1VMGA

Crystal structure of mazg nucleotide pyrophosphohydrolase (13816655) from sulfolobus solfataricus at 1.46 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
83
structure length
83
Chain Sequence
b'MDLELKELQSKMKEMYFEKDSQRGIYATFTWLVEEVGELAEALLSNNLDSIQEELADVIAWTVSIANLEGIDIEEALKKKYKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein SSO3215
publication title Crystal structure of MazG nucleotide pyrophosphohydrolase (13816655) from Sulfolobus solfataricus at 1.46 A resolution
rcsb
source organism Sulfolobus solfataricus
molecule tags Hydrolase
total genus 32
structure length 83
sequence length 83
ec nomenclature ec 3.6.1.-:
pdb deposition date 2004-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03819 MazG MazG nucleotide pyrophosphohydrolase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 1vmgA00
4QGPA 2OIGA 2A3QA 3CRAA 2Q73A 2Q9LA 1Y6XA 1YXBA 2P06A 1YVWA 2Q5ZA 2A7WA 1VMGA 3CRCA 2GTAA 2YXHA 5IE9A 3C90A 2Q4PA 2OIEA
chains in the Genus database with same CATH superfamily
2GDSA 1MZFA 4L87A 4JV5B 1G4YB 5ITZB 3OGIB 4JYYA 2LFSA 4WFEA 3HPLC 3FAVA 3HKEB 2QWOB 2GTSA 1AJQA 4KHPO 4K8XA 4J80A 4DR2B 2ZCEA 1M56B 2DN9A 4R6ZA 2KG7A 4ICGA 3OAAG 2WA4A 1RSOA 5JVDB 1LUVA 2RQ6A 3CB2A 4PDMA 3RVZA 3IJ4A 2Y48A 3RYHB 1KUQA 1EZVH 5JQGB 4FLXA 2CGNA 4DR4B 5LOVB 1TVKA 2VS0A 2IM9A 3DXRA 1N33B 4EFBA 5CA3A 4LNUB 3U0ZA 2JJ2G 1H2SB 2KG7B 4LF8B 3GVMA 3JASB 1N4CA 1RSOB 4MS2A 4JI2O 3SYOA 2WLKA 1AROP 1Y76A 1TVKB 2Q67A 1IX9A 2VQFO 1XI1A 1HW7A 2Z3YA 1SA0B 4H37A 4D7TA 1CXZB 4YJ2A 4KP4A 2JS3A 1VP7A 3WB2A 5KMGA 4MTGA 1K5QA 4C7UA 2CK3G 1YJNV 2D3OW 4NYKA 4DR1O 1K97A 3RYIB 1WAZA 2EIMC 4WFGA 2XOKG 3B4SA 4RUFA 3JAKA 2HVJC 4DUZO 4DR6B 3CCJV 3FKSG 1XNQB 2ZXWB 2H8PC 3AG3C 4JI1O 5KAFZ 3GWOA 1LNQA 1WPXA 5KMGB 3OTOO 3LSUA 3ZMUA 4LFCB 3K08A 4F4LA 3CCEV 5LHHA 1H8HG 2CDYA 4ZHQA 4RUEA 4WFHA 3JAKB 3OE7G 4DXWA 3OMIB 2DYSC 4X20A 1K34A 2EILB 4CBCA 3ZRVA 3OD4A 2GUZB 1PKXA 1NBMG 4NTWA 1LR1A 3W7WA 3T2MA 1H2NA 4QE9A 2UXCB 3T4ZA 4RQFA 3CPWU 1PNMA 1M56C 2ZINA 3SYAA 4ZHQB 2A3QA 4DV2O 2V1DA 5IDJA 1J95A 1N36O 4LR3A 1NVPD 2UUBB 2BCCH 4O4HA 4DR5O 2E74B 4DV4B 1YZBA 1Z2GA 1M5IA 1S5HC 1Z5VA 4YY3O 2UXDB 1BSMA 3L70H 1NR1A 3OGCC 1DGSA 1QCEA 1ZAUA 4OGQB 3KKYA 1IXBA 4O4HB 1P4RA 1NVPB 2P67A 1SS3A 4ABMA 2R70A 5LXTA 1MSDA 2FL4A 4XDLA 4X8AA 2WLMA 4B08A 2O57A 1Q86W 4K35A 4X65B 1HNXO 5IYCO 3ZN0A 5IY5C 4DR3O 4UCRA 5LXTB 2DQ3A 4I4TA 3T1HO 1GM7A 1S3JA 2YXHA 1EZJA 4QIWF 4B3TO 3EXAA 4GKJB 1L0NH 5IJ9B 3BA8A 4J7KA 3SPCA 2ZXWC 3ZHUA 2JEUA 3HKDB 3K5MA 5IYZA 3DGEA 3BCCH 4JF3A 3IAYA 4FLUA 4LF6B 4IYHA 2LO1A 3SDLA 4DV0B 1ZWIC 1ORQC 2OCCC 5J2TA 2A0LA 1IBMO 2DJVA 2JVDA 1VQ4V 4EKWA 5EYPA 5FNVA 4NR1A 1K4CC 3F5WC 2EILC 5JWPA 3H1HH 3K03A 2N74A 4ZI7A 2OYQA 2EULA 3EHBB 4FZ0A 3QG5A 4DW0A 4I50B 4JV5O 2P22C 2WPDG 3MDSA 2YSUB 3OUSA 2P4KA 3H1IH 5FNVB 3GWKC 4KXRA 1FXHA 1URFA 3C3TA 4RWUA 5KLVH 4DR2O 1N8RW 3SJAC 1I0HA 2B5UA 3APOA 1E79G 4JI0B 2EJ7A 2JRIA 4YIOA 1WJZA 4PI2A 4DR4O 4JI5B 5KHIA 2XAQA 2PI5A 1AI7A 2ZM6O 1N33O 1N0NA 4J9ZB 3CC2V 4IT5A 1OCOB 4KUMA 1XNRO 1ZL8A 1NZ6A 3D36A 4YHHO 5KUMA 4LF5B 5FL7G 1B6QA 2L6LA 5GONA 4F6EA 1XILA 1SQPH 4HZ3A 2A79B 4Z1MG 5C93A 2PYJA 1TUEB 1ZL8B 5LP6A 5D5QA 1J5EB 4QGPA 1KMIZ 4AQYB 1FXKA 4JTDB 1VQOV 2IJHA 2NR5A 1NT2B 1JX9A 4DRXB 1HNWB 1RM1C 1S72V 2LP7A 1X4TA 2HG5C 1S0VA 3N2KA 3CCRV 2XUMA 4JI4B 4LF4O 1XNQO 4ZOLA 2QM4A 4ZBMA 3TCUA 3CCVV 5LMNB 4CC5A 4X62B 3CMAV 4G27B 3T1YO 1KD1W 4F6RA 1FXKB 3QO8A 4IYIA 1AR4A 1G8MA 1HP8A 1YXBA 2LW7A 5AG2A 3O9OA 3P30A 1EN5A 3P3PA 2Y69B 3PN1A 3TXQA 2GHYA 3N2KB 4JYBA 2YC0A 4NTXA 2JIZG 1K8AW 2JJ1G 1GKFA 1V54B 3DSQA 4QPKA 5EBLC 4BWAA 2UXCO 3K0DA 4D6TH 1HWYA 1MABG 1Q6UA 2UUBO 2UXNA 5L3GA 5KA6A 4DV4O 3HKBA 5J2UA 4L8JA 1NI8A 1QLEC 3VQXA 4PA3A 3JSNA 2KSDA 5EK0A 4X88A 3ZCCA 1Q90D 3E2EA 3OW2U 1XMOO 2V7QG 3EFFK 1OCOC 1VQLV 1AJNA 2XAGA 4PA9A 5KX5A 1VQPV 2UUCB 4K8ZA 4E2LA 3UT5A 5IWAB 3HKBB 5J2UB 1NR7A 4TOIA 3SJCC 2LJ2A 5J9PC 2F1MA 2UUAB 5BY1A 4XDKA 3CJHB 1SERA 2CTQA 5H6RA 3CCLV 2CH7A 4X65O 4OPHA 3D36C 3UT5B 3CX5F 3J80N 1YI2V 5DEDA 1IXMA 4PDLA 1NU1H 4UV8A 3Q4HA 4HNAB 3L9DA 4QE7A 1QVFU 1AVMA 3F5TA 3I5DA 4NTYA 2IJIA 2QJ1A 4GKJO 1M93A 5EIBC 2Q9LA 2CH7B 3E35A 2FYUH 2ETNA 4OX9B 1PPJH 1QR9A 3IC9A 3CCSV 3R65A 1Q82W 1QNMA 2GTAA 3CP1A 4UCVA 1FXKC 2HHHB 3E22A 4PI0A 4I55B 3HKCB 3AG1B 3QO7A 4DV0O 5B1NA 3Q4HB 2Y69C 3E89A 3LDDA 4DV7B 1K5SA 4A5UB 4UCTA 1L8DA 2RNBA 1TUBA 4IL6Z 2XHBA 4U7NA 1V54C 2KKWA 3ZN1A 1CPYA 2JGDB 4W4KA 2Y0IA 3JARB 2BSKA 4B3RB 1P7GA 2WLJA 5C8YB 5DM6V 1YVWA 1AP6A 3LDEA 1TUBB 1FKAO 3FB6C 2ZT9B 3JD4A 5BMVB 1E1QG 3ETDA 3OR7C 1GK9A 3SYCA 2IU0A 3LSSA 1VQKV 3QO5A 3JAWB 4GX0A 2LGWA 4TV8A 3N27A 1N32B 2ZIOA 1SRYA 1SESA 1VEWA 2JGUA 4Z2WA 2CGOA 1Y67A 1R3JC 2B9ZA 5DN6G 5IE9A 4LF5O 3JCZA 1PP9H 2ZR2A 5F2VO 3K3WA 1BS3A 5HFLA 2CUGA 2AGAA 1QQCA 1QHTA 1FD9A 4RAIA 4O4JA 1IBKB 3DTUB 2HVKC 1BQ0A 4CH3A 4TV9A 2F95B 1Q8IA 2AZ2A 1N34B 4FLTA 2PUSA 2M6YA 1VMGA 4AQYO 4UCOA 4LF7B 1VQ9V 4HYOA 5GW7A 1F4MA 2BOCC 1COWG 1HNWO 2Q0AA 2IBZH 4K0KB 3RN4A 4O4JB 1VQNV 1FJGB 3JYCA 1DLBA 4JI4O 3K58A 3AG1C 4FFKA 1WP8A 3FAVB 2IH3C 4X62O 1VF5B 3SPJA 2IW5A 3BHPA 5CBGA 4CZZA 3T1CA 3L75H 4TSFG 2X0LA 4FFBA 3B8NA 1FFXA 2QSAA 1SKVA 3JATA 1BQZA 3SPHA 2QR4A 3DXRB 3OMNB 2F4VB 1D5NA 4Q6GA 3QF7A 5FLXN 1YJ9V 3G6BA 4LFAB 5LMUO 3WU2Z 4UB6Z 1WLEA 3W7TA 3H1LH 3ABLB 1FFXB 5DECA 1XL6A 2DWDC 1ROPA 4UXNA 5CA0A 3JATB 4LC1A 1Y76B 1NS1A 2ARHA 1OV9A 1BMFG 3CXCU 2LQTA 3N2GA 5BZBA 4GKKB 3X2QB 4YJ2B 1CP9A 4IGGA 2UUCO 1O9GA 4CH6A 1ZUQA 2OIGA 5IWAO 1GM8A 5CA0B 5LGUA 3FX7A 3ETGA 5JCOA 1Y4MA 2WAMA 1DF5A 4JAVA 2CTWA 1P49A 4JI3B 2UUAO 4UB8Z 2UXBB 2C2AA 2IJJA 4BW9A 4LFBB 2QWNB 2XNDG 2QWPB 1GN4A 3BY6A 1H38A 3E8GA 3DC6A 4AILC 2EZPA 3AG7A 5LYJA 4YXWG 4J10A 1I7FA 4DV3B 2Z5UA 3JD2A 3E83A 3RFRA 3AG2B 3WG7B 4BIZA 1N0JA 2GBOA 2ZDIC 4TWKA 4X20B 1NTMH 4X1KA 3QNEA 4CS3A 1UPGA 3M8AA 4OX9O 4MTFA 3I56V 3B8MA 3ZX6A 3CC7V 5LYJB 3CMEV 4RO2A 2B1IA 3ZJZA 3A0BZ 3E8HA 3VQYA 2A9HA 4DR7B 2XTAA 1SQQH 2F93B 2ZQMA 1GN3A 2E3CA 1XHZA 4X1KB 4DV7O 3G4SV 2UXXA 4EFEA 3RGBA 4LF9B 3HR0A 4MTXA 2YI9A 1PV0A 1GN2A 1PM9A 2KQXA 2P6JA 5H6QA 4JPRA 4FPPA 1JJOA 4B3RO 1H2MA 4FM1A 5CBHA 1HR0B 3GB7C 4TQFA 1BE3H 2P7TC 2ADPA 3CS5A 1MOFA 4GZRB 3CRAA 3X2QC 4MW3A 4PV1B 1XMQB 4YJ3A 1DF4A 3K59A 3KZIZ 4BW5A 3ZIAG 4I4TB 3OMAB 3AG4B 4H13B 2IU3A 2EJRA 2ATKC 1NKDA 4WBNA 4G28B 4JI8B 3OR6C 1JOYA 1JFFA 3DC5A 3MD0A 3L72H 4PA4A 3ABUA 1P7BA 3D3QA 4NB5A 1JMKC 5IYZB 2G38A 4YJ3B 5LL6Y 3PJSK 4DV5B 5JH7A 3ZRSA 5JJEB 4MVZA 1BCCH 4QJFB 1GTOA 1W2BU 2GSMB 4CS4A 3AG2C 5LGNA 1N34O 5J2TB 5K1PA 4K3AA 2PTMA 2WLHA 5EYPB 2L35A 3BPZA 2AW9A 2YXYA 4LF7O 1JQ0A 3M99B 4J7JA 4O4IA 4B3MB 3H1KH 3M7MX 4ZI7B 2EIJB 4K0KO 4X64B 5JH7B 1FFTB 4X9QA 3THOA 1Y66A 2QKSA 1FJGO 4MVOA 4O2BA 2WLNA 3K79A 2WA3A 1SQXH 3TJTA 1TGOA 3SGIA 2YIAA 2HEPA 1D2DA 2HR3A 2K9PA 4FK5C 4LF8O 3LUTB 4PA7A 4XBFA 1K7DA 3L71H 1Q7YW 3JD3A 1PD3A 1R6NA 2E5LB 4XDJA 1W59A 1SZXA 2F4VO 4GX2A 4TUYA 1VF7A 4DYLA 4H44B 4JAUA 1DTOA 4LFAO 3OEEG 4JI6B 3ICXA 1UFIA 2QTSA 3K0GA 5HFMA 4X1IA 3RT3C 5GONB 1OCCB 3K5NA 1GO3F 1KP3A 3ABMB 3I55V 5EBWC 4DR6O 5LP6B 3L73H 3J7AU 4KL1A 3AG4C 4UVAA 4KHPB 5BR8B 2JK5C 1IDSA 1W0KG 4X1IB 4LFCO 3TXSA 1F7YA 1V55B 4JI3O 1IBLB 3OEHG 1GAXA 3W7UA 5KHHA 1MA1A 4ZOLB 2ZE8A 1P84F 2AHYA 3E86A 5IT9N 2EZOA 5GTIZ 3QTCA 3A0HZ 1K73W 4F6RB 1SF9A 1W0JG 2Z0AA 3SPGA 2CE4A 5B1BB 3C3SA 4G2KA 1JVMA 1SQVH 5E1AC 4UCSA 1RP3B 2QKCA 4B7EA 1S5JA 3A8TA 5TISZ 2DWEC 4RQEA 2UXDO 1VQ5V 4B3SB 2F66C 4HAMA 3A2FA 3STZC 2ZKOA 3CCMV 2OWOA 2R72A 4FLWA 5B66Z 5KHKA 4DR1B 4DR7O 4JYAB 3APQA 1X59A 2Q7EA 1WA8A 2ZIMA 1MMMA 1R1BA 3ML0A 4DUZB 1FXVA 2DYRB 2XAHA 2AXTZ 2OTLV 2QE7G 2IJKA 5L3FA 4LF9O 1GN6A 1H2GA 1R3KC 4P2ZA 4GT1A 4IIJA 3UO3A 2JS5A 1S5LZ 5KX5B 4FIPC 5JJJB 3SPIA 2LGQA 1D5AA 5A2QN 2W0FC 1HR0O 5IYBO 4EB6A 2HKOA 5H5NA 1OCCC 4LP8A 1FPOA 1H2LA 2W6IG 4E4EA 1AR1B 3ABMC 2HJFC 4ASUG 3UCSC 3W7XA 2YEVA 3JCUZ 5LP6C 3FB5C 1EN6A 3G6EV 1VIBA 3B09A 2CTRA 4DV2B 3ETQA 5GTHZ 5CA1A 4LF6O 1N36B 2DQ0A 5KAIZ 4NXNB 3E8BA 1S76D 1XQ8A 1YITV 1M4UA 4H0LB 2ZE6A 2YI8A 1V55C 3RYFA 3ZHVA 4JI8O 3FFQA 5FPOA 4AHCA 1M1KW 2NN4A 5KA5A 2YEVB 3RYCA 3AEIA 2BTOA 1WNSA 1PL4A 4DW1A 5CBFA 3NR7A 4PDVA 1GH6A 4FM2A 3E22B 3CRQA 3CSXA 3FD9A 3CWBH 4OPAA 2P5OA 5B1BC 5CB4A 3P3NA 2QTOA 2LFRA 3H01A 4LCUC 3RYCB 1XDCA 4DUYB 2RN9A 1VQMV 2YS8A 4BAYA 2F23A 1KC8W 1Z5WA 4NXMB 1M90W 2FKXA 4DK1A 5H2FZ 4GX1A 4JI0O 3BABA 3CE2A 5CB4B 3ZHQA 1PNLA 3MAQA 4DO2A 3W7SA 4JI5O 2BSKB 4NVPA 4W4LA 1BT8A 4YIPA 5B3SB 4ZKIA 2EIKB 3T1HB 3KCYA 2QKAA 4JZGA 1XOUA 3ZHRA 1VF6A 2Q6AA 5D5PA 2VQEB 3ABTA 3SR2C 1U97A 3B40A 2DYRC 3KCXA 1K33A 2W0XA 1YJWV 1R73A 4JI7B 3MHHC 4TV8B 1Y74A 1KECA 2UU9B 1K4DC 3SYQA 2VRZA 4I5SA 4HBNA 1BHAA 1YIJV 1IBMB 1UJWB 1FYJA 1J5EO 3WFVA 1YSCA 5A9GA 4JI6O 2BTQA 1NH2D 3K04A 2DMXA 1YEWA 1SQBH 3AK3A 1TAEA 2OCHA 5JVDA 4UVCA 3SJQC 4X66B 4R7CA 2KB1A 4FLZA 3RYHA 5JQGA 5CMUA 2HFEC 5LOVA 1ENVA 2R9AA 4TV9B 2V4DA 3UM7A 2Q68A 2WLIA 5LMNO 4LNUA 1WPBA 1OCZB 2YUAA 5BR8O 1BZKA 1SETA 2QA4V 2BTQB 5B1AB 3CCUV 5L3CA 1MSWD 2IH1C 4WFAV 1OJHA 1NH2B 3JASA 3P32A 1KQSU 2DOSA 3CEIA 1QR8A 2QM7A 4J41A 3LDCA 4J42A 4DV6B 2ZM6B 1IBLO 1KP2A 2WLIB 4PDRA 4J7ZA 3TK1A 1SA0A 2NLJC 1K9MW 1XNRB 4GYCB 4YHHB 5LGTA 2X7RB 2PF4E 1BL8A 1R3LC 1YCIA 1QBZA 4FFBB 1KKDA 1G6UA 1B04A 3K5OA 3RYIA 5EZYA 3FYIB 3ZMTA 1KU9A 2HP8A 3JD1A 2ODMA 2Y4TA 4B3SO 3IFXA 5B3SC 2EIKC 4GCZA 2H3OA 2Q0OC 3B2EE 5IY5B 4PJ0Z 4AI8A 4ZIBA 1XUQA 1ZLZA 2QWRB 4JYAO 5EC2C 3O65A 1JPXA 5EZYB 2YICA 3IGAC 4I0XA 4TQDA 2P06A 2XAFA 4UFZA 4JTAB 4FJCC 2N04A 3VBBA 4LF4B 2GUZA 1IURA 1G1XB 4MVRA 2F43G 4JASA 1M9NA 2QM8A 3N2GB 3WB1A 1R6TA 3T1YB 3ZMSA 3CHXA 1VF6C 4R8CA 1IZ3A 2Y0PA 3R66A 2XASA 1Q5OA 1QVGU 1RPOA 1XHXA 2OCCB 3ASNB 3JSLA 3S3WA 1Q6HA 4I0XB 1F4NA 1R3IC 4LWSA 2K1EA 1CEZA 2RDCA 2E75B 1RPRA 2ZR3A 3RVYA 3ZMVA 5BXZA 3ZEDA 4MVUA 1OCZC 2OT5A 3AK1A 5B1AC 1L0LH 1YDXA 2HHHO 2P4VA 4P9PA 4NXNO 4N23A 1PNKA 4LWSB 2JEXA 1OHHG 3G80A 1HNZB 4UUJC 3CXHF 4MT8A 1IVSA 4UVBA 4FMTA 4JGSA 1XMOB 3OUFA 1SQFA 2YIDA 1TA8A 4JYCA 3A0RA 3NXSA 1KYOF 3BVOA 4CS2A 3RWRD 3KG2A 3BEHA 3CD6V 3S3XA 1EBOA 3MHSC 4WF9V 3QVNA 4DV1B 1AI5A 2PY5A 3ABLC 2EBOA 2HJDA 4BIUA 2X6AA 3F7VC 2BOBC 3HB3B 4U3FH 1ZTEA 2H94A 4DUYO 5KHJA 5IJ9A 4NXMO 4JTCB 4LH7A 1XREA 2RMKB 2BE3A 3HKDA 1NTZH 2B1GA 1ZSPA 1Y6XA 2VWJA 1N32O 1GM9A 1I5YA 4I7ZB 1AP5A 2AHZA 2WSSG 4FLVA 2ILMA 4DK0A 4FLYA 2VQEO 1WB8A 3G67A 2FB5A 1RM1B 4O2AA 3OM3B 3BRCA 4JI7O 4GX5A 5KHGA 2UU9O 4I50A 1SC5B 5LA6A 4EEQA 1EN4A 1V9PA 1VQ8V 3ASNC 1IBKO 4FZ1A 3K9SA 1DK1A 3CYOA 4PD4F 3WG7C 4WBNB 5JCOC 3JD0A 5L3DA 2Q4PA 1F23A 1JFFB 4O2AB 3UKMA 4LBEC 3FB7C 1I08A 5KUKA 3LNNA 1MG1A 1QU7A 3U11A 2Q7HA 2ITDC 4QPJA 4X66O 3K9AA 3STLC 3CRRA 1AR5A 5LA6B 3FB8C 4TT3G 3ABKB 4U3JA 1EFRG 3H9VA 4MW8A 1OCRB 3FYEB 1K92A 4MSWC 3RBZA 4WFFA 1YHQV 5IYDO 4NKGB 4O4IB 4I9QA 1E1RG 3CRMA 1QLEB 4CC6A 3T4DA 2X6CA 1YTFD 2YIBD 2MK3A 2YIBA 2YXLA 4DV6O 4U3JB 5L3EA 5EBMC 1YF2A 4O2BB 4R50A 1Q81W 4MTOA 2D2CB 4CH4A 3BFRA 1EM1A 2EINB 3OTFA 1F51A 4WFBV 5EC1C 1AI6A 4DRXA 1S77D 3RW0A 5H9CA 1SZTA 3B77A 1YTFB 1I94B 5EIBD 3ZBHA 1THZA 3ZMZA 2PI4A 3L74H 1Q6IA 3ETEA 3UO2A 4GLXA 4TUYB 3JALA 2AZ0A 5K1XA 1KBHA 2R9RB 2XT9A 4UV9A 1AB3A 4GKKO 1L1FA 1AILA 1O9HA 4JZ2A 4JAAA 4BR6A 2A7WA 1FAFA 1K3EA 1QLNA 1VARA 1US6A 2ZNJA 4QNHB 4BIOA 2E76B 3C90A 3UQ8A 3LSQA 3VQVA 2PZSA 2LW1A 3JALB 1R6KA 2UXBO 2QDOA 4LFBO 4PELA 2R9IA 4MVMA 4X1YA 3ASOB 5FPRA 1VQ7V 2OTJV 4DV3O 4JI2B 2M7WA 3ZHTA 1AJPA 1SQGA 1M57B 2EIJC 5CN0A 1ZX3A 1WP7A 3ABKC 4N21A 2VQFB 4MVSA 2Q73A 4B7KA 1OCRC 4X1YB 3LNMB 3G71V 5LMUB 3ZHSA 2YDEA 2ADQB 3U10A 2QEXV 1I5XA 1T5EA 3TETA 1MNGA 2Q7GA 1Q43A 4FVMA 3H1JH 1HNZO 2ZE5A 4J11A 5LBQA 2RCVA 3CJHA 2NNUA 4UCUA 1KKCA 2DW4A 1NJIW 2WWWA 3IC7A 2ZD9A 4JI1B 1U96A 4J9YB 3OTOB 2WLLA 2Q8VA 2EINC 3ZS8C 1OZ0A 4DV1O 1WN7A 4CH5A 2P90A 1H2KA 1WA8B 2PYLA 4HNAA 3OT7A 1A32A 1JCHA 2JDIG 2HLDG 3WB0A 5E79Z 3ZRXA 2N05A 1JR9A 2WLLB 4IIJB 1AI4A 4PHZA 1XBLA 3AK2A 4X89A 3K57A 3D8CA 1JA8A 1XMQO 4I55A 3HKCA 1Y74B 5L3BA 5B1OA 1KB9F 4DR5B 2ITCC 2ZNIA 2A06H 3CCQV 3VOUA 4EB6B 2QGNA 1VQ6V 3CC4V 4U7OA 1PL0A 1RFYA 2CAZC 4YY3B 4P9OA 3K06A 5LHIA 4D7SA 4O4LA 2Q5ZA 3OFNG 3BAAA 3EVKA 1B3QA 2Y4UA 3K5LA 1GMGA 2XAJA 2JGDA 5CA1B 2RJZA 3ASOC 4DV5O 5IJ0A 3JARA 3BA9A 3RYFB 5C8YA 4MVQA 1MZEA 1B06A 2MW2B 4O4LB 1M57C 4LH6A 2QWQB 3VQWA 5BMVA 3D3IA 2PGGA 1NQTA 1GRJA 4B3MO 4I9WA 1LUWA 3JAWA 1HNXB 4X64O 3TGUH 3SJBC 2W6JG 5IJ0B 2OIEA 4DR3B 2CTPA 1JJ2U 4PA6A 5LHGA 1NTKH 4B3TB 2FTKA 2VWKA 3ZRWA 4IHJA 2EIMB 3SYPA 4Z1VA 2E5LO 2X6BA 5ITZA 5JJNB 2ZE7A 1FS0G 3AG3B 4Q20A 1BHBA 2GV9A 2DE0X 3HKEA 4FM0A 1H8EG 3F7YC 3JAMN 3E8FA 4GUNA 1XL4A 2EX3A 3CRCA 3ZRWB 4H33A 1HDJA 4IHJB 4KFMA 1Q3EA 1WB7A 1BGYH 1XEQA 4OXSA 2ZDIA 5B5EZ 2Q69A 2DYSB 3J81N 4P30A 2FMLA 4WCEV 1I94O
chains in the Genus database with same CATH topology
4QGPA 2OIGA 2A3QA 3CRAA 2Q73A 2Q9LA 1Y6XA 1YXBA 2P06A 1YVWA 2Q5ZA 2A7WA 1VMGA 3CRCA 2GTAA 2YXHA 5IE9A 3C90A 2Q4PA 2OIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QGP A;  2OIG A;  2A3Q A;  3CRA A;  2Q73 A;  2Q9L A;  1Y6X A;  1YXB A;  2P06 A;  1YVW A;  2Q5Z A;  2A7W A;  1VMG A;  3CRC A;  2GTA A;  2YXH A;  5IE9 A;  3C90 A;  2Q4P A;  2OIE A; 
#chains in the Genus database with same CATH topology
 2GDS A;  1MZF A;  4L87 A;  4JV5 B;  1G4Y B;  5ITZ B;  3OGI B;  4JYY A;  2LFS A;  4WFE A;  3HPL C;  3FAV A;  3HKE B;  2QWO B;  2GTS A;  1AJQ A;  4KHP O;  4K8X A;  4J80 A;  4DR2 B;  2ZCE A;  1M56 B;  2DN9 A;  4R6Z A;  2KG7 A;  4ICG A;  3OAA G;  2WA4 A;  1RSO A;  5JVD B;  1LUV A;  2RQ6 A;  3CB2 A;  4PDM A;  3RVZ A;  3IJ4 A;  2Y48 A;  3RYH B;  1KUQ A;  1EZV H;  5JQG B;  4FLX A;  2CGN A;  4DR4 B;  5LOV B;  1TVK A;  2VS0 A;  2IM9 A;  3DXR A;  1N33 B;  4EFB A;  5CA3 A;  4LNU B;  3U0Z A;  2JJ2 G;  1H2S B;  2KG7 B;  4LF8 B;  3GVM A;  3JAS B;  1N4C A;  1RSO B;  4MS2 A;  4JI2 O;  3SYO A;  2WLK A;  1ARO P;  1Y76 A;  1TVK B;  2Q67 A;  1IX9 A;  2VQF O;  1XI1 A;  1HW7 A;  2Z3Y A;  1SA0 B;  4H37 A;  4D7T A;  1CXZ B;  4YJ2 A;  4KP4 A;  2JS3 A;  1VP7 A;  3WB2 A;  5KMG A;  4MTG A;  1K5Q A;  4C7U A;  2CK3 G;  1YJN V;  2D3O W;  4NYK A;  4DR1 O;  1K97 A;  3RYI B;  1WAZ A;  2EIM C;  4WFG A;  2XOK G;  3B4S A;  4RUF A;  3JAK A;  2HVJ C;  4DUZ O;  4DR6 B;  3CCJ V;  3FKS G;  1XNQ B;  2ZXW B;  2H8P C;  3AG3 C;  4JI1 O;  5KAF Z;  3GWO A;  1LNQ A;  1WPX A;  5KMG B;  3OTO O;  3LSU A;  3ZMU A;  4LFC B;  3K08 A;  4F4L A;  3CCE V;  5LHH A;  1H8H G;  2CDY A;  4ZHQ A;  4RUE A;  4WFH A;  3JAK B;  3OE7 G;  4DXW A;  3OMI B;  2DYS C;  4X20 A;  1K34 A;  2EIL B;  4CBC A;  3ZRV A;  3OD4 A;  2GUZ B;  1PKX A;  1NBM G;  4NTW A;  1LR1 A;  3W7W A;  3T2M A;  1H2N A;  4QE9 A;  2UXC B;  3T4Z A;  4RQF A;  3CPW U;  1PNM A;  1M56 C;  2ZIN A;  3SYA A;  4ZHQ B;  2A3Q A;  4DV2 O;  2V1D A;  5IDJ A;  1J95 A;  1N36 O;  4LR3 A;  1NVP D;  2UUB B;  2BCC H;  4O4H A;  4DR5 O;  2E74 B;  4DV4 B;  1YZB A;  1Z2G A;  1M5I A;  1S5H C;  1Z5V A;  4YY3 O;  2UXD B;  1BSM A;  3L70 H;  1NR1 A;  3OGC C;  1DGS A;  1QCE A;  1ZAU A;  4OGQ B;  3KKY A;  1IXB A;  4O4H B;  1P4R A;  1NVP B;  2P67 A;  1SS3 A;  4ABM A;  2R70 A;  5LXT A;  1MSD A;  2FL4 A;  4XDL A;  4X8A A;  2WLM A;  4B08 A;  2O57 A;  1Q86 W;  4K35 A;  4X65 B;  1HNX O;  5IYC O;  3ZN0 A;  5IY5 C;  4DR3 O;  4UCR A;  5LXT B;  2DQ3 A;  4I4T A;  3T1H O;  1GM7 A;  1S3J A;  2YXH A;  1EZJ A;  4QIW F;  4B3T O;  3EXA A;  4GKJ B;  1L0N H;  5IJ9 B;  3BA8 A;  4J7K A;  3SPC A;  2ZXW C;  3ZHU A;  2JEU A;  3HKD B;  3K5M A;  5IYZ A;  3DGE A;  3BCC H;  4JF3 A;  3IAY A;  4FLU A;  4LF6 B;  4IYH A;  2LO1 A;  3SDL A;  4DV0 B;  1ZWI C;  1ORQ C;  2OCC C;  5J2T A;  2A0L A;  1IBM O;  2DJV A;  2JVD A;  1VQ4 V;  4EKW A;  5EYP A;  5FNV A;  4NR1 A;  1K4C C;  3F5W C;  2EIL C;  5JWP A;  3H1H H;  3K03 A;  2N74 A;  4ZI7 A;  2OYQ A;  2EUL A;  3EHB B;  4FZ0 A;  3QG5 A;  4DW0 A;  4I50 B;  4JV5 O;  2P22 C;  2WPD G;  3MDS A;  2YSU B;  3OUS A;  2P4K A;  3H1I H;  5FNV B;  3GWK C;  4KXR A;  1FXH A;  1URF A;  3C3T A;  4RWU A;  5KLV H;  4DR2 O;  1N8R W;  3SJA C;  1I0H A;  2B5U A;  3APO A;  1E79 G;  4JI0 B;  2EJ7 A;  2JRI A;  4YIO A;  1WJZ A;  4PI2 A;  4DR4 O;  4JI5 B;  5KHI A;  2XAQ A;  2PI5 A;  1AI7 A;  2ZM6 O;  1N33 O;  1N0N A;  4J9Z B;  3CC2 V;  4IT5 A;  1OCO B;  4KUM A;  1XNR O;  1ZL8 A;  1NZ6 A;  3D36 A;  4YHH O;  5KUM A;  4LF5 B;  5FL7 G;  1B6Q A;  2L6L A;  5GON A;  4F6E A;  1XIL A;  1SQP H;  4HZ3 A;  2A79 B;  4Z1M G;  5C93 A;  2PYJ A;  1TUE B;  1ZL8 B;  5LP6 A;  5D5Q A;  1J5E B;  4QGP A;  1KMI Z;  4AQY B;  1FXK A;  4JTD B;  1VQO V;  2IJH A;  2NR5 A;  1NT2 B;  1JX9 A;  4DRX B;  1HNW B;  1RM1 C;  1S72 V;  2LP7 A;  1X4T A;  2HG5 C;  1S0V A;  3N2K A;  3CCR V;  2XUM A;  4JI4 B;  4LF4 O;  1XNQ O;  4ZOL A;  2QM4 A;  4ZBM A;  3TCU A;  3CCV V;  5LMN B;  4CC5 A;  4X62 B;  3CMA V;  4G27 B;  3T1Y O;  1KD1 W;  4F6R A;  1FXK B;  3QO8 A;  4IYI A;  1AR4 A;  1G8M A;  1HP8 A;  1YXB A;  2LW7 A;  5AG2 A;  3O9O A;  3P30 A;  1EN5 A;  3P3P A;  2Y69 B;  3PN1 A;  3TXQ A;  2GHY A;  3N2K B;  4JYB A;  2YC0 A;  4NTX A;  2JIZ G;  1K8A W;  2JJ1 G;  1GKF A;  1V54 B;  3DSQ A;  4QPK A;  5EBL C;  4BWA A;  2UXC O;  3K0D A;  4D6T H;  1HWY A;  1MAB G;  1Q6U A;  2UUB O;  2UXN A;  5L3G A;  5KA6 A;  4DV4 O;  3HKB A;  5J2U A;  4L8J A;  1NI8 A;  1QLE C;  3VQX A;  4PA3 A;  3JSN A;  2KSD A;  5EK0 A;  4X88 A;  3ZCC A;  1Q90 D;  3E2E A;  3OW2 U;  1XMO O;  2V7Q G;  3EFF K;  1OCO C;  1VQL V;  1AJN A;  2XAG A;  4PA9 A;  5KX5 A;  1VQP V;  2UUC B;  4K8Z A;  4E2L A;  3UT5 A;  5IWA B;  3HKB B;  5J2U B;  1NR7 A;  4TOI A;  3SJC C;  2LJ2 A;  5J9P C;  2F1M A;  2UUA B;  5BY1 A;  4XDK A;  3CJH B;  1SER A;  2CTQ A;  5H6R A;  3CCL V;  2CH7 A;  4X65 O;  4OPH A;  3D36 C;  3UT5 B;  3CX5 F;  3J80 N;  1YI2 V;  5DED A;  1IXM A;  4PDL A;  1NU1 H;  4UV8 A;  3Q4H A;  4HNA B;  3L9D A;  4QE7 A;  1QVF U;  1AVM A;  3F5T A;  3I5D A;  4NTY A;  2IJI A;  2QJ1 A;  4GKJ O;  1M93 A;  5EIB C;  2Q9L A;  2CH7 B;  3E35 A;  2FYU H;  2ETN A;  4OX9 B;  1PPJ H;  1QR9 A;  3IC9 A;  3CCS V;  3R65 A;  1Q82 W;  1QNM A;  2GTA A;  3CP1 A;  4UCV A;  1FXK C;  2HHH B;  3E22 A;  4PI0 A;  4I55 B;  3HKC B;  3AG1 B;  3QO7 A;  4DV0 O;  5B1N A;  3Q4H B;  2Y69 C;  3E89 A;  3LDD A;  4DV7 B;  1K5S A;  4A5U B;  4UCT A;  1L8D A;  2RNB A;  1TUB A;  4IL6 Z;  2XHB A;  4U7N A;  1V54 C;  2KKW A;  3ZN1 A;  1CPY A;  2JGD B;  4W4K A;  2Y0I A;  3JAR B;  2BSK A;  4B3R B;  1P7G A;  2WLJ A;  5C8Y B;  5DM6 V;  1YVW A;  1AP6 A;  3LDE A;  1TUB B;  1FKA O;  3FB6 C;  2ZT9 B;  3JD4 A;  5BMV B;  1E1Q G;  3ETD A;  3OR7 C;  1GK9 A;  3SYC A;  2IU0 A;  3LSS A;  1VQK V;  3QO5 A;  3JAW B;  4GX0 A;  2LGW A;  4TV8 A;  3N27 A;  1N32 B;  2ZIO A;  1SRY A;  1SES A;  1VEW A;  2JGU A;  4Z2W A;  2CGO A;  1Y67 A;  1R3J C;  2B9Z A;  5DN6 G;  5IE9 A;  4LF5 O;  3JCZ A;  1PP9 H;  2ZR2 A;  5F2V O;  3K3W A;  1BS3 A;  5HFL A;  2CUG A;  2AGA A;  1QQC A;  1QHT A;  1FD9 A;  4RAI A;  4O4J A;  1IBK B;  3DTU B;  2HVK C;  1BQ0 A;  4CH3 A;  4TV9 A;  2F95 B;  1Q8I A;  2AZ2 A;  1N34 B;  4FLT A;  2PUS A;  2M6Y A;  1VMG A;  4AQY O;  4UCO A;  4LF7 B;  1VQ9 V;  4HYO A;  5GW7 A;  1F4M A;  2BOC C;  1COW G;  1HNW O;  2Q0A A;  2IBZ H;  4K0K B;  3RN4 A;  4O4J B;  1VQN V;  1FJG B;  3JYC A;  1DLB A;  4JI4 O;  3K58 A;  3AG1 C;  4FFK A;  1WP8 A;  3FAV B;  2IH3 C;  4X62 O;  1VF5 B;  3SPJ A;  2IW5 A;  3BHP A;  5CBG A;  4CZZ A;  3T1C A;  3L75 H;  4TSF G;  2X0L A;  4FFB A;  3B8N A;  1FFX A;  2QSA A;  1SKV A;  3JAT A;  1BQZ A;  3SPH A;  2QR4 A;  3DXR B;  3OMN B;  2F4V B;  1D5N A;  4Q6G A;  3QF7 A;  5FLX N;  1YJ9 V;  3G6B A;  4LFA B;  5LMU O;  3WU2 Z;  4UB6 Z;  1WLE A;  3W7T A;  3H1L H;  3ABL B;  1FFX B;  5DEC A;  1XL6 A;  2DWD C;  1ROP A;  4UXN A;  5CA0 A;  3JAT B;  4LC1 A;  1Y76 B;  1NS1 A;  2ARH A;  1OV9 A;  1BMF G;  3CXC U;  2LQT A;  3N2G A;  5BZB A;  4GKK B;  3X2Q B;  4YJ2 B;  1CP9 A;  4IGG A;  2UUC O;  1O9G A;  4CH6 A;  1ZUQ A;  2OIG A;  5IWA O;  1GM8 A;  5CA0 B;  5LGU A;  3FX7 A;  3ETG A;  5JCO A;  1Y4M A;  2WAM A;  1DF5 A;  4JAV A;  2CTW A;  1P49 A;  4JI3 B;  2UUA O;  4UB8 Z;  2UXB B;  2C2A A;  2IJJ A;  4BW9 A;  4LFB B;  2QWN B;  2XND G;  2QWP B;  1GN4 A;  3BY6 A;  1H38 A;  3E8G A;  3DC6 A;  4AIL C;  2EZP A;  3AG7 A;  5LYJ A;  4YXW G;  4J10 A;  1I7F A;  4DV3 B;  2Z5U A;  3JD2 A;  3E83 A;  3RFR A;  3AG2 B;  3WG7 B;  4BIZ A;  1N0J A;  2GBO A;  2ZDI C;  4TWK A;  4X20 B;  1NTM H;  4X1K A;  3QNE A;  4CS3 A;  1UPG A;  3M8A A;  4OX9 O;  4MTF A;  3I56 V;  3B8M A;  3ZX6 A;  3CC7 V;  5LYJ B;  3CME V;  4RO2 A;  2B1I A;  3ZJZ A;  3A0B Z;  3E8H A;  3VQY A;  2A9H A;  4DR7 B;  2XTA A;  1SQQ H;  2F93 B;  2ZQM A;  1GN3 A;  2E3C A;  1XHZ A;  4X1K B;  4DV7 O;  3G4S V;  2UXX A;  4EFE A;  3RGB A;  4LF9 B;  3HR0 A;  4MTX A;  2YI9 A;  1PV0 A;  1GN2 A;  1PM9 A;  2KQX A;  2P6J A;  5H6Q A;  4JPR A;  4FPP A;  1JJO A;  4B3R O;  1H2M A;  4FM1 A;  5CBH A;  1HR0 B;  3GB7 C;  4TQF A;  1BE3 H;  2P7T C;  2ADP A;  3CS5 A;  1MOF A;  4GZR B;  3CRA A;  3X2Q C;  4MW3 A;  4PV1 B;  1XMQ B;  4YJ3 A;  1DF4 A;  3K59 A;  3KZI Z;  4BW5 A;  3ZIA G;  4I4T B;  3OMA B;  3AG4 B;  4H13 B;  2IU3 A;  2EJR A;  2ATK C;  1NKD A;  4WBN A;  4G28 B;  4JI8 B;  3OR6 C;  1JOY A;  1JFF A;  3DC5 A;  3MD0 A;  3L72 H;  4PA4 A;  3ABU A;  1P7B A;  3D3Q A;  4NB5 A;  1JMK C;  5IYZ B;  2G38 A;  4YJ3 B;  5LL6 Y;  3PJS K;  4DV5 B;  5JH7 A;  3ZRS A;  5JJE B;  4MVZ A;  1BCC H;  4QJF B;  1GTO A;  1W2B U;  2GSM B;  4CS4 A;  3AG2 C;  5LGN A;  1N34 O;  5J2T B;  5K1P A;  4K3A A;  2PTM A;  2WLH A;  5EYP B;  2L35 A;  3BPZ A;  2AW9 A;  2YXY A;  4LF7 O;  1JQ0 A;  3M99 B;  4J7J A;  4O4I A;  4B3M B;  3H1K H;  3M7M X;  4ZI7 B;  2EIJ B;  4K0K O;  4X64 B;  5JH7 B;  1FFT B;  4X9Q A;  3THO A;  1Y66 A;  2QKS A;  1FJG O;  4MVO A;  4O2B A;  2WLN A;  3K79 A;  2WA3 A;  1SQX H;  3TJT A;  1TGO A;  3SGI A;  2YIA A;  2HEP A;  1D2D A;  2HR3 A;  2K9P A;  4FK5 C;  4LF8 O;  3LUT B;  4PA7 A;  4XBF A;  1K7D A;  3L71 H;  1Q7Y W;  3JD3 A;  1PD3 A;  1R6N A;  2E5L B;  4XDJ A;  1W59 A;  1SZX A;  2F4V O;  4GX2 A;  4TUY A;  1VF7 A;  4DYL A;  4H44 B;  4JAU A;  1DTO A;  4LFA O;  3OEE G;  4JI6 B;  3ICX A;  1UFI A;  2QTS A;  3K0G A;  5HFM A;  4X1I A;  3RT3 C;  5GON B;  1OCC B;  3K5N A;  1GO3 F;  1KP3 A;  3ABM B;  3I55 V;  5EBW C;  4DR6 O;  5LP6 B;  3L73 H;  3J7A U;  4KL1 A;  3AG4 C;  4UVA A;  4KHP B;  5BR8 B;  2JK5 C;  1IDS A;  1W0K G;  4X1I B;  4LFC O;  3TXS A;  1F7Y A;  1V55 B;  4JI3 O;  1IBL B;  3OEH G;  1GAX A;  3W7U A;  5KHH A;  1MA1 A;  4ZOL B;  2ZE8 A;  1P84 F;  2AHY A;  3E86 A;  5IT9 N;  2EZO A;  5GTI Z;  3QTC A;  3A0H Z;  1K73 W;  4F6R B;  1SF9 A;  1W0J G;  2Z0A A;  3SPG A;  2CE4 A;  5B1B B;  3C3S A;  4G2K A;  1JVM A;  1SQV H;  5E1A C;  4UCS A;  1RP3 B;  2QKC A;  4B7E A;  1S5J A;  3A8T A;  5TIS Z;  2DWE C;  4RQE A;  2UXD O;  1VQ5 V;  4B3S B;  2F66 C;  4HAM A;  3A2F A;  3STZ C;  2ZKO A;  3CCM V;  2OWO A;  2R72 A;  4FLW A;  5B66 Z;  5KHK A;  4DR1 B;  4DR7 O;  4JYA B;  3APQ A;  1X59 A;  2Q7E A;  1WA8 A;  2ZIM A;  1MMM A;  1R1B A;  3ML0 A;  4DUZ B;  1FXV A;  2DYR B;  2XAH A;  2AXT Z;  2OTL V;  2QE7 G;  2IJK A;  5L3F A;  4LF9 O;  1GN6 A;  1H2G A;  1R3K C;  4P2Z A;  4GT1 A;  4IIJ A;  3UO3 A;  2JS5 A;  1S5L Z;  5KX5 B;  4FIP C;  5JJJ B;  3SPI A;  2LGQ A;  1D5A A;  5A2Q N;  2W0F C;  1HR0 O;  5IYB O;  4EB6 A;  2HKO A;  5H5N A;  1OCC C;  4LP8 A;  1FPO A;  1H2L A;  2W6I G;  4E4E A;  1AR1 B;  3ABM C;  2HJF C;  4ASU G;  3UCS C;  3W7X A;  2YEV A;  3JCU Z;  5LP6 C;  3FB5 C;  1EN6 A;  3G6E V;  1VIB A;  3B09 A;  2CTR A;  4DV2 B;  3ETQ A;  5GTH Z;  5CA1 A;  4LF6 O;  1N36 B;  2DQ0 A;  5KAI Z;  4NXN B;  3E8B A;  1S76 D;  1XQ8 A;  1YIT V;  1M4U A;  4H0L B;  2ZE6 A;  2YI8 A;  1V55 C;  3RYF A;  3ZHV A;  4JI8 O;  3FFQ A;  5FPO A;  4AHC A;  1M1K W;  2NN4 A;  5KA5 A;  2YEV B;  3RYC A;  3AEI A;  2BTO A;  1WNS A;  1PL4 A;  4DW1 A;  5CBF A;  3NR7 A;  4PDV A;  1GH6 A;  4FM2 A;  3E22 B;  3CRQ A;  3CSX A;  3FD9 A;  3CWB H;  4OPA A;  2P5O A;  5B1B C;  5CB4 A;  3P3N A;  2QTO A;  2LFR A;  3H01 A;  4LCU C;  3RYC B;  1XDC A;  4DUY B;  2RN9 A;  1VQM V;  2YS8 A;  4BAY A;  2F23 A;  1KC8 W;  1Z5W A;  4NXM B;  1M90 W;  2FKX A;  4DK1 A;  5H2F Z;  4GX1 A;  4JI0 O;  3BAB A;  3CE2 A;  5CB4 B;  3ZHQ A;  1PNL A;  3MAQ A;  4DO2 A;  3W7S A;  4JI5 O;  2BSK B;  4NVP A;  4W4L A;  1BT8 A;  4YIP A;  5B3S B;  4ZKI A;  2EIK B;  3T1H B;  3KCY A;  2QKA A;  4JZG A;  1XOU A;  3ZHR A;  1VF6 A;  2Q6A A;  5D5P A;  2VQE B;  3ABT A;  3SR2 C;  1U97 A;  3B40 A;  2DYR C;  3KCX A;  1K33 A;  2W0X A;  1YJW V;  1R73 A;  4JI7 B;  3MHH C;  4TV8 B;  1Y74 A;  1KEC A;  2UU9 B;  1K4D C;  3SYQ A;  2VRZ A;  4I5S A;  4HBN A;  1BHA A;  1YIJ V;  1IBM B;  1UJW B;  1FYJ A;  1J5E O;  3WFV A;  1YSC A;  5A9G A;  4JI6 O;  2BTQ A;  1NH2 D;  3K04 A;  2DMX A;  1YEW A;  1SQB H;  3AK3 A;  1TAE A;  2OCH A;  5JVD A;  4UVC A;  3SJQ C;  4X66 B;  4R7C A;  2KB1 A;  4FLZ A;  3RYH A;  5JQG A;  5CMU A;  2HFE C;  5LOV A;  1ENV A;  2R9A A;  4TV9 B;  2V4D A;  3UM7 A;  2Q68 A;  2WLI A;  5LMN O;  4LNU A;  1WPB A;  1OCZ B;  2YUA A;  5BR8 O;  1BZK A;  1SET A;  2QA4 V;  2BTQ B;  5B1A B;  3CCU V;  5L3C A;  1MSW D;  2IH1 C;  4WFA V;  1OJH A;  1NH2 B;  3JAS A;  3P32 A;  1KQS U;  2DOS A;  3CEI A;  1QR8 A;  2QM7 A;  4J41 A;  3LDC A;  4J42 A;  4DV6 B;  2ZM6 B;  1IBL O;  1KP2 A;  2WLI B;  4PDR A;  4J7Z A;  3TK1 A;  1SA0 A;  2NLJ C;  1K9M W;  1XNR B;  4GYC B;  4YHH B;  5LGT A;  2X7R B;  2PF4 E;  1BL8 A;  1R3L C;  1YCI A;  1QBZ A;  4FFB B;  1KKD A;  1G6U A;  1B04 A;  3K5O A;  3RYI A;  5EZY A;  3FYI B;  3ZMT A;  1KU9 A;  2HP8 A;  3JD1 A;  2ODM A;  2Y4T A;  4B3S O;  3IFX A;  5B3S C;  2EIK C;  4GCZ A;  2H3O A;  2Q0O C;  3B2E E;  5IY5 B;  4PJ0 Z;  4AI8 A;  4ZIB A;  1XUQ A;  1ZLZ A;  2QWR B;  4JYA O;  5EC2 C;  3O65 A;  1JPX A;  5EZY B;  2YIC A;  3IGA C;  4I0X A;  4TQD A;  2P06 A;  2XAF A;  4UFZ A;  4JTA B;  4FJC C;  2N04 A;  3VBB A;  4LF4 B;  2GUZ A;  1IUR A;  1G1X B;  4MVR A;  2F43 G;  4JAS A;  1M9N A;  2QM8 A;  3N2G B;  3WB1 A;  1R6T A;  3T1Y B;  3ZMS A;  3CHX A;  1VF6 C;  4R8C A;  1IZ3 A;  2Y0P A;  3R66 A;  2XAS A;  1Q5O A;  1QVG U;  1RPO A;  1XHX A;  2OCC B;  3ASN B;  3JSL A;  3S3W A;  1Q6H A;  4I0X B;  1F4N A;  1R3I C;  4LWS A;  2K1E A;  1CEZ A;  2RDC A;  2E75 B;  1RPR A;  2ZR3 A;  3RVY A;  3ZMV A;  5BXZ A;  3ZED A;  4MVU A;  1OCZ C;  2OT5 A;  3AK1 A;  5B1A C;  1L0L H;  1YDX A;  2HHH O;  2P4V A;  4P9P A;  4NXN O;  4N23 A;  1PNK A;  4LWS B;  2JEX A;  1OHH G;  3G80 A;  1HNZ B;  4UUJ C;  3CXH F;  4MT8 A;  1IVS A;  4UVB A;  4FMT A;  4JGS A;  1XMO B;  3OUF A;  1SQF A;  2YID A;  1TA8 A;  4JYC A;  3A0R A;  3NXS A;  1KYO F;  3BVO A;  4CS2 A;  3RWR D;  3KG2 A;  3BEH A;  3CD6 V;  3S3X A;  1EBO A;  3MHS C;  4WF9 V;  3QVN A;  4DV1 B;  1AI5 A;  2PY5 A;  3ABL C;  2EBO A;  2HJD A;  4BIU A;  2X6A A;  3F7V C;  2BOB C;  3HB3 B;  4U3F H;  1ZTE A;  2H94 A;  4DUY O;  5KHJ A;  5IJ9 A;  4NXM O;  4JTC B;  4LH7 A;  1XRE A;  2RMK B;  2BE3 A;  3HKD A;  1NTZ H;  2B1G A;  1ZSP A;  1Y6X A;  2VWJ A;  1N32 O;  1GM9 A;  1I5Y A;  4I7Z B;  1AP5 A;  2AHZ A;  2WSS G;  4FLV A;  2ILM A;  4DK0 A;  4FLY A;  2VQE O;  1WB8 A;  3G67 A;  2FB5 A;  1RM1 B;  4O2A A;  3OM3 B;  3BRC A;  4JI7 O;  4GX5 A;  5KHG A;  2UU9 O;  4I50 A;  1SC5 B;  5LA6 A;  4EEQ A;  1EN4 A;  1V9P A;  1VQ8 V;  3ASN C;  1IBK O;  4FZ1 A;  3K9S A;  1DK1 A;  3CYO A;  4PD4 F;  3WG7 C;  4WBN B;  5JCO C;  3JD0 A;  5L3D A;  2Q4P A;  1F23 A;  1JFF B;  4O2A B;  3UKM A;  4LBE C;  3FB7 C;  1I08 A;  5KUK A;  3LNN A;  1MG1 A;  1QU7 A;  3U11 A;  2Q7H A;  2ITD C;  4QPJ A;  4X66 O;  3K9A A;  3STL C;  3CRR A;  1AR5 A;  5LA6 B;  3FB8 C;  4TT3 G;  3ABK B;  4U3J A;  1EFR G;  3H9V A;  4MW8 A;  1OCR B;  3FYE B;  1K92 A;  4MSW C;  3RBZ A;  4WFF A;  1YHQ V;  5IYD O;  4NKG B;  4O4I B;  4I9Q A;  1E1R G;  3CRM A;  1QLE B;  4CC6 A;  3T4D A;  2X6C A;  1YTF D;  2YIB D;  2MK3 A;  2YIB A;  2YXL A;  4DV6 O;  4U3J B;  5L3E A;  5EBM C;  1YF2 A;  4O2B B;  4R50 A;  1Q81 W;  4MTO A;  2D2C B;  4CH4 A;  3BFR A;  1EM1 A;  2EIN B;  3OTF A;  1F51 A;  4WFB V;  5EC1 C;  1AI6 A;  4DRX A;  1S77 D;  3RW0 A;  5H9C A;  1SZT A;  3B77 A;  1YTF B;  1I94 B;  5EIB D;  3ZBH A;  1THZ A;  3ZMZ A;  2PI4 A;  3L74 H;  1Q6I A;  3ETE A;  3UO2 A;  4GLX A;  4TUY B;  3JAL A;  2AZ0 A;  5K1X A;  1KBH A;  2R9R B;  2XT9 A;  4UV9 A;  1AB3 A;  4GKK O;  1L1F A;  1AIL A;  1O9H A;  4JZ2 A;  4JAA A;  4BR6 A;  2A7W A;  1FAF A;  1K3E A;  1QLN A;  1VAR A;  1US6 A;  2ZNJ A;  4QNH B;  4BIO A;  2E76 B;  3C90 A;  3UQ8 A;  3LSQ A;  3VQV A;  2PZS A;  2LW1 A;  3JAL B;  1R6K A;  2UXB O;  2QDO A;  4LFB O;  4PEL A;  2R9I A;  4MVM A;  4X1Y A;  3ASO B;  5FPR A;  1VQ7 V;  2OTJ V;  4DV3 O;  4JI2 B;  2M7W A;  3ZHT A;  1AJP A;  1SQG A;  1M57 B;  2EIJ C;  5CN0 A;  1ZX3 A;  1WP7 A;  3ABK C;  4N21 A;  2VQF B;  4MVS A;  2Q73 A;  4B7K A;  1OCR C;  4X1Y B;  3LNM B;  3G71 V;  5LMU B;  3ZHS A;  2YDE A;  2ADQ B;  3U10 A;  2QEX V;  1I5X A;  1T5E A;  3TET A;  1MNG A;  2Q7G A;  1Q43 A;  4FVM A;  3H1J H;  1HNZ O;  2ZE5 A;  4J11 A;  5LBQ A;  2RCV A;  3CJH A;  2NNU A;  4UCU A;  1KKC A;  2DW4 A;  1NJI W;  2WWW A;  3IC7 A;  2ZD9 A;  4JI1 B;  1U96 A;  4J9Y B;  3OTO B;  2WLL A;  2Q8V A;  2EIN C;  3ZS8 C;  1OZ0 A;  4DV1 O;  1WN7 A;  4CH5 A;  2P90 A;  1H2K A;  1WA8 B;  2PYL A;  4HNA A;  3OT7 A;  1A32 A;  1JCH A;  2JDI G;  2HLD G;  3WB0 A;  5E79 Z;  3ZRX A;  2N05 A;  1JR9 A;  2WLL B;  4IIJ B;  1AI4 A;  4PHZ A;  1XBL A;  3AK2 A;  4X89 A;  3K57 A;  3D8C A;  1JA8 A;  1XMQ O;  4I55 A;  3HKC A;  1Y74 B;  5L3B A;  5B1O A;  1KB9 F;  4DR5 B;  2ITC C;  2ZNI A;  2A06 H;  3CCQ V;  3VOU A;  4EB6 B;  2QGN A;  1VQ6 V;  3CC4 V;  4U7O A;  1PL0 A;  1RFY A;  2CAZ C;  4YY3 B;  4P9O A;  3K06 A;  5LHI A;  4D7S A;  4O4L A;  2Q5Z A;  3OFN G;  3BAA A;  3EVK A;  1B3Q A;  2Y4U A;  3K5L A;  1GMG A;  2XAJ A;  2JGD A;  5CA1 B;  2RJZ A;  3ASO C;  4DV5 O;  5IJ0 A;  3JAR A;  3BA9 A;  3RYF B;  5C8Y A;  4MVQ A;  1MZE A;  1B06 A;  2MW2 B;  4O4L B;  1M57 C;  4LH6 A;  2QWQ B;  3VQW A;  5BMV A;  3D3I A;  2PGG A;  1NQT A;  1GRJ A;  4B3M O;  4I9W A;  1LUW A;  3JAW A;  1HNX B;  4X64 O;  3TGU H;  3SJB C;  2W6J G;  5IJ0 B;  2OIE A;  4DR3 B;  2CTP A;  1JJ2 U;  4PA6 A;  5LHG A;  1NTK H;  4B3T B;  2FTK A;  2VWK A;  3ZRW A;  4IHJ A;  2EIM B;  3SYP A;  4Z1V A;  2E5L O;  2X6B A;  5ITZ A;  5JJN B;  2ZE7 A;  1FS0 G;  3AG3 B;  4Q20 A;  1BHB A;  2GV9 A;  2DE0 X;  3HKE A;  4FM0 A;  1H8E G;  3F7Y C;  3JAM N;  3E8F A;  4GUN A;  1XL4 A;  2EX3 A;  3CRC A;  3ZRW B;  4H33 A;  1HDJ A;  4IHJ B;  4KFM A;  1Q3E A;  1WB7 A;  1BGY H;  1XEQ A;  4OXS A;  2ZDI A;  5B5E Z;  2Q69 A;  2DYS B;  3J81 N;  4P30 A;  2FML A;  4WCE V;  1I94 O; 
#chains in the Genus database with same CATH homology
 4QGP A;  2OIG A;  2A3Q A;  3CRA A;  2Q73 A;  2Q9L A;  1Y6X A;  1YXB A;  2P06 A;  1YVW A;  2Q5Z A;  2A7W A;  1VMG A;  3CRC A;  2GTA A;  2YXH A;  5IE9 A;  3C90 A;  2Q4P A;  2OIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...