1VMPA

Structure of the anti-hiv chemokine vmip-ii
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the anti-HIV chemokine vMIP-II.
pubmed rcsb
source organism Human herpesvirus 8
molecule tags Antiviral protein
molecule keywords PROTEIN (ANTI-HIV CHEMOKINE MIP VII)
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vmpA00
2NZ1D 2NYZD 2JP1A 3I91A 4HAEA 2KEDA 2B2TC 1B53A 1PFMA 1ESRA 1AZPA 1X32A 2MJ8A 5EQ0A 4IURA 4ZKBB 4ZKCB 1BNZA 4MHEA 1HA6A 2KOLA 1HUNA 4XT3B 1G6ZA 4CJ1B 4R9WA 1GUWA 4RAUC 1XYIA 2XIWA 1VMCA 4HCSA 2X6GA 2EE1A 1U4MA 1VMPA 2B2TA 1RODA 1O80A 1SAPA 1S4ZA 1RTNA 5D65A 1F9PA 1PFNA 1IKMA 2RVLA 5D14A 1G91A 3F2UA 1B2TA 1HUMA 2L12A 1F2LA 4IUTA 4R8IA 1B4OA 2Q8RE 4NW2A 3GV3A 2DY8A 4IUUA 5E4XA 2B2WC 2B2YA 2RSOA 2B2VA 2HDLA 2L11A 1HRJA 1BO0A 2FJ2A 1PDQA 2MP1A 3MWYW 1CA5A 1DOLA 1JICA 1KNAA 1QNKA 1NCVA 1U4RA 1IL8A 2EPBA 1NR4A 1Q3LA 2KEEA 1B50A 3IFDA 1WTWA 5T1GA 1AZQA 4HSVA 3I8ZA 3TN2A 2B2YC 1BF4A 1X3QA 1AP0A 3P7JA 2EOTA 4UAIA 2HCCA 1E0BA 4IUVA 2K1BA 2N55A 2RA4A 3ONAB 4OIKA 1WTRA 1EQTA 1HFGA 4RA8A 5EPLA 1SSOA 5CBEE 3N52A 1PLFA 2K04A 4U68A 1CA6A 5COYA 3GV6A 5CORA 1TVXA 2K05A 2L1BA 1F9SA 1DONA 2X6LA 1WTPA 1U4PA 1XX8A 2HDMA 3I3CA 2B2WA 4ZAIA 4O42A 1J8IA 1CM9A 1F9QA 1WD1A 4CJ0B 2R3ZA 4X3SA 1QG7A 5EPKA 4ZK9B 3I90A 1NAPA 5CBAE 2JYOA 2J7ZA 2KVMA 3HP3A 1U4LA 1WD0A 2D9UA 1MSGA 1RJTA 3TZDA 1G2TA 1O7YA 2L4NA 1RTOA 1WVLA 1HHVA 2B2VC 2FMMA 1ILPA 3H91A 2B2UC 4X3TA 2FINB 4LMQD 4QUFA 1PFBA 5AFWA 1X3PA 1WTVA 1O7ZA 3IL8A 1C8CA 2RSNA 2SDFA 2H1EA 2IL8A 5DNFA 3DM1A 1DOKA 3FDTA 4RWSC 2DY7A 1EL0A 2NWGA 3FPUB 4IUPA 1BBXC 3QO2A 3KUPA 3R93A 1B3AA 1MI2A 3G7LA 1EIHA 5JJZA 4XDXA 4ZLTF 1NR2A 5EPJA 4X3UA 1ILQA 2KECA 3DEOA 4XT1B 1LV9A 2BDNA 1IKLA 1EOTA 1WTQA 2HCIA 2HUGA 2KUMA 1QE6A 1HFNA 5E4WC 2K03A 2M2LA 1DOMA 2MPMA 2N88A 5EJWA 1JE4A 1M8AA 3D6WA 1ML0D 4DN4M 3SVMA 4CJ2C 2K01A 2FHTA 2K28A 2L9HA 4HEDA 1ICWA 2FFKB 4OIJA 1A15A 5EKIA 5CMDA 2B2UA 1G2SA 2CVRA 3DEPA 3LWEA 1SDFA 2MGSA 1KNEA 1WTXA 4MN3A 4QUCA 1MSHA 1J9OA 1DZ1A 1F9RA 2Q8TA 1WTOA 1ZXTA 1MGSA 2X69A 4X3KA 3MTSA 3Q6SA 2VXWA 3UI2A 5T1IA 1EIGA 1RHPA 4IUQA 3KBXA
chains in the Genus database with same CATH superfamily
4CBVA 3I4MB 1ZYRD 3BVGA 3ULLA 3I2ZA 1M90C 3E6ZX 1L2FA 3OPOA 3PUWA 2F0PA 3KDFA 4UHVA 4AH6A 4A75A 2KOLA 3H15A 1UEAB 2N78A 3K0XA 5C3EG 2D0OA 1H9MA 2FMCA 3WOFA 1RIPA 2A6HD 1GUGA 1JOQA 5M3FG 2VQEQ 1HTPA 3K0YA 1PFNA 3SK8A 5I6WA 2BE5C 1S40A 2EYJA 2Q8RE 1RL2A 4C3IG 5DAUA 4BBSB 5KYLA 5LHY1 3GTOB 3S17B 2UXBQ 3NBIA 2Y0SG 4P74A 3URYA 1YHAA 2EYPA 2JEBI 3GDEA 4A3FG 3S14B 1I50B 2EPBA 2R7ZH 3A7LA 2E2JH 3HS0C 3KF8B 1A8VA 4PNYA 1E2ZA 4KLKA 3AFPA 2NZHA 5CV5A 1EU4A 4UAIA 3OTOL 1LTBD 2Z8LA 2QEXA 1AE3A 5EBDA 2AWOA 5EPLA 1HR0L 2F0UA 4AIMA 4FF4A 5CV6A 1LTLA 4F87A 4POGA 1STBA 2PMZB 2Y0SE 4K5WA 3I3CA 3UDXA 4WJWA 1WD1A 1TS2A 2IX1A 1LYLA 5IGGA 4DR3L 4GKKQ 5EGTA 2BH2A 4NPSA 2LMCB 1KHIA 5LMNW 1WTVA 2CWAA 2EJMA 1PYWD 5AFWA 4A3DH 2F52A 1OXXK 3S14H 4AQYQ 1I4QA 1OO9B 1XXGA 3FKIB 5A35A 2KQ3A 2VUMB 1EIHA 4RCNA 3IAYA 2IX0A 4ZYSA 1EQQA 1QVCA 2XTIA 4XT1B 4J8QA 1IKLA 4LNQA 1DGSA 2HUGA 4OWTB 1W3SA 3OIPA 3KLSX 2A6HC 2L5TA 2PQEA 2FHTA 5I2XA 1YI2A 4OO1G 3OOCA 3STBC 5KEEA 2G9HD 4ALPA 2AUJD 1SROA 1TWAB 4B9XA 4N9TA 3QOLA 4X6AH 3TSSA 2JA7G 3F2DA 4X62Q 1YHBA 5LL6S 1K8OA 3T53B 4Z9CB 2F0FA 2CKZB 1CT1D 1V1PB 4ZKCB 2M00A 3HOXG 5DLQE 1GUWA 5C5MA 1H9SA 1IBKL 1K83B 5L37A 5KNDA 2EZVA 2B63B 2UUCQ 4Q0FA 5IYDG 3T1HL 2Q2TA 3F2UA 1XWEA 3T16A 2NVQB 1ET9A 1S5BD 5CV7A 2RSOA 2E2HB 3J81E 3NENA 3TS0A 4OO1I 3PUVA 4P73A 2UU9L 1W2BA 1DOLA 4ME5A 4DV1L 3UDGA 3PO2B 5K36H 1LO5D 5E7NA 3VR2A 1WTWA 2K52A 3KDFB 4B3SL 1JT8A 4NMZA 3NELA 1EY8A 3G71A 2KCCA 1WYDA 5DM73 3VR3A 1IL2A 1Y1WH 3WDNA 3GTLH 2F0VA 4JC0A 2K05A 2L1BA 4J1MA 4H02A 2JA5H 2B2WA 1FJGQ 1NAPA 2RQXA 2PZWA 4IUNA 5C44H 1S5DD 2XSCA 4F8MA 5M3FB 1MBYA 1I50H 1VS0A 3S2HH 1HNXL 3FDTA 1SNMA 1N8RC 3EIVA 4GN3B 4DR6Q 1ASZA 3HOYB 2Z6BA 3NQTA 3AU7A 3S1MB 4RGTA 1JE5A 4QMGA 3HOXH 5FLXc 3GTJH 2HCIA 3KLSA 1LTAD 2NVYB 4DR5L 3JAMi 1ML0D 4EQPA 2XRSD 4OIJA 3MZ5A 5EKIA 2F0OA 2F4IA 1Z47A 3HOWB 1I3QH 2NBFA 1G2SA 3DEPA 3VYRA 3VYUA 1KNEA 2VB2X 3QB3A 1O7LA 2JK8A 2GVAA 4K5VA 1LT5D 1O7IA 3PUZA 3OW2A 1V1QA 4M1UB 1F77A 1RHPA 3KJOA 3W5OA 1XTCD 1B8AA 1QUQB 3K5OA 1B53A 1ESRA 4K6DA 5EQ0A 4DKAC 3PO2H 1PYBA 3HZXA 3ND9A 4DU9A 1SYGA 1WCMG 4PV1C 1XYIA 2ENBA 1Q86C 1PH6A 1FJGL 2C9OA 2KHIA 4JI3L 3ULJA 1VQEA 1RDPD 5IWAL 4YWLA 4DAMA 1EY7A 1RCVD 2AHOB 3NQIA 2F0GA 2CHBD 1FNUA 2RVLA 2Z4IA 4TVAB 1IKMA 4KJNA 1FGUA 1YNJC 4LF6Q 1Y1WG 1X3EA 2PI2A 2DY8A 1PYSB 2B2WC 2LXJA 4IPHA 1GXDC 3KLWA 3RZOH 1BO0A 2ZTDA 3BZKA 2ZJRA 3PO3H 5CV4A 5FLMG 2A73B 3PQIA 4JBJA 3BZCA 3CXCA 3PGZA 3NTKA 2R92H 4DF7A 1GVPA 3V2TA 1LTID 3SGIA 1VQ5A 1SEBD 3KYHC 2F0QA 3S1NB 1KD1C 1VQJA 4LF7Q 3BU2A 3KOJA 1PTOH 2Q2HA 2HDMA 2XNAC 1QCBD 4ZAIA 1HCZA 5IYBG 5EKLA 4ABNA 5CBAE 2J7ZA 4CDEC 4GKJQ 1EOVA 1HQMC 3A8JE 3HOWG 3FHWA 3J80E 2IL8A 1PH7A 3PO3B 1EL0A 2K7VA 2DJGC 3G7LA 3KF6B 5C44B 2MFIA 1GUTA 2F0WA 3OMCA 2N3SA 3BG3A 1PZJD 4IPDA 2HT1A 1VQ4A 3S24A 2N88A 3K7UC 3U4VA 3M9BA 1A3VA 1A3TA 3W3AA 3A0JA 1BVSA 1NE3A 1C48A 2LY7A 3KK7A 3CPFA 2WAQB 2YYZA 3VYTA 2E5LL 4A3JH 4L63B 3NSWA 5E3FA 1YNXA 2D62A 4JPBW 4NDXA 3P20A 1LTSD 2HD3A 3HOVG 4B3RL 3M4PA 2AQ1B 4R9WA 1UE5A 3AB9A 3Q24A 2JA9A 3FMCA 3S17H 1A63A 4Y7NH 3HOWH 1JQYD 4DV5L 4P75A 1JJ2A 4FXGC 1L0YB 4R8NA 3RD4A 2SOBA 3NEMA 1WFQA 3PIO3 3CCJA 1YNNC 2QILA 3F1ZA 1VDZA 3A74A 2JA6B 3KLRA 5IYBH 2UUBQ 3H0GG 1YHQA 1RKNA 2VUMG 1NUCA 2WKDA 4DV1Q 1MHWC 3QOJA 2Z1CA 3GTGH 1AE2A 3TN2A 1YBYA 4KHVA 1K0SA 1X3QA 3J81j 1GUSA 1H9RA 3NBHA 1AP0A 3AEVA 1CKNA 2A69D 4KI0A 4B3SQ 5KNBA 4OWWB 4A3JG 4OIKA 3DM3A 3M85A 1S5FD 3HG9A 4OEMB 3N52A 1HR0W 4DV2Q 2JN4A 1N9WA 3HOZB 2R93B 1SMYD 1HXYD 3OSOA 4GS3A 1N34L 3A8KE 4JW0A 4A3DG 1QG7A 2AMCB 4JBWA 3I90A 4J15A 1PMRA 1D7QA 2BA1A 3PF4A 1GHKA 2E75C 1VQ7A 3W1BA 3K8AA 2E2JB 3MFYA 1OTCA 1I4XA 2LFNA 3A8IE 4QIWB 5DM63 2OXPA 4A3GG 3QO2A 4CDCC 5M3FH 4LF8Q 1NR2A 2NVQH 2E2IH 2BDNA 1VQ9A 3V96A 3EBEA 3HOVH 1PTOF 1KTKA 1TWCH 4C3JH 3HOZH 1M1KC 3MEFA 3ZJYC 4IO9A 1CSQA 1MIUA 5J3BA 3D0FA 1BKBA 4JYAQ 1FNVA 2YU9B 3MTSA 4JI8L 5JJIA 2K6AA 4ZK9B 1PVOA 2JQOA 4B08A 4K8JA 5M3MB 3IRBA 4IURA 1GO3E 3BYYB 1PRTC 3AYHB 2EYMA 3STBD 1HUNA 4XT3B 2I5LX 3CMEA 4BXXH 4X66L 3RZOB 3NUCA 4LF7L 4YCWA 4KHPL 3CPWA 1E2WA 4I7AA 5TSSA 3OW7A 2A69C 5BR8L 4PZ8A 4JI3Q 2SEBD 5ELNA 1VQDA 5IWAQ 2R6GA 3W1GA 5IP9G 2L12A 3JAML 2IT1A 1XTDA 3T4AC 4NW2A 4G7HC 3E0JA 2F3WA 2JSOA 2R93G 3P75A 1HJPA 3C46A 4KD3A 2VQEL 4I65A 1HRJA 5IY0A 4DPGA 2JA6G 4LFCQ 5ELEA 3EJIA 3MA2B 1IBLQ 2AKWB 2MUYA 5EBCA 1XPOA 1SR3A 1JORA 1JB7A 1FNWA 2PQAB 3CU7A 2EOTA 3R3OA 4A3KB 3GTPB 2ZTCA 1CTMA 3BDOA 1YNJD 1NTGA 2EYOA 5C3EB 3BVZA 3E9IA 4EVOA 3A56A 2X6LA 4BXXG 2JA7H 1I4RA 4J6HA 2L15A 3HOVB 3MXNB 1QJOA 1EIYB 1SNDA 2KVMA 3I55A 1BCPB 1Q46A 5JJKA 3RZDB 3RNUA 4CDFC 3UE1A 1PRTB 3CC2A 4HIMA 1MJCA 1VQFA 2K75A 1K8AC 2WB1G 1CFMA 3U50C 3HKZG 4IFDI 5IT9L 1DJRD 4NXNL 3GTKH 4IPGA 1VQBA 2ZXPA 5IGDA 3S16B 2JA6H 2K5WA 1Q7YC 3ERQA 3I4NH 3DEOA 4LUOA 3G4SA 3M3YH 1QNUA 5C44G 2TSSA 3CC7A 4BY1G 4FNFA 1L1OB 1OXVA 1UE7A 1SYDA 3M4YA 4IALA 1B44D 3GTLB 4HIOA 4Y7NB 4HJ8A 2B29A 3R8BA 3H3VH 1F9RA 1CQFA 4QF4A 2B63G 1NMGA 5ELBA 1EIGA 4K2LA 4HAEA 4ID6A 4JBMA 5C3XA 1QUQA 5NUCA 3CCVA 3QJYA 1XNQQ 1Q8IA 2A74C 1HZBA 4C1NK 4WORA 1IW7C 2QDBA 5GAGC 3TDQA 2DNEA 1EQRA 2NVTH 4KY6A 4ME3A 1EYDA 2R7ZG 4P71A 3RUZA 1EZ8A 4CGYB 2BA0A 2A6EC 1PHJA 3MHBA 4A3BB 5LMNQ 3K5NA 3S15H 3Q0AA 1CA5A 2FJ2A 3A5ZB 4YHHL 4JV5Q 1I4PA 1JICA 3S2HB 2ZT9C 1Q1EA 4P72A 3I4MH 4LFBQ 1Q8KA 3BDCA 2B2YC 5M5YH 1ZEQX 3A54A 4NP5A 4IUVA 1HTLD 2WFWA 2A68D 1HFGA 2KENA 1KC8C 4R4OA 5F2DA 3D6CA 2EXDA 4JI4Q 1SYBA 1V9PA 2PZTA 3MEHA 3HOZG 4TSSA 2R3ZA 2XN9C 4DR7Q 1CZWA 4X3SA 4JI8Q 3Q8DA 3CCMA 3HP3A 4OONA 3MVVA 1YJ9A 5I6YA 1XNQL 4NB3A 1G2TA 1I6HB 4PMBA 1K73C 1KXLA 3DHQA 2RSNA 5HGQA 3CCLA 3J80i 4Q5VA 5C4XB 2PW7A 4JI7L 1PZKD 3OYYA 1V1OA 3MXGA 4LF5Q 3LNNA 1ILQA 1QVGA 3H3VI 3HOUG 1YITA 4HCEA 3GO5A 3BS1A 5IGBA 3FVQA 2WAQE 1WTHA 3NWTA 1PV4A 4QJFA 1IYVA 1VQCA 5AJ3Q 1SNQA 1KAWA 1EY9A 3S1NH 2CVRA 1STHA 1WTXA 1KIXA 3C1EA 4A76A 1MSHA 2A6ED 3VR6A 4C1NI 3K57A 1I6VC 3J7AF 1EEID 1DYQA 1DCZA 1J5EL 4RG1A 3PMFA 2NZ1D 3I91A 1JB3A 1TXYA 1S5CD 1I5FA 4FVMA 4ZKBB 2F1MA 3IKJA 3RN2A 4GN4B 4QGUA 2GVBA 5C4ZA 2LSSA 1HNWL 1TWAH 4RAUC 3NP8A 4BBSH 4QB4A 3PIP3 1KL9A 4X66Q 4XYOA 1HR0Q 2MHVA 4KKTA 4RHSA 1EYGA 5I4DA 1VQ6A 4BBRB 3S1QH 4RGOS 5FLXE 4Y52H 3QIAA 4A3LH 4KKUA 5C5LA 4O1NA 1EUJA 4OGQC 1G51A 3GTQB 2Y0SB 1PTOC 3FKIH 4IFDH 4LF5L 1IXRA 1V1PA 4A3BG 3MXUA 1GUOA 1VQLA 1U4RA 3SDZA 2B8FA 1CHQD 1Y1VG 3I8ZA 1X55A 4JVZA 3PIOA 2NN6I 2Q8IB 4PZ6A 5JPNC 3EFXD 1P8LA 3TBIB 3X3MA 5JJLA 3PO2G 1SSOA 5CBEE 1CUKA 2EJFC 4JCVE 1VCIA 4BY1H 1HQRD 2KCTA 1CKOA 1F2YA 1GD7A 2VB3X 3VR4A 4HJ7A 2XRQD 1PH8A 2KCNA 3A55A 2O2LD 4DUYQ 4DAVA 1LLRD 2E2DC 3TZDA 1WVLA 3HKZE 2YV5A 1Z6HA 5H1SE 5J22A 5C4XH 2PMZE 5ISRA 3I72A 1DOKA 2E8GA 1Y8NB 5C0XJ 1C0AA 2RKSA 2F0KA 4GKJL 5JJZA 4A3BH 5BN3A 1JC7A 5JVG3 4RFBA 3E9HA 4UY8C 4PMWA 3R2IA 1WTQA 2NN6G 2UUCL 3CHBD 4HN7A 3EVQA 2K03A 4DR2L 2F0LA 3W2DA 1H9SB 4XXEA 4RKBA 2ICEC 4XIGS 1OXSC 4JV5L 2D0PA 4WJ3M 1E3PA 1PH2A 5CR3A 3E0EA 1VQKA 1E24A 5EKKA 4APVA 1R9TB 4A3LG 4YY3L 1ESFA 5IE8A 1AZPA 1TS3A 5I2YA 1ONLA 3CCSA 4O0AA 1BR9A 2QCPX 3S15B 2WKCA 2EE1A 3TS2A 2EY6A 3GP7A 3J80L 1SYCA 1N36Q 1RTNA 1TKWB 4DNIA 4B3TQ 2V1CC 1Y69U 3TQYA 2L0CA 4UP8A 4X65Q 5JEAH 4JI5L 1A0IA 3S1MH 4ZCKA 4A3MH 1T5XD 2WB1E 1HH2P 4N8X1 2K4KA 3GV3A 2NUCA 3AMUA 4A3FB 4K8IA 4OL7A 3DLLA 1A3UA 2CW0D 1BCPD 5HURA 4PQXA 4C3HH 4IZ8A 4I7ZC 1IL8A 4FYDA 1FR3A 1D5MC 3CCEA 1QVFA 3D31A 5E1FA 4DR1L 4FXDA 1E0BA 1CZGA 3EA6A 3ONAB 5KYIA 1NNXA 4IJHA 4DFAA 5AJ3L 3CD6A 1I3QB 4MNOA 1YEZA 2F0NA 4LF9Q 4DR4L 1F9SA 4BY7H 4L5TA 2NZOA 2A1AA 3S2DH 4H7BA 4LFAL 2JYOA 1K3RA 2D9UA 3QR8A 1HHVA 4CDDC 1L0XB 3HGBA 4XQQA 3NPPA 2CQAA 2EY2A 1PFBA 5BN5A 3G6EA 2G5DA 1KAAA 3NTIA 2H1EA 3KF6A 4UDUC 1SNCA 1UE1A 1ENAA 4C56C 1NY4A 1BQQT 1STAA 2DN8A 4H0LC 3U9SA 4BWGB 4BA2I 2EQSA 2JJQA 2B3GA 2GN5A 4JI2L 5IP9H 3D6WA 3L9AX 1SRUA 1A15A 1VF7A 1YNND 2K33A 1K8GA 5J39A 1SNOA 3HRZC 4HIKA 1I4GA 1Z7TA 1QOHA 1ZXTA 5KRUA 1U5KA 3Q6SA 5M9OA 3ICEA 1L0WA 2JP1A 2F4VQ 1EQVA 2MJ8A 4BBSG 4C3HB 1PFSA 4YWMA 1D2BA 2YTVA 1JCKB 1STGA 3M7GA 5M5XB 2NVXB 2MNAA 5IYCH 1FD7D 2B2TA 4X64Q 1SAPA 3DWAA 1H9KA 3HFZB 4DAYB 2PPBC 4GOPC 1SMYC 3RLFA 1AW7A 1G91A 3GTJB 1C4QA 1LTRD 1B2TA 2IHEA 1HNZQ 1AEXA 1XNRQ 2NVTB 4KHPQ 4IUUA 2B2YA 4PG3A 1K0RA 2ZM6L 4A3IG 1PH5A 4HMIA 2L55A 2MP1A 3MWYW 1NSNS 1QNKA 1NMFA 3R2TA 5A2QL 1X9NA 1A2TA 1X6OA 2KEEA 1HPCA 5T1GA 2EY1A 1NJIC 2MO1A 4UPAA 4YCVA 2H5XA 1L1OC 5C0XH 5ELCA 1GM5A 5JVH3 4OO1H 5FO8B 5IYDH 1W6JA 1IZ6A 5I9OA 2ZJPA 4HJ5A 3H6MA 2UXBL 1A6XA 1LT6D 2C35B 4C2MH 5C3EH 3I4MG 5K36G 3DUZA 1F9QA 4JG2A 1SNPA 4OELB 3BJUA 3J80c 1TWHH 1T9HA 1WD0A 1G291 2L4NA 2R92B 3PO3G 1M4VA 1C8CA 4HTHA 4X64L 4KK7A 1QZHA 3NTHA 1WJJA 4CHTB 3M4OB 1PRTD 4IUPA 4DV0L 4A3EG 2XWBB 4XDXA 1XMQL 1XJVA 3E5SA 4C3IB 5I9PA 4MTNA 4GLAC 1N32Q 5E4WC 1DOMA 1VF5C 2BDOA 4K0KQ 1TWFB 2Z4HA 4LAAA 4POFA 3PCOB 3J81c 2L9HA 4NXNQ 4IOAA 5G3LD 4MZ9A 2CWPA 2B2UA 1VQPA 3MFGA 1KRSA 1SDFA 1Y8OB 1RD9D 2OQ0A 3SK5A 1JOOA 2Q8TA 4LF6L 4YCUA 5DEHA 3KJPA 4IUQA 3GTGB 2JEAI 2AWNA 1X32A 4CKCA 3DWPA 4DUZL 1STEA 4WFN3 5C4JB 1E1TA 2ASBA 4A93G 4LF9L 3GTMH 4WJ4A 1VMCA 2AQ3B 5KGUA 2I5MX 1KQSA 1EY6A 4DV7L 1U4MA 1VMPA 1RODA 1X3FA 2RBMA 4DV2L 3M7NA 2PYKA 4DGZA 1N34Q 1IBML 5D14A 3JC66 4IFDJ 2E2IB 2EDGA 2F0IA 4R4QA 5E4XA 3Q23A 4JI6Q 2R61A 3PIPA 2ZTEA 4DA2A 1XMQQ 1D1IA 3T13A 3J7YW 3MAQA 4F7XA 1NR4A 1IHZA 4RGNA 3IFDA 5IGCA 4K0KL 3ITPA 1BOSA 1I6HH 2F0TA 1E2VA 4A3JB 5CV8A 2K5QA 1TWHB 3I56A 3I7FA 2RA4A 3G48A 4G4KA 2H4OA 2RHQB 1PLFA 3K5MA 1CQVA 4K6LA 4BY1B 4C3JB 5GAHC 1JJGA 5JOBA 4R4TA 3LWUA 4LUZA 4LWCA 3J7AV 2TMPA 5C4XG 2RHSB 4A3KH 3GTPH 1EFWA 1MSGA 2RDFA 2NTTA 4OX9L 4JYAL 2B2UC 4MTKA 2MQHA 1X3PA 2EJGC 4JI4L 2R92G 4OHJA 4ULLA 2BCOA 3F8TA 1JR0D 2PO4A 2QW7A 4DR7L 3OIQA 1BBXC 3CMAA 4YWKA 3R93A 1MI2A 4ILWA 4A3MB 1TQOA 2Z6KA 2IPKD 3TP5A 4B3MQ 4BBRH 4DV5Q 3SVMA 2VNUD 5ELOA 4C2MB 4CJ2C 2K50A 4DR3Q 1FVIA 3VYSA 4TRDA 1TR5A 2PI2E 2I5HA 3I4LA 3PUXA 4LJZC 4MN3A 4BS9A 4LFCL 3CP0A 3D8GA 1MGSA 4KY7A 2WIIB 2JA5G 3UI2A 2UUBL 3SK4A 3CW2C 3M4QA 2Q2UA 4DR5Q 1B9MA 2F0MA 2RCFA 3B6YA 1Z9FA 1OXUA 1L1OA 1Y8PB 4K14A 4A3GB 2K14A 2N49A 3MC0B 1PH1A 1S4ZA 1KLUD 1TWFH 2D5DA 4KD4A 1K3BC 5G3LF 5IGFA 1JOKA 3X3NA 4C3IH 1Y1VB 4A3IH 1F2LA 2NB0A 4G57A 4X62L 1CHPD 1E22A 2KCMA 4DAYA 4F88A 2B2VA 4XYQA 1EWIA 3V05A 1WOCA 2SNMA 1R9TH 2G9DA 3SXHA 2BH8A 5HGTA 2K5HA 1QZGA 2QA4A 1IW7D 2K1BA 2N55A 3OWFA 1VQ8A 1QILA 3VDYA 2RDGA 2ATWA 2K04A 3GV6A 1TVXA 2DUDA 3NK9A 3D3RA 1DXMA 2EY5A 4GNXA 2Z6KC 4KMUC 3AQQA 1JWMD 4DV4Q 1STNA 1PH4A 3FP9A 1R4PB 1U4LA 1TS5A 3CCRA 1SJED 1HZAA 2FMMA 1ILPA 3KFUA 3NBHB 5FLXL 2WP8J 1EFID 2A19A 1A62A 2HHHQ 2PNHA 4DV3L 4TQUS 2UUAL 2HIVA 2ES2A 2E5LQ 2IJ0A 1EWHA 1Y1VH 1SYEA 3MXPA 2O4XA 4RKLA 1BCPF 3I4NG 3EN2A 3OWEB 2OQKA 4AYBB 4M8AA 1B1ZA 1ICWA 4PMCA 4MIUA 5JAVA 2KHSA 2UXCQ 1AZQA 2MGSA 3VR5A 5D3DA 2B8GA 4JBKA 4EGVA 2X69A 5M5YB 3CKIB 2OF1A 4DR6L 2B2TC 4AQYL 2C5CA 2LKVA 1VQGA 3H0GB 5IOCA 3PUYA 3J7ZC 3H94A 4MHEA 5J1ZA 4GOPA 4A3EB 2XIWA 1EU3A 4C3JG 4DV4L 3D4DA 2DNCA 2HQLA 1G6PA 4HCSA 4BY7G 1K28A 3LX0A 1EEFD 2IW3A 1FGBD 4EX5A 1B70B 4OWXB 4FF2A 1BBUA 4NKLA 1F9PA 4YY3Q 3H3VC 4LW1A 1TS4A 2YTYA 4L5RC 5KIXA 1HA5A 2IHFA 4OX9Q 1H9JA 4UP7A 4K2KA 4CKBA 3CCQA 1IBMQ 3SE0A 1B4OA 4YIJA 4E6IA 4A3GH 4B9WA 4B3RQ 4G7OC 3K80C 1VQOA 1MJEA 3CC4A 1HNZL 1NCVA 1Q81C 5M3MH 1ZYRC 4X65L 2CQOA 3TZUA 3MXNA 1BF4A 4NXML 2XWJB 4FF1A 1VQAA 2YU9H 1TT2A 1FL0A 1OXTA 1EZ6A 1W6KA 4LF4L 1Y14B 2F3VA 5LMUL 2NTSA 1MKHA 1CA6A 5CORA 1SJHD 1C7YA 2R93H 3T1HQ 1Y1WB 1DM0B 1F2MA 2J4XA 1JWUD 4AYBE 1ZKOA 3KBGA 2PCFB 3H91A 2F0JA 1K8MA 3Q22A 3TREA 1Q12A 1J5EQ 1KDBA 2A8VA 2R7ZB 5IIFA 3ND8A 4IN3A 3DM1A 5ELFA 1SYFA 1FYCA 5C0XI 2OEOA 2IY5B 2KJXA 2NWGA 3J81i 3TP7A 3EROA 3GTQH 3T1YL 4ZLTF 5IT9c 5EAYA 3L7ZC 3NE5B 2KECA 3NXWA 1LV9A 5M3MG 4ZRZA 1XPUA 2RCNA 1HFNA 1QE6A 3S1QB 3PSIA 2OTLA 3CQZB 4B3ML 3K81C 4HEDA 3D4RA 4GOPB 1AN8A 5M5XH 2PW5A 1EY5A 3GTMB 1KRTA 1II3A 2WB1B 3SK6A 4A3EH 4FO2A 2E76C 1XPRA 2VL6A 3L2PA 5LMUQ 2VXWA 5LMNL 4H44C 2NYZD 1SE3A 2QKIC 2I46A 1HNXQ 2PZUA 1BNZA 1PRTF 1G6ZA 2FXQA 3RR5A 1C9OA 3TMEA 1UUPA 4DUZQ 1O80A 1Q82C 1CI3M 5CYUA 5GQOA 1N33Q 4JOIC 2F3IA 3PF5A 1B9NA 1LACA 3GQBA 1Q90A 2YTXA 1LT3D 4DV7Q 4GZYC 1X56A 3K6OA 4DUYL 3TEHB 4GNXC 2B63H 1X3GA 3S9WA 1X65A 3HOYH 2A68C 5LL6X 1LM0A 2HDLA 4GN5A 4CKEA 3K7AB 2HHHL 2EXZA 1DD2A 3FKIG 4A3MG 4IFDG 1TIID 2EIFA 4EQNA 4R4CA 5BR8Q 3NWSA 5ELDA 1UEBA 1BBWA 3S1RB 3I73A 3P7JA 4L8JA 4KTAA 3TRZA 1TY0A 1PH3A 3EQLC 4KKSA 1EYAA 3RLOA 1BDOA 2KBNA 5FJ8G 4V0BA 5KNCA 3E3XA 2SNSA 1EWCA 3P1HA 1J8IA 2WACA 4O42A 1CM9A 5FO9B 4RMFA 5EPKA 3SHLA 3M3YB 1CK1A 2ZXOA 3FEWX 2Z9HA 3K59A 1RTOA 2CW0C 4HSPA 3BZDB 3VA7A 1U9RA 2JA8G 3SR1A 5CC4A 1O7ZA 4BA1I 1SE4A 1KDAA 3K7AH 2EYHA 4FDBA 4DK0A 3JAMc 1AH9A 2ICIA 2K5NA 3CCUA 3DWQA 4A3FH 1ENCA 2OTJA 2CCZA 1ENFA 1KDCA 4X3UA 3N6RA 3RN5A 1JWSD 5A2QE 5FKAC 1N36L 4IQZA 3J81L 3OMGA 1D6EC 2M2LA 2O5IC 2MPMA 5BN4A 3CRKC 1XMOQ 1AFPA 3H09A 1LABA 2JA5B 2IX3A 1TU2B 2K28A 1PTOB 4N8FA 3A7AB 4IPCA 4L5QA 2Q2IA 2UXCL 4S3SA 3HKZB 2DJFC 1DZ1A 3H0GH 3SEBA 3ZYYX 2FFKB 4DV6Q 2KEDA 1IYJB 1PFMA 3IFTA 1I94L 4ZUJA 3HOYG 2EYLA 1HA6A 3HOUH 4DR1Q 4CJ1B 4HMJA 1S72A 4A3CG 2K32A 1T5EA 2VY3A 3GTOH 2X6GA 2UXDQ 5D65A 1TWCB 2F0SA 4DR4Q 1O78A 3CQZH 4DK3C 4H13C 4A3KG 4DXGA 4ZQ3A 1GHJA 4R4IA 2VQFQ 1HUMA 4DK1A 3C1FA 4LFAQ 5FLMH 4IUTA 1WCMH 5GROA 2VUMH 5FJ8H 1IYUA 3GTKB 2L11A 2OCEA 5C4JH 1KNAA 4O2DA 2B39A 2V4DA 2ALYB 4L6TB 1VQMA 3QG1A 5CGKA 2K5VA 2KA7A 1XMOL 4JI0L 3CF5A 2K5DA 2QGQA 1SE8A 4NXMQ 1H95A 1UWVA 1CSPA 3TP8A 5FO7B 1EYCA 1U0LA 4DAPA 4JI2Q 4RCOA 5D3IB 4IOCA 4A93H 5IGEA 4YHHQ 1XX8A 1HZ9A 2QEJC 1I94Q 4KN4C 3WOEA 2VZAA 4R8IA 2F0DA 3PV0A 3K58A 4LFBL 1SXTA 2JE6I 1UE6A 1ET6A 1O7YA 1RF2D 2XVSA 1PXUA 4K5XA 4QL5A 1GOZA 2R7FA 2FINB 4LMQD 1S3OA 1UNSA 2SDFA 3WWVA 1VQHA 5DNFA 1YIJA 2ID0A 2DY7A 3RMHA 3ERSX 3FPUB 2VQFL 1JJCB 3J7A5 5EPJA 3OHXC 3BDLA 1P16A 4R1JA 5IT9E 1Q1BA 1EOTA 1B3QA 1VQNA 4A3CH 5M5WH 5C3WA 2MO0A 4DV3Q 2UUAQ 1JE4A 4FP5D 4DN4M 2JA7B 1YJWA 2K01A 4OXPA 1E7ZA 5GAEC 1SMXA 4JOIA 5C4HA 5JEAJ 2ZJQA 1QB5D 1GKHA 3T56B 4QUCA 2CFMA 2OT2A 1EIFA 2BE5D 2RDHA 1IBKQ 1LUZA 4QCLA 3U9OA 1QWYA 1SLJA 3UE0A 4KV6A 4QQBX 5FOBB 4JK1C 3F2BA 2E2HH 3DMUA 3TP6A 3LGJA 2NVYH 4JI1L 3L3OC 5M5WB 1N33L 4G7ZC 1E1OA 1STYA 4KHZA 2UU9Q 3HOXB 4ODGA 1YVCA 1TWGH 4LUVA 3UDIA 1WI5A 3M4OH 1LTTD 1PDQA 5JPMC 4KY5A 5C6AA 5IP7H 1SFOB 2JA8H 4A4IA 1S5ED 1I4HA 1Q3LA 2BOSA 2WV6D 1B50A 4XQNA 2D2CC 4HSVA 4DV0Q 1SE2A 4HJAA 2AQ2B 1WTRA 4XQJA 2VS1A 4RA8A 3D4WA 2VW9A 2O5JC 4U68A 2QF7A 1PTOD 4HIDA 1UAPA 3GD7A 4A93B 4V190 1WTPA 1U4PA 1V43A 5GADC 4LF4Q 2KHJA 1A2UA 4RHRA 4N9PA 4C3HG 4DK6C 2I0QA 1BUVT 4TKOB 2AUKA 1D1KA 1CKMA 1RJTA 3CRLC 3A5UA 3L0OA 3S1RH 3S16H 1D8LA 2PQAA 2N8NA 1F2ZA 3O13A 3U58A 1SFOH 2JA8B 3QWNA 1IBLL 3DXJC 4JI1Q 2WINB 4UP9A 1SN8A 1ASYA 2CH4W 2PNRC 4P2CB 3BVMA 2CH4A 2DGYA 4RH6A 1WCMB 2F4VL 3I70A 1TY2A 2E74C 4QY7A 4A3IB 1EY0A 1NBWA 1B7YB 2F0EA 1K9MC 4ZUIA 2HIXA 4CJ0B 3C3LA 5EJWA 4IJLA 3NHHA 1M8AA 2I07B 3OTOQ 3T1YQ 4EQOA 3I4OA 3AFQA 2P5ZX 4BBRG 1MD2D 1WTOA 1XNRL 1EY4A 1PA6A 3RLNA 1SBBB 2Z0SA 5IODA 4WRDA 2ZM6Q 3LWEA 4GKKL 5HY6A 4JI7Q 4KJOA 4DV6L 1KABA 2R7DA 4DR2Q 3ER0A 1BCPC 1X54A 4XTCS 2OWOA 1D5ZC 2QDLA 5IP7G 4HJ9A 2UXDL 1ICFB 3CAMA 4LK1C 3UDFA 2EVBA 4FXKC 3HKSA 3I4NB 5K5PA 4GLVB 2LXKA 4PZ7A 4FF3A 2NN6H 2NVXH 4KN7C 2XGTA 1GUNA 3G6JB 2HQEA 3HOUB 1JMCA 2WAQG 2J0TD 5IYCG 1HNWQ 1GJXA 2LS01 1YJNA 4B3TL 2JXMB 4JI0Q 2HCCA 4JI5Q 3U4ZA 1EQTA 1D5XC 4L5SA 3FRPB 4BY7B 1DONA 1YZ6A 3VA5A 1N32L 2GA4B 1G8ZD 3KF8A 3FPPA 5CV9A 4LF8L 4GLXA 3HEJA 2B2VC 4X3TA 2F0HA 4QUFA 4DNRB 3IL8A 4U673 1VQIA 4EQ5A 3T51B 1PZID 4RWSC 2F03A 2IWHA 1V8QA 4DXFA 1KLGD 4A3DB 3K5LA 2EYFA 3KUPA 1B3AA 4AYBG 1BXTA 1TWGB 3RZDH 3C2PA 1HZCA 2RF4A 3JAME 4DNTB 1J6QA 4GNXB 1LT4D 2M9VA 2KUMA 3BYTB 3S2DB 4RGMA 5FK9C 1K83H 5CMDA 3ULPA 4HR7B 1CKNB 2A5HA 5JEAG 5C0XG 4JI6L 2ZXRA 1J9OA 1R4QB 1LTGD 4QIWE 4X3KA 1PH9A 5T1IA 3F2CA 5COYA 3KBXA
chains in the Genus database with same CATH topology
4CBVA 3I4MB 1ZYRD 3BVGA 3E6ZX 3OPOA 3PUWA 2F0PA 2KOLA 1UEAB 1H9MA 2FMCA 3WOFA 2A6HD 1GUGA 1JOQA 1HTPA 3K0YA 1PFNA 3SK8A 5I6WA 2BE5C 2EYJA 2Q8RE 4C3IG 5DAUA 4BBSB 5KYLA 5LHY1 3GTOB 3S17B 3NBIA 3S14B 3URYA 2EYPA 2JEBI 1I50B 2EPBA 3A7LA 3HS0C 4PNYA 1E2ZA 5CV5A 1EU4A 4UAIA 1LTBD 2Z8LA 5EBDA 2AWOA 5EPLA 2F0UA 4FF4A 5CV6A 4F87A 1STBA 2PMZB 4K5WA 3I3CA 4WJWA 1WD1A 1TS2A 2IX1A 5IGGA 5EGTA 2LMCB 1WTVA 2EJMA 5AFWA 1PYWD 1OXXK 1I4QA 1OO9B 1XXGA 3FKIB 5A35A 2KQ3A 2VUMB 1EIHA 4RCNA 3IAYA 2IX0A 4ZYSA 4XT1B 4J8QA 1IKLA 2HUGA 3OIPA 3KLSX 2A6HC 2L5TA 2PQEA 2FHTA 5I2XA 4OO1G 3OOCA 5KEEA 2G9HD 2AUJD 1TWAB 4B9XA 4N9TA 3QOLA 3TSSA 1K8OA 5LL6S 3T53B 4Z9CB 2F0FA 1CT1D 1V1PB 4ZKCB 2M00A 1GUWA 5C5MA 1H9SA 1K83B 2EZVA 5KNDA 2B63B 4Q0FA 3F2UA 1XWEA 3T16A 2NVQB 1ET9A 1S5BD 5CV7A 2RSOA 2E2HB 3J81E 4OO1I 3PUVA 1DOLA 4ME5A 3PO2B 5K36H 1LO5D 3VR2A 1WTWA 4NMZA 1EY8A 2KCCA 5DM73 3VR3A 3WDNA 2F0VA 2K05A 2L1BA 4J1MA 2B2WA 1NAPA 2RQXA 2PZWA 4IUNA 1S5DD 2XSCA 4F8MA 5M3FB 1MBYA 3FDTA 1SNMA 3HOYB 3NQTA 3AU7A 3S1MB 4RGTA 4QMGA 2HCIA 3KLSA 1LTAD 2NVYB 1ML0D 4EQPA 2XRSD 4OIJA 3MZ5A 5EKIA 2F0OA 2F4IA 1Z47A 3HOWB 2NBFA 1G2SA 3VYRA 3DEPA 3VYUA 1KNEA 2VB2X 3QB3A 1O7LA 4K5VA 1LT5D 3PUZA 4M1UB 1F77A 1RHPA 1XTCD 3K5OA 1B53A 1ESRA 4K6DA 5EQ0A 3ND9A 3HZXA 4DU9A 1SYGA 4PV1C 1XYIA 2ENBA 2C9OA 1RDPD 1EY7A 1RCVD 3NQIA 2F0GA 2CHBD 1FNUA 2RVLA 2Z4IA 1IKMA 4KJNA 1YNJC 2DY8A 2B2WC 1GXDC 1BO0A 5CV4A 2A73B 3NTKA 4DF7A 3V2TA 1LTID 1SEBD 2F0QA 3S1NB 1PTOH 2HDMA 2XNAC 1QCBD 4ZAIA 1HCZA 5EKLA 4ABNA 5CBAE 2J7ZA 1HQMC 3A8JE 3J80E 2IL8A 3PO3B 1EL0A 2K7VA 3G7LA 5C44B 1GUTA 2F0WA 3OMCA 3BG3A 1PZJD 2N88A 1A3TA 1A3VA 3W3AA 1C48A 2LY7A 3KK7A 2WAQB 2YYZA 3VYTA 4L63B 3NSWA 5E3FA 2D62A 4NDXA 3P20A 1LTSD 2AQ1B 4R9WA 3AB9A 3Q24A 3FMCA 1JQYD 4FXGC 1L0YB 4R8NA 3RD4A 2SOBA 3PIO3 1YNNC 2QILA 1VDZA 2JA6B 3KLRA 1RKNA 1NUCA 2WKDA 3QOJA 2Z1CA 3TN2A 4KHVA 1X3QA 1GUSA 1H9RA 3NBHA 1AP0A 2A69D 4KI0A 5KNBA 4OIKA 3M85A 1S5FD 3HG9A 3N52A 3HOZB 2R93B 1SMYD 1HXYD 3OSOA 3A8KE 1QG7A 4JBWA 3I90A 1PMRA 2BA1A 1GHKA 2E75C 2E2JB 3MFYA 1I4XA 2LFNA 3A8IE 5DM63 4QIWB 2OXPA 3QO2A 1NR2A 2BDNA 3V96A 1PTOF 1KTKA 1FNVA 2YU9B 3MTSA 4ZK9B 2K6AA 4B08A 4K8JA 5M3MB 4IURA 3BYYB 1PRTC 2EYMA 1HUNA 4XT3B 3RZOB 3NUCA 1E2WA 5TSSA 3OW7A 2A69C 2SEBD 2R6GA 2L12A 3JAML 2IT1A 3T4AC 4NW2A 4G7HC 3E0JA 2F3WA 2JSOA 3P75A 3C46A 4KD3A 1HRJA 4I65A 5ELEA 3EJIA 3MA2B 2MUYA 5EBCA 1JORA 1FNWA 3CU7A 2EOTA 3R3OA 4A3KB 3GTPB 1CTMA 3BDOA 1YNJD 2EYOA 5C3EB 3BVZA 4EVOA 3A56A 2X6LA 1I4RA 4J6HA 3HOVB 1QJOA 1SNDA 2KVMA 1BCPB 3RZDB 1PRTB 1CFMA 4IFDI 5IT9L 1DJRD 2ZXPA 5IGDA 3S16B 2K5WA 3ERQA 3DEOA 1QNUA 2TSSA 4FNFA 1OXVA 1SYDA 3M4YA 4IALA 1B44D 3GTLB 4Y7NB 3R8BA 1F9RA 1CQFA 4QF4A 5ELBA 1EIGA 4K2LA 4HAEA 4ID6A 5C3XA 5NUCA 3QJYA 1Q8IA 2A74C 4C1NK 4WORA 1IW7C 2QDBA 3TDQA 2DNEA 4KY6A 1EYDA 3RUZA 1EZ8A 4CGYB 2BA0A 2A6EC 3MHBA 4A3BB 3K5NA 3Q0AA 1CA5A 2FJ2A 1I4PA 1JICA 3S2HB 2ZT9C 1Q1EA 3BDCA 2B2YC 1ZEQX 3A54A 4NP5A 4IUVA 1HTLD 2A68D 1HFGA 5F2DA 3D6CA 1SYBA 2PZTA 3MEHA 4TSSA 2R3ZA 2XN9C 1CZWA 4X3SA 3HP3A 3MVVA 5I6YA 1G2TA 1I6HB 4PMBA 3DHQA 2RSNA 4Q5VA 5C4XB 2PW7A 1PZKD 1V1OA 3MXGA 3LNNA 1ILQA 4HCEA 3GO5A 3BS1A 5IGBA 3FVQA 3NWTA 1IYVA 1SNQA 1EY9A 2CVRA 1STHA 1WTXA 3C1EA 1MSHA 2A6ED 3VR6A 4C1NI 3K57A 1I6VC 3J7AF 1EEID 1DYQA 1DCZA 3PMFA 2NZ1D 3I91A 1JB3A 1S5CD 4FVMA 4ZKBB 2F1MA 3IKJA 5C4ZA 4RAUC 3NP8A 4QB4A 3PIP3 4XYOA 2MHVA 4KKTA 4RHSA 5I4DA 4BBRB 4RGOS 5FLXE 3QIAA 4KKUA 5C5LA 4O1NA 4OGQC 3GTQB 2Y0SB 1PTOC 4IFDH 1V1PA 3MXUA 1GUOA 1U4RA 3SDZA 2B8FA 1CHQD 3I8ZA 2NN6I 2Q8IB 5JPNC 3EFXD 3TBIB 3X3MA 1SSOA 5CBEE 2EJFC 1VCIA 1HQRD 1F2YA 2VB3X 3VR4A 2XRQD 2KCNA 3A55A 2O2LD 4DAVA 1LLRD 2E2DC 3TZDA 1WVLA 1Z6HA 5J22A 5ISRA 3I72A 1DOKA 1Y8NB 5C0XJ 2RKSA 2F0KA 5JJZA 5BN3A 1JC7A 5JVG3 4RFBA 4PMWA 3R2IA 1WTQA 2NN6G 3CHBD 4HN7A 3EVQA 2K03A 2F0LA 3W2DA 1H9SB 4XXEA 4RKBA 2ICEC 4XIGS 1OXSC 5CR3A 5EKKA 1R9TB 1ESFA 1AZPA 1TS3A 5I2YA 1ONLA 1BR9A 2QCPX 3S15B 2WKCA 2EE1A 2EY6A 3GP7A 3J80L 1SYCA 1RTNA 1TKWB 1Y69U 2L0CA 5JEAH 1T5XD 3GV3A 2NUCA 3AMUA 4A3FB 4K8IA 4OL7A 1A3UA 2CW0D 1BCPD 5HURA 4PQXA 4IZ8A 4I7ZC 1IL8A 4FYDA 1FR3A 1D5MC 3D31A 5E1FA 4FXDA 1E0BA 1CZGA 3EA6A 3ONAB 5KYIA 4DFAA 1I3QB 2F0NA 1F9SA 4H7BA 2JYOA 2D9UA 1HHVA 1L0XB 3HGBA 4XQQA 3NPPA 2CQAA 2EY2A 1PFBA 5BN5A 1KAAA 3NTIA 2H1EA 4UDUC 1SNCA 1ENAA 4C56C 1BQQT 1STAA 2DN8A 4H0LC 3U9SA 4BWGB 4BA2I 3D6WA 3L9AX 1A15A 1VF7A 1YNND 2K33A 5J39A 1SNOA 3HRZC 1I4GA 1Z7TA 1QOHA 1ZXTA 5KRUA 3Q6SA 5M9OA 2JP1A 1EQVA 2MJ8A 4C3HB 1D2BA 1JCKB 1STGA 3M7GA 5M5XB 2NVXB 1FD7D 2B2TA 1SAPA 3DWAA 1H9KA 2PPBC 1SMYC 3RLFA 1AW7A 1G91A 3GTJB 1C4QA 1LTRD 1B2TA 1AEXA 2NVTB 4IUUA 2B2YA 4HMIA 2L55A 2MP1A 3MWYW 1NSNS 1QNKA 3R2TA 5A2QL 1A2TA 2KEEA 1HPCA 5T1GA 2EY1A 5C0XH 5ELCA 5JVH3 4OO1H 5FO8B 1W6JA 5I9OA 3H6MA 1A6XA 1LT6D 5K36G 3DUZA 1F9QA 1SNPA 1WD0A 1G291 2L4NA 2R92B 1M4VA 1C8CA 4HTHA 4KK7A 3NTHA 4CHTB 3M4OB 1PRTD 4IUPA 2XWBB 4XDXA 3E5SA 4C3IB 5I9PA 5E4WC 1DOMA 1VF5C 2BDOA 1TWFB 2Z4HA 4LAAA 2L9HA 5G3LD 2B2UA 3MFGA 1SDFA 1Y8OB 1RD9D 3SK5A 1JOOA 2Q8TA 5DEHA 4IUQA 3GTGB 2JEAI 2AWNA 1X32A 4CKCA 3DWPA 1STEA 4WFN3 5C4JB 1VMCA 2AQ3B 5KGUA 1EY6A 1U4MA 1VMPA 1RODA 2RBMA 3M7NA 2PYKA 4DGZA 5D14A 4IFDJ 2E2IB 2EDGA 2F0IA 5E4XA 3Q23A 2R61A 4DA2A 3MAQA 1D1IA 3T13A 3J7YW 4F7XA 1NR4A 1IHZA 4RGNA 3IFDA 5IGCA 3ITPA 1BOSA 2F0TA 1E2VA 4A3JB 5CV8A 2K5QA 1TWHB 2RA4A 4G4KA 2H4OA 1PLFA 3K5MA 1CQVA 4K6LA 4BY1B 4C3JB 5JOBA 3LWUA 3J7AV 2TMPA 1MSGA 2RDFA 2NTTA 2B2UC 1X3PA 2EJGC 4OHJA 4ULLA 2BCOA 1JR0D 2PO4A 3OIQA 1BBXC 3R93A 1MI2A 4ILWA 4A3MB 1TQOA 2IPKD 3TP5A 3SVMA 2VNUD 4C2MB 4CJ2C 3VYSA 4TRDA 1TR5A 3I4LA 3PUXA 4LJZC 4MN3A 4BS9A 3D8GA 4KY7A 1MGSA 2WIIB 3UI2A 3SK4A 1B9MA 2F0MA 1OXUA 1Y8PB 4K14A 4A3GB 3MC0B 1S4ZA 1KLUD 2D5DA 4KD4A 5G3LF 5IGFA 1JOKA 3X3NA 1Y1VB 1F2LA 2NB0A 4G57A 1CHPD 4DAYA 4F88A 2B2VA 4XYQA 3V05A 2SNMA 2G9DA 3SXHA 5HGTA 1IW7D 2K1BA 2N55A 3OWFA 1QILA 2RDGA 2K04A 3GV6A 1TVXA 3D3RA 3NK9A 1DXMA 2EY5A 4KMUC 1JWMD 1STNA 1R4PB 1U4LA 1TS5A 1SJED 2FMMA 1ILPA 5FLXL 2WP8J 1EFID 4TQUS 2IJ0A 1EWHA 1SYEA 3MXPA 2O4XA 4RKLA 1BCPF 3OWEB 4AYBB 4M8AA 1B1ZA 1ICWA 4PMCA 4MIUA 5JAVA 2KHSA 1AZQA 2MGSA 3VR5A 5D3DA 2B8GA 4EGVA 2X69A 5M5YB 3CKIB 2OF1A 2B2TC 2C5CA 2LKVA 3H0GB 5IOCA 3PUYA 3H94A 4MHEA 5J1ZA 4A3EB 2XIWA 1EU3A 4C3JG 3D4DA 2DNCA 4HCSA 3LX0A 1EEFD 2IW3A 1FGBD 4FF2A 4NKLA 1F9PA 3H3VC 1TS4A 5KIXA 1HA5A 1H9JA 4K2KA 4CKBA 3SE0A 1B4OA 4YIJA 4E6IA 4B9WA 4G7OC 1NCVA 1ZYRC 3TZUA 3MXNA 1BF4A 4FF1A 2XWJB 1TT2A 1OXTA 1EZ6A 1W6KA 2F3VA 2NTSA 1CA6A 5CORA 1SJHD 1Y1WB 1DM0B 1F2MA 2J4XA 1JWUD 1ZKOA 3KBGA 2PCFB 3H91A 2F0JA 1K8MA 3Q22A 1Q12A 1KDBA 2R7ZB 5IIFA 3ND8A 4IN3A 3DM1A 5ELFA 1SYFA 5C0XI 1FYCA 2OEOA 2KJXA 2NWGA 3TP7A 3EROA 4ZLTF 3L7ZC 3NE5B 2KECA 3NXWA 1LV9A 4ZRZA 1HFNA 1QE6A 3S1QB 3CQZB 4HEDA 3D4RA 1AN8A 2PW5A 1EY5A 3GTMB 1II3A 2WB1B 3SK6A 4FO2A 2E76C 2VXWA 4H44C 2NYZD 1SE3A 2QKIC 2I46A 2PZUA 1BNZA 1PRTF 1G6ZA 3TMEA 1UUPA 1O80A 1CI3M 5CYUA 1B9NA 1LACA 3GQBA 1Q90A 1LT3D 4GZYC 3K6OA 3S9WA 2A68C 5LL6X 2HDLA 4CKEA 3K7AB 2EXZA 1DD2A 4IFDG 1TIID 4EQNA 3NWSA 5ELDA 3S1RB 3I73A 3P7JA 4L8JA 4KTAA 1TY0A 3EQLC 4KKSA 1EYAA 1BDOA 4V0BA 5KNCA 2SNSA 1EWCA 3P1HA 1J8IA 2WACA 4O42A 1CM9A 5FO9B 5EPKA 3SHLA 3M3YB 1CK1A 2ZXOA 3FEWX 3K59A 1RTOA 2CW0C 4HSPA 3BZDB 3VA7A 1U9RA 3SR1A 5CC4A 1O7ZA 4BA1I 1SE4A 1KDAA 4DK0A 2EYHA 2ICIA 3DWQA 1ENCA 1ENFA 1KDCA 4X3UA 3N6RA 1JWSD 5A2QE 5FKAC 4IQZA 3J81L 3OMGA 1D6EC 2M2LA 2O5IC 5BN4A 2MPMA 3CRKC 1AFPA 3H09A 1LABA 2JA5B 2IX3A 1TU2B 2K28A 1PTOB 3A7AB 4S3SA 3HKZB 1DZ1A 3SEBA 3ZYYX 2FFKB 2KEDA 1PFMA 3IFTA 4ZUJA 2EYLA 1HA6A 4CJ1B 4HMJA 2K32A 1T5EA 2X6GA 5D65A 1TWCB 2F0SA 1O78A 4H13C 4DXGA 4ZQ3A 1GHJA 1HUMA 4DK1A 3C1FA 4IUTA 1IYUA 3GTKB 2L11A 1KNAA 2B39A 2V4DA 4L6TB 3QG1A 5CGKA 2KA7A 2K5DA 3TP8A 5FO7B 1EYCA 4DAPA 4RCOA 5D3IB 5IGEA 1XX8A 2QEJC 4KN4C 3WOEA 4R8IA 2F0DA 3PV0A 3K58A 1SXTA 2JE6I 1ET6A 1O7YA 1RF2D 2XVSA 1PXUA 4K5XA 1GOZA 2FINB 4LMQD 1UNSA 2SDFA 5DNFA 2ID0A 2DY7A 3RMHA 3FPUB 5EPJA 3OHXC 3BDLA 5IT9E 1Q1BA 1EOTA 5C3WA 1JE4A 4FP5D 4DN4M 2JA7B 2K01A 5C4HA 5JEAJ 1QB5D 3T56B 4QUCA 2OT2A 2BE5D 2RDHA 4QCLA 3U9OA 1QWYA 4KV6A 5FOBB 4JK1C 3DMUA 3TP6A 3L3OC 5M5WB 4G7ZC 1STYA 4KHZA 3HOXB 4ODGA 1LTTD 1PDQA 5JPMC 4KY5A 5C6AA 1SFOB 1S5ED 1I4HA 1Q3LA 2BOSA 2WV6D 1B50A 4XQNA 2D2CC 4HSVA 1SE2A 2AQ2B 1WTRA 4XQJA 4RA8A 3D4WA 2O5JC 4U68A 2QF7A 1PTOD 1UAPA 3GD7A 4A93B 4V190 1WTPA 1U4PA 1V43A 1A2UA 4RHRA 4N9PA 4C3HG 1BUVT 4TKOB 2AUKA 1D1KA 1RJTA 3CRLC 1F2ZA 3O13A 2JA8B 3QWNA 3DXJC 2WINB 2PNRC 3BVMA 4P2CB 4RH6A 1WCMB 3I70A 1TY2A 4A3IB 2E74C 1EY0A 2F0EA 4ZUIA 4CJ0B 3C3LA 5EJWA 3NHHA 1M8AA 2I07B 4EQOA 1MD2D 1WTOA 1EY4A 1SBBB 5IODA 4WRDA 3LWEA 4KJOA 1KABA 1BCPC 4XTCS 1D5ZC 4LK1C 2EVBA 4FXKC 3I4NB 5K5PA 4FF3A 2NN6H 4KN7C 1GUNA 3G6JB 2HQEA 3HOUB 2J0TD 1GJXA 2LS01 2JXMB 2HCCA 1EQTA 1D5XC 3FRPB 4BY7B 1DONA 3VA5A 2GA4B 1G8ZD 3KF8A 3FPPA 5CV9A 3HEJA 2B2VC 4X3TA 2F0HA 4QUFA 4DNRB 3IL8A 4U673 3T51B 1PZID 4RWSC 2F03A 2IWHA 1V8QA 4DXFA 1KLGD 4A3DB 3K5LA 2EYFA 3KUPA 1B3AA 1BXTA 1TWGB 3C2PA 3JAME 4DNTB 1LT4D 2M9VA 2KUMA 3BYTB 3S2DB 4RGMA 5FK9C 5CMDA 4HR7B 2A5HA 5JEAG 5C0XG 2ZXRA 1J9OA 1R4QB 1LTGD 4X3KA 5T1IA 5COYA 3KBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZ1 D;  2NYZ D;  2JP1 A;  3I91 A;  4HAE A;  2KED A;  2B2T C;  1B53 A;  1PFM A;  1ESR A;  1AZP A;  1X32 A;  2MJ8 A;  5EQ0 A;  4IUR A;  4ZKB B;  4ZKC B;  1BNZ A;  4MHE A;  1HA6 A;  2KOL A;  1HUN A;  4XT3 B;  1G6Z A;  4CJ1 B;  4R9W A;  1GUW A;  4RAU C;  1XYI A;  2XIW A;  1VMC A;  4HCS A;  2X6G A;  2EE1 A;  1U4M A;  1VMP A;  2B2T A;  1ROD A;  1O80 A;  1SAP A;  1S4Z A;  1RTN A;  5D65 A;  1F9P A;  1PFN A;  1IKM A;  2RVL A;  5D14 A;  1G91 A;  3F2U A;  1B2T A;  1HUM A;  2L12 A;  1F2L A;  4IUT A;  4R8I A;  1B4O A;  2Q8R E;  4NW2 A;  3GV3 A;  2DY8 A;  4IUU A;  5E4X A;  2B2W C;  2B2Y A;  2RSO A;  2B2V A;  2HDL A;  2L11 A;  1HRJ A;  1BO0 A;  2FJ2 A;  1PDQ A;  2MP1 A;  3MWY W;  1CA5 A;  1DOL A;  1JIC A;  1KNA A;  1QNK A;  1NCV A;  1U4R A;  1IL8 A;  2EPB A;  1NR4 A;  1Q3L A;  2KEE A;  1B50 A;  3IFD A;  1WTW A;  5T1G A;  1AZQ A;  4HSV A;  3I8Z A;  3TN2 A;  2B2Y C;  1BF4 A;  1X3Q A;  1AP0 A;  3P7J A;  2EOT A;  4UAI A;  2HCC A;  1E0B A;  4IUV A;  2K1B A;  2N55 A;  2RA4 A;  3ONA B;  4OIK A;  1WTR A;  1EQT A;  1HFG A;  4RA8 A;  5EPL A;  1SSO A;  5CBE E;  3N52 A;  1PLF A;  2K04 A;  4U68 A;  1CA6 A;  5COY A;  3GV6 A;  5COR A;  1TVX A;  2K05 A;  2L1B A;  1F9S A;  1DON A;  2X6L A;  1WTP A;  1U4P A;  1XX8 A;  2HDM A;  3I3C A;  2B2W A;  4ZAI A;  4O42 A;  1J8I A;  1CM9 A;  1F9Q A;  1WD1 A;  4CJ0 B;  2R3Z A;  4X3S A;  1QG7 A;  5EPK A;  4ZK9 B;  3I90 A;  1NAP A;  5CBA E;  2JYO A;  2J7Z A;  2KVM A;  3HP3 A;  1U4L A;  1WD0 A;  2D9U A;  1MSG A;  1RJT A;  3TZD A;  1G2T A;  1O7Y A;  2L4N A;  1RTO A;  1WVL A;  1HHV A;  2B2V C;  2FMM A;  1ILP A;  3H91 A;  2B2U C;  4X3T A;  2FIN B;  4LMQ D;  4QUF A;  1PFB A;  5AFW A;  1X3P A;  1WTV A;  1O7Z A;  3IL8 A;  1C8C A;  2RSN A;  2SDF A;  2H1E A;  2IL8 A;  5DNF A;  3DM1 A;  1DOK A;  3FDT A;  4RWS C;  2DY7 A;  1EL0 A;  2NWG A;  3FPU B;  4IUP A;  1BBX C;  3QO2 A;  3KUP A;  3R93 A;  1B3A A;  1MI2 A;  3G7L A;  1EIH A;  5JJZ A;  4XDX A;  4ZLT F;  1NR2 A;  5EPJ A;  4X3U A;  1ILQ A;  2KEC A;  3DEO A;  4XT1 B;  1LV9 A;  2BDN A;  1IKL A;  1EOT A;  1WTQ A;  2HCI A;  2HUG A;  2KUM A;  1QE6 A;  1HFN A;  5E4W C;  2K03 A;  2M2L A;  1DOM A;  2MPM A;  2N88 A;  5EJW A;  1JE4 A;  1M8A A;  3D6W A;  1ML0 D;  4DN4 M;  3SVM A;  4CJ2 C;  2K01 A;  2FHT A;  2K28 A;  2L9H A;  4HED A;  1ICW A;  2FFK B;  4OIJ A;  1A15 A;  5EKI A;  5CMD A;  2B2U A;  1G2S A;  2CVR A;  3DEP A;  3LWE A;  1SDF A;  2MGS A;  1KNE A;  1WTX A;  4MN3 A;  4QUC A;  1MSH A;  1J9O A;  1DZ1 A;  1F9R A;  2Q8T A;  1WTO A;  1ZXT A;  1MGS A;  2X69 A;  4X3K A;  3MTS A;  3Q6S A;  2VXW A;  3UI2 A;  5T1I A;  1EIG A;  1RHP A;  4IUQ A;  3KBX A; 
#chains in the Genus database with same CATH topology
 4CBV A;  3I4M B;  1ZYR D;  3BVG A;  3ULL A;  3I2Z A;  1M90 C;  3E6Z X;  1L2F A;  3OPO A;  3PUW A;  2F0P A;  3KDF A;  4UHV A;  4AH6 A;  4A75 A;  2KOL A;  3H15 A;  1UEA B;  2N78 A;  3K0X A;  5C3E G;  2D0O A;  1H9M A;  2FMC A;  3WOF A;  1RIP A;  2A6H D;  1GUG A;  1JOQ A;  5M3F G;  2VQE Q;  1HTP A;  3K0Y A;  1PFN A;  3SK8 A;  5I6W A;  2BE5 C;  1S40 A;  2EYJ A;  2Q8R E;  1RL2 A;  4C3I G;  5DAU A;  4BBS B;  5KYL A;  5LHY 1;  3GTO B;  3S17 B;  2UXB Q;  3NBI A;  2Y0S G;  4P74 A;  3URY A;  1YHA A;  2EYP A;  2JEB I;  3GDE A;  4A3F G;  3S14 B;  1I50 B;  2EPB A;  2R7Z H;  3A7L A;  2E2J H;  3HS0 C;  3KF8 B;  1A8V A;  4PNY A;  1E2Z A;  4KLK A;  3AFP A;  2NZH A;  5CV5 A;  1EU4 A;  4UAI A;  3OTO L;  1LTB D;  2Z8L A;  2QEX A;  1AE3 A;  5EBD A;  2AWO A;  5EPL A;  1HR0 L;  2F0U A;  4AIM A;  4FF4 A;  5CV6 A;  1LTL A;  4F87 A;  4POG A;  1STB A;  2PMZ B;  2Y0S E;  4K5W A;  3I3C A;  3UDX A;  4WJW A;  1WD1 A;  1TS2 A;  2IX1 A;  1LYL A;  5IGG A;  4DR3 L;  4GKK Q;  5EGT A;  2BH2 A;  4NPS A;  2LMC B;  1KHI A;  5LMN W;  1WTV A;  2CWA A;  2EJM A;  1PYW D;  5AFW A;  4A3D H;  2F52 A;  1OXX K;  3S14 H;  4AQY Q;  1I4Q A;  1OO9 B;  1XXG A;  3FKI B;  5A35 A;  2KQ3 A;  2VUM B;  1EIH A;  4RCN A;  3IAY A;  2IX0 A;  4ZYS A;  1EQQ A;  1QVC A;  2XTI A;  4XT1 B;  4J8Q A;  1IKL A;  4LNQ A;  1DGS A;  2HUG A;  4OWT B;  1W3S A;  3OIP A;  3KLS X;  2A6H C;  2L5T A;  2PQE A;  2FHT A;  5I2X A;  1YI2 A;  4OO1 G;  3OOC A;  3STB C;  5KEE A;  2G9H D;  4ALP A;  2AUJ D;  1SRO A;  1TWA B;  4B9X A;  4N9T A;  3QOL A;  4X6A H;  3TSS A;  2JA7 G;  3F2D A;  4X62 Q;  1YHB A;  5LL6 S;  1K8O A;  3T53 B;  4Z9C B;  2F0F A;  2CKZ B;  1CT1 D;  1V1P B;  4ZKC B;  2M00 A;  3HOX G;  5DLQ E;  1GUW A;  5C5M A;  1H9S A;  1IBK L;  1K83 B;  5L37 A;  5KND A;  2EZV A;  2B63 B;  2UUC Q;  4Q0F A;  5IYD G;  3T1H L;  2Q2T A;  3F2U A;  1XWE A;  3T16 A;  2NVQ B;  1ET9 A;  1S5B D;  5CV7 A;  2RSO A;  2E2H B;  3J81 E;  3NEN A;  3TS0 A;  4OO1 I;  3PUV A;  4P73 A;  2UU9 L;  1W2B A;  1DOL A;  4ME5 A;  4DV1 L;  3UDG A;  3PO2 B;  5K36 H;  1LO5 D;  5E7N A;  3VR2 A;  1WTW A;  2K52 A;  3KDF B;  4B3S L;  1JT8 A;  4NMZ A;  3NEL A;  1EY8 A;  3G71 A;  2KCC A;  1WYD A;  5DM7 3;  3VR3 A;  1IL2 A;  1Y1W H;  3WDN A;  3GTL H;  2F0V A;  4JC0 A;  2K05 A;  2L1B A;  4J1M A;  4H02 A;  2JA5 H;  2B2W A;  1FJG Q;  1NAP A;  2RQX A;  2PZW A;  4IUN A;  5C44 H;  1S5D D;  2XSC A;  4F8M A;  5M3F B;  1MBY A;  1I50 H;  1VS0 A;  3S2H H;  1HNX L;  3FDT A;  1SNM A;  1N8R C;  3EIV A;  4GN3 B;  4DR6 Q;  1ASZ A;  3HOY B;  2Z6B A;  3NQT A;  3AU7 A;  3S1M B;  4RGT A;  1JE5 A;  4QMG A;  3HOX H;  5FLX c;  3GTJ H;  2HCI A;  3KLS A;  1LTA D;  2NVY B;  4DR5 L;  3JAM i;  1ML0 D;  4EQP A;  2XRS D;  4OIJ A;  3MZ5 A;  5EKI A;  2F0O A;  2F4I A;  1Z47 A;  3HOW B;  1I3Q H;  2NBF A;  1G2S A;  3DEP A;  3VYR A;  3VYU A;  1KNE A;  2VB2 X;  3QB3 A;  1O7L A;  2JK8 A;  2GVA A;  4K5V A;  1LT5 D;  1O7I A;  3PUZ A;  3OW2 A;  1V1Q A;  4M1U B;  1F77 A;  1RHP A;  3KJO A;  3W5O A;  1XTC D;  1B8A A;  1QUQ B;  3K5O A;  1B53 A;  1ESR A;  4K6D A;  5EQ0 A;  4DKA C;  3PO2 H;  1PYB A;  3HZX A;  3ND9 A;  4DU9 A;  1SYG A;  1WCM G;  4PV1 C;  1XYI A;  2ENB A;  1Q86 C;  1PH6 A;  1FJG L;  2C9O A;  2KHI A;  4JI3 L;  3ULJ A;  1VQE A;  1RDP D;  5IWA L;  4YWL A;  4DAM A;  1EY7 A;  1RCV D;  2AHO B;  3NQI A;  2F0G A;  2CHB D;  1FNU A;  2RVL A;  2Z4I A;  4TVA B;  1IKM A;  4KJN A;  1FGU A;  1YNJ C;  4LF6 Q;  1Y1W G;  1X3E A;  2PI2 A;  2DY8 A;  1PYS B;  2B2W C;  2LXJ A;  4IPH A;  1GXD C;  3KLW A;  3RZO H;  1BO0 A;  2ZTD A;  3BZK A;  2ZJR A;  3PO3 H;  5CV4 A;  5FLM G;  2A73 B;  3PQI A;  4JBJ A;  3BZC A;  3CXC A;  3PGZ A;  3NTK A;  2R92 H;  4DF7 A;  1GVP A;  3V2T A;  1LTI D;  3SGI A;  1VQ5 A;  1SEB D;  3KYH C;  2F0Q A;  3S1N B;  1KD1 C;  1VQJ A;  4LF7 Q;  3BU2 A;  3KOJ A;  1PTO H;  2Q2H A;  2HDM A;  2XNA C;  1QCB D;  4ZAI A;  1HCZ A;  5IYB G;  5EKL A;  4ABN A;  5CBA E;  2J7Z A;  4CDE C;  4GKJ Q;  1EOV A;  1HQM C;  3A8J E;  3HOW G;  3FHW A;  3J80 E;  2IL8 A;  1PH7 A;  3PO3 B;  1EL0 A;  2K7V A;  2DJG C;  3G7L A;  3KF6 B;  5C44 B;  2MFI A;  1GUT A;  2F0W A;  3OMC A;  2N3S A;  3BG3 A;  1PZJ D;  4IPD A;  2HT1 A;  1VQ4 A;  3S24 A;  2N88 A;  3K7U C;  3U4V A;  3M9B A;  1A3V A;  1A3T A;  3W3A A;  3A0J A;  1BVS A;  1NE3 A;  1C48 A;  2LY7 A;  3KK7 A;  3CPF A;  2WAQ B;  2YYZ A;  3VYT A;  2E5L L;  4A3J H;  4L63 B;  3NSW A;  5E3F A;  1YNX A;  2D62 A;  4JPB W;  4NDX A;  3P20 A;  1LTS D;  2HD3 A;  3HOV G;  4B3R L;  3M4P A;  2AQ1 B;  4R9W A;  1UE5 A;  3AB9 A;  3Q24 A;  2JA9 A;  3FMC A;  3S17 H;  1A63 A;  4Y7N H;  3HOW H;  1JQY D;  4DV5 L;  4P75 A;  1JJ2 A;  4FXG C;  1L0Y B;  4R8N A;  3RD4 A;  2SOB A;  3NEM A;  1WFQ A;  3PIO 3;  3CCJ A;  1YNN C;  2QIL A;  3F1Z A;  1VDZ A;  3A74 A;  2JA6 B;  3KLR A;  5IYB H;  2UUB Q;  3H0G G;  1YHQ A;  1RKN A;  2VUM G;  1NUC A;  2WKD A;  4DV1 Q;  1MHW C;  3QOJ A;  2Z1C A;  3GTG H;  1AE2 A;  3TN2 A;  1YBY A;  4KHV A;  1K0S A;  1X3Q A;  3J81 j;  1GUS A;  1H9R A;  3NBH A;  1AP0 A;  3AEV A;  1CKN A;  2A69 D;  4KI0 A;  4B3S Q;  5KNB A;  4OWW B;  4A3J G;  4OIK A;  3DM3 A;  3M85 A;  1S5F D;  3HG9 A;  4OEM B;  3N52 A;  1HR0 W;  4DV2 Q;  2JN4 A;  1N9W A;  3HOZ B;  2R93 B;  1SMY D;  1HXY D;  3OSO A;  4GS3 A;  1N34 L;  3A8K E;  4JW0 A;  4A3D G;  1QG7 A;  2AMC B;  4JBW A;  3I90 A;  4J15 A;  1PMR A;  1D7Q A;  2BA1 A;  3PF4 A;  1GHK A;  2E75 C;  1VQ7 A;  3W1B A;  3K8A A;  2E2J B;  3MFY A;  1OTC A;  1I4X A;  2LFN A;  3A8I E;  4QIW B;  5DM6 3;  2OXP A;  4A3G G;  3QO2 A;  4CDC C;  5M3F H;  4LF8 Q;  1NR2 A;  2NVQ H;  2E2I H;  2BDN A;  1VQ9 A;  3V96 A;  3EBE A;  3HOV H;  1PTO F;  1KTK A;  1TWC H;  4C3J H;  3HOZ H;  1M1K C;  3MEF A;  3ZJY C;  4IO9 A;  1CSQ A;  1MIU A;  5J3B A;  3D0F A;  1BKB A;  4JYA Q;  1FNV A;  2YU9 B;  3MTS A;  4JI8 L;  5JJI A;  2K6A A;  4ZK9 B;  1PVO A;  2JQO A;  4B08 A;  4K8J A;  5M3M B;  3IRB A;  4IUR A;  1GO3 E;  3BYY B;  1PRT C;  3AYH B;  2EYM A;  3STB D;  1HUN A;  4XT3 B;  2I5L X;  3CME A;  4BXX H;  4X66 L;  3RZO B;  3NUC A;  4LF7 L;  4YCW A;  4KHP L;  3CPW A;  1E2W A;  4I7A A;  5TSS A;  3OW7 A;  2A69 C;  5BR8 L;  4PZ8 A;  4JI3 Q;  2SEB D;  5ELN A;  1VQD A;  5IWA Q;  2R6G A;  3W1G A;  5IP9 G;  2L12 A;  3JAM L;  2IT1 A;  1XTD A;  3T4A C;  4NW2 A;  4G7H C;  3E0J A;  2F3W A;  2JSO A;  2R93 G;  3P75 A;  1HJP A;  3C46 A;  4KD3 A;  2VQE L;  4I65 A;  1HRJ A;  5IY0 A;  4DPG A;  2JA6 G;  4LFC Q;  5ELE A;  3EJI A;  3MA2 B;  1IBL Q;  2AKW B;  2MUY A;  5EBC A;  1XPO A;  1SR3 A;  1JOR A;  1JB7 A;  1FNW A;  2PQA B;  3CU7 A;  2EOT A;  3R3O A;  4A3K B;  3GTP B;  2ZTC A;  1CTM A;  3BDO A;  1YNJ D;  1NTG A;  2EYO A;  5C3E B;  3BVZ A;  3E9I A;  4EVO A;  3A56 A;  2X6L A;  4BXX G;  2JA7 H;  1I4R A;  4J6H A;  2L15 A;  3HOV B;  3MXN B;  1QJO A;  1EIY B;  1SND A;  2KVM A;  3I55 A;  1BCP B;  1Q46 A;  5JJK A;  3RZD B;  3RNU A;  4CDF C;  3UE1 A;  1PRT B;  3CC2 A;  4HIM A;  1MJC A;  1VQF A;  2K75 A;  1K8A C;  2WB1 G;  1CFM A;  3U50 C;  3HKZ G;  4IFD I;  5IT9 L;  1DJR D;  4NXN L;  3GTK H;  4IPG A;  1VQB A;  2ZXP A;  5IGD A;  3S16 B;  2JA6 H;  2K5W A;  1Q7Y C;  3ERQ A;  3I4N H;  3DEO A;  4LUO A;  3G4S A;  3M3Y H;  1QNU A;  5C44 G;  2TSS A;  3CC7 A;  4BY1 G;  4FNF A;  1L1O B;  1OXV A;  1UE7 A;  1SYD A;  3M4Y A;  4IAL A;  1B44 D;  3GTL B;  4HIO A;  4Y7N B;  4HJ8 A;  2B29 A;  3R8B A;  3H3V H;  1F9R A;  1CQF A;  4QF4 A;  2B63 G;  1NMG A;  5ELB A;  1EIG A;  4K2L A;  4HAE A;  4ID6 A;  4JBM A;  5C3X A;  1QUQ A;  5NUC A;  3CCV A;  3QJY A;  1XNQ Q;  1Q8I A;  2A74 C;  1HZB A;  4C1N K;  4WOR A;  1IW7 C;  2QDB A;  5GAG C;  3TDQ A;  2DNE A;  1EQR A;  2NVT H;  4KY6 A;  4ME3 A;  1EYD A;  2R7Z G;  4P71 A;  3RUZ A;  1EZ8 A;  4CGY B;  2BA0 A;  2A6E C;  1PHJ A;  3MHB A;  4A3B B;  5LMN Q;  3K5N A;  3S15 H;  3Q0A A;  1CA5 A;  2FJ2 A;  3A5Z B;  4YHH L;  4JV5 Q;  1I4P A;  1JIC A;  3S2H B;  2ZT9 C;  1Q1E A;  4P72 A;  3I4M H;  4LFB Q;  1Q8K A;  3BDC A;  2B2Y C;  5M5Y H;  1ZEQ X;  3A54 A;  4NP5 A;  4IUV A;  1HTL D;  2WFW A;  2A68 D;  1HFG A;  2KEN A;  1KC8 C;  4R4O A;  5F2D A;  3D6C A;  2EXD A;  4JI4 Q;  1SYB A;  1V9P A;  2PZT A;  3MEH A;  3HOZ G;  4TSS A;  2R3Z A;  2XN9 C;  4DR7 Q;  1CZW A;  4X3S A;  4JI8 Q;  3Q8D A;  3CCM A;  3HP3 A;  4OON A;  3MVV A;  1YJ9 A;  5I6Y A;  1XNQ L;  4NB3 A;  1G2T A;  1I6H B;  4PMB A;  1K73 C;  1KXL A;  3DHQ A;  2RSN A;  5HGQ A;  3CCL A;  3J80 i;  4Q5V A;  5C4X B;  2PW7 A;  4JI7 L;  1PZK D;  3OYY A;  1V1O A;  3MXG A;  4LF5 Q;  3LNN A;  1ILQ A;  1QVG A;  3H3V I;  3HOU G;  1YIT A;  4HCE A;  3GO5 A;  3BS1 A;  5IGB A;  3FVQ A;  2WAQ E;  1WTH A;  3NWT A;  1PV4 A;  4QJF A;  1IYV A;  1VQC A;  5AJ3 Q;  1SNQ A;  1KAW A;  1EY9 A;  3S1N H;  2CVR A;  1STH A;  1WTX A;  1KIX A;  3C1E A;  4A76 A;  1MSH A;  2A6E D;  3VR6 A;  4C1N I;  3K57 A;  1I6V C;  3J7A F;  1EEI D;  1DYQ A;  1DCZ A;  1J5E L;  4RG1 A;  3PMF A;  2NZ1 D;  3I91 A;  1JB3 A;  1TXY A;  1S5C D;  1I5F A;  4FVM A;  4ZKB B;  2F1M A;  3IKJ A;  3RN2 A;  4GN4 B;  4QGU A;  2GVB A;  5C4Z A;  2LSS A;  1HNW L;  1TWA H;  4RAU C;  3NP8 A;  4BBS H;  4QB4 A;  3PIP 3;  1KL9 A;  4X66 Q;  4XYO A;  1HR0 Q;  2MHV A;  4KKT A;  4RHS A;  1EYG A;  5I4D A;  1VQ6 A;  4BBR B;  3S1Q H;  4RGO S;  5FLX E;  4Y52 H;  3QIA A;  4A3L H;  4KKU A;  5C5L A;  4O1N A;  1EUJ A;  4OGQ C;  1G51 A;  3GTQ B;  2Y0S B;  1PTO C;  3FKI H;  4IFD H;  4LF5 L;  1IXR A;  1V1P A;  4A3B G;  3MXU A;  1GUO A;  1VQL A;  1U4R A;  3SDZ A;  2B8F A;  1CHQ D;  1Y1V G;  3I8Z A;  1X55 A;  4JVZ A;  3PIO A;  2NN6 I;  2Q8I B;  4PZ6 A;  5JPN C;  3EFX D;  1P8L A;  3TBI B;  3X3M A;  5JJL A;  3PO2 G;  1SSO A;  5CBE E;  1CUK A;  2EJF C;  4JCV E;  1VCI A;  4BY1 H;  1HQR D;  2KCT A;  1CKO A;  1F2Y A;  1GD7 A;  2VB3 X;  3VR4 A;  4HJ7 A;  2XRQ D;  1PH8 A;  2KCN A;  3A55 A;  2O2L D;  4DUY Q;  4DAV A;  1LLR D;  2E2D C;  3TZD A;  1WVL A;  3HKZ E;  2YV5 A;  1Z6H A;  5H1S E;  5J22 A;  5C4X H;  2PMZ E;  5ISR A;  3I72 A;  1DOK A;  2E8G A;  1Y8N B;  5C0X J;  1C0A A;  2RKS A;  2F0K A;  4GKJ L;  5JJZ A;  4A3B H;  5BN3 A;  1JC7 A;  5JVG 3;  4RFB A;  3E9H A;  4UY8 C;  4PMW A;  3R2I A;  1WTQ A;  2NN6 G;  2UUC L;  3CHB D;  4HN7 A;  3EVQ A;  2K03 A;  4DR2 L;  2F0L A;  3W2D A;  1H9S B;  4XXE A;  4RKB A;  2ICE C;  4XIG S;  1OXS C;  4JV5 L;  2D0P A;  4WJ3 M;  1E3P A;  1PH2 A;  5CR3 A;  3E0E A;  1VQK A;  1E24 A;  5EKK A;  4APV A;  1R9T B;  4A3L G;  4YY3 L;  1ESF A;  5IE8 A;  1AZP A;  1TS3 A;  5I2Y A;  1ONL A;  3CCS A;  4O0A A;  1BR9 A;  2QCP X;  3S15 B;  2WKC A;  2EE1 A;  3TS2 A;  2EY6 A;  3GP7 A;  3J80 L;  1SYC A;  1N36 Q;  1RTN A;  1TKW B;  4DNI A;  4B3T Q;  2V1C C;  1Y69 U;  3TQY A;  2L0C A;  4UP8 A;  4X65 Q;  5JEA H;  4JI5 L;  1A0I A;  3S1M H;  4ZCK A;  4A3M H;  1T5X D;  2WB1 E;  1HH2 P;  4N8X 1;  2K4K A;  3GV3 A;  2NUC A;  3AMU A;  4A3F B;  4K8I A;  4OL7 A;  3DLL A;  1A3U A;  2CW0 D;  1BCP D;  5HUR A;  4PQX A;  4C3H H;  4IZ8 A;  4I7Z C;  1IL8 A;  4FYD A;  1FR3 A;  1D5M C;  3CCE A;  1QVF A;  3D31 A;  5E1F A;  4DR1 L;  4FXD A;  1E0B A;  1CZG A;  3EA6 A;  3ONA B;  5KYI A;  1NNX A;  4IJH A;  4DFA A;  5AJ3 L;  3CD6 A;  1I3Q B;  4MNO A;  1YEZ A;  2F0N A;  4LF9 Q;  4DR4 L;  1F9S A;  4BY7 H;  4L5T A;  2NZO A;  2A1A A;  3S2D H;  4H7B A;  4LFA L;  2JYO A;  1K3R A;  2D9U A;  3QR8 A;  1HHV A;  4CDD C;  1L0X B;  3HGB A;  4XQQ A;  3NPP A;  2CQA A;  2EY2 A;  1PFB A;  5BN5 A;  3G6E A;  2G5D A;  1KAA A;  3NTI A;  2H1E A;  3KF6 A;  4UDU C;  1SNC A;  1UE1 A;  1ENA A;  4C56 C;  1NY4 A;  1BQQ T;  1STA A;  2DN8 A;  4H0L C;  3U9S A;  4BWG B;  4BA2 I;  2EQS A;  2JJQ A;  2B3G A;  2GN5 A;  4JI2 L;  5IP9 H;  3D6W A;  3L9A X;  1SRU A;  1A15 A;  1VF7 A;  1YNN D;  2K33 A;  1K8G A;  5J39 A;  1SNO A;  3HRZ C;  4HIK A;  1I4G A;  1Z7T A;  1QOH A;  1ZXT A;  5KRU A;  1U5K A;  3Q6S A;  5M9O A;  3ICE A;  1L0W A;  2JP1 A;  2F4V Q;  1EQV A;  2MJ8 A;  4BBS G;  4C3H B;  1PFS A;  4YWM A;  1D2B A;  2YTV A;  1JCK B;  1STG A;  3M7G A;  5M5X B;  2NVX B;  2MNA A;  5IYC H;  1FD7 D;  2B2T A;  4X64 Q;  1SAP A;  3DWA A;  1H9K A;  3HFZ B;  4DAY B;  2PPB C;  4GOP C;  1SMY C;  3RLF A;  1AW7 A;  1G91 A;  3GTJ B;  1C4Q A;  1LTR D;  1B2T A;  2IHE A;  1HNZ Q;  1AEX A;  1XNR Q;  2NVT B;  4KHP Q;  4IUU A;  2B2Y A;  4PG3 A;  1K0R A;  2ZM6 L;  4A3I G;  1PH5 A;  4HMI A;  2L55 A;  2MP1 A;  3MWY W;  1NSN S;  1QNK A;  1NMF A;  3R2T A;  5A2Q L;  1X9N A;  1A2T A;  1X6O A;  2KEE A;  1HPC A;  5T1G A;  2EY1 A;  1NJI C;  2MO1 A;  4UPA A;  4YCV A;  2H5X A;  1L1O C;  5C0X H;  5ELC A;  1GM5 A;  5JVH 3;  4OO1 H;  5FO8 B;  5IYD H;  1W6J A;  1IZ6 A;  5I9O A;  2ZJP A;  4HJ5 A;  3H6M A;  2UXB L;  1A6X A;  1LT6 D;  2C35 B;  4C2M H;  5C3E H;  3I4M G;  5K36 G;  3DUZ A;  1F9Q A;  4JG2 A;  1SNP A;  4OEL B;  3BJU A;  3J80 c;  1TWH H;  1T9H A;  1WD0 A;  1G29 1;  2L4N A;  2R92 B;  3PO3 G;  1M4V A;  1C8C A;  4HTH A;  4X64 L;  4KK7 A;  1QZH A;  3NTH A;  1WJJ A;  4CHT B;  3M4O B;  1PRT D;  4IUP A;  4DV0 L;  4A3E G;  2XWB B;  4XDX A;  1XMQ L;  1XJV A;  3E5S A;  4C3I B;  5I9P A;  4MTN A;  4GLA C;  1N32 Q;  5E4W C;  1DOM A;  1VF5 C;  2BDO A;  4K0K Q;  1TWF B;  2Z4H A;  4LAA A;  4POF A;  3PCO B;  3J81 c;  2L9H A;  4NXN Q;  4IOA A;  5G3L D;  4MZ9 A;  2CWP A;  2B2U A;  1VQP A;  3MFG A;  1KRS A;  1SDF A;  1Y8O B;  1RD9 D;  2OQ0 A;  3SK5 A;  1JOO A;  2Q8T A;  4LF6 L;  4YCU A;  5DEH A;  3KJP A;  4IUQ A;  3GTG B;  2JEA I;  2AWN A;  1X32 A;  4CKC A;  3DWP A;  4DUZ L;  1STE A;  4WFN 3;  5C4J B;  1E1T A;  2ASB A;  4A93 G;  4LF9 L;  3GTM H;  4WJ4 A;  1VMC A;  2AQ3 B;  5KGU A;  2I5M X;  1KQS A;  1EY6 A;  4DV7 L;  1U4M A;  1VMP A;  1ROD A;  1X3F A;  2RBM A;  4DV2 L;  3M7N A;  2PYK A;  4DGZ A;  1N34 Q;  1IBM L;  5D14 A;  3JC6 6;  4IFD J;  2E2I B;  2EDG A;  2F0I A;  4R4Q A;  5E4X A;  3Q23 A;  4JI6 Q;  2R61 A;  3PIP A;  2ZTE A;  4DA2 A;  1XMQ Q;  1D1I A;  3T13 A;  3J7Y W;  3MAQ A;  4F7X A;  1NR4 A;  1IHZ A;  4RGN A;  3IFD A;  5IGC A;  4K0K L;  3ITP A;  1BOS A;  1I6H H;  2F0T A;  1E2V A;  4A3J B;  5CV8 A;  2K5Q A;  1TWH B;  3I56 A;  3I7F A;  2RA4 A;  3G48 A;  4G4K A;  2H4O A;  2RHQ B;  1PLF A;  3K5M A;  1CQV A;  4K6L A;  4BY1 B;  4C3J B;  5GAH C;  1JJG A;  5JOB A;  4R4T A;  3LWU A;  4LUZ A;  4LWC A;  3J7A V;  2TMP A;  5C4X G;  2RHS B;  4A3K H;  3GTP H;  1EFW A;  1MSG A;  2RDF A;  2NTT A;  4OX9 L;  4JYA L;  2B2U C;  4MTK A;  2MQH A;  1X3P A;  2EJG C;  4JI4 L;  2R92 G;  4OHJ A;  4ULL A;  2BCO A;  3F8T A;  1JR0 D;  2PO4 A;  2QW7 A;  4DR7 L;  3OIQ A;  1BBX C;  3CMA A;  4YWK A;  3R93 A;  1MI2 A;  4ILW A;  4A3M B;  1TQO A;  2Z6K A;  2IPK D;  3TP5 A;  4B3M Q;  4BBR H;  4DV5 Q;  3SVM A;  2VNU D;  5ELO A;  4C2M B;  4CJ2 C;  2K50 A;  4DR3 Q;  1FVI A;  3VYS A;  4TRD A;  1TR5 A;  2PI2 E;  2I5H A;  3I4L A;  3PUX A;  4LJZ C;  4MN3 A;  4BS9 A;  4LFC L;  3CP0 A;  3D8G A;  1MGS A;  4KY7 A;  2WII B;  2JA5 G;  3UI2 A;  2UUB L;  3SK4 A;  3CW2 C;  3M4Q A;  2Q2U A;  4DR5 Q;  1B9M A;  2F0M A;  2RCF A;  3B6Y A;  1Z9F A;  1OXU A;  1L1O A;  1Y8P B;  4K14 A;  4A3G B;  2K14 A;  2N49 A;  3MC0 B;  1PH1 A;  1S4Z A;  1KLU D;  1TWF H;  2D5D A;  4KD4 A;  1K3B C;  5G3L F;  5IGF A;  1JOK A;  3X3N A;  4C3I H;  1Y1V B;  4A3I H;  1F2L A;  2NB0 A;  4G57 A;  4X62 L;  1CHP D;  1E22 A;  2KCM A;  4DAY A;  4F88 A;  2B2V A;  4XYQ A;  1EWI A;  3V05 A;  1WOC A;  2SNM A;  1R9T H;  2G9D A;  3SXH A;  2BH8 A;  5HGT A;  2K5H A;  1QZG A;  2QA4 A;  1IW7 D;  2K1B A;  2N55 A;  3OWF A;  1VQ8 A;  1QIL A;  3VDY A;  2RDG A;  2ATW A;  2K04 A;  3GV6 A;  1TVX A;  2DUD A;  3NK9 A;  3D3R A;  1DXM A;  2EY5 A;  4GNX A;  2Z6K C;  4KMU C;  3AQQ A;  1JWM D;  4DV4 Q;  1STN A;  1PH4 A;  3FP9 A;  1R4P B;  1U4L A;  1TS5 A;  3CCR A;  1SJE D;  1HZA A;  2FMM A;  1ILP A;  3KFU A;  3NBH B;  5FLX L;  2WP8 J;  1EFI D;  2A19 A;  1A62 A;  2HHH Q;  2PNH A;  4DV3 L;  4TQU S;  2UUA L;  2HIV A;  2ES2 A;  2E5L Q;  2IJ0 A;  1EWH A;  1Y1V H;  1SYE A;  3MXP A;  2O4X A;  4RKL A;  1BCP F;  3I4N G;  3EN2 A;  3OWE B;  2OQK A;  4AYB B;  4M8A A;  1B1Z A;  1ICW A;  4PMC A;  4MIU A;  5JAV A;  2KHS A;  2UXC Q;  1AZQ A;  2MGS A;  3VR5 A;  5D3D A;  2B8G A;  4JBK A;  4EGV A;  2X69 A;  5M5Y B;  3CKI B;  2OF1 A;  4DR6 L;  2B2T C;  4AQY L;  2C5C A;  2LKV A;  1VQG A;  3H0G B;  5IOC A;  3PUY A;  3J7Z C;  3H94 A;  4MHE A;  5J1Z A;  4GOP A;  4A3E B;  2XIW A;  1EU3 A;  4C3J G;  4DV4 L;  3D4D A;  2DNC A;  2HQL A;  1G6P A;  4HCS A;  4BY7 G;  1K28 A;  3LX0 A;  1EEF D;  2IW3 A;  1FGB D;  4EX5 A;  1B70 B;  4OWX B;  4FF2 A;  1BBU A;  4NKL A;  1F9P A;  4YY3 Q;  3H3V C;  4LW1 A;  1TS4 A;  2YTY A;  4L5R C;  5KIX A;  1HA5 A;  2IHF A;  4OX9 Q;  1H9J A;  4UP7 A;  4K2K A;  4CKB A;  3CCQ A;  1IBM Q;  3SE0 A;  1B4O A;  4YIJ A;  4E6I A;  4A3G H;  4B9W A;  4B3R Q;  4G7O C;  3K80 C;  1VQO A;  1MJE A;  3CC4 A;  1HNZ L;  1NCV A;  1Q81 C;  5M3M H;  1ZYR C;  4X65 L;  2CQO A;  3TZU A;  3MXN A;  1BF4 A;  4NXM L;  2XWJ B;  4FF1 A;  1VQA A;  2YU9 H;  1TT2 A;  1FL0 A;  1OXT A;  1EZ6 A;  1W6K A;  4LF4 L;  1Y14 B;  2F3V A;  5LMU L;  2NTS A;  1MKH A;  1CA6 A;  5COR A;  1SJH D;  1C7Y A;  2R93 H;  3T1H Q;  1Y1W B;  1DM0 B;  1F2M A;  2J4X A;  1JWU D;  4AYB E;  1ZKO A;  3KBG A;  2PCF B;  3H91 A;  2F0J A;  1K8M A;  3Q22 A;  3TRE A;  1Q12 A;  1J5E Q;  1KDB A;  2A8V A;  2R7Z B;  5IIF A;  3ND8 A;  4IN3 A;  3DM1 A;  5ELF A;  1SYF A;  1FYC A;  5C0X I;  2OEO A;  2IY5 B;  2KJX A;  2NWG A;  3J81 i;  3TP7 A;  3ERO A;  3GTQ H;  3T1Y L;  4ZLT F;  5IT9 c;  5EAY A;  3L7Z C;  3NE5 B;  2KEC A;  3NXW A;  1LV9 A;  5M3M G;  4ZRZ A;  1XPU A;  2RCN A;  1HFN A;  1QE6 A;  3S1Q B;  3PSI A;  2OTL A;  3CQZ B;  4B3M L;  3K81 C;  4HED A;  3D4R A;  4GOP B;  1AN8 A;  5M5X H;  2PW5 A;  1EY5 A;  3GTM B;  1KRT A;  1II3 A;  2WB1 B;  3SK6 A;  4A3E H;  4FO2 A;  2E76 C;  1XPR A;  2VL6 A;  3L2P A;  5LMU Q;  2VXW A;  5LMN L;  4H44 C;  2NYZ D;  1SE3 A;  2QKI C;  2I46 A;  1HNX Q;  2PZU A;  1BNZ A;  1PRT F;  1G6Z A;  2FXQ A;  3RR5 A;  1C9O A;  3TME A;  1UUP A;  4DUZ Q;  1O80 A;  1Q82 C;  1CI3 M;  5CYU A;  5GQO A;  1N33 Q;  4JOI C;  2F3I A;  3PF5 A;  1B9N A;  1LAC A;  3GQB A;  1Q90 A;  2YTX A;  1LT3 D;  4DV7 Q;  4GZY C;  1X56 A;  3K6O A;  4DUY L;  3TEH B;  4GNX C;  2B63 H;  1X3G A;  3S9W A;  1X65 A;  3HOY H;  2A68 C;  5LL6 X;  1LM0 A;  2HDL A;  4GN5 A;  4CKE A;  3K7A B;  2HHH L;  2EXZ A;  1DD2 A;  3FKI G;  4A3M G;  4IFD G;  1TII D;  2EIF A;  4EQN A;  4R4C A;  5BR8 Q;  3NWS A;  5ELD A;  1UEB A;  1BBW A;  3S1R B;  3I73 A;  3P7J A;  4L8J A;  4KTA A;  3TRZ A;  1TY0 A;  1PH3 A;  3EQL C;  4KKS A;  1EYA A;  3RLO A;  1BDO A;  2KBN A;  5FJ8 G;  4V0B A;  5KNC A;  3E3X A;  2SNS A;  1EWC A;  3P1H A;  1J8I A;  2WAC A;  4O42 A;  1CM9 A;  5FO9 B;  4RMF A;  5EPK A;  3SHL A;  3M3Y B;  1CK1 A;  2ZXO A;  3FEW X;  2Z9H A;  3K59 A;  1RTO A;  2CW0 C;  4HSP A;  3BZD B;  3VA7 A;  1U9R A;  2JA8 G;  3SR1 A;  5CC4 A;  1O7Z A;  4BA1 I;  1SE4 A;  1KDA A;  3K7A H;  2EYH A;  4FDB A;  4DK0 A;  3JAM c;  1AH9 A;  2ICI A;  2K5N A;  3CCU A;  3DWQ A;  4A3F H;  1ENC A;  2OTJ A;  2CCZ A;  1ENF A;  1KDC A;  4X3U A;  3N6R A;  3RN5 A;  1JWS D;  5A2Q E;  5FKA C;  1N36 L;  4IQZ A;  3J81 L;  3OMG A;  1D6E C;  2M2L A;  2O5I C;  2MPM A;  5BN4 A;  3CRK C;  1XMO Q;  1AFP A;  3H09 A;  1LAB A;  2JA5 B;  2IX3 A;  1TU2 B;  2K28 A;  1PTO B;  4N8F A;  3A7A B;  4IPC A;  4L5Q A;  2Q2I A;  2UXC L;  4S3S A;  3HKZ B;  2DJF C;  1DZ1 A;  3H0G H;  3SEB A;  3ZYY X;  2FFK B;  4DV6 Q;  2KED A;  1IYJ B;  1PFM A;  3IFT A;  1I94 L;  4ZUJ A;  3HOY G;  2EYL A;  1HA6 A;  3HOU H;  4DR1 Q;  4CJ1 B;  4HMJ A;  1S72 A;  4A3C G;  2K32 A;  1T5E A;  2VY3 A;  3GTO H;  2X6G A;  2UXD Q;  5D65 A;  1TWC B;  2F0S A;  4DR4 Q;  1O78 A;  3CQZ H;  4DK3 C;  4H13 C;  4A3K G;  4DXG A;  4ZQ3 A;  1GHJ A;  4R4I A;  2VQF Q;  1HUM A;  4DK1 A;  3C1F A;  4LFA Q;  5FLM H;  4IUT A;  1WCM H;  5GRO A;  2VUM H;  5FJ8 H;  1IYU A;  3GTK B;  2L11 A;  2OCE A;  5C4J H;  1KNA A;  4O2D A;  2B39 A;  2V4D A;  2ALY B;  4L6T B;  1VQM A;  3QG1 A;  5CGK A;  2K5V A;  2KA7 A;  1XMO L;  4JI0 L;  3CF5 A;  2K5D A;  2QGQ A;  1SE8 A;  4NXM Q;  1H95 A;  1UWV A;  1CSP A;  3TP8 A;  5FO7 B;  1EYC A;  1U0L A;  4DAP A;  4JI2 Q;  4RCO A;  5D3I B;  4IOC A;  4A93 H;  5IGE A;  4YHH Q;  1XX8 A;  1HZ9 A;  2QEJ C;  1I94 Q;  4KN4 C;  3WOE A;  2VZA A;  4R8I A;  2F0D A;  3PV0 A;  3K58 A;  4LFB L;  1SXT A;  2JE6 I;  1UE6 A;  1ET6 A;  1O7Y A;  1RF2 D;  2XVS A;  1PXU A;  4K5X A;  4QL5 A;  1GOZ A;  2R7F A;  2FIN B;  4LMQ D;  1S3O A;  1UNS A;  2SDF A;  3WWV A;  1VQH A;  5DNF A;  1YIJ A;  2ID0 A;  2DY7 A;  3RMH A;  3ERS X;  3FPU B;  2VQF L;  1JJC B;  3J7A 5;  5EPJ A;  3OHX C;  3BDL A;  1P16 A;  4R1J A;  5IT9 E;  1Q1B A;  1EOT A;  1B3Q A;  1VQN A;  4A3C H;  5M5W H;  5C3W A;  2MO0 A;  4DV3 Q;  2UUA Q;  1JE4 A;  4FP5 D;  4DN4 M;  2JA7 B;  1YJW A;  2K01 A;  4OXP A;  1E7Z A;  5GAE C;  1SMX A;  4JOI A;  5C4H A;  5JEA J;  2ZJQ A;  1QB5 D;  1GKH A;  3T56 B;  4QUC A;  2CFM A;  2OT2 A;  1EIF A;  2BE5 D;  2RDH A;  1IBK Q;  1LUZ A;  4QCL A;  3U9O A;  1QWY A;  1SLJ A;  3UE0 A;  4KV6 A;  4QQB X;  5FOB B;  4JK1 C;  3F2B A;  2E2H H;  3DMU A;  3TP6 A;  3LGJ A;  2NVY H;  4JI1 L;  3L3O C;  5M5W B;  1N33 L;  4G7Z C;  1E1O A;  1STY A;  4KHZ A;  2UU9 Q;  3HOX B;  4ODG A;  1YVC A;  1TWG H;  4LUV A;  3UDI A;  1WI5 A;  3M4O H;  1LTT D;  1PDQ A;  5JPM C;  4KY5 A;  5C6A A;  5IP7 H;  1SFO B;  2JA8 H;  4A4I A;  1S5E D;  1I4H A;  1Q3L A;  2BOS A;  2WV6 D;  1B50 A;  4XQN A;  2D2C C;  4HSV A;  4DV0 Q;  1SE2 A;  4HJA A;  2AQ2 B;  1WTR A;  4XQJ A;  2VS1 A;  4RA8 A;  3D4W A;  2VW9 A;  2O5J C;  4U68 A;  2QF7 A;  1PTO D;  4HID A;  1UAP A;  3GD7 A;  4A93 B;  4V19 0;  1WTP A;  1U4P A;  1V43 A;  5GAD C;  4LF4 Q;  2KHJ A;  1A2U A;  4RHR A;  4N9P A;  4C3H G;  4DK6 C;  2I0Q A;  1BUV T;  4TKO B;  2AUK A;  1D1K A;  1CKM A;  1RJT A;  3CRL C;  3A5U A;  3L0O A;  3S1R H;  3S16 H;  1D8L A;  2PQA A;  2N8N A;  1F2Z A;  3O13 A;  3U58 A;  1SFO H;  2JA8 B;  3QWN A;  1IBL L;  3DXJ C;  4JI1 Q;  2WIN B;  4UP9 A;  1SN8 A;  1ASY A;  2CH4 W;  2PNR C;  4P2C B;  3BVM A;  2CH4 A;  2DGY A;  4RH6 A;  1WCM B;  2F4V L;  3I70 A;  1TY2 A;  2E74 C;  4QY7 A;  4A3I B;  1EY0 A;  1NBW A;  1B7Y B;  2F0E A;  1K9M C;  4ZUI A;  2HIX A;  4CJ0 B;  3C3L A;  5EJW A;  4IJL A;  3NHH A;  1M8A A;  2I07 B;  3OTO Q;  3T1Y Q;  4EQO A;  3I4O A;  3AFQ A;  2P5Z X;  4BBR G;  1MD2 D;  1WTO A;  1XNR L;  1EY4 A;  1PA6 A;  3RLN A;  1SBB B;  2Z0S A;  5IOD A;  4WRD A;  2ZM6 Q;  3LWE A;  4GKK L;  5HY6 A;  4JI7 Q;  4KJO A;  4DV6 L;  1KAB A;  2R7D A;  4DR2 Q;  3ER0 A;  1BCP C;  1X54 A;  4XTC S;  2OWO A;  1D5Z C;  2QDL A;  5IP7 G;  4HJ9 A;  2UXD L;  1ICF B;  3CAM A;  4LK1 C;  3UDF A;  2EVB A;  4FXK C;  3HKS A;  3I4N B;  5K5P A;  4GLV B;  2LXK A;  4PZ7 A;  4FF3 A;  2NN6 H;  2NVX H;  4KN7 C;  2XGT A;  1GUN A;  3G6J B;  2HQE A;  3HOU B;  1JMC A;  2WAQ G;  2J0T D;  5IYC G;  1HNW Q;  1GJX A;  2LS0 1;  1YJN A;  4B3T L;  2JXM B;  4JI0 Q;  2HCC A;  4JI5 Q;  3U4Z A;  1EQT A;  1D5X C;  4L5S A;  3FRP B;  4BY7 B;  1DON A;  1YZ6 A;  3VA5 A;  1N32 L;  2GA4 B;  1G8Z D;  3KF8 A;  3FPP A;  5CV9 A;  4LF8 L;  4GLX A;  3HEJ A;  2B2V C;  4X3T A;  2F0H A;  4QUF A;  4DNR B;  3IL8 A;  4U67 3;  1VQI A;  4EQ5 A;  3T51 B;  1PZI D;  4RWS C;  2F03 A;  2IWH A;  1V8Q A;  4DXF A;  1KLG D;  4A3D B;  3K5L A;  2EYF A;  3KUP A;  1B3A A;  4AYB G;  1BXT A;  1TWG B;  3RZD H;  3C2P A;  1HZC A;  2RF4 A;  3JAM E;  4DNT B;  1J6Q A;  4GNX B;  1LT4 D;  2M9V A;  2KUM A;  3BYT B;  3S2D B;  4RGM A;  5FK9 C;  1K83 H;  5CMD A;  3ULP A;  4HR7 B;  1CKN B;  2A5H A;  5JEA G;  5C0X G;  4JI6 L;  2ZXR A;  1J9O A;  1R4Q B;  1LTG D;  4QIW E;  4X3K A;  1PH9 A;  5T1I A;  3F2C A;  5COY A;  3KBX A; 
#chains in the Genus database with same CATH homology
 4CBV A;  3I4M B;  1ZYR D;  3BVG A;  3E6Z X;  3OPO A;  3PUW A;  2F0P A;  2KOL A;  1UEA B;  1H9M A;  2FMC A;  3WOF A;  2A6H D;  1GUG A;  1JOQ A;  1HTP A;  3K0Y A;  1PFN A;  3SK8 A;  5I6W A;  2BE5 C;  2EYJ A;  2Q8R E;  4C3I G;  5DAU A;  4BBS B;  5KYL A;  5LHY 1;  3GTO B;  3S17 B;  3NBI A;  3S14 B;  3URY A;  2EYP A;  2JEB I;  1I50 B;  2EPB A;  3A7L A;  3HS0 C;  4PNY A;  1E2Z A;  5CV5 A;  1EU4 A;  4UAI A;  1LTB D;  2Z8L A;  5EBD A;  2AWO A;  5EPL A;  2F0U A;  4FF4 A;  5CV6 A;  4F87 A;  1STB A;  2PMZ B;  4K5W A;  3I3C A;  4WJW A;  1WD1 A;  1TS2 A;  2IX1 A;  5IGG A;  5EGT A;  2LMC B;  1WTV A;  2EJM A;  5AFW A;  1PYW D;  1OXX K;  1I4Q A;  1OO9 B;  1XXG A;  3FKI B;  5A35 A;  2KQ3 A;  2VUM B;  1EIH A;  4RCN A;  3IAY A;  2IX0 A;  4ZYS A;  4XT1 B;  4J8Q A;  1IKL A;  2HUG A;  3OIP A;  3KLS X;  2A6H C;  2L5T A;  2PQE A;  2FHT A;  5I2X A;  4OO1 G;  3OOC A;  5KEE A;  2G9H D;  2AUJ D;  1TWA B;  4B9X A;  4N9T A;  3QOL A;  3TSS A;  1K8O A;  5LL6 S;  3T53 B;  4Z9C B;  2F0F A;  1CT1 D;  1V1P B;  4ZKC B;  2M00 A;  1GUW A;  5C5M A;  1H9S A;  1K83 B;  2EZV A;  5KND A;  2B63 B;  4Q0F A;  3F2U A;  1XWE A;  3T16 A;  2NVQ B;  1ET9 A;  1S5B D;  5CV7 A;  2RSO A;  2E2H B;  3J81 E;  4OO1 I;  3PUV A;  1DOL A;  4ME5 A;  3PO2 B;  5K36 H;  1LO5 D;  3VR2 A;  1WTW A;  4NMZ A;  1EY8 A;  2KCC A;  5DM7 3;  3VR3 A;  3WDN A;  2F0V A;  2K05 A;  2L1B A;  4J1M A;  2B2W A;  1NAP A;  2RQX A;  2PZW A;  4IUN A;  1S5D D;  2XSC A;  4F8M A;  5M3F B;  1MBY A;  3FDT A;  1SNM A;  3HOY B;  3NQT A;  3AU7 A;  3S1M B;  4RGT A;  4QMG A;  2HCI A;  3KLS A;  1LTA D;  2NVY B;  1ML0 D;  4EQP A;  2XRS D;  4OIJ A;  3MZ5 A;  5EKI A;  2F0O A;  2F4I A;  1Z47 A;  3HOW B;  2NBF A;  1G2S A;  3VYR A;  3DEP A;  3VYU A;  1KNE A;  2VB2 X;  3QB3 A;  1O7L A;  4K5V A;  1LT5 D;  3PUZ A;  4M1U B;  1F77 A;  1RHP A;  1XTC D;  3K5O A;  1B53 A;  1ESR A;  4K6D A;  5EQ0 A;  3ND9 A;  3HZX A;  4DU9 A;  1SYG A;  4PV1 C;  1XYI A;  2ENB A;  2C9O A;  1RDP D;  1EY7 A;  1RCV D;  3NQI A;  2F0G A;  2CHB D;  1FNU A;  2RVL A;  2Z4I A;  1IKM A;  4KJN A;  1YNJ C;  2DY8 A;  2B2W C;  1GXD C;  1BO0 A;  5CV4 A;  2A73 B;  3NTK A;  4DF7 A;  3V2T A;  1LTI D;  1SEB D;  2F0Q A;  3S1N B;  1PTO H;  2HDM A;  2XNA C;  1QCB D;  4ZAI A;  1HCZ A;  5EKL A;  4ABN A;  5CBA E;  2J7Z A;  1HQM C;  3A8J E;  3J80 E;  2IL8 A;  3PO3 B;  1EL0 A;  2K7V A;  3G7L A;  5C44 B;  1GUT A;  2F0W A;  3OMC A;  3BG3 A;  1PZJ D;  2N88 A;  1A3T A;  1A3V A;  3W3A A;  1C48 A;  2LY7 A;  3KK7 A;  2WAQ B;  2YYZ A;  3VYT A;  4L63 B;  3NSW A;  5E3F A;  2D62 A;  4NDX A;  3P20 A;  1LTS D;  2AQ1 B;  4R9W A;  3AB9 A;  3Q24 A;  3FMC A;  1JQY D;  4FXG C;  1L0Y B;  4R8N A;  3RD4 A;  2SOB A;  3PIO 3;  1YNN C;  2QIL A;  1VDZ A;  2JA6 B;  3KLR A;  1RKN A;  1NUC A;  2WKD A;  3QOJ A;  2Z1C A;  3TN2 A;  4KHV A;  1X3Q A;  1GUS A;  1H9R A;  3NBH A;  1AP0 A;  2A69 D;  4KI0 A;  5KNB A;  4OIK A;  3M85 A;  1S5F D;  3HG9 A;  3N52 A;  3HOZ B;  2R93 B;  1SMY D;  1HXY D;  3OSO A;  3A8K E;  1QG7 A;  4JBW A;  3I90 A;  1PMR A;  2BA1 A;  1GHK A;  2E75 C;  2E2J B;  3MFY A;  1I4X A;  2LFN A;  3A8I E;  5DM6 3;  4QIW B;  2OXP A;  3QO2 A;  1NR2 A;  2BDN A;  3V96 A;  1PTO F;  1KTK A;  1FNV A;  2YU9 B;  3MTS A;  4ZK9 B;  2K6A A;  4B08 A;  4K8J A;  5M3M B;  4IUR A;  3BYY B;  1PRT C;  2EYM A;  1HUN A;  4XT3 B;  3RZO B;  3NUC A;  1E2W A;  5TSS A;  3OW7 A;  2A69 C;  2SEB D;  2R6G A;  2L12 A;  3JAM L;  2IT1 A;  3T4A C;  4NW2 A;  4G7H C;  3E0J A;  2F3W A;  2JSO A;  3P75 A;  3C46 A;  4KD3 A;  1HRJ A;  4I65 A;  5ELE A;  3EJI A;  3MA2 B;  2MUY A;  5EBC A;  1JOR A;  1FNW A;  3CU7 A;  2EOT A;  3R3O A;  4A3K B;  3GTP B;  1CTM A;  3BDO A;  1YNJ D;  2EYO A;  5C3E B;  3BVZ A;  4EVO A;  3A56 A;  2X6L A;  1I4R A;  4J6H A;  3HOV B;  1QJO A;  1SND A;  2KVM A;  1BCP B;  3RZD B;  1PRT B;  1CFM A;  4IFD I;  5IT9 L;  1DJR D;  2ZXP A;  5IGD A;  3S16 B;  2K5W A;  3ERQ A;  3DEO A;  1QNU A;  2TSS A;  4FNF A;  1OXV A;  1SYD A;  3M4Y A;  4IAL A;  1B44 D;  3GTL B;  4Y7N B;  3R8B A;  1F9R A;  1CQF A;  4QF4 A;  5ELB A;  1EIG A;  4K2L A;  4HAE A;  4ID6 A;  5C3X A;  5NUC A;  3QJY A;  1Q8I A;  2A74 C;  4C1N K;  4WOR A;  1IW7 C;  2QDB A;  3TDQ A;  2DNE A;  4KY6 A;  1EYD A;  3RUZ A;  1EZ8 A;  4CGY B;  2BA0 A;  2A6E C;  3MHB A;  4A3B B;  3K5N A;  3Q0A A;  1CA5 A;  2FJ2 A;  1I4P A;  1JIC A;  3S2H B;  2ZT9 C;  1Q1E A;  3BDC A;  2B2Y C;  1ZEQ X;  3A54 A;  4NP5 A;  4IUV A;  1HTL D;  2A68 D;  1HFG A;  5F2D A;  3D6C A;  1SYB A;  2PZT A;  3MEH A;  4TSS A;  2R3Z A;  2XN9 C;  1CZW A;  4X3S A;  3HP3 A;  3MVV A;  5I6Y A;  1G2T A;  1I6H B;  4PMB A;  3DHQ A;  2RSN A;  4Q5V A;  5C4X B;  2PW7 A;  1PZK D;  1V1O A;  3MXG A;  3LNN A;  1ILQ A;  4HCE A;  3GO5 A;  3BS1 A;  5IGB A;  3FVQ A;  3NWT A;  1IYV A;  1SNQ A;  1EY9 A;  2CVR A;  1STH A;  1WTX A;  3C1E A;  1MSH A;  2A6E D;  3VR6 A;  4C1N I;  3K57 A;  1I6V C;  3J7A F;  1EEI D;  1DYQ A;  1DCZ A;  3PMF A;  2NZ1 D;  3I91 A;  1JB3 A;  1S5C D;  4FVM A;  4ZKB B;  2F1M A;  3IKJ A;  5C4Z A;  4RAU C;  3NP8 A;  4QB4 A;  3PIP 3;  4XYO A;  2MHV A;  4KKT A;  4RHS A;  5I4D A;  4BBR B;  4RGO S;  5FLX E;  3QIA A;  4KKU A;  5C5L A;  4O1N A;  4OGQ C;  3GTQ B;  2Y0S B;  1PTO C;  4IFD H;  1V1P A;  3MXU A;  1GUO A;  1U4R A;  3SDZ A;  2B8F A;  1CHQ D;  3I8Z A;  2NN6 I;  2Q8I B;  5JPN C;  3EFX D;  3TBI B;  3X3M A;  1SSO A;  5CBE E;  2EJF C;  1VCI A;  1HQR D;  1F2Y A;  2VB3 X;  3VR4 A;  2XRQ D;  2KCN A;  3A55 A;  2O2L D;  4DAV A;  1LLR D;  2E2D C;  3TZD A;  1WVL A;  1Z6H A;  5J22 A;  5ISR A;  3I72 A;  1DOK A;  1Y8N B;  5C0X J;  2RKS A;  2F0K A;  5JJZ A;  5BN3 A;  1JC7 A;  5JVG 3;  4RFB A;  4PMW A;  3R2I A;  1WTQ A;  2NN6 G;  3CHB D;  4HN7 A;  3EVQ A;  2K03 A;  2F0L A;  3W2D A;  1H9S B;  4XXE A;  4RKB A;  2ICE C;  4XIG S;  1OXS C;  5CR3 A;  5EKK A;  1R9T B;  1ESF A;  1AZP A;  1TS3 A;  5I2Y A;  1ONL A;  1BR9 A;  2QCP X;  3S15 B;  2WKC A;  2EE1 A;  2EY6 A;  3GP7 A;  3J80 L;  1SYC A;  1RTN A;  1TKW B;  1Y69 U;  2L0C A;  5JEA H;  1T5X D;  3GV3 A;  2NUC A;  3AMU A;  4A3F B;  4K8I A;  4OL7 A;  1A3U A;  2CW0 D;  1BCP D;  5HUR A;  4PQX A;  4IZ8 A;  4I7Z C;  1IL8 A;  4FYD A;  1FR3 A;  1D5M C;  3D31 A;  5E1F A;  4FXD A;  1E0B A;  1CZG A;  3EA6 A;  3ONA B;  5KYI A;  4DFA A;  1I3Q B;  2F0N A;  1F9S A;  4H7B A;  2JYO A;  2D9U A;  1HHV A;  1L0X B;  3HGB A;  4XQQ A;  3NPP A;  2CQA A;  2EY2 A;  1PFB A;  5BN5 A;  1KAA A;  3NTI A;  2H1E A;  4UDU C;  1SNC A;  1ENA A;  4C56 C;  1BQQ T;  1STA A;  2DN8 A;  4H0L C;  3U9S A;  4BWG B;  4BA2 I;  3D6W A;  3L9A X;  1A15 A;  1VF7 A;  1YNN D;  2K33 A;  5J39 A;  1SNO A;  3HRZ C;  1I4G A;  1Z7T A;  1QOH A;  1ZXT A;  5KRU A;  3Q6S A;  5M9O A;  2JP1 A;  1EQV A;  2MJ8 A;  4C3H B;  1D2B A;  1JCK B;  1STG A;  3M7G A;  5M5X B;  2NVX B;  1FD7 D;  2B2T A;  1SAP A;  3DWA A;  1H9K A;  2PPB C;  1SMY C;  3RLF A;  1AW7 A;  1G91 A;  3GTJ B;  1C4Q A;  1LTR D;  1B2T A;  1AEX A;  2NVT B;  4IUU A;  2B2Y A;  4HMI A;  2L55 A;  2MP1 A;  3MWY W;  1NSN S;  1QNK A;  3R2T A;  5A2Q L;  1A2T A;  2KEE A;  1HPC A;  5T1G A;  2EY1 A;  5C0X H;  5ELC A;  5JVH 3;  4OO1 H;  5FO8 B;  1W6J A;  5I9O A;  3H6M A;  1A6X A;  1LT6 D;  5K36 G;  3DUZ A;  1F9Q A;  1SNP A;  1WD0 A;  1G29 1;  2L4N A;  2R92 B;  1M4V A;  1C8C A;  4HTH A;  4KK7 A;  3NTH A;  4CHT B;  3M4O B;  1PRT D;  4IUP A;  2XWB B;  4XDX A;  3E5S A;  4C3I B;  5I9P A;  5E4W C;  1DOM A;  1VF5 C;  2BDO A;  1TWF B;  2Z4H A;  4LAA A;  2L9H A;  5G3L D;  2B2U A;  3MFG A;  1SDF A;  1Y8O B;  1RD9 D;  3SK5 A;  1JOO A;  2Q8T A;  5DEH A;  4IUQ A;  3GTG B;  2JEA I;  2AWN A;  1X32 A;  4CKC A;  3DWP A;  1STE A;  4WFN 3;  5C4J B;  1VMC A;  2AQ3 B;  5KGU A;  1EY6 A;  1U4M A;  1VMP A;  1ROD A;  2RBM A;  3M7N A;  2PYK A;  4DGZ A;  5D14 A;  4IFD J;  2E2I B;  2EDG A;  2F0I A;  5E4X A;  3Q23 A;  2R61 A;  4DA2 A;  3MAQ A;  1D1I A;  3T13 A;  3J7Y W;  4F7X A;  1NR4 A;  1IHZ A;  4RGN A;  3IFD A;  5IGC A;  3ITP A;  1BOS A;  2F0T A;  1E2V A;  4A3J B;  5CV8 A;  2K5Q A;  1TWH B;  2RA4 A;  4G4K A;  2H4O A;  1PLF A;  3K5M A;  1CQV A;  4K6L A;  4BY1 B;  4C3J B;  5JOB A;  3LWU A;  3J7A V;  2TMP A;  1MSG A;  2RDF A;  2NTT A;  2B2U C;  1X3P A;  2EJG C;  4OHJ A;  4ULL A;  2BCO A;  1JR0 D;  2PO4 A;  3OIQ A;  1BBX C;  3R93 A;  1MI2 A;  4ILW A;  4A3M B;  1TQO A;  2IPK D;  3TP5 A;  3SVM A;  2VNU D;  4C2M B;  4CJ2 C;  3VYS A;  4TRD A;  1TR5 A;  3I4L A;  3PUX A;  4LJZ C;  4MN3 A;  4BS9 A;  3D8G A;  4KY7 A;  1MGS A;  2WII B;  3UI2 A;  3SK4 A;  1B9M A;  2F0M A;  1OXU A;  1Y8P B;  4K14 A;  4A3G B;  3MC0 B;  1S4Z A;  1KLU D;  2D5D A;  4KD4 A;  5G3L F;  5IGF A;  1JOK A;  3X3N A;  1Y1V B;  1F2L A;  2NB0 A;  4G57 A;  1CHP D;  4DAY A;  4F88 A;  2B2V A;  4XYQ A;  3V05 A;  2SNM A;  2G9D A;  3SXH A;  5HGT A;  1IW7 D;  2K1B A;  2N55 A;  3OWF A;  1QIL A;  2RDG A;  2K04 A;  3GV6 A;  1TVX A;  3D3R A;  3NK9 A;  1DXM A;  2EY5 A;  4KMU C;  1JWM D;  1STN A;  1R4P B;  1U4L A;  1TS5 A;  1SJE D;  2FMM A;  1ILP A;  5FLX L;  2WP8 J;  1EFI D;  4TQU S;  2IJ0 A;  1EWH A;  1SYE A;  3MXP A;  2O4X A;  4RKL A;  1BCP F;  3OWE B;  4AYB B;  4M8A A;  1B1Z A;  1ICW A;  4PMC A;  4MIU A;  5JAV A;  2KHS A;  1AZQ A;  2MGS A;  3VR5 A;  5D3D A;  2B8G A;  4EGV A;  2X69 A;  5M5Y B;  3CKI B;  2OF1 A;  2B2T C;  2C5C A;  2LKV A;  3H0G B;  5IOC A;  3PUY A;  3H94 A;  4MHE A;  5J1Z A;  4A3E B;  2XIW A;  1EU3 A;  4C3J G;  3D4D A;  2DNC A;  4HCS A;  3LX0 A;  1EEF D;  2IW3 A;  1FGB D;  4FF2 A;  4NKL A;  1F9P A;  3H3V C;  1TS4 A;  5KIX A;  1HA5 A;  1H9J A;  4K2K A;  4CKB A;  3SE0 A;  1B4O A;  4YIJ A;  4E6I A;  4B9W A;  4G7O C;  1NCV A;  1ZYR C;  3TZU A;  3MXN A;  1BF4 A;  4FF1 A;  2XWJ B;  1TT2 A;  1OXT A;  1EZ6 A;  1W6K A;  2F3V A;  2NTS A;  1CA6 A;  5COR A;  1SJH D;  1Y1W B;  1DM0 B;  1F2M A;  2J4X A;  1JWU D;  1ZKO A;  3KBG A;  2PCF B;  3H91 A;  2F0J A;  1K8M A;  3Q22 A;  1Q12 A;  1KDB A;  2R7Z B;  5IIF A;  3ND8 A;  4IN3 A;  3DM1 A;  5ELF A;  1SYF A;  5C0X I;  1FYC A;  2OEO A;  2KJX A;  2NWG A;  3TP7 A;  3ERO A;  4ZLT F;  3L7Z C;  3NE5 B;  2KEC A;  3NXW A;  1LV9 A;  4ZRZ A;  1HFN A;  1QE6 A;  3S1Q B;  3CQZ B;  4HED A;  3D4R A;  1AN8 A;  2PW5 A;  1EY5 A;  3GTM B;  1II3 A;  2WB1 B;  3SK6 A;  4FO2 A;  2E76 C;  2VXW A;  4H44 C;  2NYZ D;  1SE3 A;  2QKI C;  2I46 A;  2PZU A;  1BNZ A;  1PRT F;  1G6Z A;  3TME A;  1UUP A;  1O80 A;  1CI3 M;  5CYU A;  1B9N A;  1LAC A;  3GQB A;  1Q90 A;  1LT3 D;  4GZY C;  3K6O A;  3S9W A;  2A68 C;  5LL6 X;  2HDL A;  4CKE A;  3K7A B;  2EXZ A;  1DD2 A;  4IFD G;  1TII D;  4EQN A;  3NWS A;  5ELD A;  3S1R B;  3I73 A;  3P7J A;  4L8J A;  4KTA A;  1TY0 A;  3EQL C;  4KKS A;  1EYA A;  1BDO A;  4V0B A;  5KNC A;  2SNS A;  1EWC A;  3P1H A;  1J8I A;  2WAC A;  4O42 A;  1CM9 A;  5FO9 B;  5EPK A;  3SHL A;  3M3Y B;  1CK1 A;  2ZXO A;  3FEW X;  3K59 A;  1RTO A;  2CW0 C;  4HSP A;  3BZD B;  3VA7 A;  1U9R A;  3SR1 A;  5CC4 A;  1O7Z A;  4BA1 I;  1SE4 A;  1KDA A;  4DK0 A;  2EYH A;  2ICI A;  3DWQ A;  1ENC A;  1ENF A;  1KDC A;  4X3U A;  3N6R A;  1JWS D;  5A2Q E;  5FKA C;  4IQZ A;  3J81 L;  3OMG A;  1D6E C;  2M2L A;  2O5I C;  5BN4 A;  2MPM A;  3CRK C;  1AFP A;  3H09 A;  1LAB A;  2JA5 B;  2IX3 A;  1TU2 B;  2K28 A;  1PTO B;  3A7A B;  4S3S A;  3HKZ B;  1DZ1 A;  3SEB A;  3ZYY X;  2FFK B;  2KED A;  1PFM A;  3IFT A;  4ZUJ A;  2EYL A;  1HA6 A;  4CJ1 B;  4HMJ A;  2K32 A;  1T5E A;  2X6G A;  5D65 A;  1TWC B;  2F0S A;  1O78 A;  4H13 C;  4DXG A;  4ZQ3 A;  1GHJ A;  1HUM A;  4DK1 A;  3C1F A;  4IUT A;  1IYU A;  3GTK B;  2L11 A;  1KNA A;  2B39 A;  2V4D A;  4L6T B;  3QG1 A;  5CGK A;  2KA7 A;  2K5D A;  3TP8 A;  5FO7 B;  1EYC A;  4DAP A;  4RCO A;  5D3I B;  5IGE A;  1XX8 A;  2QEJ C;  4KN4 C;  3WOE A;  4R8I A;  2F0D A;  3PV0 A;  3K58 A;  1SXT A;  2JE6 I;  1ET6 A;  1O7Y A;  1RF2 D;  2XVS A;  1PXU A;  4K5X A;  1GOZ A;  2FIN B;  4LMQ D;  1UNS A;  2SDF A;  5DNF A;  2ID0 A;  2DY7 A;  3RMH A;  3FPU B;  5EPJ A;  3OHX C;  3BDL A;  5IT9 E;  1Q1B A;  1EOT A;  5C3W A;  1JE4 A;  4FP5 D;  4DN4 M;  2JA7 B;  2K01 A;  5C4H A;  5JEA J;  1QB5 D;  3T56 B;  4QUC A;  2OT2 A;  2BE5 D;  2RDH A;  4QCL A;  3U9O A;  1QWY A;  4KV6 A;  5FOB B;  4JK1 C;  3DMU A;  3TP6 A;  3L3O C;  5M5W B;  4G7Z C;  1STY A;  4KHZ A;  3HOX B;  4ODG A;  1LTT D;  1PDQ A;  5JPM C;  4KY5 A;  5C6A A;  1SFO B;  1S5E D;  1I4H A;  1Q3L A;  2BOS A;  2WV6 D;  1B50 A;  4XQN A;  2D2C C;  4HSV A;  1SE2 A;  2AQ2 B;  1WTR A;  4XQJ A;  4RA8 A;  3D4W A;  2O5J C;  4U68 A;  2QF7 A;  1PTO D;  1UAP A;  3GD7 A;  4A93 B;  4V19 0;  1WTP A;  1U4P A;  1V43 A;  1A2U A;  4RHR A;  4N9P A;  4C3H G;  1BUV T;  4TKO B;  2AUK A;  1D1K A;  1RJT A;  3CRL C;  1F2Z A;  3O13 A;  2JA8 B;  3QWN A;  3DXJ C;  2WIN B;  2PNR C;  3BVM A;  4P2C B;  4RH6 A;  1WCM B;  3I70 A;  1TY2 A;  4A3I B;  2E74 C;  1EY0 A;  2F0E A;  4ZUI A;  4CJ0 B;  3C3L A;  5EJW A;  3NHH A;  1M8A A;  2I07 B;  4EQO A;  1MD2 D;  1WTO A;  1EY4 A;  1SBB B;  5IOD A;  4WRD A;  3LWE A;  4KJO A;  1KAB A;  1BCP C;  4XTC S;  1D5Z C;  4LK1 C;  2EVB A;  4FXK C;  3I4N B;  5K5P A;  4FF3 A;  2NN6 H;  4KN7 C;  1GUN A;  3G6J B;  2HQE A;  3HOU B;  2J0T D;  1GJX A;  2LS0 1;  2JXM B;  2HCC A;  1EQT A;  1D5X C;  3FRP B;  4BY7 B;  1DON A;  3VA5 A;  2GA4 B;  1G8Z D;  3KF8 A;  3FPP A;  5CV9 A;  3HEJ A;  2B2V C;  4X3T A;  2F0H A;  4QUF A;  4DNR B;  3IL8 A;  4U67 3;  3T51 B;  1PZI D;  4RWS C;  2F03 A;  2IWH A;  1V8Q A;  4DXF A;  1KLG D;  4A3D B;  3K5L A;  2EYF A;  3KUP A;  1B3A A;  1BXT A;  1TWG B;  3C2P A;  3JAM E;  4DNT B;  1LT4 D;  2M9V A;  2KUM A;  3BYT B;  3S2D B;  4RGM A;  5FK9 C;  5CMD A;  4HR7 B;  2A5H A;  5JEA G;  5C0X G;  2ZXR A;  1J9O A;  1R4Q B;  1LTG D;  4X3K A;  5T1I A;  5COY A;  3KBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...