  5CB4 B;  3A0R A;  3FAV A;  1N32 O;  5CB4 A;  3GWO A;  1I5Y A;  3K9S A;  3W7S A;  1YSC A;  1OHH G;  2ZDI C;  4UVC A;  4GX1 A;  2ZD9 A;  5FPO A;  3EHB B;  4JAU A;  1Z5V A;  2E5L O;  2QWR B;  3JD1 A;  1B6Q A;  3AK1 A;  2VS0 A;  3F7V C;  4WFB V;  2ZNI A;  3ABM C;  4I5S A;  2E3C A;  1VQM V;  4FLW A;  1YF2 A;  3H1H H;  1N34 B;  2OCC C;  4LNU A;  2P22 C;  3JAT A;  3D36 A;  4I9Q A;  4X64 O;  2P6J A;  4I0X B;  5IDJ A;  3C90 A;  3T1H O;  4JI3 O;  4R7C A;  5H6R A;  4YJ3 A;  2JRI A;  3DSQ A;  4EB6 A;  4NB5 A;  1EZJ A;  2ZM6 B;  1QVG U;  2IU0 A;  1BSM A;  3OT7 A;  3L71 H;  3JAW A;  1D2D A;  4X66 B;  5KX5 B;  4K3A A;  3E8H A;  3SYQ A;  4X88 A;  1ZL8 B;  5LA6 B;  4B3M B;  3W7X A;  1HW7 A;  4PA3 A;  2BTO A;  1FXH A;  3OGI B;  1NR7 A;  3L72 H;  3E89 A;  1BGY H;  1Y76 A;  4HBN A;  1V9P A;  1WPB A;  2ADP A;  3NR7 A;  2RQ6 A;  3OMA B;  4E2L A;  4JZG A;  3ICX A;  1M9N A;  4PJ0 Z;  3SGI A;  5EYP B;  1AI5 A;  3J81 N;  4J80 A;  2UXC B;  1Y67 A;  1ZTE A;  4HNA A;  4FM1 A;  3FB7 C;  3ABK B;  1PPJ H;  2HFE C;  3E8B A;  2D3O W;  5ITZ A;  2FL4 A;  1HDJ A;  2JIZ G;  1VQN V;  2PF4 E;  3PN1 A;  2QKS A;  4I4T B;  1R3K C;  1I08 A;  1J95 A;  4TWK A;  4IIJ A;  5ITZ B;  3ZBH A;  5JJE B;  1SQX H;  4O2B B;  3FB5 C;  4PDL A;  4LFA O;  1RP3 B;  1SA0 B;  1GAX A;  4D7T A;  4JI4 B;  4JI4 O;  1L8D A;  1JJO A;  2EIN B;  1JQ0 A;  4K8Z A;  5JCO C;  4I7Z B;  4DUY B;  4AQY O;  1RPR A;  2A06 H;  4PDR A;  4JI5 O;  2IM9 A;  3ZMT A;  4NKG B;  1WAZ A;  4D7S A;  1H2M A;  2Q0A A;  1Y74 B;  4QE7 A;  3VQX A;  2RDC A;  4ZOL B;  3ETG A;  1HP8 A;  3AG3 B;  4J11 A;  4J42 A;  1FFX B;  1F4N A;  4JAA A;  3ASN C;  1KP2 A;  4NTW A;  3LSU A;  4WFE A;  3I56 V;  4GZR B;  3HKE B;  4UCR A;  5LHG A;  3EVK A;  2LGQ A;  3ABK C;  4B3S O;  3U11 A;  2ILM A;  3JAR B;  4OX9 O;  4GX2 A;  4FLY A;  4DR6 B;  2VQE O;  3A8T A;  1PKX A;  2ADQ B;  5GON B;  4FFB B;  3RYF A;  2Q67 A;  3RBZ A;  2LGW A;  4YJ2 A;  5CA3 A;  1LUW A;  3OW2 U;  2OWO A;  4X89 A;  4H13 B;  1EN6 A;  3D3I A;  3BRC A;  3K5M A;  1HNZ B;  3LDC A;  3P32 A;  2Y0I A;  1KC8 W;  1VIB A;  3K58 A;  1BL8 A;  5H6Q A;  3T1H B;  2W0X A;  4N21 A;  2EZO A;  3L70 H;  2CH7 A;  2Q7H A;  4FMT A;  2P06 A;  2WPD G;  3BVO A;  3M99 B;  2OIE A;  2CH7 B;  4W4L A;  5IWA B;  1DGS A;  3H1L H;  2XTA A;  1VQP V;  2UXB O;  2X0L A;  1KD1 W;  4JI7 O;  1OCC C;  3ML0 A;  1IX9 A;  1Q6I A;  2HHH B;  2EX3 A;  1EM1 A;  2P7T C;  2HEP A;  3JCZ A;  5KUM A;  2ZQM A;  3IJ4 A;  5BMV B;  4DXW A;  2PZS A;  4B3R O;  3CCQ V;  3UKM A;  4UV8 A;  5LP6 A;  4I50 A;  3CRC A;  4DV4 B;  3BAA A;  4DV4 O;  2YI9 A;  1GRJ A;  1KP3 A;  4J10 A;  4LH7 A;  1GMG A;  3MHS C;  2YXH A;  5L3B A;  4L8J A;  1JX9 A;  3NXS A;  4WFF A;  2QE7 G;  1I94 O;  1FXK C;  3K0D A;  2N04 A;  2WLM A;  4K35 A;  1QNM A;  1BS3 A;  2WA4 A;  1N4C A;  2ZT9 B;  1WLE A;  3KCX A;  2QTO A;  4RWU A;  4YXW G;  4GCZ A;  3M7M X;  1EZV H;  3BAB A;  2ZXW B;  3RFR A;  2ZKO A;  4DR2 O;  4CH3 A;  4JI0 B;  1KKC A;  2DJV A;  2PI4 A;  1YCI A;  3R65 A;  5GTI Z;  2YXY A;  5GW7 A;  1W0J G;  1R6K A;  4CH6 A;  2UUB O;  3E2E A;  4XBF A;  2CTR A;  1I94 B;  4UCU A;  4IYI A;  4O4L A;  4H37 A;  1JMK C;  5BR8 O;  2ZIO A;  1R3L C;  1Q5O A;  1NTK H;  4O4I A;  1KQS U;  4GKK O;  2WLL B;  1M57 C;  1NTZ H;  2QWN B;  2RN9 A;  4YHH O;  1MMM A;  4DR2 B;  2ETN A;  3B09 A;  1SES A;  2HVJ C;  4JTD B;  2EIM C;  4MTF A;  1N0J A;  5LOV B;  4FVM A;  2ITC C;  1R73 A;  1M1K W;  3K03 A;  1WP7 A;  4R6Z A;  4TV8 B;  3MD0 A;  5LMN B;  4LC1 A;  1BQZ A;  4FLV A;  2Q8V A;  2WLH A;  3RYH A;  2A79 B;  1XQ8 A;  1D5A A;  3H1K H;  1DF5 A;  2RMK B;  3BCC H;  3DXR A;  3RW0 A;  3BFR A;  1AI4 A;  3F7Y C;  5DN6 G;  3SJB C;  3F5W C;  4J9Z B;  2QKA A;  4AQY B;  1LUV A;  2K9P A;  3S3W A;  4B3T B;  1PV0 A;  1WA8 B;  3G67 A;  2F23 A;  3C3S A;  3T4Z A;  4G28 B;  4LF6 O;  3AK3 A;  2BCC H;  2V1D A;  4JI8 O;  5EBL C;  3E22 A;  1WB8 A;  4DV2 O;  1SER A;  4MW8 A;  4FLU A;  5KX5 A;  4FLT A;  3JD2 A;  4JZ2 A;  3TXS A;  2ARH A;  2Z0A A;  1THZ A;  2BOC C;  1KKD A;  4EB6 B;  5LGN A;  4X65 B;  2Y4T A;  1VMG A;  1G8M A;  1Y66 A;  5C8Y A;  2JEU A;  3CHX A;  4FFB A;  4J41 A;  1XDC A;  2O57 A;  5C8Y B;  1M90 W;  1FXV A;  2Y69 B;  1TGO A;  3L73 H;  1YXB A;  2YIC A;  3DGE A;  1Q8I A;  2UXX A;  1PNL A;  1DLB A;  5IY5 B;  1JFF B;  3N2K B;  4HYO A;  3ZHU A;  3IAY A;  1IBK O;  3FX7 A;  2H94 A;  3HKC B;  4UFZ A;  5AG2 A;  2ZE7 A;  3SYP A;  1LNQ A;  3R66 A;  4LCU C;  2P67 A;  4U7N A;  4LF9 O;  1YJW V;  2UUB B;  1MAB G;  1TAE A;  5LYJ A;  2WLL A;  4UCS A;  1MZF A;  1YHQ V;  4JI2 B;  1QBZ A;  1OJH A;  3TCU A;  4FFK A;  3STZ C;  2DYS C;  3ZED A;  2UUC B;  3WG7 C;  3G6E V;  3CRQ A;  2LFS A;  4O2B A;  2XAG A;  3K9A A;  2F93 B;  4EEQ A;  2YS8 A;  2HVK C;  5LXT B;  1Q43 A;  2AZ2 A;  3FD9 A;  5IT9 N;  3A2F A;  4O4J B;  4DR1 O;  4DV0 B;  3HPL C;  2MW2 B;  3ETD A;  5J9P C;  3OTO O;  1DF4 A;  2NLJ C;  1YEW A;  2NNU A;  1BT8 A;  1QR9 A;  4LF4 B;  3ZHT A;  1BHB A;  3JAK B;  1OCR B;  1R1B A;  4PA4 A;  3LDE A;  2AW9 A;  2CUG A;  1FFX A;  4X1I A;  2HHH O;  1NKD A;  1SKV A;  3RVY A;  5LHH A;  4B3M O;  4DUY O;  5KUK A;  4K8X A;  1XMQ O;  5LMU B;  4JYB A;  2LW1 A;  4TUY A;  2UUA O;  2KQX A;  2V7Q G;  2HG5 C;  4UUJ C;  1KYO F;  4AHC A;  2W0F C;  4LF8 B;  3RWR D;  3CX5 F;  4X8A A;  2F4V B;  2UXD B;  4O4I B;  3N2G B;  4PHZ A;  1OCZ B;  4F6E A; 
#chains in the Genus database with same CATH homology
 2P06 A;  2Q9L A;  1VMG A;  1YXB A;  3CRC A;  4QGP A;  2Q73 A;  2OIE A;  5IE9 A;  2A7W A;  2Q4P A;  1YVW A;  1Y6X A;  3CRA A;  2GTA A;  2OIG A;  2YXH A;  2A3Q A;  2Q5Z A;  3C90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...