1VMPA

Structure of the anti-hiv chemokine vmip-ii
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ANTI-HIV CHEMOKINE MIP VII)
publication title The solution structure of the anti-HIV chemokine vMIP-II.
pubmed rcsb
source organism Human herpesvirus 8
molecule tags Antiviral protein
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vmpA00
1X32A 3DEOA 1U4MA 1G2SA 3I90A 4ZAIA 1JICA 3ONAB 2KEDA 2HCIA 1B4OA 4OIKA 1WTVA 4CJ2C 1G91A 2X6LA 1HRJA 5D65A 1O7ZA 2X69A 1EQTA 4HAEA 4CJ1B 2B2VC 2MGSA 2NWGA 2SDFA 3UI2A 1HHVA 2KUMA 2B2TC 1ESRA 1PFMA 1ILQA 4RWSC 4ZKBB 4IUPA 1J9OA 1A15A 3FDTA 1VMCA 2H1EA 2RA4A 3KUPA 3I3CA 2B2WA 4O42A 5EJWA 4MHEA 1F9PA 2B2YA 2XIWA 3Q6SA 4RAUC 1PFNA 3N52A 1RODA 1WTOA 2HDLA 4HEDA 2NZ1D 1RHPA 2MPMA 2FFKB 1WTWA 2EPBA 1WD1A 1J8IA 4UAIA 1NR4A 3MWYW 1HFNA 2Q8RE 2L11A 1QNKA 2K1BA 1DONA 4ZLTF 1E0BA 1O7YA 3SVMA 3IFDA 5D14A 1MSHA 2KECA 1BF4A 3P7JA 1BO0A 1SSOA 2DY8A 3G7LA 4ZK9B 5DNFA 1MI2A 5JJZA 5T1GA 4IURA 1EL0A 4QUFA 2K03A 3HP3A 1F9SA 2EE1A 2K05A 2L4NA 1KNEA 4CJ0B 2B2UA 3KBXA 1RJTA 1WTXA 2K28A 2M2LA 2HDMA 5EPKA 2RVLA 1PFBA 4RA8A 5EPLA 1GUWA 1ML0D 1HUNA 1LV9A 1MGSA 1ICWA 2D9UA 1U4RA 1DOKA 2RSOA 4NW2A 1NCVA 2CVRA 1SDFA 3FPUB 5EPJA 1CA5A 2DY7A 1HA6A 5CBEE 1RTNA 2K01A 1XYIA 1MSGA 2MP1A 1B50A 4X3KA 2N88A 1PDQA 1S4ZA 1NAPA 1ILPA 4R9WA 5EQ0A 1WTQA 2Q8TA 2B2WC 5COYA 1JE4A 1U4LA 2L9HA 3I8ZA 1ZXTA 1WTRA 2RSNA 2B2YC 3QO2A 1O80A 3F2UA 5E4XA 1HUMA 4IUTA 1F9QA 2J7ZA 3GV6A 3H91A 1CM9A 1G2TA 4IUQA 3TN2A 1F9RA 1VMPA 4OIJA 1WVLA 4ZKCB 3DM1A 3LWEA 2B2VA 4LMQD 1B53A 1XX8A 3GV3A 3I91A 4HSVA 4IUVA 1BNZA 1IL8A 1KNAA 1Q3LA 1QE6A 1IKLA 2B2TA 2JP1A 2NYZD 1F2LA 2N55A 4U68A 4X3SA 5AFWA 1IKMA 2KVMA 2L12A 2MJ8A 1X3QA 4XDXA 1WTPA 5E4WC 1PLFA 2FMMA 1AZQA 3IL8A 3TZDA 2KEEA 1DZ1A 3R93A 2KOLA 4R8IA 1CA6A 4XT3B 5T1IA 2B2UC 4XT1B 1HFGA 3DEPA 2FHTA 1M8AA 1BBXC 2VXWA 3MTSA 2HCCA 2K04A 3D6WA 1B2TA 1EIGA 1QG7A 2HUGA 2X6GA 2IL8A 2R3ZA 1X3PA 2L1BA 4IUUA 4QUCA 5CMDA 2EOTA 1DOLA 2FINB 1DOMA 4X3TA 4X3UA 1EIHA 5CBAE 1NR2A 2FJ2A 4MN3A 1RTOA 2BDNA 4HCSA 1G6ZA 1AP0A 2JYOA 5EKIA 5CORA 1SAPA 4DN4M 1AZPA 1B3AA 1C8CA 1TVXA 1U4PA 1EOTA 1WD0A
chains in the Genus database with same CATH superfamily
2EXDA 1TWCB 1PH4A 2EQSA 4L8JA 1CI3M 4IFDH 4GOPA 1PXUA 1BVSA 4DV3Q 2AQ1B 2X69A 2MGSA 3D8GA 2R7DA 1VQ4A 2EJMA 2VY3A 1X54A 3K57A 4XXEA 5J1ZA 1SYEA 1VMCA 5HURA 1C4QA 2AMCB 4B9XA 4L6TB 3CD6A 2KHJA 3F2DA 4BY1B 3E6ZX 5IP7H 2VQEQ 3KF6B 3K5MA 5ELDA 2JA5H 1E24A 5FLXE 1AFPA 2B63B 2M9VA 1BF4A 1TQOA 2PCFB 3MEHA 4N9TA 1I94Q 1QILA 3MFGA 4C2MH 2JA7H 4B3TL 3WOFA 1MIUA 3MZ5A 2L4NA 4YY3Q 1A3VA 3UDIA 2JQOA 4UDUC 4EQNA 3TS2A 4IZ8A 2J0TD 1U9RA 2F0WA 2BH8A 1HR0L 1KRSA 1HXYD 4NW2A 1ASZA 3PUZA 2IX3A 2N49A 1NAPA 3MXNB 4R4CA 2HHHQ 2G9DA 1ZXTA 3A54A 1O80A 2B3GA 1H9KA 1CK1A 1C48A 2JE6I 1Z7TA 5C4JH 5KEEA 1ZYRC 1ENFA 4PMBA 5HY6A 4AYBE 4A3FB 3RD4A 1Q3LA 4F87A 3PGZA 2N55A 1VQPA 4NXMQ 2MUYA 4OO1H 5G3LF 1LT4D 2UUBL 1CA6A 2R7ZG 1FGUA 4XT3B 4G4KA 4YCWA 5DAUA 4DXFA 2CW0C 2K04A 4C3HH 1EIGA 3PIPA 1B9NA 4LUVA 1SNOA 3RLOA 1N32L 4K0KL 2D5DA 1B44D 2B63G 4TSSA 2OXPA 2FMCA 3NWSA 1JWSD 3K5OA 1TVXA 5IP9H 1B9MA 4LF8Q 1LTBD 3CCVA 1XMQL 1EU4A 1G2SA 4LF9L 1I4PA 1JOOA 3R2IA 5IOCA 3KJOA 2I5HA 3HOWB 4UP7A 4WJ4A 3K0YA 5J39A 2IPKD 4B3TQ 4KN7C 3GTOB 1FD7D 2E75C 3GTQH 2CWAA 2Q8IB 4MZ9A 1PFNA 3J81i 1ET9A 2L15A 1KTKA 2Z4HA 1SMYC 2K5NA 2ZM6L 2FFKB 4HIDA 1HR0Q 3G6EA 2E8GA 1E1TA 2E2DC 2Z6BA 5D14A 3QOJA 3CRLC 3E9HA 1NJIC 4A3FG 5ELOA 1I4GA 4CDFC 1HH2P 1HZCA 2EYPA 2K03A 4CJ0B 1C9OA 1BXTA 4P71A 4JBWA 1LT3D 3QG1A 4AYBG 3PUYA 2BDOA 1HJPA 2ICIA 5M5WH 2RSOA 4LFCQ 3IRBA 2HQLA 1Y8OB 4KY6A 2UUBQ 3L9AX 4DV4L 1D1IA 4RKBA 5EQ0A 3FRPB 4DK3C 1ZYRD 2Q8TA 2M00A 4NXNL 2E76C 4PQXA 4LK1C 4C3JH 1UWVA 4LW1A 1A8VA 3S16H 1N32Q 2NVXH 2IW3A 4MNOA 4K0KQ 3X3MA 5JVG3 4KHZA 4BWGB 1XX8A 1BNZA 2JP1A 2RCFA 2CW0D 4G7OC 2UUCL 1XMQQ 4JV5L 4LF9Q 2YTVA 4LNQA 3J80c 3CU7A 4Q5VA 3NSWA 1IW7C 2E2HH 3CMAA 5IYBG 1LUZA 4L5QA 3OMCA 1LT5D 2HUGA 1H9SB 2R3ZA 1I6HB 1DOLA 4CDEC 3MC0B 5IYCG 1X3EA 4MN3A 4OWXB 4I65A 3RLFA 1VQEA 1G6ZA 1TWHH 3AU7A 1AP0A 1VQOA 1E3PA 4A3MH 4I7ZC 1PRTD 1OXUA 3EROA 5CBEE 1HNXL 5I2YA 4WJWA 2F1MA 2F0PA 3J80E 1VCIA 4FF1A 5FLMH 3HOYH 3V05A 3DUZA 1G91A 3M4OB 4QMGA 3CQZB 4GNXB 1SMYD 4JW0A 3M3YB 3AMUA 4OEMB 1V9PA 3NEMA 2PYKA 4DR3L 4YWLA 4A3BG 3BYYB 2HIVA 4DUYL 4L5RC 3M7NA 5FJ8G 2XNAC 1GUSA 3PO2B 3KBGA 1O7LA 3RLNA 4DUZL 1SN8A 3AQQA 2VS1A 2K33A 3NTHA 5IE8A 5BN5A 4JK1C 1GHKA 4DAPA 3IFDA 4O2DA 2KECA 2XN9C 1HNWQ 1M90C 3A5UA 2AUJD 1CT1D 4NXNQ 3S1MB 2EDGA 2NBFA 4IOAA 5D3IB 1D5XC 4DFAA 5I9OA 1EL0A 1I5FA 1KL9A 3BVMA 3GP7A 1F2YA 4RGNA 1K8MA 2I5MX 2Q2UA 5EPKA 3RN2A 1PFBA 2AUKA 1MGSA 2ZTCA 4IJHA 1CSQA 4JV5Q 4GN5A 3LWUA 1B50A 2MO1A 1X55A 1CKOA 3I70A 3G48A 1K8AC 1S5ED 3S15B 2XWBB 1MJCA 1YJWA 2QEJC 4H44C 4IALA 3FVQA 2ICEC 1EY5A 1EQVA 4EGVA 2Y0SE 3PO3H 1I4XA 4ME3A 1PMRA 1EEID 3LWEA 3PSIA 3TQYA 3KF6A 5EKLA 1STNA 1HNXQ 4C3HB 5DM63 3K5NA 2Y0SB 4NPSA 4RGOS 2A69C 4YWMA 3HOXH 1E2WA 3DEPA 5LMNW 3DXJC 3PO2G 2B8FA 4RG1A 2BA0A 5CV9A 4GOPB 1CZWA 4DR3Q 3ZJYC 2Z8LA 5JVH3 4JI1L 1GJXA 1Z9FA 4HCSA 2LXJA 4ZRZA 2E2JB 4TKOB 3Q24A 5M5YH 2QF7A 1FR3A 4DUZQ 4BBSB 3NBIA 4UPAA 3K7AH 1JICA 3ULLA 3KFUA 1KABA 1PTOC 5IGDA 4BBRG 2R92G 1KDAA 3BU2A 5EGTA 4K2LA 2JEBI 4HAEA 3STBD 2NZOA 4A3EB 3W3AA 1LLRD 3A8IE 1PFMA 1ILQA 3FDTA 1QUQB 4ZUJA 3VYRA 4GLXA 4HTHA 3PUWA 4O42A 3DWQA 1D1KA 4CDDC 1FVIA 5CR3A 4A3JB 3D3RA 1VQKA 4UP8A 5C4HA 3LX0A 3AFQA 2NN6I 3VR3A 3Q23A 1CQFA 2CCZA 1BBWA 1GXDC 2NZHA 1M4VA 2JA6H 3H94A 2CQAA 3KF8A 3GTPH 4QUFA 2E2IB 1I50B 2EXZA 2BH2A 3HOZB 3KBXA 1JE5A 2R7FA 2Y0SG 2K28A 2WFWA 3E3XA 2QCPX 3U50C 3L0OA 5C44G 1NCVA 1EUJA 5C0XG 3U9SA 2XVSA 3K0XA 4HSPA 4ZUIA 1TWFB 5M9OA 3I4LA 4DKAC 2RKSA 1Y1VH 2ZXOA 5A2QL 1J5EL 3F2UA 5DEHA 4Y52H 3O13A 3VR5A 1K83B 1AE3A 2C5CA 4JI1Q 4BBSG 4IUQA 1RF2D 2EY2A 3KJPA 4HN7A 4A3KG 2R93G 5C3EG 4FYDA 1Z47A 3NHHA 2A69D 2EY1A 3M4PA 2OEOA 2R7ZH 2XTIA 3GTMB 4A3LG 4XDXA 2LSSA 1BCPF 4A3EG 1I6VC 1FNWA 1O78A 1AE2A 1XPUA 1GHJA 1LO5D 4Q0FA 1TWHB 1BBXC 1DCZA 4A3JG 4A3MB 2NVQH 3T13A 5CMDA 4A93H 5J22A 4IOCA 1G8ZD 1PTOD 3HOYB 5I6YA 3AFPA 1RTOA 3HFZB 4IQZA 2A8VA 1XJVA 1UE5A 3FKIG 1KDCA 2C9OA 1HNZL 1GO3E 2F3VA 3N6RA 5C4XG 3S1QB 2WKCA 3RMHA 5KIXA 4B3ML 2TSSA 5EKKA 3U4ZA 4BY7H 3NELA 1L0YB 2NVYH 3M9BA 2OT2A 2O5IC 1RDPD 1JOKA 1Y69U 1VQ5A 5IGFA 1LTSD 5IGBA 1V8QA 2O4XA 3CMEA 1XNRL 2F0MA 5JPMC 1PZKD 4WORA 1VQ8A 2MNAA 1NY4A 3TZUA 1TWAB 3DLLA 1L1OB 5GADC 2KCCA 1DONA 1O7YA 4QL5A 1TWGH 1UE6A 1J5EQ 3H0GH 5A2QE 4HR7B 3GTKB 2K05A 1KRTA 2QDLA 1KAAA 1B7YB 2RDFA 1XPOA 1CTMA 1PYBA 5I2XA 3R3OA 3NQIA 2MFIA 4LWCA 1CUKA 4K2KA 4CDCC 1PH5A 5ELEA 5I4DA 4R4QA 2K01A 1EWHA 2JA8B 4GNXA 4LAAA 1IZ6A 4C56C 5COYA 2LFNA 2RSNA 4KJOA 5FO9B 1SBBB 3QB3A 4RFBA 4JI6Q 4FDBA 1VQFA 1FYCA 2EY6A 2OTJA 3H91A 1WOCA 1F9RA 1VQIA 5HGQA 2DNCA 4B9WA 1QCBD 4KKTA 5IIFA 3W1GA 4ALPA 5L37A 3NWTA 2K5QA 2L12A 3FMCA 1HNZQ 3H3VC 1TKWB 3OIPA 2PO4A 4WFN3 1NSNS 1E7ZA 3MXUA 4B3MQ 2XRSD 3MVVA 2Z1CA 4C1NK 2HCCA 2DJFC 3TP5A 4G7HC 5H1SE 1X3GA 1P16A 4X65L 1XNRQ 4DK6C 3PUXA 1H9RA 3F2CA 2ZTDA 3BVZA 1LTGD 3JC66 1HQRD 2JA9A 1WCMB 1U4MA 2YTXA 2NTSA 3SDZA 3HOUB 2KEDA 2X6LA 4A3BH 2IT1A 2IHFA 2OQKA 2NWGA 3F2BA 3UI2A 3I4NH 5M3FG 3ER0A 4CKCA 5FJ8H 1J9OA 2F0KA 1WI5A 1N8RC 1FGBD 3PQIA 2EJGC 2B2WA 4IPCA 2JA8G 2XIWA 1ZKOA 4EQOA 2JEAI 3T51B 4EQPA 1QWYA 4JI0L 4NXML 1KDBA 3JAMi 1HFNA 4BA1I 3GTPB 1AN8A 3HG9A 4DV6L 1LTTD 2RBMA 3W2DA 1BO0A 5ELBA 4ZK9B 3BDOA 1JMCA 5IYDG 1TS5A 2PZWA 5GAEC 2G9HD 1SYFA 3RZOB 1HA5A 2AWNA 3EBEA 4ME5A 4J6HA 3E0EA 4PZ7A 4RA8A 2EYHA 3IAYA 5JPNC 1ML0D 1Y1VB 4LJZC 3J81j 2F0DA 1U4RA 2AQ2B 3HOVH 4OO1I 3S1RH 2PQAB 2L0CA 3KOJA 2QA4A 4LF8L 2N8NA 1EWCA 1G6PA 1S4ZA 3GTLH 1YHBA 2P5ZX 1Y14B 1SE2A 5M3MB 1U4LA 3BDCA 2F0LA 3C3LA 3I8ZA 1QUQA 4ZQ3A 1ASYA 1NE3A 1WCMG 3DM1A 4IPGA 1OXXK 4X65Q 1BR9A 2DN8A 5EJWA 4DF7A 2N3SA 3CCSA 1STEA 1STAA 1EYCA 1EQQA 2ASBA 4R8IA 1PFSA 2PNRC 1EY6A 1ENAA 5T1IA 4HJAA 5K36G 4XT1B 4DR7Q 1DGSA 2X6GA 1AH9A 4FXGC 2JSOA 2WKDA 3QR8A 2EOTA 4QGUA 1EY8A 5CBAE 1EIFA 1NR2A 2VB2X 4F8MA 3GTJH 1Y1WB 1SLJA 5I6WA 1UUPA 1XWEA 4GNXC 3C1FA 3FP9A 1SAPA 1QVCA 2FXQA 4JI0Q 1KLUD 4BBRH 3CRKC 2R92H 4JI7Q 2CQOA 4LFCL 2WINB 4WJ3M 4DV6Q 4ZAIA 2AKWB 2KHSA 1XTDA 2BE5D 3HEJA 1SNMA 4QIWE 3VR2A 3S17B 1VS0A 3ERSX 1II3A 3UE1A 5LMNL 1Q86C 1NMGA 4BY1G 4KMUC 1YNJC 1Q46A 1OO9B 3KF8B 4QIWB 1F9PA 2I5LX 2XGTA 5IY0A 1RODA 3EQLC 3VDYA 2HDLA 1TWGB 5M3MG 3J7ZC 1WTWA 4ZCKA 1JJGA 4R4TA 2Q8RE 1DM0B 4ZLTF 1K3RA 3D4WA 3P7JA 1Q1EA 2NN6G 2EIFA 3FHWA 3CC4A 1K73C 2K32A 3GQBA 3AYHB 4JBMA 5C0XH 4EX5A 1JORA 4PMCA 1VDZA 5EPLA 1GUWA 1L0WA 4P74A 3DWPA 2PPBC 2K50A 3FPUB 3PF5A 4L63B 5A35A 1YZ6A 3J80L 4GN4B 4B08A 3CPWA 2B2WC 1Y1WG 2IY5B 1EU3A 3QO2A 4A3KH 3D4RA 5C3EH 1E22A 1SNQA 2E74C 4IUTA 4ZYSA 4FVMA 3P20A 4FO2A 5CV6A 4J1MA 1PA6A 4ZKCB 4QQBX 1LTLA 2H5XA 1L1OA 1PV4A 3IFTA 4GOPC 1GKHA 2MJ8A 4ABNA 1N34L 5DM73 1PH8A 4A3IB 2ZJPA 1V1OA 1SRUA 1R4PB 2QKIC 1M8AA 4CKEA 1HNWL 1SE4A 5LMNQ 3UDFA 4PZ8A 1UE1A 1SYCA 3S14B 2FINB 1UEBA 1W3SA 2F0IA 2K5HA 3FKIH 1T9HA 3CW2C 2NB0A 4DN4M 3I4NB 5C4XH 3HOWG 3TP8A 3U9OA 1IYUA 2F0EA 1Q81C 2HCIA 3UE0A 1YEZA 1SJHD 2F0FA 4NB3A 1XTCD 2KUMA 4RWSC 2DUDA 1MHWC 4ZKBB 2XRQD 4IUPA 1E2VA 3PIO3 2F0SA 3NTKA 4YWKA 2LS01 4A3GH 3Q6SA 1KLGD 4HEDA 2NZ1D 4RCOA 2O2LD 3SE0A 4K8IA 3ITPA 5FK9C 1QNKA 2D0PA 2K1BA 5LHY1 3SVMA 1MSHA 1QB5D 4DAYB 2N78A 1EIYB 4JOIA 3C2PA 2PNHA 3VA7A 3AEVA 1UNSA 2F4IA 4O1NA 3GTGH 1R9TH 4IN3A 4L5TA 2JA5B 3A0JA 1CKNA 1BOSA 3GTLB 1H9MA 2AHOB 2A6EC 1SFOH 4Y7NH 1LV9A 1NNXA 1TU2B 4YCUA 4C2MB 2JA7B 1N34Q 1KD1C 3CC2A 2N88A 3I2ZA 4HIMA 2K6AA 3WDNA 1DYQA 1LTAD 4JI4Q 4PG3A 1WTQA 4K5WA 4XQJA 4JBJA 5C5MA 1A3UA 1GOZA 2PI2E 2WIIB 1CHPD 5E4XA 4ODGA 4RMFA 3MA2B 5KYIA 3CKIB 3BS1A 2Q2HA 3CPFA 4OIJA 1SNDA 2VUMH 1WFQA 2B2VA 2RF4A 1VQCA 4AQYQ 3J7YW 1IL8A 1KNAA 1RKNA 5M5XH 4U68A 1JJ2A 2LY7A 3SGIA 4A3DH 4C3IH 1AZQA 3I4MH 5JEAG 2OCEA 2QILA 1CFMA 1IYVA 3NBHA 5C4JB 3GTJB 3MEFA 1EY4A 1PRTF 4IFDG 4RHSA 1A63A 1SNPA 1EEFD 2FJ2A 4DR4L 1IW7D 2D2CC 3T4AC 2PQAA 1PRTB 5EAYA 4DV2Q 1KHIA 1JR0D 2WB1B 3T1HL 1IBML 4JCVE 4YHHL 1PTOH 4IJLA 3KLSX 2K7VA 4OIKA 1ONLA 4QY7A 5IP7G 2PZTA 3A7AB 1C0AA 2QW7A 2D0OA 3DMUA 5D65A 1PH9A 1N36L 1LM0A 3MXGA 4V190 1L0XB 1ESRA 1L1OC 3C46A 1FL0A 2JA7G 3EJIA 3HRZC 3DHQA 1B8AA 2B2YA 4B3SL 1A3TA 1RHPA 1J8IA 2RCNA 4DNRB 4UAIA 2MHVA 1HZAA 3KLRA 5IYDH 1H9JA 1E0BA 4KK7A 2RHQB 5GAHC 3OTOL 1U0LA 3GTQB 3K8AA 1PH2A 3CCEA 2A6ED 3SR1A 5T1GA 4POFA 1EY9A 4BXXG 4S3SA 3W1BA 3OYYA 1DXMA 3KYHC 5C0XJ 2DNEA 3JAMc 3HZXA 2UUAQ 3S9WA 3H09A 4XQQA 4UP9A 5IT9c 3OW7A 3RN5A 3G71A 3PMFA 1S3OA 1S5BD 2YYZA 4LUZA 2QDBA 3RZDH 5ELNA 5M5WB 2J7ZA 2UXCL 4FXDA 1VMPA 3SK5A 4DR4Q 4C3HG 3F8TA 3SK8A 1IYJB 4PV1C 4TQUS 2JJQA 2Z0SA 4JOIC 2EYFA 4K6DA 2WAQE 3T1HQ 1IBMQ 3MAQA 3TS0A 4C3JB 4YHHQ 2EZVA 1R4QB 3S2HH 3S16B 5IP9G 4RHRA 2F03A 2NVXB 1SYBA 1I3QH 1HFGA 1N36Q 2FHTA 2BCOA 1TWCH 1GD7A 3D6WA 4OWTB 2WAQB 1YITA 3A8KE 4QUCA 1GUGA 1YNNC 3TP7A 4X3UA 3T16A 3KDFA 2CWPA 4B3SQ 3SK4A 2J4XA 2E2HB 4Z9CB 2SNMA 5JJIA 3H6MA 1XPRA 1DJRD 1X32A 3B6YA 1SJED 5K5PA 1YHAA 2K5VA 3TRZA 3OTOQ 4A3GB 4BY1H 1JWMD 3SK6A 4DR5L 1YVCA 2B2VC 4JI6L 1BCPB 2B63H 2L55A 1YHQA 3MFYA 2KA7A 2XWJB 4DGZA 5IWAL 2SOBA 1KC8C 5JAVA 2RHSB 2GN5A 3SEBA 4FNFA 4H13C 4ILWA 1VF7A 2LKVA 2WP8J 5AJ3Q 3J80i 3HOZG 5GROA 1S72A 3BZDB 1SFOB 5JJZA 3HKZE 3J7A5 1M1KC 2UXCQ 1HZBA 4DK0A 1KNEA 1JCKB 3D4DA 1X65A 3EN2A 4C3JG 2F0VA 2RVLA 1MD2D 2KCMA 5JJLA 3HKZB 2DY7A 2CKZB 4KV6A 4K8JA 2E5LL 5E3FA 4OWWB 4X3KA 4A3FH 3S24A 1ILPA 4DR6L 3NPPA 1I4RA 2WACA 4UY8C 1CSPA 2B2YC 1TT2A 1EZ8A 1CKMA 1B70B 3I4OA 1F9QA 1A0IA 1CM9A 3D6CA 3TN2A 1SMXA 1EYGA 2KQ3A 3J7AF 1WVLA 3I4MB 1B3QA 3I7FA 4X62L 3J81c 2B2TA 3H15A 3Q0AA 3ICEA 5CC4A 3L7ZC 2B29A 4DAYA 5KNCA 5KRUA 1DZ1A 4A3MG 4K14A 1HQMC 1PTOF 3PO3B 4OONA 3K58A 2AQ3B 1VQ9A 4H0LC 4DR5Q 1BQQT 5FLMG 3HOYG 2F3WA 2GVAA 2EY5A 2VNUD 2L1BA 4IUUA 1IHZA 4K6LA 3J81E 3BYTB 3HOWH 1Q8IA 4IPHA 5F2DA 1SYDA 3VR6A 5IWAQ 4KHPL 1NBWA 2SEBD 5EBDA 3I73A 1AZPA 2V1CC 4A75A 3HOXB 1EYDA 5EBCA 3HS0C 3I90A 3WOEA 3MXPA 5IYBH 2VB3X 1B4OA 1JB3A 1DD2A 1JQYD 3QIAA 3U4VA 4CJ1B 3LGJA 4EVOA 1FNVA 2SDFA 4GLVB 5IYCH 5M5YB 3EFXD 2PQEA 3RUZA 2F0TA 1A15A 4X6AH 3HKZG 1HTPA 1RCVD 3I3CA 2BA1A 2Q2TA 2PI2A 2K75A 2ZT9C 3K7AB 4K5VA 1RD9D 1IBKQ 2NVTH 5JJKA 4DV0L 5CYUA 1CKNB 3VR4A 1NR4A 2E5LQ 4XQNA 1BDOA 4DR1Q 1PHJA 4DR6Q 2F3IA 1FNUA 3PV0A 3G7LA 1RL2A 5J3BA 1LYLA 4DR7L 1V1QA 4BS9A 4KTAA 1E2ZA 2B39A 1F9SA 1W6JA 2EE1A 1PH6A 2UU9Q 4X62Q 4M1UB 1LT6D 2HDMA 3PO3G 1VQJA 3WWVA 2LMCB 2RQXA 1TS2A 4DAVA 3M4QA 1SDFA 2JA6B 4F7XA 4JI7L 1V1PB 1TY0A 4HMJA 4DR2L 3K81C 3GO5A 1VQ6A 3OSOA 2YU9H 2NUCA 2F0HA 5I9PA 2A74C 3K80C 3OIQA 4M8AA 4MTNA 2IX0A 3NBHB 2DGYA 2IJ0A 4KI0A 3HOXG 3J7AV 5KNBA 2Z9HA 5ELFA 2CH4W 1D8LA 4N8X1 4HSVA 3GV3A 5JEAH 4KHPQ 5GAGC 4OX9L 1ICFB 4A76A 1I6HH 1AW7A 2HQEA 2RDGA 4GN3B 3IL8A 3TZDA 3DM3A 3S1NH 5BN3A 3OMGA 4HJ7A 1A2TA 1MKHA 3CCJA 5FLXc 1QOHA 2L5TA 2UXBL 1PH3A 4DU9A 1SE3A 1V43A 1X3PA 2R7ZB 4CGYB 5G3LD 3M4OH 1WYDA 3CQZH 3FPPA 3NENA 1CHQD 3W5OA 3HOUG 3M3YH 3K59A 5NUCA 3L3OC 1HCZA 4DV0Q 1C8CA 1A2UA 2CFMA 4HIKA 2NVQB 5CV7A 3PIOA 3PO2H 2MO0A 1WTVA 4LF5L 4A93B 1VQMA 4KY7A 1HHVA 4P73A 2B2TC 5IGGA 3HGBA 1CQVA 1N9WA 2H1EA 2JA6G 2ATWA 5C0XI 2I07B 3S1MH 1L2FA 3UDXA 1EOVA 3CCUA 3ND9A 1I4QA 1Q8KA 3GD7A 4BY7B 2JXMB 1QZGA 2NVYB 5IGEA 1JWUD 2OQ0A 5IGCA 4DR2Q 1KQSA 1SSOA 4BXXH 3CAMA 4U673 3NXWA 1EQRA 2H4OA 4OHJA 1PH7A 1Y1VG 1LACA 3M85A 3PCOB 1N33L 3S15H 2MQHA 4DXGA 4OX9Q 2D9UA 4PNYA 5EPJA 3H0GB 2D62A 1K0SA 4AYBB 4JI3L 2QEXA 1ENCA 2Z6KA 3P75A 2UXBQ 3VYSA 5KNDA 1OXSC 1X6OA 2IHEA 4RCNA 5C44H 1B53A 2ES2A 3I91A 2B8GA 5ELCA 4A93G 5AFWA 1NMFA 1PH1A 1OXTA 3KDFB 2KVMA 5FO8B 1PLFA 3NQTA 1G291 1SR3A 2KJXA 1YJ9A 1YJNA 3RR5A 4LF4L 2E2JH 4HMIA 4LF5Q 1EWIA 2ZXRA 1PRTC 4BBSH 2VQFL 2CHBD 3MTSA 2EYJA 1NUCA 2R93H 5GQOA 4UHVA 1D2BA 2EYOA 4BY7G 1DOMA 4DK1A 2ALYB 4A3LH 5CV5A 3RNUA 4A3EH 1YIJA 5CORA 2I0QA 1B3AA 3GDEA 1Q90A 1U4PA 4FF3A 1EOTA 3BVGA 2CH4A 2VZAA 3HKSA 4R4IA 4PMWA 4A3JH 4H02A 4CJ2C 4QF4A 4JI4L 1EQTA 3NK9A 2NVTB 1TY2A 1P8LA 4P75A 4YIJA 3H0GG 1N33Q 3A5ZB 4OL7A 4MHEA 1LTRD 1PYSB 1AEXA 1WTOA 5C3XA 3QOLA 4AQYL 1D6EC 4A3BB 1MJEA 2E2IH 1I50H 3E0JA 3HOZH 1UEAB 3Q8DA 5BR8L 1C7YA 2EYMA 4JI3Q 4DAMA 3BDLA 1VQNA 1YNJD 3E5SA 4XIGS 3D0FA 1O7IA 3EVQA 1MI2A 4XYQA 5IODA 1RIPA 2A68C 4IURA 3PUVA 3ERQA 2DJGC 1TWFH 4POGA 3S2DH 2TMPA 3F1ZA 4DV7L 1RJTA 1WTXA 4F88A 1BBUA 4AIMA 4A3CG 1EZ6A 2YU9B 2HD3A 1K83H 1UAPA 4APVA 4CHTB 4KKSA 2CVRA 4DV2L 2F0OA 1NTGA 4K5XA 4LF4Q 1PDQA 2L9HA 3MHBA 3GTMH 1WTRA 2VQFQ 3V2TA 2GA4B 2OTLA 3HOVB 3S1NB 3S1RB 3VYTA 3OWEB 3R2TA 4HJ9A 5BN4A 2ZM6Q 4A3IG 1SXTA 4X3SA 5JEAJ 3CCQA 4H7BA 3Q22A 5LMUL 4HCEA 1JOQA 1KAWA 4J15A 3K6OA 4R4OA 1SE8A 1IXRA 1STYA 1ESFA 3QWNA 1BUVT 4IFDJ 2A73B 3TMEA 1K8OA 1QG7A 3CCLA 4HJ8A 2ZJQA 3I4NG 3S1QH 1Q82C 2YTYA 3STBC 2JYOA 2Z6KC 1V1PA 2K5DA 1E1OA 4DPGA 5CV8A 3PIP3 2VW9A 1BCPC 5BR8Q 4RH6A 1GUOA 4BA2I 1TR5A 2UUAL 1TS4A 4DV4Q 1QVFA 1S5CD 4G57A 4KN4C 3VYUA 1TWAH 2KBNA 1J6QA 3P1HA 1XNQL 2Z4IA 3EA6A 4KJNA 5D3DA 4JYAL 3ND8A 4LFBL 1EY7A 3NP8A 4QCLA 2WB1E 4BBRB 2RA4A 2R92B 2UXDL 4RGTA 2ZTEA 4DV7Q 1ZEQX 1S40A 2V4DA 1HR0W 2JN4A 2A19A 3JAML 3GTKH 4JG2A 2UUCQ 5IT9L 2F0NA 1XXGA 2A68D 1PVOA 4NKLA 2HT1A 5M3FH 3HOVG 4GKKL 2VL6A 2JA5G 2C35B 1S5DD 4JC0A 1Q1BA 1QJOA 5FKAC 1SROA 4L5SA 2JA8H 2Q2IA 3TEHB 3HP3A 3CXCA 3CCMA 2B2UA 3BZCA 1LABA 3CF5A 4RGMA 4DV5L 3U58A 4P72A 3K7UC 1UE7A 3TSSA 1EYAA 2F4VL 1FJGL 4JVZA 3CCRA 3CC7A 3M4YA 5LMUQ 3KLSA 1DOKA 4ULLA 1GUNA 4YCVA 1YBYA 4NDXA 5LL6X 1K8GA 4LFAL 4R9WA 5C44B 1T5EA 4N9PA 3ZYYX 1U5KA 3OW2A 1HPCA 1HUMA 3GV6A 4DUYQ 1G2TA 3BG3A 3BZKA 2LXKA 1VQ7A 1Q7YC 2SNSA 4LMQD 5FOBB 4IUVA 4R1JA 1IKLA 1IKMA 3E9IA 1XMOL 1OXVA 3MXNA 4LUOA 1WTPA 1Y8PB 4A3KB 2FMMA 2R93B 5C3EB 4I7AA 1HZ9A 2BOSA 2R61A 1GM5A 3NTIA 1QZHA 1KXLA 5AJ3L 4OO1G 1TS3A 1WCMH 4LFBQ 1XNQQ 2IX1A 4JYAQ 1YI2A 1BCPD 2IL8A 4TRDA 3HOUH 1Q12A 2UXDQ 5JOBA 4A4IA 1F2ZA 2WB1G 3T1YL 2F52A 4GS3A 2K4KA 1YNXA 1A62A 3KK7A 4DV1L 2A5HA 3JAME 4EQ5A 3TBIB 5IT9E 4JI8L 1VQLA 1JJCB 4LF7L 3TREA 4CBVA 1VQHA 5K36H 3PF4A 3BJUA 2JK8A 4NMZA 4GKKQ 3IKJA 3LNNA 1HRJA 3FKIB 5FO7B 1O7ZA 4KLKA 5C5LA 1TIID 4JI2L 1Y8NB 3KUPA 1TXYA 4IUNA 1G51A 5C4XB 4DV5Q 1K0RA 4XTCS 2F4VQ 5C6AA 4RAUC 2F0UA 2F0JA 4B3RL 1FJGQ 1X56A 2MPMA 3RZOH 2EPBA 4ID6A 4LF6L 5C4ZA 3MWYW 3M7GA 5ISRA 4KKUA 4LFAQ 3S2DB 2K52A 4X66L 2ID0A 1K28A 4KD3A 1OTCA 4KD4A 5DNFA 2KCNA 4P2CB 2AWOA 3I55A 1F77A 1VQAA 3EIVA 1JT8A 2ZXPA 5M3MH 3J81L 4GZYC 3UDGA 2M2LA 4OXPA 2RDHA 1W2BA 1JC7A 1XMOQ 1K3BC 1ICWA 2KENA 4FXKC 2OF1A 1VQBA 3H3VI 1HA6A 3FEWX 1MBYA 1RTNA 1WTHA 2MP1A 4FF4A 2K14A 3GTGB 2NN6H 1R9TB 3I56A 1PZJD 1GVPA 4RKLA 2PMZE 3A8JE 4DNTB 4Y7NB 1HTLD 1ET6A 3ULPA 3L2PA 3TP6A 1SYGA 2A6HC 4HJ5A 3NUCA 4IO9A 3T1YQ 3G6JB 4V0BA 4DV1Q 3X3NA 1IBKL 1STBA 2NYZD 2OWOA 5CGKA 2PMZB 1F2MA 1B1ZA 1X3FA 1X3QA 4JI8Q 4LF7Q 2KEEA 1Y1WH 3R93A 2KOLA 4X64L 2WAQG 4DR1L 4G7ZC 4MIUA 2B2UC 3OHXC 1SNCA 2YV5A 2VUMB 1IBLL 4DA2A 2ZJRA 4JI2Q 3SXHA 5LL6S 5M5XB 1CZGA 3A55A 4KHVA 4A3DB 2KCTA 4X3TA 3T56B 3OOCA 4C3IB 4JBKA 3S17H 1EIHA 1S5FD 2UU9L 2PW7A 4B3RQ 1VQDA 3A7LA 1JB7A 4GKJL 5EKIA 4A3GG 4LF6Q 4NP5A 3A74A 3DEOA 1WD0A 2EJFC 2XSCA 3H3VH 4WRDA 4MTKA 3ONAB 4JI5L 1YNND 4X66Q 1QVGA 2F0QA 1KIXA 2WV6D 4OGQC 1H9SA 4OELB 2K5WA 2NTTA 4TVAB 1IL2A 2EYLA 2GVBA 3URYA 2IWHA 4AH6A 2F0GA 2I46A 4IPDA 1PTOB 5M3FB 4J8QA 1STHA 3N52A 3TDQA 1WD1A 3ULJA 3GTOH 2L11A 2QGQA 1WJJA 5E1FA 2DY8A 3G4SA 4DV3L 3C1EA 1PYWD 4CKBA 5KYLA 2HIXA 3QJYA 1X9NA 4A3CH 2O5JC 3CHBD 4FP5D 1VQGA 2A1AA 1EFWA 1EY0A 3OWFA 2ENBA 1HUNA 4R8NA 2VUMG 1I4HA 1CA5A 2VQEL 5KGUA 3DWAA 4X64Q 1XYIA 5FLXL 1MSGA 2A6HD 3I72A 3OPOA 4IFDI 4A3DG 2PZUA 3KLWA 4XYOA 3T53B 1I94L 1H95A 4QJFA 4C3IG 1JE4A 4JPBW 3I4MG 1K9MC 1Z6HA 1IBLQ 2R6GA 4FF2A 4GLAC 3K5LA 4A3IH 1GUTA 3R8BA 1VF5C 2G5DA 3CP0A 4YY3L 4HIOA 5C3WA 4C1NI 1QNUA 1QE6A 4GKJQ 1F2LA 2PW5A 4O0AA 1A6XA 3S14H 1STGA 5E4WC 5CV4A 3SHLA 2EVBA 3RZDB 3VA5A 1PZID 4JI5Q 1SEBD 5E7NA 2HHHL 1LTID 3A56A 2KHIA 5TSSA 3AB9A 2VXWA 3V96A 1W6KA 4QB4A 1B2TA 4PZ6A 3NE5B 4N8FA 1T5XD 1BKBA 2BE5C 4KY5A 4DNIA 3D31A 2BDNA 1D7QA 4E6IA 3S2HB 5DLQE 1D5MC 5HGTA 1I3QB 1EFID 1D5ZC
chains in the Genus database with same CATH topology
1TWCB 4L8JA 1CI3M 4IFDH 1PXUA 2AQ1B 2X69A 2MGSA 3D8GA 2EJMA 3K57A 4XXEA 5J1ZA 1SYEA 1VMCA 5HURA 1C4QA 4B9XA 4L6TB 4BY1B 3E6ZX 3K5MA 5ELDA 5FLXE 1AFPA 2B63B 2M9VA 1BF4A 1TQOA 2PCFB 3MEHA 4N9TA 1QILA 3MFGA 3WOFA 3MZ5A 2L4NA 1A3VA 4UDUC 4EQNA 4IZ8A 2J0TD 1U9RA 2F0WA 1HXYD 4NW2A 3PUZA 2IX3A 1NAPA 2G9DA 1ZXTA 3A54A 1O80A 1H9KA 1CK1A 1C48A 2JE6I 1Z7TA 5KEEA 1ZYRC 1ENFA 4PMBA 4A3FB 3RD4A 1Q3LA 4F87A 2N55A 2MUYA 4OO1H 5G3LF 1LT4D 1CA6A 4XT3B 4G4KA 5DAUA 4DXFA 2CW0C 2K04A 1EIGA 1B9NA 1SNOA 2D5DA 1B44D 4TSSA 2OXPA 2FMCA 3NWSA 1JWSD 3K5OA 1TVXA 1B9MA 1LTBD 1EU4A 1G2SA 1I4PA 1JOOA 3R2IA 5IOCA 3HOWB 3K0YA 5J39A 2IPKD 4KN7C 3GTOB 1FD7D 2E75C 2Q8IB 1PFNA 1ET9A 1KTKA 2Z4HA 1SMYC 2FFKB 2E2DC 5D14A 3QOJA 3CRLC 1I4GA 2EYPA 2K03A 4CJ0B 1BXTA 4JBWA 1LT3D 3QG1A 3PUYA 2BDOA 2ICIA 2RSOA 1Y8OB 4KY6A 3L9AX 1D1IA 4RKBA 5EQ0A 3FRPB 1ZYRD 2Q8TA 2M00A 2E76C 4PQXA 4LK1C 2IW3A 3X3MA 5JVG3 4KHZA 4BWGB 1XX8A 1BNZA 2JP1A 2CW0D 4G7OC 4Q5VA 3CU7A 3NSWA 1IW7C 3OMCA 1LT5D 2HUGA 1H9SB 2R3ZA 1I6HB 1DOLA 3MC0B 4MN3A 4I65A 3RLFA 1G6ZA 3AU7A 1AP0A 4I7ZC 1PRTD 1OXUA 3EROA 5CBEE 5I2YA 4WJWA 2F1MA 2F0PA 3J80E 1VCIA 4FF1A 3V05A 3DUZA 1G91A 3M4OB 4QMGA 3CQZB 1SMYD 3M3YB 3AMUA 2PYKA 3BYYB 3M7NA 2XNAC 1GUSA 3PO2B 3KBGA 1O7LA 2K33A 3NTHA 5BN5A 4JK1C 1GHKA 4DAPA 3IFDA 2KECA 2XN9C 2AUJD 1CT1D 3S1MB 2EDGA 2NBFA 5D3IB 1D5XC 4DFAA 5I9OA 1EL0A 3BVMA 3GP7A 1F2YA 4RGNA 1K8MA 5EPKA 1PFBA 2AUKA 1MGSA 3LWUA 1B50A 3I70A 1S5ED 3S15B 2XWBB 2QEJC 4H44C 4IALA 3FVQA 2ICEC 1EY5A 1EQVA 4EGVA 1I4XA 1PMRA 1EEID 3LWEA 5EKLA 1STNA 4C3HB 5DM63 3K5NA 2Y0SB 4RGOS 2A69C 1E2WA 3DEPA 3DXJC 2B8FA 2BA0A 5CV9A 1CZWA 2Z8LA 5JVH3 1GJXA 4HCSA 4ZRZA 2E2JB 4TKOB 3Q24A 2QF7A 1FR3A 4BBSB 3NBIA 1JICA 1KABA 1PTOC 5IGDA 1KDAA 5EGTA 4K2LA 2JEBI 4HAEA 4A3EB 3W3AA 1LLRD 3A8IE 1PFMA 1ILQA 3FDTA 4ZUJA 3VYRA 4HTHA 3PUWA 4O42A 3DWQA 1D1KA 5CR3A 4A3JB 3D3RA 5C4HA 3LX0A 2NN6I 3VR3A 3Q23A 1CQFA 1GXDC 1M4VA 3H94A 2CQAA 3KF8A 4QUFA 2E2IB 1I50B 2EXZA 3HOZB 3KBXA 2K28A 2QCPX 1NCVA 5C0XG 3U9SA 2XVSA 4HSPA 4ZUIA 1TWFB 5M9OA 3I4LA 2RKSA 2ZXOA 5A2QL 3F2UA 5DEHA 3O13A 3VR5A 1K83B 2C5CA 4IUQA 1RF2D 2EY2A 4HN7A 4FYDA 1Z47A 3NHHA 2A69D 2EY1A 2OEOA 3GTMB 4XDXA 1BCPF 1I6VC 1FNWA 1O78A 1GHJA 1LO5D 4Q0FA 1TWHB 1BBXC 1DCZA 4A3MB 3T13A 5CMDA 5J22A 1G8ZD 1PTOD 3HOYB 5I6YA 1RTOA 4IQZA 1KDCA 2C9OA 2F3VA 3N6RA 3S1QB 2WKCA 3RMHA 5KIXA 2TSSA 5EKKA 1L0YB 2OT2A 2O5IC 1RDPD 1JOKA 1Y69U 5IGFA 1LTSD 5IGBA 1V8QA 2O4XA 2F0MA 5JPMC 1PZKD 4WORA 3TZUA 1TWAB 2KCCA 1DONA 1O7YA 5A2QE 4HR7B 3GTKB 2K05A 1KAAA 2RDFA 1CTMA 5I2XA 3R3OA 3NQIA 4K2KA 5ELEA 5I4DA 2K01A 1EWHA 2JA8B 4LAAA 4C56C 5COYA 2LFNA 2RSNA 4KJOA 5FO9B 1SBBB 3QB3A 4RFBA 1FYCA 2EY6A 3H91A 1F9RA 2DNCA 4B9WA 1QCBD 4KKTA 5IIFA 3NWTA 2K5QA 2L12A 3FMCA 3H3VC 1TKWB 3OIPA 2PO4A 4WFN3 1NSNS 3MXUA 2XRSD 3MVVA 2Z1CA 4C1NK 2HCCA 4G7HC 3TP5A 3PUXA 1H9RA 3BVZA 1LTGD 1HQRD 1WCMB 1U4MA 2NTSA 3SDZA 3HOUB 2KEDA 2X6LA 2IT1A 2NWGA 3UI2A 4CKCA 1J9OA 2F0KA 1FGBD 2EJGC 2B2WA 2XIWA 1ZKOA 4EQOA 2JEAI 3T51B 4EQPA 1QWYA 1KDBA 1HFNA 4BA1I 3GTPB 1AN8A 3HG9A 1LTTD 2RBMA 3W2DA 1BO0A 5ELBA 4ZK9B 3BDOA 1TS5A 2PZWA 2G9HD 1SYFA 3RZOB 1HA5A 2AWNA 4ME5A 4J6HA 4RA8A 2EYHA 3IAYA 5JPNC 1ML0D 1Y1VB 4LJZC 2F0DA 1U4RA 2AQ2B 4OO1I 2L0CA 1EWCA 1S4ZA 5M3MB 1SE2A 1U4LA 3BDCA 2F0LA 3C3LA 3I8ZA 4ZQ3A 3DM1A 1OXXK 1BR9A 2DN8A 5EJWA 4DF7A 1STEA 1STAA 1EYCA 4R8IA 2PNRC 1EY6A 1ENAA 5T1IA 5K36G 4XT1B 2X6GA 4FXGC 2JSOA 2WKDA 2EOTA 1EY8A 5CBAE 1NR2A 2VB2X 4F8MA 1Y1WB 5I6WA 1UUPA 1XWEA 3C1FA 1SAPA 1KLUD 3CRKC 2WINB 4ZAIA 2KHSA 2BE5D 3HEJA 1SNMA 3VR2A 3S17B 1II3A 4KMUC 1YNJC 1OO9B 4QIWB 1F9PA 1RODA 3EQLC 2HDLA 1TWGB 1WTWA 2Q8RE 1DM0B 4ZLTF 3D4WA 3P7JA 1Q1EA 2NN6G 2K32A 3GQBA 5C0XH 1JORA 4PMCA 1VDZA 5EPLA 1GUWA 3DWPA 2PPBC 3FPUB 4L63B 5A35A 3J80L 4B08A 2B2WC 1EU3A 3QO2A 3D4RA 1SNQA 4IUTA 2E74C 4ZYSA 4FVMA 3P20A 4FO2A 5CV6A 4J1MA 4ZKCB 3IFTA 2MJ8A 4ABNA 5DM73 4A3IB 1V1OA 1R4PB 2QKIC 1M8AA 4CKEA 1SE4A 1SYCA 3S14B 2FINB 2F0IA 2NB0A 4DN4M 3I4NB 3TP8A 3U9OA 1IYUA 2F0EA 2HCIA 1SJHD 2F0FA 1XTCD 2KUMA 4RWSC 4ZKBB 2XRQD 4IUPA 1E2VA 3PIO3 2F0SA 3NTKA 2LS01 3Q6SA 1KLGD 4HEDA 2NZ1D 4RCOA 2O2LD 3SE0A 4K8IA 3ITPA 5FK9C 1QNKA 2K1BA 5LHY1 3SVMA 1MSHA 1QB5D 3C2PA 3VA7A 1UNSA 2F4IA 4O1NA 4IN3A 2JA5B 1BOSA 3GTLB 1H9MA 2A6EC 1LV9A 1TU2B 4C2MB 2JA7B 2N88A 2K6AA 3WDNA 1DYQA 1LTAD 1WTQA 4K5WA 4XQJA 5C5MA 1A3UA 1GOZA 2WIIB 1CHPD 5E4XA 4ODGA 3MA2B 5KYIA 3CKIB 3BS1A 4OIJA 1SNDA 2B2VA 3J7YW 1IL8A 1KNAA 1RKNA 4U68A 2LY7A 1AZQA 5JEAG 2QILA 1CFMA 1IYVA 3NBHA 5C4JB 3GTJB 1EY4A 1PRTF 4IFDG 4RHSA 1SNPA 1EEFD 2FJ2A 1IW7D 2D2CC 3T4AC 1PRTB 1JR0D 2WB1B 1PTOH 3KLSX 2K7VA 4OIKA 1ONLA 2PZTA 3A7AB 3DMUA 5D65A 3MXGA 4V190 1L0XB 1ESRA 3C46A 3EJIA 3HRZC 3DHQA 2B2YA 1A3TA 1RHPA 1J8IA 4DNRB 4UAIA 2MHVA 3KLRA 1H9JA 1E0BA 4KK7A 3GTQB 2A6ED 3SR1A 5T1GA 1EY9A 4S3SA 1DXMA 5C0XJ 2DNEA 3HZXA 3S9WA 3H09A 4XQQA 3OW7A 3PMFA 1S5BD 2YYZA 2QDBA 5M5WB 2J7ZA 4FXDA 1VMPA 3SK5A 4C3HG 3SK8A 4PV1C 4TQUS 2EYFA 4K6DA 3MAQA 4C3JB 2EZVA 1R4QB 3S16B 4RHRA 2F03A 2NVXB 1SYBA 1HFGA 2FHTA 2BCOA 3D6WA 2WAQB 3A8KE 4QUCA 1GUGA 1YNNC 3TP7A 4X3UA 3T16A 3SK4A 2J4XA 2E2HB 4Z9CB 2SNMA 3H6MA 1DJRD 1X32A 1SJED 5K5PA 4A3GB 1JWMD 3SK6A 2B2VC 1BCPB 2L55A 3MFYA 2KA7A 2XWJB 4DGZA 2SOBA 5JAVA 3SEBA 4FNFA 4H13C 4ILWA 1VF7A 2LKVA 2WP8J 3BZDB 1SFOB 5JJZA 4DK0A 1KNEA 1JCKB 3D4DA 4C3JG 2F0VA 2RVLA 1MD2D 3HKZB 2DY7A 4KV6A 4K8JA 5E3FA 4X3KA 1ILPA 1I4RA 3NPPA 2WACA 2B2YC 1TT2A 1EZ8A 1F9QA 1CM9A 3D6CA 3TN2A 3J7AF 3I4MB 2KQ3A 1WVLA 2B2TA 3Q0AA 5CC4A 3L7ZC 5KNCA 4DAYA 5KRUA 1DZ1A 4K14A 1HQMC 1PTOF 3PO3B 3K58A 2AQ3B 4H0LC 1BQQT 2F3WA 2EY5A 2VNUD 2L1BA 4IUUA 1IHZA 4K6LA 3J81E 3BYTB 1Q8IA 5F2DA 3VR6A 1SYDA 2SEBD 5EBDA 3I73A 1AZPA 3HOXB 1EYDA 5EBCA 3HS0C 3I90A 3WOEA 3MXPA 2VB3X 1B4OA 1JB3A 1DD2A 1JQYD 3QIAA 4CJ1B 4EVOA 1FNVA 2SDFA 5M5YB 3EFXD 2PQEA 3RUZA 2F0TA 1A15A 1HTPA 1RCVD 3I3CA 2BA1A 2ZT9C 3K7AB 4K5VA 1RD9D 5CYUA 3VR4A 1NR4A 4XQNA 1BDOA 1FNUA 3PV0A 3G7LA 4BS9A 4KTAA 1E2ZA 2B39A 1F9SA 1W6JA 2EE1A 4M1UB 1LT6D 2HDMA 2LMCB 2RQXA 1TS2A 4DAVA 1SDFA 2JA6B 4F7XA 1V1PB 1TY0A 4HMJA 3GO5A 3OSOA 2NUCA 2F0HA 5I9PA 2A74C 3OIQA 4M8AA 2IX0A 2IJ0A 4KI0A 3J7AV 5KNBA 5ELFA 4HSVA 3GV3A 5JEAH 1AW7A 2HQEA 2RDGA 3IL8A 3TZDA 5BN3A 3OMGA 1A2TA 1QOHA 2L5TA 4DU9A 1SE3A 1V43A 1X3PA 2R7ZB 4CGYB 5G3LD 3FPPA 1CHQD 3K59A 5NUCA 3L3OC 1HCZA 1C8CA 1A2UA 2NVQB 5CV7A 1WTVA 4A93B 4KY7A 1HHVA 2B2TC 5IGGA 3HGBA 1CQVA 2H1EA 5C0XI 2I07B 3ND9A 1I4QA 3GD7A 4BY7B 2JXMB 2NVYB 5IGEA 1JWUD 5IGCA 1SSOA 4U673 3NXWA 2H4OA 4OHJA 1LACA 3M85A 4DXGA 2D9UA 4PNYA 5EPJA 3H0GB 2D62A 4AYBB 1ENCA 3P75A 3VYSA 5KNDA 1OXSC 4RCNA 1B53A 3I91A 2B8GA 5ELCA 5AFWA 1OXTA 5FO8B 2KVMA 1PLFA 3NQTA 1G291 2KJXA 4HMIA 2ZXRA 1PRTC 2CHBD 3MTSA 2EYJA 1NUCA 1D2BA 2EYOA 1DOMA 4DK1A 5CV5A 5CORA 1B3AA 1Q90A 1U4PA 4FF3A 1EOTA 3BVGA 4PMWA 4CJ2C 4QF4A 1EQTA 3NK9A 2NVTB 1TY2A 4YIJA 4OL7A 4MHEA 1LTRD 1AEXA 1WTOA 5C3XA 3QOLA 1D6EC 4A3BB 3E0JA 1UEAB 2EYMA 3BDLA 1YNJD 3E5SA 4XIGS 3EVQA 1MI2A 4XYQA 5IODA 2A68C 4IURA 3PUVA 3ERQA 2TMPA 1RJTA 1WTXA 4F88A 1EZ6A 2YU9B 1UAPA 4CHTB 4KKSA 2CVRA 2F0OA 4K5XA 1PDQA 2L9HA 3MHBA 1WTRA 3V2TA 2GA4B 3HOVB 3S1NB 3S1RB 3VYTA 3OWEB 3R2TA 5BN4A 1SXTA 4X3SA 5JEAJ 4H7BA 3Q22A 4HCEA 1JOQA 3K6OA 1STYA 1ESFA 3QWNA 1BUVT 4IFDJ 2A73B 3TMEA 1K8OA 1QG7A 2JYOA 1V1PA 2K5DA 5CV8A 3PIP3 1BCPC 4BA2I 4RH6A 1GUOA 1TR5A 1TS4A 1S5CD 4G57A 4KN4C 3VYUA 3P1HA 2Z4IA 3EA6A 4KJNA 5D3DA 3ND8A 1EY7A 3NP8A 4QCLA 4BBRB 2RA4A 2R92B 4RGTA 1ZEQX 2V4DA 3JAML 5IT9L 2F0NA 1XXGA 2A68D 4NKLA 1S5DD 1Q1BA 1QJOA 5FKAC 3HP3A 2B2UA 1LABA 4RGMA 3TSSA 1EYAA 3M4YA 3KLSA 1DOKA 4ULLA 1GUNA 4NDXA 5LL6X 4R9WA 5C44B 1T5EA 4N9PA 3ZYYX 1HPCA 1HUMA 3GV6A 1G2TA 3BG3A 2SNSA 4LMQD 5FOBB 4IUVA 1IKLA 1IKMA 1OXVA 3MXNA 1WTPA 1Y8PB 4A3KB 2FMMA 2R93B 5C3EB 2BOSA 2R61A 3NTIA 4OO1G 1TS3A 2IX1A 1BCPD 2IL8A 4TRDA 1Q12A 5JOBA 1F2ZA 3KK7A 2A5HA 3JAME 3TBIB 5IT9E 4CBVA 5K36H 4NMZA 3IKJA 3LNNA 1HRJA 3FKIB 5FO7B 1O7ZA 5C5LA 1TIID 1Y8NB 3KUPA 4IUNA 5C4XB 4XTCS 5C6AA 4RAUC 2F0UA 2F0JA 2MPMA 2EPBA 4ID6A 5C4ZA 3MWYW 3M7GA 5ISRA 4KKUA 3S2DB 2ID0A 4KD3A 4KD4A 5DNFA 2KCNA 4P2CB 2AWOA 1F77A 2ZXPA 3J81L 4GZYC 2M2LA 2RDHA 1JC7A 1ICWA 4FXKC 2OF1A 1HA6A 3FEWX 1MBYA 1RTNA 4FF4A 2MP1A 3GTGB 2NN6H 1R9TB 1PZJD 4RKLA 3A8JE 4DNTB 4Y7NB 1HTLD 1ET6A 3TP6A 1SYGA 2A6HC 3NUCA 3G6JB 4V0BA 3X3NA 1STBA 2NYZD 5CGKA 2PMZB 1F2MA 1B1ZA 1X3QA 2KEEA 3R93A 2KOLA 4G7ZC 4MIUA 2B2UC 3OHXC 1SNCA 2VUMB 4DA2A 3SXHA 5LL6S 5M5XB 1CZGA 3A55A 4KHVA 4A3DB 4X3TA 3T56B 3OOCA 4C3IB 1EIHA 1S5FD 2PW7A 3A7LA 5EKIA 4NP5A 1WD0A 3DEOA 2EJFC 2XSCA 4WRDA 3ONAB 1YNND 2F0QA 2WV6D 4OGQC 1H9SA 2K5WA 2NTTA 2EYLA 3URYA 2IWHA 2F0GA 2I46A 1PTOB 5M3FB 4J8QA 1STHA 3N52A 3TDQA 1WD1A 2L11A 5E1FA 2DY8A 3C1EA 1PYWD 4CKBA 5KYLA 3QJYA 2O5JC 3CHBD 4FP5D 1EY0A 3OWFA 2ENBA 1HUNA 4R8NA 1I4HA 1CA5A 5KGUA 3DWAA 1XYIA 5FLXL 1MSGA 2A6HD 3I72A 3OPOA 4IFDI 2PZUA 4XYOA 3T53B 4C3IG 1JE4A 1Z6HA 2R6GA 4FF2A 3K5LA 1GUTA 3R8BA 1VF5C 5C3WA 4C1NI 1QNUA 1QE6A 1F2LA 2PW5A 1A6XA 1STGA 5E4WC 5CV4A 3SHLA 2EVBA 3RZDB 3VA5A 1PZID 1SEBD 1LTID 3A56A 5TSSA 3AB9A 2VXWA 3V96A 1W6KA 4QB4A 1B2TA 3NE5B 1T5XD 2BE5C 4KY5A 3D31A 2BDNA 4E6IA 3S2HB 1D5MC 5HGTA 1I3QB 1EFID 1D5ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X32 A;  3DEO A;  1U4M A;  1G2S A;  3I90 A;  4ZAI A;  1JIC A;  3ONA B;  2KED A;  2HCI A;  1B4O A;  4OIK A;  1WTV A;  4CJ2 C;  1G91 A;  2X6L A;  1HRJ A;  5D65 A;  1O7Z A;  2X69 A;  1EQT A;  4HAE A;  4CJ1 B;  2B2V C;  2MGS A;  2NWG A;  2SDF A;  3UI2 A;  1HHV A;  2KUM A;  2B2T C;  1ESR A;  1PFM A;  1ILQ A;  4RWS C;  4ZKB B;  4IUP A;  1J9O A;  1A15 A;  3FDT A;  1VMC A;  2H1E A;  2RA4 A;  3KUP A;  3I3C A;  2B2W A;  4O42 A;  5EJW A;  4MHE A;  1F9P A;  2B2Y A;  2XIW A;  3Q6S A;  4RAU C;  1PFN A;  3N52 A;  1ROD A;  1WTO A;  2HDL A;  4HED A;  2NZ1 D;  1RHP A;  2MPM A;  2FFK B;  1WTW A;  2EPB A;  1WD1 A;  1J8I A;  4UAI A;  1NR4 A;  3MWY W;  1HFN A;  2Q8R E;  2L11 A;  1QNK A;  2K1B A;  1DON A;  4ZLT F;  1E0B A;  1O7Y A;  3SVM A;  3IFD A;  5D14 A;  1MSH A;  2KEC A;  1BF4 A;  3P7J A;  1BO0 A;  1SSO A;  2DY8 A;  3G7L A;  4ZK9 B;  5DNF A;  1MI2 A;  5JJZ A;  5T1G A;  4IUR A;  1EL0 A;  4QUF A;  2K03 A;  3HP3 A;  1F9S A;  2EE1 A;  2K05 A;  2L4N A;  1KNE A;  4CJ0 B;  2B2U A;  3KBX A;  1RJT A;  1WTX A;  2K28 A;  2M2L A;  2HDM A;  5EPK A;  2RVL A;  1PFB A;  4RA8 A;  5EPL A;  1GUW A;  1ML0 D;  1HUN A;  1LV9 A;  1MGS A;  1ICW A;  2D9U A;  1U4R A;  1DOK A;  2RSO A;  4NW2 A;  1NCV A;  2CVR A;  1SDF A;  3FPU B;  5EPJ A;  1CA5 A;  2DY7 A;  1HA6 A;  5CBE E;  1RTN A;  2K01 A;  1XYI A;  1MSG A;  2MP1 A;  1B50 A;  4X3K A;  2N88 A;  1PDQ A;  1S4Z A;  1NAP A;  1ILP A;  4R9W A;  5EQ0 A;  1WTQ A;  2Q8T A;  2B2W C;  5COY A;  1JE4 A;  1U4L A;  2L9H A;  3I8Z A;  1ZXT A;  1WTR A;  2RSN A;  2B2Y C;  3QO2 A;  1O80 A;  3F2U A;  5E4X A;  1HUM A;  4IUT A;  1F9Q A;  2J7Z A;  3GV6 A;  3H91 A;  1CM9 A;  1G2T A;  4IUQ A;  3TN2 A;  1F9R A;  1VMP A;  4OIJ A;  1WVL A;  4ZKC B;  3DM1 A;  3LWE A;  2B2V A;  4LMQ D;  1B53 A;  1XX8 A;  3GV3 A;  3I91 A;  4HSV A;  4IUV A;  1BNZ A;  1IL8 A;  1KNA A;  1Q3L A;  1QE6 A;  1IKL A;  2B2T A;  2JP1 A;  2NYZ D;  1F2L A;  2N55 A;  4U68 A;  4X3S A;  5AFW A;  1IKM A;  2KVM A;  2L12 A;  2MJ8 A;  1X3Q A;  4XDX A;  1WTP A;  5E4W C;  1PLF A;  2FMM A;  1AZQ A;  3IL8 A;  3TZD A;  2KEE A;  1DZ1 A;  3R93 A;  2KOL A;  4R8I A;  1CA6 A;  4XT3 B;  5T1I A;  2B2U C;  4XT1 B;  1HFG A;  3DEP A;  2FHT A;  1M8A A;  1BBX C;  2VXW A;  3MTS A;  2HCC A;  2K04 A;  3D6W A;  1B2T A;  1EIG A;  1QG7 A;  2HUG A;  2X6G A;  2IL8 A;  2R3Z A;  1X3P A;  2L1B A;  4IUU A;  4QUC A;  5CMD A;  2EOT A;  1DOL A;  2FIN B;  1DOM A;  4X3T A;  4X3U A;  1EIH A;  5CBA E;  1NR2 A;  2FJ2 A;  4MN3 A;  1RTO A;  2BDN A;  4HCS A;  1G6Z A;  1AP0 A;  2JYO A;  5EKI A;  5COR A;  1SAP A;  4DN4 M;  1AZP A;  1B3A A;  1C8C A;  1TVX A;  1U4P A;  1EOT A;  1WD0 A; 
#chains in the Genus database with same CATH topology
 2EXD A;  1TWC B;  1PH4 A;  2EQS A;  4L8J A;  1CI3 M;  4IFD H;  4GOP A;  1PXU A;  1BVS A;  4DV3 Q;  2AQ1 B;  2X69 A;  2MGS A;  3D8G A;  2R7D A;  1VQ4 A;  2EJM A;  2VY3 A;  1X54 A;  3K57 A;  4XXE A;  5J1Z A;  1SYE A;  1VMC A;  5HUR A;  1C4Q A;  2AMC B;  4B9X A;  4L6T B;  3CD6 A;  2KHJ A;  3F2D A;  4BY1 B;  3E6Z X;  5IP7 H;  2VQE Q;  3KF6 B;  3K5M A;  5ELD A;  2JA5 H;  1E24 A;  5FLX E;  1AFP A;  2B63 B;  2M9V A;  1BF4 A;  1TQO A;  2PCF B;  3MEH A;  4N9T A;  1I94 Q;  1QIL A;  3MFG A;  4C2M H;  2JA7 H;  4B3T L;  3WOF A;  1MIU A;  3MZ5 A;  2L4N A;  4YY3 Q;  1A3V A;  3UDI A;  2JQO A;  4UDU C;  4EQN A;  3TS2 A;  4IZ8 A;  2J0T D;  1U9R A;  2F0W A;  2BH8 A;  1HR0 L;  1KRS A;  1HXY D;  4NW2 A;  1ASZ A;  3PUZ A;  2IX3 A;  2N49 A;  1NAP A;  3MXN B;  4R4C A;  2HHH Q;  2G9D A;  1ZXT A;  3A54 A;  1O80 A;  2B3G A;  1H9K A;  1CK1 A;  1C48 A;  2JE6 I;  1Z7T A;  5C4J H;  5KEE A;  1ZYR C;  1ENF A;  4PMB A;  5HY6 A;  4AYB E;  4A3F B;  3RD4 A;  1Q3L A;  4F87 A;  3PGZ A;  2N55 A;  1VQP A;  4NXM Q;  2MUY A;  4OO1 H;  5G3L F;  1LT4 D;  2UUB L;  1CA6 A;  2R7Z G;  1FGU A;  4XT3 B;  4G4K A;  4YCW A;  5DAU A;  4DXF A;  2CW0 C;  2K04 A;  4C3H H;  1EIG A;  3PIP A;  1B9N A;  4LUV A;  1SNO A;  3RLO A;  1N32 L;  4K0K L;  2D5D A;  1B44 D;  2B63 G;  4TSS A;  2OXP A;  2FMC A;  3NWS A;  1JWS D;  3K5O A;  1TVX A;  5IP9 H;  1B9M A;  4LF8 Q;  1LTB D;  3CCV A;  1XMQ L;  1EU4 A;  1G2S A;  4LF9 L;  1I4P A;  1JOO A;  3R2I A;  5IOC A;  3KJO A;  2I5H A;  3HOW B;  4UP7 A;  4WJ4 A;  3K0Y A;  5J39 A;  2IPK D;  4B3T Q;  4KN7 C;  3GTO B;  1FD7 D;  2E75 C;  3GTQ H;  2CWA A;  2Q8I B;  4MZ9 A;  1PFN A;  3J81 i;  1ET9 A;  2L15 A;  1KTK A;  2Z4H A;  1SMY C;  2K5N A;  2ZM6 L;  2FFK B;  4HID A;  1HR0 Q;  3G6E A;  2E8G A;  1E1T A;  2E2D C;  2Z6B A;  5D14 A;  3QOJ A;  3CRL C;  3E9H A;  1NJI C;  4A3F G;  5ELO A;  1I4G A;  4CDF C;  1HH2 P;  1HZC A;  2EYP A;  2K03 A;  4CJ0 B;  1C9O A;  1BXT A;  4P71 A;  4JBW A;  1LT3 D;  3QG1 A;  4AYB G;  3PUY A;  2BDO A;  1HJP A;  2ICI A;  5M5W H;  2RSO A;  4LFC Q;  3IRB A;  2HQL A;  1Y8O B;  4KY6 A;  2UUB Q;  3L9A X;  4DV4 L;  1D1I A;  4RKB A;  5EQ0 A;  3FRP B;  4DK3 C;  1ZYR D;  2Q8T A;  2M00 A;  4NXN L;  2E76 C;  4PQX A;  4LK1 C;  4C3J H;  1UWV A;  4LW1 A;  1A8V A;  3S16 H;  1N32 Q;  2NVX H;  2IW3 A;  4MNO A;  4K0K Q;  3X3M A;  5JVG 3;  4KHZ A;  4BWG B;  1XX8 A;  1BNZ A;  2JP1 A;  2RCF A;  2CW0 D;  4G7O C;  2UUC L;  1XMQ Q;  4JV5 L;  4LF9 Q;  2YTV A;  4LNQ A;  3J80 c;  3CU7 A;  4Q5V A;  3NSW A;  1IW7 C;  2E2H H;  3CMA A;  5IYB G;  1LUZ A;  4L5Q A;  3OMC A;  1LT5 D;  2HUG A;  1H9S B;  2R3Z A;  1I6H B;  1DOL A;  4CDE C;  3MC0 B;  5IYC G;  1X3E A;  4MN3 A;  4OWX B;  4I65 A;  3RLF A;  1VQE A;  1G6Z A;  1TWH H;  3AU7 A;  1AP0 A;  1VQO A;  1E3P A;  4A3M H;  4I7Z C;  1PRT D;  1OXU A;  3ERO A;  5CBE E;  1HNX L;  5I2Y A;  4WJW A;  2F1M A;  2F0P A;  3J80 E;  1VCI A;  4FF1 A;  5FLM H;  3HOY H;  3V05 A;  3DUZ A;  1G91 A;  3M4O B;  4QMG A;  3CQZ B;  4GNX B;  1SMY D;  4JW0 A;  3M3Y B;  3AMU A;  4OEM B;  1V9P A;  3NEM A;  2PYK A;  4DR3 L;  4YWL A;  4A3B G;  3BYY B;  2HIV A;  4DUY L;  4L5R C;  3M7N A;  5FJ8 G;  2XNA C;  1GUS A;  3PO2 B;  3KBG A;  1O7L A;  3RLN A;  4DUZ L;  1SN8 A;  3AQQ A;  2VS1 A;  2K33 A;  3NTH A;  5IE8 A;  5BN5 A;  4JK1 C;  1GHK A;  4DAP A;  3IFD A;  4O2D A;  2KEC A;  2XN9 C;  1HNW Q;  1M90 C;  3A5U A;  2AUJ D;  1CT1 D;  4NXN Q;  3S1M B;  2EDG A;  2NBF A;  4IOA A;  5D3I B;  1D5X C;  4DFA A;  5I9O A;  1EL0 A;  1I5F A;  1KL9 A;  3BVM A;  3GP7 A;  1F2Y A;  4RGN A;  1K8M A;  2I5M X;  2Q2U A;  5EPK A;  3RN2 A;  1PFB A;  2AUK A;  1MGS A;  2ZTC A;  4IJH A;  1CSQ A;  4JV5 Q;  4GN5 A;  3LWU A;  1B50 A;  2MO1 A;  1X55 A;  1CKO A;  3I70 A;  3G48 A;  1K8A C;  1S5E D;  3S15 B;  2XWB B;  1MJC A;  1YJW A;  2QEJ C;  4H44 C;  4IAL A;  3FVQ A;  2ICE C;  1EY5 A;  1EQV A;  4EGV A;  2Y0S E;  3PO3 H;  1I4X A;  4ME3 A;  1PMR A;  1EEI D;  3LWE A;  3PSI A;  3TQY A;  3KF6 A;  5EKL A;  1STN A;  1HNX Q;  4C3H B;  5DM6 3;  3K5N A;  2Y0S B;  4NPS A;  4RGO S;  2A69 C;  4YWM A;  3HOX H;  1E2W A;  3DEP A;  5LMN W;  3DXJ C;  3PO2 G;  2B8F A;  4RG1 A;  2BA0 A;  5CV9 A;  4GOP B;  1CZW A;  4DR3 Q;  3ZJY C;  2Z8L A;  5JVH 3;  4JI1 L;  1GJX A;  1Z9F A;  4HCS A;  2LXJ A;  4ZRZ A;  2E2J B;  4TKO B;  3Q24 A;  5M5Y H;  2QF7 A;  1FR3 A;  4DUZ Q;  4BBS B;  3NBI A;  4UPA A;  3K7A H;  1JIC A;  3ULL A;  3KFU A;  1KAB A;  1PTO C;  5IGD A;  4BBR G;  2R92 G;  1KDA A;  3BU2 A;  5EGT A;  4K2L A;  2JEB I;  4HAE A;  3STB D;  2NZO A;  4A3E B;  3W3A A;  1LLR D;  3A8I E;  1PFM A;  1ILQ A;  3FDT A;  1QUQ B;  4ZUJ A;  3VYR A;  4GLX A;  4HTH A;  3PUW A;  4O42 A;  3DWQ A;  1D1K A;  4CDD C;  1FVI A;  5CR3 A;  4A3J B;  3D3R A;  1VQK A;  4UP8 A;  5C4H A;  3LX0 A;  3AFQ A;  2NN6 I;  3VR3 A;  3Q23 A;  1CQF A;  2CCZ A;  1BBW A;  1GXD C;  2NZH A;  1M4V A;  2JA6 H;  3H94 A;  2CQA A;  3KF8 A;  3GTP H;  4QUF A;  2E2I B;  1I50 B;  2EXZ A;  2BH2 A;  3HOZ B;  3KBX A;  1JE5 A;  2R7F A;  2Y0S G;  2K28 A;  2WFW A;  3E3X A;  2QCP X;  3U50 C;  3L0O A;  5C44 G;  1NCV A;  1EUJ A;  5C0X G;  3U9S A;  2XVS A;  3K0X A;  4HSP A;  4ZUI A;  1TWF B;  5M9O A;  3I4L A;  4DKA C;  2RKS A;  1Y1V H;  2ZXO A;  5A2Q L;  1J5E L;  3F2U A;  5DEH A;  4Y52 H;  3O13 A;  3VR5 A;  1K83 B;  1AE3 A;  2C5C A;  4JI1 Q;  4BBS G;  4IUQ A;  1RF2 D;  2EY2 A;  3KJP A;  4HN7 A;  4A3K G;  2R93 G;  5C3E G;  4FYD A;  1Z47 A;  3NHH A;  2A69 D;  2EY1 A;  3M4P A;  2OEO A;  2R7Z H;  2XTI A;  3GTM B;  4A3L G;  4XDX A;  2LSS A;  1BCP F;  4A3E G;  1I6V C;  1FNW A;  1O78 A;  1AE2 A;  1XPU A;  1GHJ A;  1LO5 D;  4Q0F A;  1TWH B;  1BBX C;  1DCZ A;  4A3J G;  4A3M B;  2NVQ H;  3T13 A;  5CMD A;  4A93 H;  5J22 A;  4IOC A;  1G8Z D;  1PTO D;  3HOY B;  5I6Y A;  3AFP A;  1RTO A;  3HFZ B;  4IQZ A;  2A8V A;  1XJV A;  1UE5 A;  3FKI G;  1KDC A;  2C9O A;  1HNZ L;  1GO3 E;  2F3V A;  3N6R A;  5C4X G;  3S1Q B;  2WKC A;  3RMH A;  5KIX A;  4B3M L;  2TSS A;  5EKK A;  3U4Z A;  4BY7 H;  3NEL A;  1L0Y B;  2NVY H;  3M9B A;  2OT2 A;  2O5I C;  1RDP D;  1JOK A;  1Y69 U;  1VQ5 A;  5IGF A;  1LTS D;  5IGB A;  1V8Q A;  2O4X A;  3CME A;  1XNR L;  2F0M A;  5JPM C;  1PZK D;  4WOR A;  1VQ8 A;  2MNA A;  1NY4 A;  3TZU A;  1TWA B;  3DLL A;  1L1O B;  5GAD C;  2KCC A;  1DON A;  1O7Y A;  4QL5 A;  1TWG H;  1UE6 A;  1J5E Q;  3H0G H;  5A2Q E;  4HR7 B;  3GTK B;  2K05 A;  1KRT A;  2QDL A;  1KAA A;  1B7Y B;  2RDF A;  1XPO A;  1CTM A;  1PYB A;  5I2X A;  3R3O A;  3NQI A;  2MFI A;  4LWC A;  1CUK A;  4K2K A;  4CDC C;  1PH5 A;  5ELE A;  5I4D A;  4R4Q A;  2K01 A;  1EWH A;  2JA8 B;  4GNX A;  4LAA A;  1IZ6 A;  4C56 C;  5COY A;  2LFN A;  2RSN A;  4KJO A;  5FO9 B;  1SBB B;  3QB3 A;  4RFB A;  4JI6 Q;  4FDB A;  1VQF A;  1FYC A;  2EY6 A;  2OTJ A;  3H91 A;  1WOC A;  1F9R A;  1VQI A;  5HGQ A;  2DNC A;  4B9W A;  1QCB D;  4KKT A;  5IIF A;  3W1G A;  4ALP A;  5L37 A;  3NWT A;  2K5Q A;  2L12 A;  3FMC A;  1HNZ Q;  3H3V C;  1TKW B;  3OIP A;  2PO4 A;  4WFN 3;  1NSN S;  1E7Z A;  3MXU A;  4B3M Q;  2XRS D;  3MVV A;  2Z1C A;  4C1N K;  2HCC A;  2DJF C;  3TP5 A;  4G7H C;  5H1S E;  1X3G A;  1P16 A;  4X65 L;  1XNR Q;  4DK6 C;  3PUX A;  1H9R A;  3F2C A;  2ZTD A;  3BVZ A;  1LTG D;  3JC6 6;  1HQR D;  2JA9 A;  1WCM B;  1U4M A;  2YTX A;  2NTS A;  3SDZ A;  3HOU B;  2KED A;  2X6L A;  4A3B H;  2IT1 A;  2IHF A;  2OQK A;  2NWG A;  3F2B A;  3UI2 A;  3I4N H;  5M3F G;  3ER0 A;  4CKC A;  5FJ8 H;  1J9O A;  2F0K A;  1WI5 A;  1N8R C;  1FGB D;  3PQI A;  2EJG C;  2B2W A;  4IPC A;  2JA8 G;  2XIW A;  1ZKO A;  4EQO A;  2JEA I;  3T51 B;  4EQP A;  1QWY A;  4JI0 L;  4NXM L;  1KDB A;  3JAM i;  1HFN A;  4BA1 I;  3GTP B;  1AN8 A;  3HG9 A;  4DV6 L;  1LTT D;  2RBM A;  3W2D A;  1BO0 A;  5ELB A;  4ZK9 B;  3BDO A;  1JMC A;  5IYD G;  1TS5 A;  2PZW A;  5GAE C;  2G9H D;  1SYF A;  3RZO B;  1HA5 A;  2AWN A;  3EBE A;  4ME5 A;  4J6H A;  3E0E A;  4PZ7 A;  4RA8 A;  2EYH A;  3IAY A;  5JPN C;  1ML0 D;  1Y1V B;  4LJZ C;  3J81 j;  2F0D A;  1U4R A;  2AQ2 B;  3HOV H;  4OO1 I;  3S1R H;  2PQA B;  2L0C A;  3KOJ A;  2QA4 A;  4LF8 L;  2N8N A;  1EWC A;  1G6P A;  1S4Z A;  3GTL H;  1YHB A;  2P5Z X;  1Y14 B;  1SE2 A;  5M3M B;  1U4L A;  3BDC A;  2F0L A;  3C3L A;  3I8Z A;  1QUQ A;  4ZQ3 A;  1ASY A;  1NE3 A;  1WCM G;  3DM1 A;  4IPG A;  1OXX K;  4X65 Q;  1BR9 A;  2DN8 A;  5EJW A;  4DF7 A;  2N3S A;  3CCS A;  1STE A;  1STA A;  1EYC A;  1EQQ A;  2ASB A;  4R8I A;  1PFS A;  2PNR C;  1EY6 A;  1ENA A;  5T1I A;  4HJA A;  5K36 G;  4XT1 B;  4DR7 Q;  1DGS A;  2X6G A;  1AH9 A;  4FXG C;  2JSO A;  2WKD A;  3QR8 A;  2EOT A;  4QGU A;  1EY8 A;  5CBA E;  1EIF A;  1NR2 A;  2VB2 X;  4F8M A;  3GTJ H;  1Y1W B;  1SLJ A;  5I6W A;  1UUP A;  1XWE A;  4GNX C;  3C1F A;  3FP9 A;  1SAP A;  1QVC A;  2FXQ A;  4JI0 Q;  1KLU D;  4BBR H;  3CRK C;  2R92 H;  4JI7 Q;  2CQO A;  4LFC L;  2WIN B;  4WJ3 M;  4DV6 Q;  4ZAI A;  2AKW B;  2KHS A;  1XTD A;  2BE5 D;  3HEJ A;  1SNM A;  4QIW E;  3VR2 A;  3S17 B;  1VS0 A;  3ERS X;  1II3 A;  3UE1 A;  5LMN L;  1Q86 C;  1NMG A;  4BY1 G;  4KMU C;  1YNJ C;  1Q46 A;  1OO9 B;  3KF8 B;  4QIW B;  1F9P A;  2I5L X;  2XGT A;  5IY0 A;  1ROD A;  3EQL C;  3VDY A;  2HDL A;  1TWG B;  5M3M G;  3J7Z C;  1WTW A;  4ZCK A;  1JJG A;  4R4T A;  2Q8R E;  1DM0 B;  4ZLT F;  1K3R A;  3D4W A;  3P7J A;  1Q1E A;  2NN6 G;  2EIF A;  3FHW A;  3CC4 A;  1K73 C;  2K32 A;  3GQB A;  3AYH B;  4JBM A;  5C0X H;  4EX5 A;  1JOR A;  4PMC A;  1VDZ A;  5EPL A;  1GUW A;  1L0W A;  4P74 A;  3DWP A;  2PPB C;  2K50 A;  3FPU B;  3PF5 A;  4L63 B;  5A35 A;  1YZ6 A;  3J80 L;  4GN4 B;  4B08 A;  3CPW A;  2B2W C;  1Y1W G;  2IY5 B;  1EU3 A;  3QO2 A;  4A3K H;  3D4R A;  5C3E H;  1E22 A;  1SNQ A;  2E74 C;  4IUT A;  4ZYS A;  4FVM A;  3P20 A;  4FO2 A;  5CV6 A;  4J1M A;  1PA6 A;  4ZKC B;  4QQB X;  1LTL A;  2H5X A;  1L1O A;  1PV4 A;  3IFT A;  4GOP C;  1GKH A;  2MJ8 A;  4ABN A;  1N34 L;  5DM7 3;  1PH8 A;  4A3I B;  2ZJP A;  1V1O A;  1SRU A;  1R4P B;  2QKI C;  1M8A A;  4CKE A;  1HNW L;  1SE4 A;  5LMN Q;  3UDF A;  4PZ8 A;  1UE1 A;  1SYC A;  3S14 B;  2FIN B;  1UEB A;  1W3S A;  2F0I A;  2K5H A;  3FKI H;  1T9H A;  3CW2 C;  2NB0 A;  4DN4 M;  3I4N B;  5C4X H;  3HOW G;  3TP8 A;  3U9O A;  1IYU A;  2F0E A;  1Q81 C;  2HCI A;  3UE0 A;  1YEZ A;  1SJH D;  2F0F A;  4NB3 A;  1XTC D;  2KUM A;  4RWS C;  2DUD A;  1MHW C;  4ZKB B;  2XRQ D;  4IUP A;  1E2V A;  3PIO 3;  2F0S A;  3NTK A;  4YWK A;  2LS0 1;  4A3G H;  3Q6S A;  1KLG D;  4HED A;  2NZ1 D;  4RCO A;  2O2L D;  3SE0 A;  4K8I A;  3ITP A;  5FK9 C;  1QNK A;  2D0P A;  2K1B A;  5LHY 1;  3SVM A;  1MSH A;  1QB5 D;  4DAY B;  2N78 A;  1EIY B;  4JOI A;  3C2P A;  2PNH A;  3VA7 A;  3AEV A;  1UNS A;  2F4I A;  4O1N A;  3GTG H;  1R9T H;  4IN3 A;  4L5T A;  2JA5 B;  3A0J A;  1CKN A;  1BOS A;  3GTL B;  1H9M A;  2AHO B;  2A6E C;  1SFO H;  4Y7N H;  1LV9 A;  1NNX A;  1TU2 B;  4YCU A;  4C2M B;  2JA7 B;  1N34 Q;  1KD1 C;  3CC2 A;  2N88 A;  3I2Z A;  4HIM A;  2K6A A;  3WDN A;  1DYQ A;  1LTA D;  4JI4 Q;  4PG3 A;  1WTQ A;  4K5W A;  4XQJ A;  4JBJ A;  5C5M A;  1A3U A;  1GOZ A;  2PI2 E;  2WII B;  1CHP D;  5E4X A;  4ODG A;  4RMF A;  3MA2 B;  5KYI A;  3CKI B;  3BS1 A;  2Q2H A;  3CPF A;  4OIJ A;  1SND A;  2VUM H;  1WFQ A;  2B2V A;  2RF4 A;  1VQC A;  4AQY Q;  3J7Y W;  1IL8 A;  1KNA A;  1RKN A;  5M5X H;  4U68 A;  1JJ2 A;  2LY7 A;  3SGI A;  4A3D H;  4C3I H;  1AZQ A;  3I4M H;  5JEA G;  2OCE A;  2QIL A;  1CFM A;  1IYV A;  3NBH A;  5C4J B;  3GTJ B;  3MEF A;  1EY4 A;  1PRT F;  4IFD G;  4RHS A;  1A63 A;  1SNP A;  1EEF D;  2FJ2 A;  4DR4 L;  1IW7 D;  2D2C C;  3T4A C;  2PQA A;  1PRT B;  5EAY A;  4DV2 Q;  1KHI A;  1JR0 D;  2WB1 B;  3T1H L;  1IBM L;  4JCV E;  4YHH L;  1PTO H;  4IJL A;  3KLS X;  2K7V A;  4OIK A;  1ONL A;  4QY7 A;  5IP7 G;  2PZT A;  3A7A B;  1C0A A;  2QW7 A;  2D0O A;  3DMU A;  5D65 A;  1PH9 A;  1N36 L;  1LM0 A;  3MXG A;  4V19 0;  1L0X B;  1ESR A;  1L1O C;  3C46 A;  1FL0 A;  2JA7 G;  3EJI A;  3HRZ C;  3DHQ A;  1B8A A;  2B2Y A;  4B3S L;  1A3T A;  1RHP A;  1J8I A;  2RCN A;  4DNR B;  4UAI A;  2MHV A;  1HZA A;  3KLR A;  5IYD H;  1H9J A;  1E0B A;  4KK7 A;  2RHQ B;  5GAH C;  3OTO L;  1U0L A;  3GTQ B;  3K8A A;  1PH2 A;  3CCE A;  2A6E D;  3SR1 A;  5T1G A;  4POF A;  1EY9 A;  4BXX G;  4S3S A;  3W1B A;  3OYY A;  1DXM A;  3KYH C;  5C0X J;  2DNE A;  3JAM c;  3HZX A;  2UUA Q;  3S9W A;  3H09 A;  4XQQ A;  4UP9 A;  5IT9 c;  3OW7 A;  3RN5 A;  3G71 A;  3PMF A;  1S3O A;  1S5B D;  2YYZ A;  4LUZ A;  2QDB A;  3RZD H;  5ELN A;  5M5W B;  2J7Z A;  2UXC L;  4FXD A;  1VMP A;  3SK5 A;  4DR4 Q;  4C3H G;  3F8T A;  3SK8 A;  1IYJ B;  4PV1 C;  4TQU S;  2JJQ A;  2Z0S A;  4JOI C;  2EYF A;  4K6D A;  2WAQ E;  3T1H Q;  1IBM Q;  3MAQ A;  3TS0 A;  4C3J B;  4YHH Q;  2EZV A;  1R4Q B;  3S2H H;  3S16 B;  5IP9 G;  4RHR A;  2F03 A;  2NVX B;  1SYB A;  1I3Q H;  1HFG A;  1N36 Q;  2FHT A;  2BCO A;  1TWC H;  1GD7 A;  3D6W A;  4OWT B;  2WAQ B;  1YIT A;  3A8K E;  4QUC A;  1GUG A;  1YNN C;  3TP7 A;  4X3U A;  3T16 A;  3KDF A;  2CWP A;  4B3S Q;  3SK4 A;  2J4X A;  2E2H B;  4Z9C B;  2SNM A;  5JJI A;  3H6M A;  1XPR A;  1DJR D;  1X32 A;  3B6Y A;  1SJE D;  5K5P A;  1YHA A;  2K5V A;  3TRZ A;  3OTO Q;  4A3G B;  4BY1 H;  1JWM D;  3SK6 A;  4DR5 L;  1YVC A;  2B2V C;  4JI6 L;  1BCP B;  2B63 H;  2L55 A;  1YHQ A;  3MFY A;  2KA7 A;  2XWJ B;  4DGZ A;  5IWA L;  2SOB A;  1KC8 C;  5JAV A;  2RHS B;  2GN5 A;  3SEB A;  4FNF A;  4H13 C;  4ILW A;  1VF7 A;  2LKV A;  2WP8 J;  5AJ3 Q;  3J80 i;  3HOZ G;  5GRO A;  1S72 A;  3BZD B;  1SFO B;  5JJZ A;  3HKZ E;  3J7A 5;  1M1K C;  2UXC Q;  1HZB A;  4DK0 A;  1KNE A;  1JCK B;  3D4D A;  1X65 A;  3EN2 A;  4C3J G;  2F0V A;  2RVL A;  1MD2 D;  2KCM A;  5JJL A;  3HKZ B;  2DY7 A;  2CKZ B;  4KV6 A;  4K8J A;  2E5L L;  5E3F A;  4OWW B;  4X3K A;  4A3F H;  3S24 A;  1ILP A;  4DR6 L;  3NPP A;  1I4R A;  2WAC A;  4UY8 C;  1CSP A;  2B2Y C;  1TT2 A;  1EZ8 A;  1CKM A;  1B70 B;  3I4O A;  1F9Q A;  1A0I A;  1CM9 A;  3D6C A;  3TN2 A;  1SMX A;  1EYG A;  2KQ3 A;  3J7A F;  1WVL A;  3I4M B;  1B3Q A;  3I7F A;  4X62 L;  3J81 c;  2B2T A;  3H15 A;  3Q0A A;  3ICE A;  5CC4 A;  3L7Z C;  2B29 A;  4DAY A;  5KNC A;  5KRU A;  1DZ1 A;  4A3M G;  4K14 A;  1HQM C;  1PTO F;  3PO3 B;  4OON A;  3K58 A;  2AQ3 B;  1VQ9 A;  4H0L C;  4DR5 Q;  1BQQ T;  5FLM G;  3HOY G;  2F3W A;  2GVA A;  2EY5 A;  2VNU D;  2L1B A;  4IUU A;  1IHZ A;  4K6L A;  3J81 E;  3BYT B;  3HOW H;  1Q8I A;  4IPH A;  5F2D A;  1SYD A;  3VR6 A;  5IWA Q;  4KHP L;  1NBW A;  2SEB D;  5EBD A;  3I73 A;  1AZP A;  2V1C C;  4A75 A;  3HOX B;  1EYD A;  5EBC A;  3HS0 C;  3I90 A;  3WOE A;  3MXP A;  5IYB H;  2VB3 X;  1B4O A;  1JB3 A;  1DD2 A;  1JQY D;  3QIA A;  3U4V A;  4CJ1 B;  3LGJ A;  4EVO A;  1FNV A;  2SDF A;  4GLV B;  5IYC H;  5M5Y B;  3EFX D;  2PQE A;  3RUZ A;  2F0T A;  1A15 A;  4X6A H;  3HKZ G;  1HTP A;  1RCV D;  3I3C A;  2BA1 A;  2Q2T A;  2PI2 A;  2K75 A;  2ZT9 C;  3K7A B;  4K5V A;  1RD9 D;  1IBK Q;  2NVT H;  5JJK A;  4DV0 L;  5CYU A;  1CKN B;  3VR4 A;  1NR4 A;  2E5L Q;  4XQN A;  1BDO A;  4DR1 Q;  1PHJ A;  4DR6 Q;  2F3I A;  1FNU A;  3PV0 A;  3G7L A;  1RL2 A;  5J3B A;  1LYL A;  4DR7 L;  1V1Q A;  4BS9 A;  4KTA A;  1E2Z A;  2B39 A;  1F9S A;  1W6J A;  2EE1 A;  1PH6 A;  2UU9 Q;  4X62 Q;  4M1U B;  1LT6 D;  2HDM A;  3PO3 G;  1VQJ A;  3WWV A;  2LMC B;  2RQX A;  1TS2 A;  4DAV A;  3M4Q A;  1SDF A;  2JA6 B;  4F7X A;  4JI7 L;  1V1P B;  1TY0 A;  4HMJ A;  4DR2 L;  3K81 C;  3GO5 A;  1VQ6 A;  3OSO A;  2YU9 H;  2NUC A;  2F0H A;  5I9P A;  2A74 C;  3K80 C;  3OIQ A;  4M8A A;  4MTN A;  2IX0 A;  3NBH B;  2DGY A;  2IJ0 A;  4KI0 A;  3HOX G;  3J7A V;  5KNB A;  2Z9H A;  5ELF A;  2CH4 W;  1D8L A;  4N8X 1;  4HSV A;  3GV3 A;  5JEA H;  4KHP Q;  5GAG C;  4OX9 L;  1ICF B;  4A76 A;  1I6H H;  1AW7 A;  2HQE A;  2RDG A;  4GN3 B;  3IL8 A;  3TZD A;  3DM3 A;  3S1N H;  5BN3 A;  3OMG A;  4HJ7 A;  1A2T A;  1MKH A;  3CCJ A;  5FLX c;  1QOH A;  2L5T A;  2UXB L;  1PH3 A;  4DU9 A;  1SE3 A;  1V43 A;  1X3P A;  2R7Z B;  4CGY B;  5G3L D;  3M4O H;  1WYD A;  3CQZ H;  3FPP A;  3NEN A;  1CHQ D;  3W5O A;  3HOU G;  3M3Y H;  3K59 A;  5NUC A;  3L3O C;  1HCZ A;  4DV0 Q;  1C8C A;  1A2U A;  2CFM A;  4HIK A;  2NVQ B;  5CV7 A;  3PIO A;  3PO2 H;  2MO0 A;  1WTV A;  4LF5 L;  4A93 B;  1VQM A;  4KY7 A;  1HHV A;  4P73 A;  2B2T C;  5IGG A;  3HGB A;  1CQV A;  1N9W A;  2H1E A;  2JA6 G;  2ATW A;  5C0X I;  2I07 B;  3S1M H;  1L2F A;  3UDX A;  1EOV A;  3CCU A;  3ND9 A;  1I4Q A;  1Q8K A;  3GD7 A;  4BY7 B;  2JXM B;  1QZG A;  2NVY B;  5IGE A;  1JWU D;  2OQ0 A;  5IGC A;  4DR2 Q;  1KQS A;  1SSO A;  4BXX H;  3CAM A;  4U67 3;  3NXW A;  1EQR A;  2H4O A;  4OHJ A;  1PH7 A;  1Y1V G;  1LAC A;  3M85 A;  3PCO B;  1N33 L;  3S15 H;  2MQH A;  4DXG A;  4OX9 Q;  2D9U A;  4PNY A;  5EPJ A;  3H0G B;  2D62 A;  1K0S A;  4AYB B;  4JI3 L;  2QEX A;  1ENC A;  2Z6K A;  3P75 A;  2UXB Q;  3VYS A;  5KND A;  1OXS C;  1X6O A;  2IHE A;  4RCN A;  5C44 H;  1B53 A;  2ES2 A;  3I91 A;  2B8G A;  5ELC A;  4A93 G;  5AFW A;  1NMF A;  1PH1 A;  1OXT A;  3KDF B;  2KVM A;  5FO8 B;  1PLF A;  3NQT A;  1G29 1;  1SR3 A;  2KJX A;  1YJ9 A;  1YJN A;  3RR5 A;  4LF4 L;  2E2J H;  4HMI A;  4LF5 Q;  1EWI A;  2ZXR A;  1PRT C;  4BBS H;  2VQF L;  2CHB D;  3MTS A;  2EYJ A;  1NUC A;  2R93 H;  5GQO A;  4UHV A;  1D2B A;  2EYO A;  4BY7 G;  1DOM A;  4DK1 A;  2ALY B;  4A3L H;  5CV5 A;  3RNU A;  4A3E H;  1YIJ A;  5COR A;  2I0Q A;  1B3A A;  3GDE A;  1Q90 A;  1U4P A;  4FF3 A;  1EOT A;  3BVG A;  2CH4 A;  2VZA A;  3HKS A;  4R4I A;  4PMW A;  4A3J H;  4H02 A;  4CJ2 C;  4QF4 A;  4JI4 L;  1EQT A;  3NK9 A;  2NVT B;  1TY2 A;  1P8L A;  4P75 A;  4YIJ A;  3H0G G;  1N33 Q;  3A5Z B;  4OL7 A;  4MHE A;  1LTR D;  1PYS B;  1AEX A;  1WTO A;  5C3X A;  3QOL A;  4AQY L;  1D6E C;  4A3B B;  1MJE A;  2E2I H;  1I50 H;  3E0J A;  3HOZ H;  1UEA B;  3Q8D A;  5BR8 L;  1C7Y A;  2EYM A;  4JI3 Q;  4DAM A;  3BDL A;  1VQN A;  1YNJ D;  3E5S A;  4XIG S;  3D0F A;  1O7I A;  3EVQ A;  1MI2 A;  4XYQ A;  5IOD A;  1RIP A;  2A68 C;  4IUR A;  3PUV A;  3ERQ A;  2DJG C;  1TWF H;  4POG A;  3S2D H;  2TMP A;  3F1Z A;  4DV7 L;  1RJT A;  1WTX A;  4F88 A;  1BBU A;  4AIM A;  4A3C G;  1EZ6 A;  2YU9 B;  2HD3 A;  1K83 H;  1UAP A;  4APV A;  4CHT B;  4KKS A;  2CVR A;  4DV2 L;  2F0O A;  1NTG A;  4K5X A;  4LF4 Q;  1PDQ A;  2L9H A;  3MHB A;  3GTM H;  1WTR A;  2VQF Q;  3V2T A;  2GA4 B;  2OTL A;  3HOV B;  3S1N B;  3S1R B;  3VYT A;  3OWE B;  3R2T A;  4HJ9 A;  5BN4 A;  2ZM6 Q;  4A3I G;  1SXT A;  4X3S A;  5JEA J;  3CCQ A;  4H7B A;  3Q22 A;  5LMU L;  4HCE A;  1JOQ A;  1KAW A;  4J15 A;  3K6O A;  4R4O A;  1SE8 A;  1IXR A;  1STY A;  1ESF A;  3QWN A;  1BUV T;  4IFD J;  2A73 B;  3TME A;  1K8O A;  1QG7 A;  3CCL A;  4HJ8 A;  2ZJQ A;  3I4N G;  3S1Q H;  1Q82 C;  2YTY A;  3STB C;  2JYO A;  2Z6K C;  1V1P A;  2K5D A;  1E1O A;  4DPG A;  5CV8 A;  3PIP 3;  2VW9 A;  1BCP C;  5BR8 Q;  4RH6 A;  1GUO A;  4BA2 I;  1TR5 A;  2UUA L;  1TS4 A;  4DV4 Q;  1QVF A;  1S5C D;  4G57 A;  4KN4 C;  3VYU A;  1TWA H;  2KBN A;  1J6Q A;  3P1H A;  1XNQ L;  2Z4I A;  3EA6 A;  4KJN A;  5D3D A;  4JYA L;  3ND8 A;  4LFB L;  1EY7 A;  3NP8 A;  4QCL A;  2WB1 E;  4BBR B;  2RA4 A;  2R92 B;  2UXD L;  4RGT A;  2ZTE A;  4DV7 Q;  1ZEQ X;  1S40 A;  2V4D A;  1HR0 W;  2JN4 A;  2A19 A;  3JAM L;  3GTK H;  4JG2 A;  2UUC Q;  5IT9 L;  2F0N A;  1XXG A;  2A68 D;  1PVO A;  4NKL A;  2HT1 A;  5M3F H;  3HOV G;  4GKK L;  2VL6 A;  2JA5 G;  2C35 B;  1S5D D;  4JC0 A;  1Q1B A;  1QJO A;  5FKA C;  1SRO A;  4L5S A;  2JA8 H;  2Q2I A;  3TEH B;  3HP3 A;  3CXC A;  3CCM A;  2B2U A;  3BZC A;  1LAB A;  3CF5 A;  4RGM A;  4DV5 L;  3U58 A;  4P72 A;  3K7U C;  1UE7 A;  3TSS A;  1EYA A;  2F4V L;  1FJG L;  4JVZ A;  3CCR A;  3CC7 A;  3M4Y A;  5LMU Q;  3KLS A;  1DOK A;  4ULL A;  1GUN A;  4YCV A;  1YBY A;  4NDX A;  5LL6 X;  1K8G A;  4LFA L;  4R9W A;  5C44 B;  1T5E A;  4N9P A;  3ZYY X;  1U5K A;  3OW2 A;  1HPC A;  1HUM A;  3GV6 A;  4DUY Q;  1G2T A;  3BG3 A;  3BZK A;  2LXK A;  1VQ7 A;  1Q7Y C;  2SNS A;  4LMQ D;  5FOB B;  4IUV A;  4R1J A;  1IKL A;  1IKM A;  3E9I A;  1XMO L;  1OXV A;  3MXN A;  4LUO A;  1WTP A;  1Y8P B;  4A3K B;  2FMM A;  2R93 B;  5C3E B;  4I7A A;  1HZ9 A;  2BOS A;  2R61 A;  1GM5 A;  3NTI A;  1QZH A;  1KXL A;  5AJ3 L;  4OO1 G;  1TS3 A;  1WCM H;  4LFB Q;  1XNQ Q;  2IX1 A;  4JYA Q;  1YI2 A;  1BCP D;  2IL8 A;  4TRD A;  3HOU H;  1Q12 A;  2UXD Q;  5JOB A;  4A4I A;  1F2Z A;  2WB1 G;  3T1Y L;  2F52 A;  4GS3 A;  2K4K A;  1YNX A;  1A62 A;  3KK7 A;  4DV1 L;  2A5H A;  3JAM E;  4EQ5 A;  3TBI B;  5IT9 E;  4JI8 L;  1VQL A;  1JJC B;  4LF7 L;  3TRE A;  4CBV A;  1VQH A;  5K36 H;  3PF4 A;  3BJU A;  2JK8 A;  4NMZ A;  4GKK Q;  3IKJ A;  3LNN A;  1HRJ A;  3FKI B;  5FO7 B;  1O7Z A;  4KLK A;  5C5L A;  1TII D;  4JI2 L;  1Y8N B;  3KUP A;  1TXY A;  4IUN A;  1G51 A;  5C4X B;  4DV5 Q;  1K0R A;  4XTC S;  2F4V Q;  5C6A A;  4RAU C;  2F0U A;  2F0J A;  4B3R L;  1FJG Q;  1X56 A;  2MPM A;  3RZO H;  2EPB A;  4ID6 A;  4LF6 L;  5C4Z A;  3MWY W;  3M7G A;  5ISR A;  4KKU A;  4LFA Q;  3S2D B;  2K52 A;  4X66 L;  2ID0 A;  1K28 A;  4KD3 A;  1OTC A;  4KD4 A;  5DNF A;  2KCN A;  4P2C B;  2AWO A;  3I55 A;  1F77 A;  1VQA A;  3EIV A;  1JT8 A;  2ZXP A;  5M3M H;  3J81 L;  4GZY C;  3UDG A;  2M2L A;  4OXP A;  2RDH A;  1W2B A;  1JC7 A;  1XMO Q;  1K3B C;  1ICW A;  2KEN A;  4FXK C;  2OF1 A;  1VQB A;  3H3V I;  1HA6 A;  3FEW X;  1MBY A;  1RTN A;  1WTH A;  2MP1 A;  4FF4 A;  2K14 A;  3GTG B;  2NN6 H;  1R9T B;  3I56 A;  1PZJ D;  1GVP A;  4RKL A;  2PMZ E;  3A8J E;  4DNT B;  4Y7N B;  1HTL D;  1ET6 A;  3ULP A;  3L2P A;  3TP6 A;  1SYG A;  2A6H C;  4HJ5 A;  3NUC A;  4IO9 A;  3T1Y Q;  3G6J B;  4V0B A;  4DV1 Q;  3X3N A;  1IBK L;  1STB A;  2NYZ D;  2OWO A;  5CGK A;  2PMZ B;  1F2M A;  1B1Z A;  1X3F A;  1X3Q A;  4JI8 Q;  4LF7 Q;  2KEE A;  1Y1W H;  3R93 A;  2KOL A;  4X64 L;  2WAQ G;  4DR1 L;  4G7Z C;  4MIU A;  2B2U C;  3OHX C;  1SNC A;  2YV5 A;  2VUM B;  1IBL L;  4DA2 A;  2ZJR A;  4JI2 Q;  3SXH A;  5LL6 S;  5M5X B;  1CZG A;  3A55 A;  4KHV A;  4A3D B;  2KCT A;  4X3T A;  3T56 B;  3OOC A;  4C3I B;  4JBK A;  3S17 H;  1EIH A;  1S5F D;  2UU9 L;  2PW7 A;  4B3R Q;  1VQD A;  3A7L A;  1JB7 A;  4GKJ L;  5EKI A;  4A3G G;  4LF6 Q;  4NP5 A;  3A74 A;  3DEO A;  1WD0 A;  2EJF C;  2XSC A;  3H3V H;  4WRD A;  4MTK A;  3ONA B;  4JI5 L;  1YNN D;  4X66 Q;  1QVG A;  2F0Q A;  1KIX A;  2WV6 D;  4OGQ C;  1H9S A;  4OEL B;  2K5W A;  2NTT A;  4TVA B;  1IL2 A;  2EYL A;  2GVB A;  3URY A;  2IWH A;  4AH6 A;  2F0G A;  2I46 A;  4IPD A;  1PTO B;  5M3F B;  4J8Q A;  1STH A;  3N52 A;  3TDQ A;  1WD1 A;  3ULJ A;  3GTO H;  2L11 A;  2QGQ A;  1WJJ A;  5E1F A;  2DY8 A;  3G4S A;  4DV3 L;  3C1E A;  1PYW D;  4CKB A;  5KYL A;  2HIX A;  3QJY A;  1X9N A;  4A3C H;  2O5J C;  3CHB D;  4FP5 D;  1VQG A;  2A1A A;  1EFW A;  1EY0 A;  3OWF A;  2ENB A;  1HUN A;  4R8N A;  2VUM G;  1I4H A;  1CA5 A;  2VQE L;  5KGU A;  3DWA A;  4X64 Q;  1XYI A;  5FLX L;  1MSG A;  2A6H D;  3I72 A;  3OPO A;  4IFD I;  4A3D G;  2PZU A;  3KLW A;  4XYO A;  3T53 B;  1I94 L;  1H95 A;  4QJF A;  4C3I G;  1JE4 A;  4JPB W;  3I4M G;  1K9M C;  1Z6H A;  1IBL Q;  2R6G A;  4FF2 A;  4GLA C;  3K5L A;  4A3I H;  1GUT A;  3R8B A;  1VF5 C;  2G5D A;  3CP0 A;  4YY3 L;  4HIO A;  5C3W A;  4C1N I;  1QNU A;  1QE6 A;  4GKJ Q;  1F2L A;  2PW5 A;  4O0A A;  1A6X A;  3S14 H;  1STG A;  5E4W C;  5CV4 A;  3SHL A;  2EVB A;  3RZD B;  3VA5 A;  1PZI D;  4JI5 Q;  1SEB D;  5E7N A;  2HHH L;  1LTI D;  3A56 A;  2KHI A;  5TSS A;  3AB9 A;  2VXW A;  3V96 A;  1W6K A;  4QB4 A;  1B2T A;  4PZ6 A;  3NE5 B;  4N8F A;  1T5X D;  1BKB A;  2BE5 C;  4KY5 A;  4DNI A;  3D31 A;  2BDN A;  1D7Q A;  4E6I A;  3S2H B;  5DLQ E;  1D5M C;  5HGT A;  1I3Q B;  1EFI D;  1D5Z C; 
#chains in the Genus database with same CATH homology
 1TWC B;  4L8J A;  1CI3 M;  4IFD H;  1PXU A;  2AQ1 B;  2X69 A;  2MGS A;  3D8G A;  2EJM A;  3K57 A;  4XXE A;  5J1Z A;  1SYE A;  1VMC A;  5HUR A;  1C4Q A;  4B9X A;  4L6T B;  4BY1 B;  3E6Z X;  3K5M A;  5ELD A;  5FLX E;  1AFP A;  2B63 B;  2M9V A;  1BF4 A;  1TQO A;  2PCF B;  3MEH A;  4N9T A;  1QIL A;  3MFG A;  3WOF A;  3MZ5 A;  2L4N A;  1A3V A;  4UDU C;  4EQN A;  4IZ8 A;  2J0T D;  1U9R A;  2F0W A;  1HXY D;  4NW2 A;  3PUZ A;  2IX3 A;  1NAP A;  2G9D A;  1ZXT A;  3A54 A;  1O80 A;  1H9K A;  1CK1 A;  1C48 A;  2JE6 I;  1Z7T A;  5KEE A;  1ZYR C;  1ENF A;  4PMB A;  4A3F B;  3RD4 A;  1Q3L A;  4F87 A;  2N55 A;  2MUY A;  4OO1 H;  5G3L F;  1LT4 D;  1CA6 A;  4XT3 B;  4G4K A;  5DAU A;  4DXF A;  2CW0 C;  2K04 A;  1EIG A;  1B9N A;  1SNO A;  2D5D A;  1B44 D;  4TSS A;  2OXP A;  2FMC A;  3NWS A;  1JWS D;  3K5O A;  1TVX A;  1B9M A;  1LTB D;  1EU4 A;  1G2S A;  1I4P A;  1JOO A;  3R2I A;  5IOC A;  3HOW B;  3K0Y A;  5J39 A;  2IPK D;  4KN7 C;  3GTO B;  1FD7 D;  2E75 C;  2Q8I B;  1PFN A;  1ET9 A;  1KTK A;  2Z4H A;  1SMY C;  2FFK B;  2E2D C;  5D14 A;  3QOJ A;  3CRL C;  1I4G A;  2EYP A;  2K03 A;  4CJ0 B;  1BXT A;  4JBW A;  1LT3 D;  3QG1 A;  3PUY A;  2BDO A;  2ICI A;  2RSO A;  1Y8O B;  4KY6 A;  3L9A X;  1D1I A;  4RKB A;  5EQ0 A;  3FRP B;  1ZYR D;  2Q8T A;  2M00 A;  2E76 C;  4PQX A;  4LK1 C;  2IW3 A;  3X3M A;  5JVG 3;  4KHZ A;  4BWG B;  1XX8 A;  1BNZ A;  2JP1 A;  2CW0 D;  4G7O C;  4Q5V A;  3CU7 A;  3NSW A;  1IW7 C;  3OMC A;  1LT5 D;  2HUG A;  1H9S B;  2R3Z A;  1I6H B;  1DOL A;  3MC0 B;  4MN3 A;  4I65 A;  3RLF A;  1G6Z A;  3AU7 A;  1AP0 A;  4I7Z C;  1PRT D;  1OXU A;  3ERO A;  5CBE E;  5I2Y A;  4WJW A;  2F1M A;  2F0P A;  3J80 E;  1VCI A;  4FF1 A;  3V05 A;  3DUZ A;  1G91 A;  3M4O B;  4QMG A;  3CQZ B;  1SMY D;  3M3Y B;  3AMU A;  2PYK A;  3BYY B;  3M7N A;  2XNA C;  1GUS A;  3PO2 B;  3KBG A;  1O7L A;  2K33 A;  3NTH A;  5BN5 A;  4JK1 C;  1GHK A;  4DAP A;  3IFD A;  2KEC A;  2XN9 C;  2AUJ D;  1CT1 D;  3S1M B;  2EDG A;  2NBF A;  5D3I B;  1D5X C;  4DFA A;  5I9O A;  1EL0 A;  3BVM A;  3GP7 A;  1F2Y A;  4RGN A;  1K8M A;  5EPK A;  1PFB A;  2AUK A;  1MGS A;  3LWU A;  1B50 A;  3I70 A;  1S5E D;  3S15 B;  2XWB B;  2QEJ C;  4H44 C;  4IAL A;  3FVQ A;  2ICE C;  1EY5 A;  1EQV A;  4EGV A;  1I4X A;  1PMR A;  1EEI D;  3LWE A;  5EKL A;  1STN A;  4C3H B;  5DM6 3;  3K5N A;  2Y0S B;  4RGO S;  2A69 C;  1E2W A;  3DEP A;  3DXJ C;  2B8F A;  2BA0 A;  5CV9 A;  1CZW A;  2Z8L A;  5JVH 3;  1GJX A;  4HCS A;  4ZRZ A;  2E2J B;  4TKO B;  3Q24 A;  2QF7 A;  1FR3 A;  4BBS B;  3NBI A;  1JIC A;  1KAB A;  1PTO C;  5IGD A;  1KDA A;  5EGT A;  4K2L A;  2JEB I;  4HAE A;  4A3E B;  3W3A A;  1LLR D;  3A8I E;  1PFM A;  1ILQ A;  3FDT A;  4ZUJ A;  3VYR A;  4HTH A;  3PUW A;  4O42 A;  3DWQ A;  1D1K A;  5CR3 A;  4A3J B;  3D3R A;  5C4H A;  3LX0 A;  2NN6 I;  3VR3 A;  3Q23 A;  1CQF A;  1GXD C;  1M4V A;  3H94 A;  2CQA A;  3KF8 A;  4QUF A;  2E2I B;  1I50 B;  2EXZ A;  3HOZ B;  3KBX A;  2K28 A;  2QCP X;  1NCV A;  5C0X G;  3U9S A;  2XVS A;  4HSP A;  4ZUI A;  1TWF B;  5M9O A;  3I4L A;  2RKS A;  2ZXO A;  5A2Q L;  3F2U A;  5DEH A;  3O13 A;  3VR5 A;  1K83 B;  2C5C A;  4IUQ A;  1RF2 D;  2EY2 A;  4HN7 A;  4FYD A;  1Z47 A;  3NHH A;  2A69 D;  2EY1 A;  2OEO A;  3GTM B;  4XDX A;  1BCP F;  1I6V C;  1FNW A;  1O78 A;  1GHJ A;  1LO5 D;  4Q0F A;  1TWH B;  1BBX C;  1DCZ A;  4A3M B;  3T13 A;  5CMD A;  5J22 A;  1G8Z D;  1PTO D;  3HOY B;  5I6Y A;  1RTO A;  4IQZ A;  1KDC A;  2C9O A;  2F3V A;  3N6R A;  3S1Q B;  2WKC A;  3RMH A;  5KIX A;  2TSS A;  5EKK A;  1L0Y B;  2OT2 A;  2O5I C;  1RDP D;  1JOK A;  1Y69 U;  5IGF A;  1LTS D;  5IGB A;  1V8Q A;  2O4X A;  2F0M A;  5JPM C;  1PZK D;  4WOR A;  3TZU A;  1TWA B;  2KCC A;  1DON A;  1O7Y A;  5A2Q E;  4HR7 B;  3GTK B;  2K05 A;  1KAA A;  2RDF A;  1CTM A;  5I2X A;  3R3O A;  3NQI A;  4K2K A;  5ELE A;  5I4D A;  2K01 A;  1EWH A;  2JA8 B;  4LAA A;  4C56 C;  5COY A;  2LFN A;  2RSN A;  4KJO A;  5FO9 B;  1SBB B;  3QB3 A;  4RFB A;  1FYC A;  2EY6 A;  3H91 A;  1F9R A;  2DNC A;  4B9W A;  1QCB D;  4KKT A;  5IIF A;  3NWT A;  2K5Q A;  2L12 A;  3FMC A;  3H3V C;  1TKW B;  3OIP A;  2PO4 A;  4WFN 3;  1NSN S;  3MXU A;  2XRS D;  3MVV A;  2Z1C A;  4C1N K;  2HCC A;  4G7H C;  3TP5 A;  3PUX A;  1H9R A;  3BVZ A;  1LTG D;  1HQR D;  1WCM B;  1U4M A;  2NTS A;  3SDZ A;  3HOU B;  2KED A;  2X6L A;  2IT1 A;  2NWG A;  3UI2 A;  4CKC A;  1J9O A;  2F0K A;  1FGB D;  2EJG C;  2B2W A;  2XIW A;  1ZKO A;  4EQO A;  2JEA I;  3T51 B;  4EQP A;  1QWY A;  1KDB A;  1HFN A;  4BA1 I;  3GTP B;  1AN8 A;  3HG9 A;  1LTT D;  2RBM A;  3W2D A;  1BO0 A;  5ELB A;  4ZK9 B;  3BDO A;  1TS5 A;  2PZW A;  2G9H D;  1SYF A;  3RZO B;  1HA5 A;  2AWN A;  4ME5 A;  4J6H A;  4RA8 A;  2EYH A;  3IAY A;  5JPN C;  1ML0 D;  1Y1V B;  4LJZ C;  2F0D A;  1U4R A;  2AQ2 B;  4OO1 I;  2L0C A;  1EWC A;  1S4Z A;  5M3M B;  1SE2 A;  1U4L A;  3BDC A;  2F0L A;  3C3L A;  3I8Z A;  4ZQ3 A;  3DM1 A;  1OXX K;  1BR9 A;  2DN8 A;  5EJW A;  4DF7 A;  1STE A;  1STA A;  1EYC A;  4R8I A;  2PNR C;  1EY6 A;  1ENA A;  5T1I A;  5K36 G;  4XT1 B;  2X6G A;  4FXG C;  2JSO A;  2WKD A;  2EOT A;  1EY8 A;  5CBA E;  1NR2 A;  2VB2 X;  4F8M A;  1Y1W B;  5I6W A;  1UUP A;  1XWE A;  3C1F A;  1SAP A;  1KLU D;  3CRK C;  2WIN B;  4ZAI A;  2KHS A;  2BE5 D;  3HEJ A;  1SNM A;  3VR2 A;  3S17 B;  1II3 A;  4KMU C;  1YNJ C;  1OO9 B;  4QIW B;  1F9P A;  1ROD A;  3EQL C;  2HDL A;  1TWG B;  1WTW A;  2Q8R E;  1DM0 B;  4ZLT F;  3D4W A;  3P7J A;  1Q1E A;  2NN6 G;  2K32 A;  3GQB A;  5C0X H;  1JOR A;  4PMC A;  1VDZ A;  5EPL A;  1GUW A;  3DWP A;  2PPB C;  3FPU B;  4L63 B;  5A35 A;  3J80 L;  4B08 A;  2B2W C;  1EU3 A;  3QO2 A;  3D4R A;  1SNQ A;  4IUT A;  2E74 C;  4ZYS A;  4FVM A;  3P20 A;  4FO2 A;  5CV6 A;  4J1M A;  4ZKC B;  3IFT A;  2MJ8 A;  4ABN A;  5DM7 3;  4A3I B;  1V1O A;  1R4P B;  2QKI C;  1M8A A;  4CKE A;  1SE4 A;  1SYC A;  3S14 B;  2FIN B;  2F0I A;  2NB0 A;  4DN4 M;  3I4N B;  3TP8 A;  3U9O A;  1IYU A;  2F0E A;  2HCI A;  1SJH D;  2F0F A;  1XTC D;  2KUM A;  4RWS C;  4ZKB B;  2XRQ D;  4IUP A;  1E2V A;  3PIO 3;  2F0S A;  3NTK A;  2LS0 1;  3Q6S A;  1KLG D;  4HED A;  2NZ1 D;  4RCO A;  2O2L D;  3SE0 A;  4K8I A;  3ITP A;  5FK9 C;  1QNK A;  2K1B A;  5LHY 1;  3SVM A;  1MSH A;  1QB5 D;  3C2P A;  3VA7 A;  1UNS A;  2F4I A;  4O1N A;  4IN3 A;  2JA5 B;  1BOS A;  3GTL B;  1H9M A;  2A6E C;  1LV9 A;  1TU2 B;  4C2M B;  2JA7 B;  2N88 A;  2K6A A;  3WDN A;  1DYQ A;  1LTA D;  1WTQ A;  4K5W A;  4XQJ A;  5C5M A;  1A3U A;  1GOZ A;  2WII B;  1CHP D;  5E4X A;  4ODG A;  3MA2 B;  5KYI A;  3CKI B;  3BS1 A;  4OIJ A;  1SND A;  2B2V A;  3J7Y W;  1IL8 A;  1KNA A;  1RKN A;  4U68 A;  2LY7 A;  1AZQ A;  5JEA G;  2QIL A;  1CFM A;  1IYV A;  3NBH A;  5C4J B;  3GTJ B;  1EY4 A;  1PRT F;  4IFD G;  4RHS A;  1SNP A;  1EEF D;  2FJ2 A;  1IW7 D;  2D2C C;  3T4A C;  1PRT B;  1JR0 D;  2WB1 B;  1PTO H;  3KLS X;  2K7V A;  4OIK A;  1ONL A;  2PZT A;  3A7A B;  3DMU A;  5D65 A;  3MXG A;  4V19 0;  1L0X B;  1ESR A;  3C46 A;  3EJI A;  3HRZ C;  3DHQ A;  2B2Y A;  1A3T A;  1RHP A;  1J8I A;  4DNR B;  4UAI A;  2MHV A;  3KLR A;  1H9J A;  1E0B A;  4KK7 A;  3GTQ B;  2A6E D;  3SR1 A;  5T1G A;  1EY9 A;  4S3S A;  1DXM A;  5C0X J;  2DNE A;  3HZX A;  3S9W A;  3H09 A;  4XQQ A;  3OW7 A;  3PMF A;  1S5B D;  2YYZ A;  2QDB A;  5M5W B;  2J7Z A;  4FXD A;  1VMP A;  3SK5 A;  4C3H G;  3SK8 A;  4PV1 C;  4TQU S;  2EYF A;  4K6D A;  3MAQ A;  4C3J B;  2EZV A;  1R4Q B;  3S16 B;  4RHR A;  2F03 A;  2NVX B;  1SYB A;  1HFG A;  2FHT A;  2BCO A;  3D6W A;  2WAQ B;  3A8K E;  4QUC A;  1GUG A;  1YNN C;  3TP7 A;  4X3U A;  3T16 A;  3SK4 A;  2J4X A;  2E2H B;  4Z9C B;  2SNM A;  3H6M A;  1DJR D;  1X32 A;  1SJE D;  5K5P A;  4A3G B;  1JWM D;  3SK6 A;  2B2V C;  1BCP B;  2L55 A;  3MFY A;  2KA7 A;  2XWJ B;  4DGZ A;  2SOB A;  5JAV A;  3SEB A;  4FNF A;  4H13 C;  4ILW A;  1VF7 A;  2LKV A;  2WP8 J;  3BZD B;  1SFO B;  5JJZ A;  4DK0 A;  1KNE A;  1JCK B;  3D4D A;  4C3J G;  2F0V A;  2RVL A;  1MD2 D;  3HKZ B;  2DY7 A;  4KV6 A;  4K8J A;  5E3F A;  4X3K A;  1ILP A;  1I4R A;  3NPP A;  2WAC A;  2B2Y C;  1TT2 A;  1EZ8 A;  1F9Q A;  1CM9 A;  3D6C A;  3TN2 A;  3J7A F;  3I4M B;  2KQ3 A;  1WVL A;  2B2T A;  3Q0A A;  5CC4 A;  3L7Z C;  5KNC A;  4DAY A;  5KRU A;  1DZ1 A;  4K14 A;  1HQM C;  1PTO F;  3PO3 B;  3K58 A;  2AQ3 B;  4H0L C;  1BQQ T;  2F3W A;  2EY5 A;  2VNU D;  2L1B A;  4IUU A;  1IHZ A;  4K6L A;  3J81 E;  3BYT B;  1Q8I A;  5F2D A;  3VR6 A;  1SYD A;  2SEB D;  5EBD A;  3I73 A;  1AZP A;  3HOX B;  1EYD A;  5EBC A;  3HS0 C;  3I90 A;  3WOE A;  3MXP A;  2VB3 X;  1B4O A;  1JB3 A;  1DD2 A;  1JQY D;  3QIA A;  4CJ1 B;  4EVO A;  1FNV A;  2SDF A;  5M5Y B;  3EFX D;  2PQE A;  3RUZ A;  2F0T A;  1A15 A;  1HTP A;  1RCV D;  3I3C A;  2BA1 A;  2ZT9 C;  3K7A B;  4K5V A;  1RD9 D;  5CYU A;  3VR4 A;  1NR4 A;  4XQN A;  1BDO A;  1FNU A;  3PV0 A;  3G7L A;  4BS9 A;  4KTA A;  1E2Z A;  2B39 A;  1F9S A;  1W6J A;  2EE1 A;  4M1U B;  1LT6 D;  2HDM A;  2LMC B;  2RQX A;  1TS2 A;  4DAV A;  1SDF A;  2JA6 B;  4F7X A;  1V1P B;  1TY0 A;  4HMJ A;  3GO5 A;  3OSO A;  2NUC A;  2F0H A;  5I9P A;  2A74 C;  3OIQ A;  4M8A A;  2IX0 A;  2IJ0 A;  4KI0 A;  3J7A V;  5KNB A;  5ELF A;  4HSV A;  3GV3 A;  5JEA H;  1AW7 A;  2HQE A;  2RDG A;  3IL8 A;  3TZD A;  5BN3 A;  3OMG A;  1A2T A;  1QOH A;  2L5T A;  4DU9 A;  1SE3 A;  1V43 A;  1X3P A;  2R7Z B;  4CGY B;  5G3L D;  3FPP A;  1CHQ D;  3K59 A;  5NUC A;  3L3O C;  1HCZ A;  1C8C A;  1A2U A;  2NVQ B;  5CV7 A;  1WTV A;  4A93 B;  4KY7 A;  1HHV A;  2B2T C;  5IGG A;  3HGB A;  1CQV A;  2H1E A;  5C0X I;  2I07 B;  3ND9 A;  1I4Q A;  3GD7 A;  4BY7 B;  2JXM B;  2NVY B;  5IGE A;  1JWU D;  5IGC A;  1SSO A;  4U67 3;  3NXW A;  2H4O A;  4OHJ A;  1LAC A;  3M85 A;  4DXG A;  2D9U A;  4PNY A;  5EPJ A;  3H0G B;  2D62 A;  4AYB B;  1ENC A;  3P75 A;  3VYS A;  5KND A;  1OXS C;  4RCN A;  1B53 A;  3I91 A;  2B8G A;  5ELC A;  5AFW A;  1OXT A;  5FO8 B;  2KVM A;  1PLF A;  3NQT A;  1G29 1;  2KJX A;  4HMI A;  2ZXR A;  1PRT C;  2CHB D;  3MTS A;  2EYJ A;  1NUC A;  1D2B A;  2EYO A;  1DOM A;  4DK1 A;  5CV5 A;  5COR A;  1B3A A;  1Q90 A;  1U4P A;  4FF3 A;  1EOT A;  3BVG A;  4PMW A;  4CJ2 C;  4QF4 A;  1EQT A;  3NK9 A;  2NVT B;  1TY2 A;  4YIJ A;  4OL7 A;  4MHE A;  1LTR D;  1AEX A;  1WTO A;  5C3X A;  3QOL A;  1D6E C;  4A3B B;  3E0J A;  1UEA B;  2EYM A;  3BDL A;  1YNJ D;  3E5S A;  4XIG S;  3EVQ A;  1MI2 A;  4XYQ A;  5IOD A;  2A68 C;  4IUR A;  3PUV A;  3ERQ A;  2TMP A;  1RJT A;  1WTX A;  4F88 A;  1EZ6 A;  2YU9 B;  1UAP A;  4CHT B;  4KKS A;  2CVR A;  2F0O A;  4K5X A;  1PDQ A;  2L9H A;  3MHB A;  1WTR A;  3V2T A;  2GA4 B;  3HOV B;  3S1N B;  3S1R B;  3VYT A;  3OWE B;  3R2T A;  5BN4 A;  1SXT A;  4X3S A;  5JEA J;  4H7B A;  3Q22 A;  4HCE A;  1JOQ A;  3K6O A;  1STY A;  1ESF A;  3QWN A;  1BUV T;  4IFD J;  2A73 B;  3TME A;  1K8O A;  1QG7 A;  2JYO A;  1V1P A;  2K5D A;  5CV8 A;  3PIP 3;  1BCP C;  4BA2 I;  4RH6 A;  1GUO A;  1TR5 A;  1TS4 A;  1S5C D;  4G57 A;  4KN4 C;  3VYU A;  3P1H A;  2Z4I A;  3EA6 A;  4KJN A;  5D3D A;  3ND8 A;  1EY7 A;  3NP8 A;  4QCL A;  4BBR B;  2RA4 A;  2R92 B;  4RGT A;  1ZEQ X;  2V4D A;  3JAM L;  5IT9 L;  2F0N A;  1XXG A;  2A68 D;  4NKL A;  1S5D D;  1Q1B A;  1QJO A;  5FKA C;  3HP3 A;  2B2U A;  1LAB A;  4RGM A;  3TSS A;  1EYA A;  3M4Y A;  3KLS A;  1DOK A;  4ULL A;  1GUN A;  4NDX A;  5LL6 X;  4R9W A;  5C44 B;  1T5E A;  4N9P A;  3ZYY X;  1HPC A;  1HUM A;  3GV6 A;  1G2T A;  3BG3 A;  2SNS A;  4LMQ D;  5FOB B;  4IUV A;  1IKL A;  1IKM A;  1OXV A;  3MXN A;  1WTP A;  1Y8P B;  4A3K B;  2FMM A;  2R93 B;  5C3E B;  2BOS A;  2R61 A;  3NTI A;  4OO1 G;  1TS3 A;  2IX1 A;  1BCP D;  2IL8 A;  4TRD A;  1Q12 A;  5JOB A;  1F2Z A;  3KK7 A;  2A5H A;  3JAM E;  3TBI B;  5IT9 E;  4CBV A;  5K36 H;  4NMZ A;  3IKJ A;  3LNN A;  1HRJ A;  3FKI B;  5FO7 B;  1O7Z A;  5C5L A;  1TII D;  1Y8N B;  3KUP A;  4IUN A;  5C4X B;  4XTC S;  5C6A A;  4RAU C;  2F0U A;  2F0J A;  2MPM A;  2EPB A;  4ID6 A;  5C4Z A;  3MWY W;  3M7G A;  5ISR A;  4KKU A;  3S2D B;  2ID0 A;  4KD3 A;  4KD4 A;  5DNF A;  2KCN A;  4P2C B;  2AWO A;  1F77 A;  2ZXP A;  3J81 L;  4GZY C;  2M2L A;  2RDH A;  1JC7 A;  1ICW A;  4FXK C;  2OF1 A;  1HA6 A;  3FEW X;  1MBY A;  1RTN A;  4FF4 A;  2MP1 A;  3GTG B;  2NN6 H;  1R9T B;  1PZJ D;  4RKL A;  3A8J E;  4DNT B;  4Y7N B;  1HTL D;  1ET6 A;  3TP6 A;  1SYG A;  2A6H C;  3NUC A;  3G6J B;  4V0B A;  3X3N A;  1STB A;  2NYZ D;  5CGK A;  2PMZ B;  1F2M A;  1B1Z A;  1X3Q A;  2KEE A;  3R93 A;  2KOL A;  4G7Z C;  4MIU A;  2B2U C;  3OHX C;  1SNC A;  2VUM B;  4DA2 A;  3SXH A;  5LL6 S;  5M5X B;  1CZG A;  3A55 A;  4KHV A;  4A3D B;  4X3T A;  3T56 B;  3OOC A;  4C3I B;  1EIH A;  1S5F D;  2PW7 A;  3A7L A;  5EKI A;  4NP5 A;  1WD0 A;  3DEO A;  2EJF C;  2XSC A;  4WRD A;  3ONA B;  1YNN D;  2F0Q A;  2WV6 D;  4OGQ C;  1H9S A;  2K5W A;  2NTT A;  2EYL A;  3URY A;  2IWH A;  2F0G A;  2I46 A;  1PTO B;  5M3F B;  4J8Q A;  1STH A;  3N52 A;  3TDQ A;  1WD1 A;  2L11 A;  5E1F A;  2DY8 A;  3C1E A;  1PYW D;  4CKB A;  5KYL A;  3QJY A;  2O5J C;  3CHB D;  4FP5 D;  1EY0 A;  3OWF A;  2ENB A;  1HUN A;  4R8N A;  1I4H A;  1CA5 A;  5KGU A;  3DWA A;  1XYI A;  5FLX L;  1MSG A;  2A6H D;  3I72 A;  3OPO A;  4IFD I;  2PZU A;  4XYO A;  3T53 B;  4C3I G;  1JE4 A;  1Z6H A;  2R6G A;  4FF2 A;  3K5L A;  1GUT A;  3R8B A;  1VF5 C;  5C3W A;  4C1N I;  1QNU A;  1QE6 A;  1F2L A;  2PW5 A;  1A6X A;  1STG A;  5E4W C;  5CV4 A;  3SHL A;  2EVB A;  3RZD B;  3VA5 A;  1PZI D;  1SEB D;  1LTI D;  3A56 A;  5TSS A;  3AB9 A;  2VXW A;  3V96 A;  1W6K A;  4QB4 A;  1B2T A;  3NE5 B;  1T5X D;  2BE5 C;  4KY5 A;  3D31 A;  2BDN A;  4E6I A;  3S2H B;  1D5M C;  5HGT A;  1I3Q B;  1EFI D;  1D5Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...