1VMPA

Structure of the anti-hiv chemokine vmip-ii
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the anti-HIV chemokine vMIP-II.
pubmed rcsb
source organism Human herpesvirus 8
molecule tags Antiviral protein
molecule keywords PROTEIN (ANTI-HIV CHEMOKINE MIP VII)
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vmpA00
3DEPA 4XT3B 2R3ZA 1O80A 3DM1A 4X3SA 1ICWA 3P7JA 4QUFA 5JJZA 1WD0A 1BNZA 1VMCA 2K04A 2L12A 2RA4A 4HCSA 4X3KA 1NR2A 5AFWA 4MHEA 5T1GA 3I3CA 3TZDA 2HDMA 2EOTA 3FDTA 3QO2A 4X3UA 4CJ1B 1WTRA 4IUPA 1SSOA 1B50A 2RSOA 1EIHA 1F9SA 5T1IA 4IUTA 2B2TA 1HUNA 2FFKB 2FMMA 2JP1A 2KECA 2L4NA 4RA8A 1O7YA 1KNEA 1M8AA 1NAPA 2X6GA 2B2UC 5D65A 3GV6A 1EQTA 1G2SA 2B2VC 2B2WC 1QE6A 3IL8A 3UI2A 4UAIA 4DN4M 5D14A 4HAEA 2DY7A 1JE4A 1HA6A 4R9WA 1HFNA 2K01A 4ZKBB 1EL0A 3LWEA 5EJWA 1WTWA 3Q6SA 1WTXA 2FJ2A 1JICA 4O42A 1QG7A 2N88A 4RAUC 1U4RA 4CJ2C 1B4OA 1HRJA 2CVRA 4LMQD 1EOTA 1SAPA 1G2TA 3N52A 1MI2A 1NCVA 2X6LA 1NR4A 2B2WA 5E4XA 3KBXA 3R93A 1RJTA 2VXWA 2MPMA 2KVMA 3H91A 1CA6A 2B2YC 2N55A 4XDXA 1TVXA 5EQ0A 1F2LA 1C8CA 4IUVA 4MN3A 1DZ1A 1AP0A 2RSNA 1WTVA 2L9HA 2HCIA 2KUMA 2SDFA 5EPKA 4R8IA 1CM9A 3FPUB 1GUWA 1WTQA 4RWSC 1S4ZA 2KEDA 4U68A 1HFGA 4OIJA 3TN2A 2HCCA 3I91A 1AZPA 3MWYW 1LV9A 1U4LA 2DY8A 1BO0A 1X3QA 1DOMA 1HUMA 2H1EA 2MGSA 2HDLA 2NYZD 2K28A 2KEEA 1HHVA 2K05A 1ILQA 4CJ0B 5CBAE 1XX8A 4HEDA 5CMDA 2J7ZA 2M2LA 1AZQA 1WD1A 3ONAB 1PFBA 1EIGA 1U4MA 2K03A 4OIKA 5EPJA 4NW2A 1WVLA 1G91A 1F9PA 3IFDA 4IURA 5CORA 1VMPA 2KOLA 4HSVA 1WTPA 1PFNA 1DONA 1MGSA 5DNFA 2B2UA 1KNAA 1MSGA 3DEOA 4XT1B 1WTOA 3G7LA 1BBXC 3KUPA 5EKIA 2XIWA 3D6WA 3F2UA 3HP3A 2B2TC 1IKMA 1QNKA 1DOKA 4QUCA 3MTSA 2X69A 5CBEE 2EE1A 1ESRA 2NZ1D 4ZLTF 4ZK9B 2D9UA 1B2TA 2EPBA 2JYOA 2K1BA 1IKLA 1U4PA 1X3PA 2L1BA 3SVMA 1PFMA 1G6ZA 1A15A 1IL8A 4ZAIA 2HUGA 1RHPA 1RTNA 4IUUA 4IUQA 1RTOA 1MSHA 1F9RA 2Q8RE 5COYA 2FHTA 2B2VA 1B3AA 2BDNA 1J9OA 3GV3A 3I8ZA 4ZKCB 5EPLA 1PDQA 2L11A 1Q3LA 3I90A 5E4WC 1J8IA 1PLFA 2RVLA 1X32A 1DOLA 4X3TA 1F9QA 1XYIA 2Q8TA 2FINB 1SDFA 2B2YA 1CA5A 1BF4A 1B53A 1ILPA 1E0BA 1O7ZA 1ML0D 2MP1A 2MJ8A 1RODA 2IL8A 2NWGA 1ZXTA
chains in the Genus database with same CATH superfamily
1Q8IA 3K57A 4OXPA 3NTIA 1SYEA 5M3FH 2JA7H 3H3VH 3P7JA 4AQYL 5IP7G 3OW7A 3CKIB 4A3EH 3QR8A 4PZ7A 4DR2L 4LFCL 1KAWA 4POGA 2FMMA 2GA4B 5E3FA 2KECA 4UPAA 1K8GA 4KTAA 4YCUA 3SK6A 5K36G 1GUGA 3TQYA 1EIFA 1LT5D 2D2CC 4A3MG 3VYUA 3RD4A 3S1NH 2FJ2A 3NTKA 1UE5A 2XRSD 2QCPX 3N52A 2VB3X 4XXEA 2RDHA 4UP7A 1I4RA 3J80i 3V05A 2LXKA 1AP0A 2MFIA 2E5LQ 1BXTA 3C2PA 4OWWB 3K0XA 4KN4C 1DOMA 2RDFA 5CBAE 5ELBA 4JBMA 3TDQA 1AZQA 1PFBA 1PTOD 4P75A 3F2CA 3CF5A 4H44C 5J3BA 3ULJA 1L1OC 3KDFA 4MZ9A 2JN4A 2NTTA 4C2MH 1VQOA 1YHAA 1ESRA 3RZOH 2D9UA 1PH5A 4Y52H 1X3PA 1AE2A 1PZID 4IUQA 3M7NA 3FMCA 2JA8H 4LF4Q 2Q8RE 1KL9A 1IXRA 4DUZL 1A3VA 1WI5A 4H02A 5C4XG 2E76C 1W2BA 4UY8C 4OO1H 3GTMH 1PDQA 3DHQA 4HTHA 2KHSA 4TVAB 4WJ4A 5IOCA 2V1CC 3NBHA 2WINB 4DUYQ 2KCNA 3I2ZA 2M00A 1B53A 1O7ZA 2OWOA 3CCLA 3GP7A 4LUOA 5BR8Q 1ICWA 1VMCA 5CV9A 4DUZQ 1CK1A 1I50H 1GKHA 2EYFA 2DJFC 5J22A 3OTOL 4IUTA 3CCSA 2E8GA 1EQVA 1AW7A 1LM0A 4PZ6A 4RCNA 1DM0B 1E2VA 4CBVA 3CMEA 4DK6C 4ME3A 1QUQA 1GJXA 4OO1G 1AEXA 3Q24A 3AFPA 2G9HD 1OTCA 3OSOA 1C7YA 1QCBD 4B9XA 1ASZA 4XTCS 1TS5A 1TWGB 1MKHA 4DAYA 2N88A 4A3MB 1HRJA 2LSSA 1JORA 2QW7A 2V4DA 2X6LA 1LTSD 4QF4A 2BE5D 4GLAC 1STNA 3D4DA 3G48A 4BA1I 1K73C 3K5MA 1QVCA 3T1YL 1V8QA 1GUNA 3GQBA 1XJVA 1WCMH 2PNHA 3H3VC 3JAMi 5IGDA 1IW7C 3AEVA 3FP9A 4GLXA 1GVPA 1KXLA 1GUWA 1E2ZA 1X65A 4BS9A 3W1GA 5IY0A 4U68A 3BDLA 1Z47A 3K7AH 2O5JC 5C5MA 1LTID 3AB9A 1W6KA 4G57A 3AFQA 4GS3A 4QGUA 1S5CD 4GN5A 5IGCA 4FF3A 5CV5A 3MXUA 1ZYRD 5FK9C 3MXNA 4HSVA 2Q2TA 2Q2IA 2F4IA 2UUAL 4XT1B 2WAQE 2A68D 3NEMA 1IKMA 3F2UA 4R1JA 3SGIA 1XNQL 3T16A 2PMZE 4R4IA 3NTHA 2ZJRA 1SEBD 3A7AB 4Z9CB 2HIXA 1C4QA 1Y1VB 1X54A 2F03A 1PH7A 4A3GH 1BCPF 2XSCA 1R4PB 3RN2A 2R7FA 3I8ZA 3CCMA 1I94L 2VUMG 4N9PA 1PRTF 1D1IA 3KLSA 3NQTA 1CA5A 5HGQA 2Q8TA 1Y8PB 1D5MC 4LF9L 1N32Q 4GKJL 1PTOH 1STHA 1T5XD 5C0XH 4JI7Q 2MP1A 4JV5Q 2Z4HA 3HOYB 1BKBA 4EQOA 5JJZA 2P5ZX 5LL6S 3FHWA 1QNUA 3DMUA 4MTKA 1VQ4A 4AYBB 1IHZA 4LNQA 5KEEA 2L4NA 5EGTA 3VR4A 3T53B 3BG3A 2ZJPA 3P1HA 4IN3A 4LK1C 1RKNA 1FL0A 3NBHB 3D4WA 2MO0A 2JA5H 3LWUA 4AIMA 4A3DB 5JVG3 3EIVA 2Y0SG 2PPBC 2VS1A 3BJUA 5I4DA 3M7GA 3MHBA 5I9OA 4KLKA 5EJWA 3F2BA 2HHHQ 5JJKA 4K6LA 2XVSA 1A3UA 1CFMA 1CHQD 3ER0A 4Q0FA 3OTOQ 4BY1G 4A93G 1VQ9A 5C3EH 2N3SA 3E9IA 2CQAA 1TVXA 3SXHA 4LF9Q 5C3XA 4K5VA 2JA8G 1CKNA 3FKIB 2E2IB 3I70A 4QIWB 4HN7A 3J81L 2KENA 3V96A 3L0OA 4EQ5A 4K0KQ 2O5IC 2NUCA 1E22A 4OHJA 1SR3A 3I55A 3H3VI 2A69C 4BBRG 2K5DA 2KEEA 1GO3E 5JEAJ 2NVQB 4ME5A 1ILQA 1K28A 4B3SQ 3SEBA 1TT2A 3J81i 4LF4L 1H9RA 3HOWG 3S2HH 1Y8OB 3L2PA 1KRSA 1L1OA 3GTLB 1IBLQ 2F0WA 2EYOA 1BNZA 2DUDA 5FOBB 1TY0A 4XYOA 5G3LD 1HNZQ 5M5YB 2OCEA 2J4XA 2NVXB 5JPMC 2MHVA 3PUWA 3KK7A 5AJ3L 1G6ZA 2R6GA 3AQQA 1H9SA 3RNUA 1SYGA 4IFDJ 2OQKA 1TWHH 1F9RA 2HQEA 3NP8A 1HH2P 3Q23A 2PZTA 2BOSA 2ZXPA 4HMJA 1FGBD 4ZKCB 1G8ZD 4BBSH 2R93H 4Q5VA 1KIXA 1F9QA 2VQEQ 3HOVG 3I4NB 1U5KA 2CH4W 3S1MB 4GNXA 2I5LX 2VQEL 2GVAA 1SE4A 2R3ZA 1E3PA 2PQAB 3T51B 1PH2A 3TP6A 1EYCA 1M90C 4JOIC 3OWEB 4L5QA 5M5WH 3H0GB 2ENBA 1DD2A 3CRLC 3RMHA 4IUPA 1B50A 2D5DA 4RGMA 5AJ3Q 2FFKB 2Y0SB 1LTGD 4LAAA 3M4OB 1BBWA 4TRDA 1NAPA 3UDFA 2ICIA 3VYTA 4RKLA 4BY1B 1Y1VH 4LWCA 1DGSA 4BBSB 1IBKQ 1HNZL 4C3JG 4BXXH 1JT8A 2PW7A 5IE8A 4Y7NH 4N9TA 4JI1Q 2DY7A 1IBLL 2OTLA 2JA7G 4RHSA 3ITPA 3Q6SA 2RKSA 4DR4Q 4U673 4JYAL 2F0HA 4ZUIA 1CZGA 1NCVA 1STYA 3K81C 1SNPA 3RLNA 4YCWA 4LUZA 3KYHC 3KF8B 3BYTB 5IT9c 5IT9E 1PTOF 3Q8DA 2I0QA 4DUYL 2QKIC 1TXYA 2HCIA 1NNXA 2F0OA 2K33A 3CW2C 3BS1A 3P20A 1VQGA 5LMUQ 1AZPA 3NENA 1QUQB 3GTPB 1HUMA 2NYZD 2EJGC 2DN8A 2YU9B 2SEBD 3J81E 1CSPA 1Q86C 4X64Q 3I72A 2R92B 4FXGC 3A56A 3L3OC 2VUMB 1SFOH 3PUZA 3VR5A 5CORA 5CC4A 3VR3A 1IW7D 2F0QA 3VA5A 4FYDA 1N36Q 5LMNQ 4YHHL 1Q7YC 2NZHA 2RDGA 4QUCA 3S2DH 3J7YW 4PQXA 4DA2A 4KKSA 3MEFA 2PI2A 2L1BA 5ELDA 1L0WA 1A15A 1RTOA 2AKWB 3CCVA 4V0BA 1B3AA 2WP8J 1VQHA 1QZHA 3J7AF 3J7ZC 4FF4A 3GTKB 4CDEC 2G9DA 1RL2A 2VQFL 4DKAC 1MD2D 1KTKA 3HOWB 3OIQA 2C9OA 3U9SA 2NN6G 4X3SA 3S9WA 3U4VA 2B63B 4C3JH 1MIUA 2K75A 3AYHB 4MHEA 2VL6A 2K5VA 4BBRB 2B29A 3FDTA 3QO2A 4X3UA 3TP7A 3UDIA 3M3YH 1X3EA 4KK7A 5DM63 1CSQA 3BZCA 1CI3M 4C3IH 1EU4A 1T5EA 4K2LA 4A3FG 4F87A 2ZXRA 4QY7A 1EL0A 3BZDB 2K14A 3M9BA 1JOKA 1F2ZA 1EEID 1LT3D 1Y14B 4JI0L 4AQYQ 4A3JB 1LT4D 5I6YA 1NMGA 3KF6A 1HZCA 5M3FB 1FYCA 3S14H 4P71A 2R93G 2KVMA 3NELA 1NUCA 2Q2HA 4XQQA 1F2LA 1CQVA 2WB1E 3PO2H 3BVMA 1E24A 1LACA 1CT1D 3QIAA 1NMFA 1EUJA 1S4ZA 2K7VA 5E7NA 5LL6X 2MGSA 1ESFA 2AQ2B 4PG3A 2DNEA 4TSSA 5M5YH 2WFWA 3FEWX 1KRTA 3ZYYX 5I9PA 1HTLD 5EBDA 2NBFA 4JW0A 3S14B 2K5HA 1PTOC 1B7YB 4JI3Q 4NW2A 3TS0A 4YY3Q 5I2XA 1LLRD 1C48A 4DAMA 2I5HA 1PFNA 4YHHQ 3GTOH 1HTPA 1L0YB 4ILWA 1II3A 1D2BA 4ULLA 3MFGA 1PA6A 3ZJYC 3UDGA 5CV6A 4FF1A 1B2TA 1VQBA 3PIP3 3T13A 1VQKA 1IL8A 1UEBA 3CPFA 1PH3A 1J6QA 2LKVA 1PYWD 3E3XA 4L6TB 1CQFA 4AYBE 2F0FA 5BR8L 2L11A 5BN3A 2ZM6Q 1IYVA 3ICEA 4I7AA 4BY1H 1VQ5A 4IPDA 3EA6A 1V1PA 1JC7A 3BDCA 4OONA 4LF5L 1SLJA 4KD3A 3HOZG 3MXNB 2RSOA 4YWKA 1LTRD 4GZYC 4YWMA 4JG2A 3MC0B 2D62A 3RN5A 5DM73 4OEMB 3VYRA 3L7ZC 3M4YA 1F9SA 1WJJA 4DU9A 5IWAL 2F0GA 2JP1A 3HOUH 4HJ5A 1X55A 3GV6A 2A6ED 4DV2L 2WACA 1A0IA 2KCCA 1GXDC 3CC7A 4A3KB 1B9NA 1A62A 2AWOA 1EWHA 5C0XG 3J7A5 1V1PB 1CZWA 1JB3A 5E4XA 5C0XJ 2O2LD 2CW0C 1I4XA 2HT1A 2BA0A 1K83B 2MNAA 4LF7L 4IUVA 4MN3A 5K5PA 1PRTC 3J80L 2FMCA 3A0JA 2A6EC 2L9HA 4JC0A 3GTPH 2Z9HA 4JI8L 4RWSC 5C3EG 3MWYW 3CP0A 3GTQH 3EVQA 1QWYA 1CTMA 4DR5L 4EVOA 3IKJA 3NSWA 5ELFA 1EIGA 3KOJA 3PMFA 1STGA 1VQCA 4KV6A 2G5DA 2JA8B 4JI5L 4DV5Q 2HQLA 2PZUA 4F8MA 3PF4A 1JR0D 2Z6KA 3K58A 1JQYD 2VNUD 3HOZB 2E2DC 3K7UC 5C4JB 1IKLA 3GTKH 3DWPA 4DR2Q 2HUGA 1RHPA 2EQSA 4RFBA 4K0KL 2EY6A 1J9OA 4KKUA 1I3QH 1JB7A 3S1RB 4A3DG 1XYIA 2I5MX 4X3TA 2F0IA 2AUKA 5M3MB 3DM3A 1RIPA 2WB1G 3M3YB 1SNCA 2NVQH 3DUZA 4G7HC 3IFDA 3S16B 4P73A 2F0SA 1TQOA 3FRPB 4NXNL 4HCSA 1OXVA 1VF7A 2E75C 2R7DA 1HZBA 4GKKQ 2NVXH 3S17H 1SSOA 4L5RC 3S1NB 3DLLA 2B2TA 1KQSA 1E1OA 4PMCA 4R4TA 1SXTA 2BH2A 2A8VA 1UEAB 3CQZB 1KC8C 3IL8A 4ABNA 2PO4A 4UAIA 4DN4M 2EXDA 2F0LA 2PYKA 2A6HD 2CQOA 1VQEA 2EYJA 4KMUC 1UNSA 4NXML 4J8QA 4R9WA 3LWEA 4JI4Q 4O42A 1QG7A 4O1NA 3HOVB 1AN8A 1MI2A 3K6OA 3QB3A 3HKZG 4DAVA 1SMYC 1MHWC 3PQIA 2IW3A 2WKDA 4JI2L 4DV3Q 4A3FB 3ND8A 1K8OA 1IYJB 1PXUA 2JXMB 5IYBH 4A3BB 1L1OB 5TSSA 2PW5A 1LTAD 4JOIA 1WCMG 1YNXA 1ENCA 4WFN3 5EPKA 1I94Q 1GD7A 1SNMA 3M4OH 4NMZA 1WTQA 2KEDA 4Y7NB 3HKZB 1JJGA 1UE7A 1U4LA 3HOVH 4H0LC 1FR3A 5IYCG 1ENFA 1IL2A 3QOLA 4X66L 2IHEA 4GNXC 2M2LA 1ASYA 2MUYA 4DAPA 2WKCA 2QDLA 1V1OA 5CV8A 2KOLA 1TWFB 4DFAA 4L63B 1MSGA 2HIVA 4M1UB 3TSSA 3SE0A 1ONLA 1BBXC 1DONA 1NBWA 5A2QL 4DR7Q 1E1TA 2CWAA 5BN5A 1XMOQ 2X69A 3HOUG 3EJIA 4NXMQ 1EYGA 3QG1A 2KHIA 1ZKOA 1U0LA 1KLUD 3DWQA 1RTNA 2TMPA 3HOWH 1BBUA 5COYA 4C1NI 1Y1WB 1PTOB 5IGEA 2F0TA 1JJ2A 1H9JA 3A54A 3BZKA 4RH6A 4A76A 3MZ5A 1ET6A 2B2YA 2R92H 1BF4A 1XMQQ 4KY7A 4A3IG 4FDBA 3DEPA 1I50B 4DNTB 3NWSA 3E0JA 1X6OA 2ALYB 4O2DA 1AE3A 2QEJC 2QGQA 4V190 3HOYG 4A3IH 2L15A 2AMCB 4X62Q 1KNEA 1B44D 4DV7L 1HR0W 2Y0SE 3VR6A 2NZOA 4N8X1 1B3QA 2JE6I 1VQDA 2F0KA 1CKMA 1Q90A 1SE8A 4NP5A 1IBML 3G6JB 4OWTB 1FJGQ 1I4HA 2YTYA 2IHFA 5C6AA 2R61A 1YJ9A 5C3EB 3K0YA 4OWXB 1GUOA 1CA6A 2AUJD 2N55A 3WWVA 1Q12A 4DR5Q 2AQ1B 1C8CA 5JPNC 4HIOA 4C3IB 4R4QA 1GUTA 2JQOA 1ET9A 2QEXA 3EFXD 1LV9A 5GADC 3H0GG 2K28A 1QJOA 2B3GA 2AWNA 4LFAQ 4L8JA 2A19A 3U9OA 2YV5A 3BU2A 3HGBA 4OX9L 4DV6L 3T1HQ 1OO9B 1F9PA 1YEZA 4DPGA 4K2KA 1UWVA 4A3FH 1QZGA 5EBCA 2F0PA 4A3MH 1G51A 1TWGH 2XIWA 3HP3A 2E74C 3MTSA 5CBEE 4QJFA 4A3JH 2NZ1D 3C1FA 4N8FA 5GROA 2R7ZG 1TS3A 1MBYA 3SVMA 4KY5A 1RD9D 3HEJA 3VA7A 5IGGA 1D1KA 2UXBL 2CHBD 4GN4B 1FD7D 2N78A 1TWFH 4GN3B 2E5LL 2RVLA 2CFMA 4UP8A 1DOLA 3OMCA 2JEBI 1QVGA 1EY8A 2JEAI 1ENAA 4A3EB 4QCLA 2NVTB 3PIOA 1EY9A 1S5FD 2F52A 3H6MA 2K04A 3R2IA 1YVCA 2RF4A 3K59A 1N8RC 2IJ0A 3SK5A 5JEAG 3SDZA 1HUNA 1HNXQ 3H09A 4GOPA 3EN2A 4A3DH 2UXDL 3D0FA 3M4PA 5J39A 5LHY1 5CR3A 1XTCD 5NUCA 3I4MG 1JE4A 3G4SA 3I56A 2ES2A 4LFCQ 4C56C 1XNRL 2RBMA 2IT1A 2NVYH 3G71A 2N49A 1UE6A 1I6HH 1JWMD 3R8BA 2OEOA 1AH9A 3KLRA 3BYYB 4G7ZC 1WYDA 3D8GA 3D6CA 2EXZA 4YY3L 4A93B 1NY4A 3I4LA 3OYYA 3H91A 2UXCL 3FPPA 1JCKB 4HR7B 1L0XB 4KHVA 2PCFB 1EQRA 5I6WA 1DZ1A 1HR0L 5LMNW 2KUMA 2SDFA 5IIFA 2F4VQ 4GOPB 3UE0A 1HFGA 2PQEA 5C44G 2YU9H 2F4VL 1JOQA 2DY8A 2HD3A 4IJLA 1QILA 2NVYB 3K7AB 1XX8A 3KLSX 4APVA 1YIJA 5JJIA 3K80C 4LF8L 4OGQC 5C4XH 3OOCA 2JA5B 4JI6Q 1H9MA 3CPWA 1H95A 3S2DB 5FLXE 1SMYD 3CCUA 3NXWA 2Q2UA 1PRTD 1KDBA 4HJ8A 3JAMc 3PGZA 4FVMA 4FXKC 3D6WA 4DXGA 1XMOL 3X3MA 1Q81C 1EWCA 3NBIA 2EE1A 4LF6Q 5EAYA 2KCTA 1TWHB 1JE5A 1PFMA 4ZUJA 2B63G 3H15A 5KNDA 1PH6A 4ZRZA 4FXDA 1G291 3GTMB 2BA1A 1LYLA 5EPLA 4X66Q 5CV7A 4KHPQ 2ICEC 4C3JB 4A3CG 3MXPA 1DCZA 1Q82C 4RKBA 4DR1Q 5C44B 1PHJA 1JWSD 2NWGA 3C1EA 3HOXG 2MQHA 4B3TL 5C4HA 4I65A 1PVOA 1TWCB 2D0OA 2VQFQ 1FNUA 2K52A 4JI2Q 3TEHB 3J81j 4CDDC 4XQNA 2SNMA 3I3CA 1I4PA 4DR3Q 1GM5A 2PMZB 4X65Q 3S2HB 1EIHA 1E7ZA 1SNDA 2UXBQ 2I46A 2KA7A 4HIKA 5M9OA 1EQTA 1YJNA 2UU9Q 1N33L 1S5DD 5C4JH 4LFBL 4WORA 1D7QA 1EFID 4CGYB 1A3TA 1SYFA 1D5XC 1KAAA 2B8GA 2K4KA 4JI6L 3VR2A 2NVTH 3S24A 1PH4A 1BCPC 1F77A 1N36L 1VQPA 3W3AA 3ND9A 1P8LA 2F0EA 2F0VA 3K5LA 4JBWA 1HPCA 1TR5A 3SK4A 4FO2A 3T1HL 4DV6Q 1WCMB 2K50A 2ZTCA 4OX9Q 1D6EC 4DV4Q 4X64L 3ERQA 2J0TD 1HNWL 3CQZH 1HR0Q 3JAME 4R8IA 1DYQA 5LMUL 3I4MB 3NQIA 4P72A 2HCCA 2CWPA 2H5XA 3S17B 3K8AA 1DJRD 4RCOA 2EY1A 1BCPD 2A73B 2OF1A 3MEHA 4BY7H 2XWJB 4F7XA 2JA7B 4PV1C 3PO2G 3U58A 1K9MC 5I2YA 1X3FA 2EYMA 3GTGH 4JPBW 1FJGL 4POFA 1QNKA 2IX3A 4TQUS 4ZLTF 2EJFC 3PCOB 4JI1L 5FLXL 4WRDA 2IX0A 1HNXL 2PZWA 4G4KA 4ZAIA 4IO9A 3DXJC 2B39A 4A4IA 4TKOB 1STAA 4XQJA 2YYZA 1EQQA 3K5OA 3QWNA 3GV3A 1EYDA 5GQOA 4A3GB 1PV4A 1AFPA 5IYDH 2JA6B 3D4RA 2D0PA 1VQAA 4QL5A 2O4XA 4OELB 2NB0A 5L37A 4JI8Q 4C3HH 5JEAH 4KN7C 1SNOA 2VZAA 1PZKD 2ZTEA 1ZXTA 2VUMH 3CHBD 5E1FA 3STBD 3WOFA 1XMQL 2EVBA 1DXMA 5HGTA 2NN6H 1SBBB 2KBNA 1PH8A 1UE1A 4CJ1B 4B3RL 1S40A 5T1IA 1Y69U 1WFQA 1TKWB 1M8AA 1LTLA 2B2WC 3CRKC 5ELNA 2F1MA 1UUPA 4DV0L 3RZOB 1KHIA 3PIPA 5D14A 4J15A 3W2DA 2K5NA 3LX0A 1VQ6A 4B3RQ 4ZKBB 1FGUA 4DAYB 4UDUC 4C2MB 4NB3A 1CKNB 1R9TB 1N33Q 4DR7L 1EY4A 4E6IA 1Y1VG 4QB4A 2EYLA 1VS0A 3NHHA 2A74C 4HIMA 1NR4A 2XNAC 3IRBA 3V2TA 4DR3L 1NJIC 4DR6L 1BDOA 2F3WA 1PYSB 3F1ZA 1A63A 2RCFA 1R4QB 4IOCA 2B63H 3NUCA 1VQMA 1ZEQX 3I91A 1SROA 2E2JH 3MFYA 3H0GH 4ALPA 2HDLA 4IQZA 3C46A 3DWAA 2QILA 1IZ6A 2EZVA 3S1QB 1JWUD 2EY2A 3GTOB 2WAQB 3GTLH 3IAYA 5M5XH 4IURA 4YCVA 2LY7A 1IBMQ 2WIIB 2A5HA 1A8VA 3DEOA 1FVIA 1LO5D 3KUPA 4KHZA 3A5ZB 1DOKA 3KLWA 2UUBQ 2Z8LA 2HHHL 2L5TA 4FP5D 3URYA 1PH9A 4IFDI 1HQMC 3A55A 5FLMG 1XXGA 2K1BA 1BOSA 3CU7A 1U4PA 5J1ZA 3C3LA 1EY6A 1G6PA 1K8AC 3ERSX 4JI3L 3U50C 4K6DA 1N34L 3PO2B 2B2VA 4BXXG 2WAQG 4K8IA 3I90A 1O7IA 2Z1CA 2CKZB 4UHVA 4GKKL 1SDFA 3MXGA 3HG9A 4DV4L 4NXNQ 1SJHD 3HOYH 1SYCA 2K6AA 4B3MQ 1HZ9A 2IL8A 4OL7A 1PYBA 5G3LF 3U4ZA 3WOEA 1X56A 1NR2A 1FNVA 1CKOA 1Z6HA 4DV1Q 1N34Q 1H9KA 3A7LA 1ZYRC 3TZDA 2EOTA 1WTRA 3CC4A 3PF5A 2F0JA 4OO1I 2NTSA 1LUZA 2LFNA 2R92G 2X6GA 4KJNA 1EY0A 4LFBQ 3OWFA 3ULPA 2WV6D 1PMRA 2UU9L 1KD1C 3OW2A 2B8FA 4RMFA 1HA6A 1YNND 5KNBA 2UXDQ 5JAVA 1XNQQ 5GAGC 3O13A 4DK0A 4C3HB 4A3BH 1EEFD 4LMQD 2F0NA 1LT6D 3MVVA 3TBIB 4PMWA 3ULLA 5FJ8G 1STEA 2H4OA 4LW1A 1XPUA 3PUYA 2VXWA 3TP5A 2MPMA 1EY7A 4GOPC 3TZUA 4EQPA 3I4NG 4EQNA 4DF7A 1Q46A 1EIYB 1HCZA 1VF5C 2F3IA 2RCNA 4NDXA 5ELEA 3HOXB 2R7ZH 3CMAA 2CCZA 2ASBA 4A3JG 4R4OA 1HHVA 4BBRH 1X3GA 4KJOA 2RHSB 1UAPA 2DGYA 2F3VA 3LNNA 4CJ0B 1EU3A 2AHOB 1B8AA 3I7FA 3W5OA 3PO3H 3BVZA 2LXJA 3G6EA 3TRZA 4A3GG 1U4MA 2FXQA 1FNWA 1WVLA 2VY3A 3CCQA 5IYBG 1SFOB 1VQJA 1RDPD 1SN8A 4XIGS 3PO3G 5IGFA 5K36H 4A93H 2B2TC 3OPOA 3BVGA 1TWAB 5IP9H 1L2FA 5F2DA 1E2WA 2EPBA 1EOVA 2ZXOA 3KF8A 5M3MH 3IFTA 4RGOS 3A8JE 4RHRA 4GLVB 3RZDH 3A5UA 4IUUA 3PUXA 1I3QB 2F0DA 2FHTA 1M4VA 2DJGC 3PUVA 5M3FG 2JA5G 5IWAQ 4L5SA 1P16A 1T9HA 3GTJH 1PLFA 2EIFA 5D3IB 1H9SB 3NWTA 4DNIA 2XRQD 3W1BA 2OQ0A 1SMXA 1I4QA 2UXCQ 1B9MA 1E0BA 3T4AC 4ZCKA 1BVSA 1TWAH 1O80A 1NE3A 4PZ8A 5JOBA 3NK9A 1Y8NB 4QUFA 4LF5Q 2C5CA 4JBJA 2L12A 2RA4A 4X3KA 1YBYA 5FLXc 4FNFA 2A69D 2HDMA 1J5EL 3HZXA 3QOJA 2ZM6L 4K8JA 1JMCA 5EKKA 3VYSA 4LJZC 2B2UC 4JYAQ 5IP9G 3A8KE 3GTJB 1QE6A 4DV5L 1Q1BA 4IFDG 5C0XI 2LMCB 5A2QE 2K32A 2ZTDA 3BDOA 4JBKA 4F88A 1J5EQ 1IBKL 2K5WA 2Z6KC 5DLQE 1JICA 5KNCA 4R8NA 4X62L 1W6JA 4KKTA 1G2TA 3E0EA 1S5ED 1I4GA 3KFUA 1W3SA 3SK8A 1KABA 1BR9A 3S1QH 2B2YC 4XDXA 4HJAA 3AU7A 4O0AA 2RQXA 2RSNA 2E2JB 2YTVA 2IWHA 2OT2A 5C3WA 1IYUA 3PSIA 1VDZA 3CCJA 2LS01 4LF7Q 5EKLA 1N9WA 5FLMH 2H1EA 3F2DA 3VDYA 2VB2X 5CMDA 3N6RA 4A3BG 1C9OA 4DXFA 3OMGA 1VQFA 4PMBA 5EPJA 3RLFA 5HY6A 3HRZC 1VMPA 2PI2E 2QA4A 2EYPA 5HURA 3L9AX 4ID6A 1EWIA 1I5FA 3GO5A 1HA5A 4EGVA 5IODA 5IYCH 2BCOA 4ZK9B 4WJ3M 1K8MA 2C35B 3GD7A 2Z4IA 3RLOA 1GUSA 3KDFB 4ZYSA 4B3SL 4B3TQ 2CW0D 3P75A 4XYQA 1Q3LA 4UP9A 1X32A 4QIWE 2KHJA 4IZ8A 4ODGA 1SNQA 1OXUA 4BY7B 1ILPA 3HKSA 2EDGA 2K5QA 3M85A 1QOHA 3TS2A 4KHPL 4B9WA 1MJCA 4K5XA 1Y1WG 1K0SA 1HJPA 5FO8B 5FKAC 3GDEA 3J81c 1VCIA 5KIXA 3EQLC 5AFWA 3UE1A 1OXTA 4G7OC 1V1QA 1K3RA 3JC66 1O7YA 4CKEA 1TS2A 2GVBA 4LF6L 1G2SA 1QB5D 2B2VC 2ZJQA 1PZJD 4MIUA 1RF2D 3R2TA 4DV7Q 5CV4A 4JCVE 1OXXK 1EZ8A 1BQQT 5KRUA 2SNSA 4HAEA 2K01A 4IFDH 4DNRB 1RCVD 1PH1A 4A3KH 3M4QA 4DV1L 4CJ2C 3STBC 4LF8Q 3Q22A 1X9NA 1GOZA 1SAPA 4C1NK 1SJED 4IUNA 5KYIA 3S1RH 2BE5C 4A3EG 4B3ML 5IYDG 4WJWA 1S5BD 1V43A 1PFSA 4CKCA 4MNOA 5IP7H 1NTGA 4YIJA 3SHLA 3CXCA 4A75A 4KY6A 4JI7L 4JV5L 2M9VA 1YJWA 5DAUA 2ZT9C 3FPUB 2L0CA 4OIJA 4FF2A 2ID0A 3KJPA 4KD4A 2K05A 3A74A 1B70B 2E2HH 1S72A 4P2CB 1WD1A 1TS4A 3CAMA 3ONAB 3MAQA 2UUBL 5C4ZA 1EY5A 3QJYA 1XNRQ 3KBGA 1MGSA 4CHTB 4HSPA 5KGUA 5M3MG 3TP8A 5CYUA 4J1MA 3G7LA 2UUCL 2A68C 4HMIA 3TREA 2JA6G 2A6HC 3HS0C 4JI5Q 3AMUA 2JK8A 3J7AV 2UUAQ 2JA9A 2JYOA 1K3BC 4L5TA 3CC2A 1EYAA 4JVZA 3D31A 1O7LA 2SOBA 1I6VC 1S3OA 4K5WA 1CHPD 3HFZB 4NKLA 5E4WC 5M5XB 4C3IG 1KDCA 4C3HG 3KF6B 3NE5B 1SYDA 1TWCH 2MJ8A 4B08A 4DR6Q 4HJ9A 1TY2A 3E6ZX 4XT3B 3DM1A 3I73A 4ZQ3A 5IT9L 3Q0AA 3I4NH 1XPOA 2PQAA 3JAML 1HQRD 3GTQB 2L55A 5FJ8H 4AYBG 1STBA 4RA8A 4DV0Q 4GNXB 5D65A 1A2UA 2EJMA 4H13C 4A3IB 2F0MA 2JA6H 4RGTA 3NPPA 3CD6A 4I7ZC 5M5WB 5LMNL 1F2MA 4HIDA 5ELOA 4DGZA 4DV2Q 4PNYA 4BA2I 1WTWA 3S15H 1WTXA 3E9HA 4RAUC 1KLGD 2CVRA 1EOTA 3HOZH 3CCRA 3PIO3 4LFAL 5ELCA 5A35A 2EY5A 3R93A 4IPHA 3SR1A 1RJTA 2BH8A 3KJOA 3B6YA 1BCPB 4X6AH 2XWBB 1WTVA 1KDAA 1SYBA 1LTBD 2PNRC 1O78A 1CM9A 2Z6BA 4RGNA 3J80E 2BDOA 3J80c 3TN2A 5IGBA 2KJXA 1R9TH 4IOAA 3S15B 4CKBA 4HEDA 2J7ZA 1VQNA 4A3LG 1VQ7A 1WTHA 3HOUB 4A3KG 2GN5A 2QDBA 1YZ6A 2K03A 4OIKA 4AH6A 4DR4L 5BN4A 5H1SE 2YTXA 2IX1A 3GTGB 4CDFC 5DNFA 3S1MH 4R4CA 5EKIA 4K14A 4NPSA 3T56B 5GAEC 1YHQA 3RUZA 1NSNS 4HJ7A 1ICFB 1YI2A 1VQIA 2JJQA 1YITA 1MSHA 3H94A 2R7ZB 2I07B 1YNJD 3HOXH 4A3LH 1Y1WH 1K0RA 1EZ6A 2F0UA 3FKIG 1HNWQ 1M1KC 2VW9A 2FINB 5FO9B 3PO3B 3TMEA 2XTIA 3R3OA 4M8AA 1OXSC 3EBEA 4A3CH 4QMGA 3A8IE 4H7BA 1A6XA 5C4XB 2DNCA 1BUVT 4RG1A 2XGTA 1WD0A 1N32L 3I4MH 2TSSA 5JVH3 5DEHA 4S3SA 5T1GA 2KQ3A 1SE2A 2ATWA 1YNJC 4JI0Q 1WOCA 2WB1B 3RZDB 3FKIH 4BBSG 3UI2A 3D3RA 1C0AA 1JJCB 1LABA 2EYHA 5ISRA 1GHJA 1YNNC 1HFNA 2N8NA 1U9RA 2QF7A 4X65L 1Z9FA 1EFWA 1B1ZA 2Z0SA 5CGKA 4P74A 1SRUA 1U4RA 2UUCQ 1TIID 1B4OA 3OIPA 3X3NA 5C5LA 1I6HB 2RHQB 4QQBX 2B2WA 3KBXA 2A1AA 3K5NA 1A2TA 1TU2B 5C44H 4DR1L 1SE3A 3RR5A 1YHBA 5EQ0A 2E2HB 4KI0A 2MO1A 3HKZE 2OXPA 3E5SA 4IPCA 1XTDA 4CDCC 5GAHC 2IY5B 4LUVA 1PRTB 4MTNA 4IJHA 5D3DA 1HZAA 5FO7B 3FVQA 4DV3L 1BO0A 1X3QA 1LTTD 4DK1A 2NN6I 2OTJA 1D5ZC 1VQLA 4JK1C 3T1YQ 1F2YA 4HCEA 1Z7TA 3S16H 2E2IH 2R93B 1G91A 4JI4L 3LGJA 1WTPA 4YWLA 2B2UA 1KNAA 1WTOA 2AQ3B 1GHKA 4IPGA 2JSOA 3F8TA 1V9PA 1JOOA 1HXYD 3OHXC 1XWEA 4DK3C 5KYLA 3I4OA 4EX5A 1Q8KA 2Q8IB 1QVFA 1MJEA 3UDXA 2KCMA 2XN9C 2BDNA 5JJLA 1K83H 3CCEA 4J6HA 1VQ8A 3PV0A 1XPRA 3WDNA 1D8LA 1J8IA 4BY7G 4IALA 3EROA 2IPKD 1CUKA 1Q1EA 4GKJQ 4BWGB 2CH4A 1ML0D 1RODA 3MA2B
chains in the Genus database with same CATH topology
1Q8IA 3K57A 3NTIA 1SYEA 3P7JA 3OW7A 3CKIB 2FMMA 2GA4B 5E3FA 2KECA 4KTAA 3SK6A 5K36G 1GUGA 1LT5D 2D2CC 3VYUA 3RD4A 2FJ2A 3NTKA 2XRSD 2QCPX 3N52A 2VB3X 4XXEA 2RDHA 1I4RA 3V05A 1AP0A 1BXTA 3C2PA 4KN4C 1DOMA 2RDFA 5CBAE 5ELBA 3TDQA 1AZQA 1PFBA 1PTOD 4H44C 2NTTA 1ESRA 2D9UA 1X3PA 1PZID 4IUQA 3M7NA 3FMCA 2Q8RE 1A3VA 2E76C 4OO1H 1PDQA 3DHQA 4HTHA 2KHSA 5IOCA 3NBHA 2WINB 2KCNA 2M00A 1B53A 1O7ZA 3GP7A 1ICWA 1VMCA 5CV9A 1CK1A 2EYFA 5J22A 4IUTA 1EQVA 1AW7A 4RCNA 1DM0B 1E2VA 4CBVA 1GJXA 4OO1G 1AEXA 3Q24A 2G9HD 3OSOA 1QCBD 4B9XA 4XTCS 1TS5A 1TWGB 4DAYA 2N88A 4A3MB 1HRJA 1JORA 2V4DA 2X6LA 1LTSD 4QF4A 2BE5D 1STNA 3D4DA 4BA1I 3K5MA 1V8QA 1GUNA 3GQBA 3H3VC 5IGDA 1IW7C 1GUWA 1E2ZA 4BS9A 4U68A 3BDLA 1Z47A 2O5JC 5C5MA 1LTID 3AB9A 1W6KA 4G57A 1S5CD 5IGCA 4FF3A 5CV5A 3MXUA 1ZYRD 5FK9C 3MXNA 4HSVA 2F4IA 4XT1B 2A68D 1IKMA 3F2UA 3T16A 3NTHA 1SEBD 3A7AB 4Z9CB 1C4QA 1Y1VB 2F03A 1BCPF 2XSCA 1R4PB 3I8ZA 4N9PA 1PRTF 1D1IA 3KLSA 3NQTA 1CA5A 2Q8TA 1Y8PB 1D5MC 1PTOH 1STHA 5C0XH 1T5XD 2MP1A 2Z4HA 3HOYB 4EQOA 5JJZA 5LL6S 1QNUA 3DMUA 4AYBB 1IHZA 5KEEA 2L4NA 5EGTA 3VR4A 3T53B 3BG3A 3P1HA 4IN3A 4LK1C 1RKNA 3D4WA 3LWUA 4A3DB 5JVG3 2PPBC 5I4DA 3M7GA 3MHBA 5I9OA 5EJWA 4K6LA 2XVSA 1A3UA 1CFMA 1CHQD 4Q0FA 2CQAA 1TVXA 3SXHA 5C3XA 4K5VA 3FKIB 2E2IB 3I70A 4QIWB 4HN7A 3J81L 3V96A 2O5IC 2NUCA 4OHJA 2A69C 2K5DA 2KEEA 5JEAJ 2NVQB 4ME5A 1ILQA 3SEBA 1TT2A 1H9RA 1Y8OB 3GTLB 2F0WA 2EYOA 1BNZA 5FOBB 1TY0A 4XYOA 5G3LD 5M5YB 2J4XA 2NVXB 5JPMC 2MHVA 3PUWA 3KK7A 1G6ZA 2R6GA 1H9SA 1SYGA 4IFDJ 1F9RA 2HQEA 3NP8A 3Q23A 2PZTA 2BOSA 2ZXPA 4HMJA 1FGBD 4ZKCB 1G8ZD 4Q5VA 1F9QA 3I4NB 3S1MB 1SE4A 2R3ZA 3T51B 3TP6A 1EYCA 3OWEB 3H0GB 2ENBA 1DD2A 3CRLC 3RMHA 4IUPA 1B50A 2D5DA 4RGMA 2FFKB 2Y0SB 1LTGD 4LAAA 3M4OB 3VYTA 4TRDA 1NAPA 2ICIA 4RKLA 4BY1B 4BBSB 4C3JG 2PW7A 4N9TA 2DY7A 4RHSA 3ITPA 3Q6SA 2RKSA 4U673 2F0HA 4ZUIA 1CZGA 1NCVA 1STYA 1SNPA 3BYTB 5IT9E 1PTOF 2QKIC 2HCIA 2F0OA 2K33A 3BS1A 3P20A 1AZPA 3GTPB 1HUMA 2NYZD 2EJGC 2DN8A 2YU9B 2SEBD 3J81E 3I72A 2R92B 4FXGC 3A56A 3L3OC 2VUMB 3PUZA 3VR5A 5CORA 5CC4A 3VR3A 1IW7D 2F0QA 3VA5A 4FYDA 2RDGA 4QUCA 3J7YW 4PQXA 4DA2A 4KKSA 2L1BA 5ELDA 1A15A 1RTOA 4V0BA 1B3AA 2WP8J 3J7AF 4FF4A 3GTKB 2G9DA 1MD2D 1KTKA 3HOWB 3OIQA 3U9SA 2C9OA 2NN6G 4X3SA 3S9WA 2B63B 4MHEA 4BBRB 3FDTA 3TP7A 3QO2A 4X3UA 4KK7A 5DM63 1CI3M 1EU4A 1T5EA 4K2LA 4F87A 2ZXRA 1EL0A 3BZDB 1JOKA 1F2ZA 1EEID 1LT3D 4A3JB 1LT4D 5I6YA 5M3FB 1FYCA 2KVMA 1NUCA 4XQQA 1F2LA 1CQVA 3BVMA 1LACA 1CT1D 3QIAA 1S4ZA 2K7VA 5LL6X 2MGSA 1ESFA 2AQ2B 2DNEA 4TSSA 3FEWX 3ZYYX 5I9PA 1HTLD 5EBDA 2NBFA 3S14B 1PTOC 4NW2A 5I2XA 1LLRD 1C48A 1PFNA 1HTPA 1L0YB 4ILWA 1II3A 1D2BA 4ULLA 3MFGA 5CV6A 4FF1A 1B2TA 3PIP3 3T13A 1IL8A 2LKVA 1PYWD 4L6TB 1CQFA 2F0FA 2L11A 5BN3A 1IYVA 3EA6A 1V1PA 1JC7A 3BDCA 4KD3A 2RSOA 1LTRD 4GZYC 3MC0B 2D62A 5DM73 3VYRA 3L7ZC 3M4YA 1F9SA 4DU9A 2F0GA 2JP1A 3GV6A 2A6ED 2WACA 2KCCA 1GXDC 4A3KB 1B9NA 2AWOA 1EWHA 5C0XG 1V1PB 1CZWA 1JB3A 5E4XA 5C0XJ 2O2LD 2CW0C 1I4XA 2BA0A 1K83B 3J80L 4IUVA 4MN3A 1PRTC 5K5PA 2FMCA 2A6EC 2L9HA 4RWSC 3MWYW 3EVQA 1QWYA 1CTMA 4EVOA 3IKJA 3NSWA 5ELFA 1EIGA 3PMFA 1STGA 4KV6A 2JA8B 2PZUA 4F8MA 1JR0D 3K58A 1JQYD 2VNUD 3HOZB 2E2DC 5C4JB 1IKLA 3DWPA 2HUGA 1RHPA 4RFBA 2EY6A 1J9OA 4KKUA 3S1RB 1XYIA 4X3TA 2F0IA 2AUKA 5M3MB 3M3YB 1SNCA 3DUZA 4G7HC 3IFDA 3S16B 2F0SA 1TQOA 3FRPB 4HCSA 1OXVA 1VF7A 2E75C 1SSOA 3S1NB 2B2TA 4PMCA 1SXTA 1UEAB 3CQZB 3IL8A 4ABNA 2PO4A 4UAIA 4DN4M 2F0LA 2PYKA 2A6HD 2EYJA 4KMUC 1UNSA 4J8QA 4R9WA 3LWEA 4O42A 1QG7A 4O1NA 3HOVB 1AN8A 1MI2A 3K6OA 3QB3A 4DAVA 1SMYC 2IW3A 2WKDA 4A3FB 3ND8A 1K8OA 1PXUA 2JXMB 4A3BB 5TSSA 2PW5A 1LTAD 1ENCA 4WFN3 5EPKA 1SNMA 4NMZA 1WTQA 2KEDA 4Y7NB 3HKZB 1U4LA 4H0LC 1FR3A 1ENFA 3QOLA 2M2LA 2MUYA 4DAPA 2WKCA 1V1OA 5CV8A 2KOLA 1TWFB 4DFAA 4L63B 1MSGA 4M1UB 3TSSA 1DONA 3SE0A 1ONLA 1BBXC 5A2QL 5BN5A 2X69A 3EJIA 3QG1A 1ZKOA 1KLUD 3DWQA 1RTNA 2TMPA 4C1NI 5COYA 1Y1WB 1PTOB 5IGEA 2F0TA 1H9JA 3A54A 4RH6A 3MZ5A 1ET6A 2B2YA 1BF4A 4KY7A 3DEPA 1I50B 4DNTB 3NWSA 3E0JA 2QEJC 4V190 1KNEA 1B44D 3VR6A 2JE6I 2F0KA 1Q90A 4NP5A 3G6JB 1I4HA 5C6AA 2R61A 5C3EB 3K0YA 1GUOA 1CA6A 2AUJD 2N55A 1Q12A 2AQ1B 1C8CA 5JPNC 4C3IB 1GUTA 1ET9A 3EFXD 1LV9A 2K28A 1QJOA 2AWNA 4L8JA 3U9OA 3HGBA 1OO9B 1F9PA 4K2KA 5EBCA 2F0PA 2XIWA 3HP3A 2E74C 3MTSA 5CBEE 2NZ1D 3C1FA 1TS3A 1MBYA 3SVMA 4KY5A 1RD9D 3HEJA 3VA7A 5IGGA 1D1KA 2CHBD 1FD7D 2RVLA 1DOLA 3OMCA 2JEBI 1EY8A 2JEAI 1ENAA 4A3EB 4QCLA 2NVTB 1EY9A 1S5FD 3H6MA 2K04A 3R2IA 3K59A 2IJ0A 3SK5A 5JEAG 3SDZA 1HUNA 3H09A 5J39A 5LHY1 5CR3A 1XTCD 5NUCA 1JE4A 4C56C 2RBMA 2IT1A 1JWMD 3R8BA 2OEOA 3KLRA 3BYYB 4G7ZC 3D8GA 3D6CA 2EXZA 4A93B 3I4LA 3H91A 3FPPA 1JCKB 4HR7B 1L0XB 4KHVA 2PCFB 5I6WA 1DZ1A 2KUMA 2SDFA 5IIFA 1HFGA 2PQEA 1JOQA 2DY8A 1QILA 2NVYB 3K7AB 1XX8A 3KLSX 4OGQC 3OOCA 2JA5B 1H9MA 3S2DB 5FLXE 1SMYD 3NXWA 1PRTD 1KDBA 4FVMA 4FXKC 3D6WA 4DXGA 3X3MA 1EWCA 3NBIA 2EE1A 1TWHB 1PFMA 4ZUJA 5KNDA 4ZRZA 4FXDA 1G291 3GTMB 2BA1A 5EPLA 5CV7A 2ICEC 4C3JB 3MXPA 1DCZA 4RKBA 5C44B 1JWSD 2NWGA 3C1EA 5C4HA 4I65A 1TWCB 1FNUA 4XQNA 2SNMA 3I3CA 1I4PA 2PMZB 3S2HB 1EIHA 1SNDA 2I46A 2KA7A 5M9OA 1EQTA 1S5DD 4WORA 1EFID 4CGYB 1A3TA 1SYFA 1D5XC 1KAAA 2B8GA 3VR2A 1BCPC 1F77A 3W3AA 3ND9A 2F0EA 2F0VA 3K5LA 4JBWA 1HPCA 1TR5A 3SK4A 4FO2A 1WCMB 1D6EC 3ERQA 2J0TD 3JAME 4R8IA 1DYQA 3I4MB 3NQIA 2HCCA 3S17B 1DJRD 4RCOA 2EY1A 1BCPD 2A73B 2OF1A 3MEHA 2XWJB 4F7XA 2JA7B 4PV1C 5I2YA 2EYMA 1QNKA 2IX3A 4TQUS 4ZLTF 2EJFC 5FLXL 4WRDA 2IX0A 2PZWA 4G4KA 4ZAIA 3DXJC 2B39A 4TKOB 1STAA 4XQJA 2YYZA 3K5OA 3QWNA 3GV3A 1EYDA 4A3GB 1AFPA 2JA6B 3D4RA 2O4XA 2NB0A 5JEAH 4KN7C 1SNOA 1PZKD 1ZXTA 3CHBD 5E1FA 3WOFA 2EVBA 1DXMA 5HGTA 2NN6H 1SBBB 4CJ1B 5T1IA 1Y69U 1TKWB 1M8AA 2B2WC 3CRKC 2F1MA 1UUPA 3RZOB 5D14A 3W2DA 3LX0A 4ZKBB 4C2MB 4UDUC 1R9TB 1EY4A 4E6IA 4QB4A 2EYLA 3NHHA 2A74C 1NR4A 2XNAC 3V2TA 1BDOA 2F3WA 1R4QB 3NUCA 1ZEQX 3I91A 3MFYA 2HDLA 4IQZA 3C46A 3DWAA 2QILA 2EZVA 3S1QB 1JWUD 2EY2A 3GTOB 2WAQB 3IAYA 4IURA 2LY7A 2WIIB 2A5HA 3DEOA 1LO5D 3KUPA 4KHZA 1DOKA 2Z8LA 2L5TA 4FP5D 3URYA 4IFDI 1HQMC 3A55A 1XXGA 2K1BA 1BOSA 3CU7A 1U4PA 5J1ZA 3C3LA 1EY6A 4K6DA 3PO2B 2B2VA 4K8IA 3I90A 2Z1CA 1SDFA 3MXGA 3HG9A 1SJHD 1SYCA 2K6AA 2IL8A 4OL7A 5G3LF 3WOEA 1NR2A 1FNVA 1Z6HA 1H9KA 3A7LA 1ZYRC 3TZDA 2EOTA 1WTRA 2F0JA 4OO1I 2NTSA 2LFNA 2X6GA 4KJNA 1EY0A 3OWFA 2WV6D 1PMRA 2B8FA 1HA6A 1YNND 5KNBA 5JAVA 3O13A 4DK0A 4C3HB 1EEFD 4LMQD 2F0NA 1LT6D 3MVVA 3TBIB 4PMWA 1STEA 2H4OA 3PUYA 2VXWA 3TP5A 2MPMA 1EY7A 3TZUA 4EQPA 4EQNA 4DF7A 1HCZA 1VF5C 5ELEA 4NDXA 3HOXB 1HHVA 4KJOA 1UAPA 2F3VA 3LNNA 4CJ0B 1EU3A 3BVZA 1U4MA 1FNWA 1WVLA 1SFOB 1RDPD 4XIGS 5IGFA 5K36H 2B2TC 3OPOA 3BVGA 1TWAB 5F2DA 1E2WA 2EPBA 2ZXOA 3KF8A 3IFTA 4RGOS 3A8JE 4RHRA 4IUUA 3PUXA 1I3QB 2F0DA 2FHTA 1M4VA 3PUVA 1PLFA 5D3IB 1H9SB 3NWTA 2XRQD 1I4QA 1B9MA 1E0BA 3T4AC 1O80A 5JOBA 3NK9A 1Y8NB 4QUFA 2C5CA 2L12A 2RA4A 4X3KA 4FNFA 2A69D 2HDMA 3HZXA 3QOJA 4K8JA 5EKKA 3VYSA 4LJZC 2B2UC 3A8KE 3GTJB 1QE6A 1Q1BA 4IFDG 5C0XI 2LMCB 5A2QE 2K32A 3BDOA 4F88A 2K5WA 1JICA 5KNCA 4R8NA 1W6JA 4KKTA 1G2TA 1S5ED 1I4GA 3SK8A 1KABA 1BR9A 2B2YC 4XDXA 3AU7A 2RQXA 2RSNA 2E2JB 2IWHA 2OT2A 5C3WA 1IYUA 1VDZA 2LS01 5EKLA 2H1EA 2VB2X 5CMDA 3N6RA 4DXFA 3OMGA 4PMBA 5EPJA 3RLFA 3HRZC 1VMPA 2EYPA 5HURA 3L9AX 4ID6A 3GO5A 1HA5A 4EGVA 5IODA 2BCOA 4ZK9B 1K8MA 3GD7A 2Z4IA 1GUSA 4ZYSA 2CW0D 3P75A 4XYQA 1Q3LA 1X32A 4ODGA 4IZ8A 1SNQA 1OXUA 4BY7B 1ILPA 2EDGA 2K5QA 3M85A 1QOHA 4B9WA 4K5XA 5FO8B 5FKAC 1VCIA 5KIXA 3EQLC 5AFWA 1OXTA 4G7OC 1O7YA 4CKEA 1TS2A 1G2SA 1QB5D 2B2VC 1PZJD 4MIUA 1RF2D 3R2TA 5CV4A 1OXXK 1EZ8A 1BQQT 5KRUA 2SNSA 4HAEA 2K01A 4IFDH 4DNRB 1RCVD 4CJ2C 3Q22A 1GOZA 1SAPA 4C1NK 1SJED 4IUNA 5KYIA 2BE5C 4WJWA 1S5BD 1V43A 4CKCA 4YIJA 3SHLA 4KY6A 2M9VA 5DAUA 2ZT9C 3FPUB 2L0CA 4OIJA 4FF2A 2ID0A 4KD4A 2K05A 4P2CB 1WD1A 1TS4A 3ONAB 3MAQA 5C4ZA 1EY5A 3QJYA 3KBGA 1MGSA 4CHTB 4HSPA 5KGUA 3TP8A 5CYUA 4J1MA 3G7LA 2A68C 4HMIA 2A6HC 3HS0C 3AMUA 3J7AV 2JYOA 1EYAA 3D31A 1O7LA 2SOBA 1I6VC 1CHPD 4K5WA 4NKLA 5E4WC 5M5XB 4C3IG 1KDCA 4C3HG 3NE5B 1SYDA 2MJ8A 4B08A 1TY2A 3E6ZX 4XT3B 3DM1A 3I73A 4ZQ3A 5IT9L 3Q0AA 3JAML 1HQRD 3GTQB 2L55A 1STBA 4RA8A 5D65A 1A2UA 2EJMA 4H13C 4A3IB 2F0MA 4RGTA 3NPPA 4I7ZC 5M5WB 1F2MA 4DGZA 4PNYA 4BA2I 1WTWA 1WTXA 4RAUC 1KLGD 2CVRA 1EOTA 3PIO3 5ELCA 5A35A 2EY5A 3R93A 3SR1A 1RJTA 1BCPB 2XWBB 1WTVA 1KDAA 1SYBA 1LTBD 2PNRC 1O78A 1CM9A 4RGNA 3J80E 2BDOA 3TN2A 5IGBA 2KJXA 3S15B 4CKBA 4HEDA 2J7ZA 3HOUB 2QDBA 2K03A 4OIKA 5BN4A 2IX1A 3GTGB 5DNFA 5EKIA 4K14A 3T56B 3RUZA 1NSNS 1MSHA 3H94A 2R7ZB 2I07B 1YNJD 1EZ6A 2F0UA 2FINB 5FO9B 3PO3B 3TMEA 3R3OA 4M8AA 1OXSC 4QMGA 3A8IE 4H7BA 1A6XA 5C4XB 2DNCA 1BUVT 1WD0A 2TSSA 5JVH3 5DEHA 4S3SA 5T1GA 2KQ3A 1SE2A 1YNJC 2WB1B 3RZDB 3UI2A 3D3RA 1LABA 2EYHA 5ISRA 1GHJA 1YNNC 1HFNA 1U9RA 2QF7A 1B1ZA 5CGKA 1U4RA 1TIID 1B4OA 3OIPA 3X3NA 5C5LA 1I6HB 2B2WA 3KBXA 3K5NA 1A2TA 1TU2B 1SE3A 5EQ0A 2E2HB 4KI0A 2OXPA 3E5SA 1PRTB 5D3DA 5FO7B 3FVQA 1BO0A 1X3QA 1LTTD 4DK1A 2NN6I 1D5ZC 4JK1C 1F2YA 4HCEA 1Z7TA 2R93B 1G91A 1WTPA 2B2UA 1KNAA 1WTOA 2AQ3B 1GHKA 2JSOA 1JOOA 1HXYD 3OHXC 1XWEA 5KYLA 2Q8IB 2XN9C 2BDNA 4J6HA 3PV0A 3WDNA 1J8IA 4IALA 3EROA 2IPKD 1Q1EA 4BWGB 1ML0D 1RODA 3MA2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEP A;  4XT3 B;  2R3Z A;  1O80 A;  3DM1 A;  4X3S A;  1ICW A;  3P7J A;  4QUF A;  5JJZ A;  1WD0 A;  1BNZ A;  1VMC A;  2K04 A;  2L12 A;  2RA4 A;  4HCS A;  4X3K A;  1NR2 A;  5AFW A;  4MHE A;  5T1G A;  3I3C A;  3TZD A;  2HDM A;  2EOT A;  3FDT A;  3QO2 A;  4X3U A;  4CJ1 B;  1WTR A;  4IUP A;  1SSO A;  1B50 A;  2RSO A;  1EIH A;  1F9S A;  5T1I A;  4IUT A;  2B2T A;  1HUN A;  2FFK B;  2FMM A;  2JP1 A;  2KEC A;  2L4N A;  4RA8 A;  1O7Y A;  1KNE A;  1M8A A;  1NAP A;  2X6G A;  2B2U C;  5D65 A;  3GV6 A;  1EQT A;  1G2S A;  2B2V C;  2B2W C;  1QE6 A;  3IL8 A;  3UI2 A;  4UAI A;  4DN4 M;  5D14 A;  4HAE A;  2DY7 A;  1JE4 A;  1HA6 A;  4R9W A;  1HFN A;  2K01 A;  4ZKB B;  1EL0 A;  3LWE A;  5EJW A;  1WTW A;  3Q6S A;  1WTX A;  2FJ2 A;  1JIC A;  4O42 A;  1QG7 A;  2N88 A;  4RAU C;  1U4R A;  4CJ2 C;  1B4O A;  1HRJ A;  2CVR A;  4LMQ D;  1EOT A;  1SAP A;  1G2T A;  3N52 A;  1MI2 A;  1NCV A;  2X6L A;  1NR4 A;  2B2W A;  5E4X A;  3KBX A;  3R93 A;  1RJT A;  2VXW A;  2MPM A;  2KVM A;  3H91 A;  1CA6 A;  2B2Y C;  2N55 A;  4XDX A;  1TVX A;  5EQ0 A;  1F2L A;  1C8C A;  4IUV A;  4MN3 A;  1DZ1 A;  1AP0 A;  2RSN A;  1WTV A;  2L9H A;  2HCI A;  2KUM A;  2SDF A;  5EPK A;  4R8I A;  1CM9 A;  3FPU B;  1GUW A;  1WTQ A;  4RWS C;  1S4Z A;  2KED A;  4U68 A;  1HFG A;  4OIJ A;  3TN2 A;  2HCC A;  3I91 A;  1AZP A;  3MWY W;  1LV9 A;  1U4L A;  2DY8 A;  1BO0 A;  1X3Q A;  1DOM A;  1HUM A;  2H1E A;  2MGS A;  2HDL A;  2NYZ D;  2K28 A;  2KEE A;  1HHV A;  2K05 A;  1ILQ A;  4CJ0 B;  5CBA E;  1XX8 A;  4HED A;  5CMD A;  2J7Z A;  2M2L A;  1AZQ A;  1WD1 A;  3ONA B;  1PFB A;  1EIG A;  1U4M A;  2K03 A;  4OIK A;  5EPJ A;  4NW2 A;  1WVL A;  1G91 A;  1F9P A;  3IFD A;  4IUR A;  5COR A;  1VMP A;  2KOL A;  4HSV A;  1WTP A;  1PFN A;  1DON A;  1MGS A;  5DNF A;  2B2U A;  1KNA A;  1MSG A;  3DEO A;  4XT1 B;  1WTO A;  3G7L A;  1BBX C;  3KUP A;  5EKI A;  2XIW A;  3D6W A;  3F2U A;  3HP3 A;  2B2T C;  1IKM A;  1QNK A;  1DOK A;  4QUC A;  3MTS A;  2X69 A;  5CBE E;  2EE1 A;  1ESR A;  2NZ1 D;  4ZLT F;  4ZK9 B;  2D9U A;  1B2T A;  2EPB A;  2JYO A;  2K1B A;  1IKL A;  1U4P A;  1X3P A;  2L1B A;  3SVM A;  1PFM A;  1G6Z A;  1A15 A;  1IL8 A;  4ZAI A;  2HUG A;  1RHP A;  1RTN A;  4IUU A;  4IUQ A;  1RTO A;  1MSH A;  1F9R A;  2Q8R E;  5COY A;  2FHT A;  2B2V A;  1B3A A;  2BDN A;  1J9O A;  3GV3 A;  3I8Z A;  4ZKC B;  5EPL A;  1PDQ A;  2L11 A;  1Q3L A;  3I90 A;  5E4W C;  1J8I A;  1PLF A;  2RVL A;  1X32 A;  1DOL A;  4X3T A;  1F9Q A;  1XYI A;  2Q8T A;  2FIN B;  1SDF A;  2B2Y A;  1CA5 A;  1BF4 A;  1B53 A;  1ILP A;  1E0B A;  1O7Z A;  1ML0 D;  2MP1 A;  2MJ8 A;  1ROD A;  2IL8 A;  2NWG A;  1ZXT A; 
#chains in the Genus database with same CATH topology
 1Q8I A;  3K57 A;  4OXP A;  3NTI A;  1SYE A;  5M3F H;  2JA7 H;  3H3V H;  3P7J A;  4AQY L;  5IP7 G;  3OW7 A;  3CKI B;  4A3E H;  3QR8 A;  4PZ7 A;  4DR2 L;  4LFC L;  1KAW A;  4POG A;  2FMM A;  2GA4 B;  5E3F A;  2KEC A;  4UPA A;  1K8G A;  4KTA A;  4YCU A;  3SK6 A;  5K36 G;  1GUG A;  3TQY A;  1EIF A;  1LT5 D;  2D2C C;  4A3M G;  3VYU A;  3RD4 A;  3S1N H;  2FJ2 A;  3NTK A;  1UE5 A;  2XRS D;  2QCP X;  3N52 A;  2VB3 X;  4XXE A;  2RDH A;  4UP7 A;  1I4R A;  3J80 i;  3V05 A;  2LXK A;  1AP0 A;  2MFI A;  2E5L Q;  1BXT A;  3C2P A;  4OWW B;  3K0X A;  4KN4 C;  1DOM A;  2RDF A;  5CBA E;  5ELB A;  4JBM A;  3TDQ A;  1AZQ A;  1PFB A;  1PTO D;  4P75 A;  3F2C A;  3CF5 A;  4H44 C;  5J3B A;  3ULJ A;  1L1O C;  3KDF A;  4MZ9 A;  2JN4 A;  2NTT A;  4C2M H;  1VQO A;  1YHA A;  1ESR A;  3RZO H;  2D9U A;  1PH5 A;  4Y52 H;  1X3P A;  1AE2 A;  1PZI D;  4IUQ A;  3M7N A;  3FMC A;  2JA8 H;  4LF4 Q;  2Q8R E;  1KL9 A;  1IXR A;  4DUZ L;  1A3V A;  1WI5 A;  4H02 A;  5C4X G;  2E76 C;  1W2B A;  4UY8 C;  4OO1 H;  3GTM H;  1PDQ A;  3DHQ A;  4HTH A;  2KHS A;  4TVA B;  4WJ4 A;  5IOC A;  2V1C C;  3NBH A;  2WIN B;  4DUY Q;  2KCN A;  3I2Z A;  2M00 A;  1B53 A;  1O7Z A;  2OWO A;  3CCL A;  3GP7 A;  4LUO A;  5BR8 Q;  1ICW A;  1VMC A;  5CV9 A;  4DUZ Q;  1CK1 A;  1I50 H;  1GKH A;  2EYF A;  2DJF C;  5J22 A;  3OTO L;  4IUT A;  3CCS A;  2E8G A;  1EQV A;  1AW7 A;  1LM0 A;  4PZ6 A;  4RCN A;  1DM0 B;  1E2V A;  4CBV A;  3CME A;  4DK6 C;  4ME3 A;  1QUQ A;  1GJX A;  4OO1 G;  1AEX A;  3Q24 A;  3AFP A;  2G9H D;  1OTC A;  3OSO A;  1C7Y A;  1QCB D;  4B9X A;  1ASZ A;  4XTC S;  1TS5 A;  1TWG B;  1MKH A;  4DAY A;  2N88 A;  4A3M B;  1HRJ A;  2LSS A;  1JOR A;  2QW7 A;  2V4D A;  2X6L A;  1LTS D;  4QF4 A;  2BE5 D;  4GLA C;  1STN A;  3D4D A;  3G48 A;  4BA1 I;  1K73 C;  3K5M A;  1QVC A;  3T1Y L;  1V8Q A;  1GUN A;  3GQB A;  1XJV A;  1WCM H;  2PNH A;  3H3V C;  3JAM i;  5IGD A;  1IW7 C;  3AEV A;  3FP9 A;  4GLX A;  1GVP A;  1KXL A;  1GUW A;  1E2Z A;  1X65 A;  4BS9 A;  3W1G A;  5IY0 A;  4U68 A;  3BDL A;  1Z47 A;  3K7A H;  2O5J C;  5C5M A;  1LTI D;  3AB9 A;  1W6K A;  4G57 A;  3AFQ A;  4GS3 A;  4QGU A;  1S5C D;  4GN5 A;  5IGC A;  4FF3 A;  5CV5 A;  3MXU A;  1ZYR D;  5FK9 C;  3MXN A;  4HSV A;  2Q2T A;  2Q2I A;  2F4I A;  2UUA L;  4XT1 B;  2WAQ E;  2A68 D;  3NEM A;  1IKM A;  3F2U A;  4R1J A;  3SGI A;  1XNQ L;  3T16 A;  2PMZ E;  4R4I A;  3NTH A;  2ZJR A;  1SEB D;  3A7A B;  4Z9C B;  2HIX A;  1C4Q A;  1Y1V B;  1X54 A;  2F03 A;  1PH7 A;  4A3G H;  1BCP F;  2XSC A;  1R4P B;  3RN2 A;  2R7F A;  3I8Z A;  3CCM A;  1I94 L;  2VUM G;  4N9P A;  1PRT F;  1D1I A;  3KLS A;  3NQT A;  1CA5 A;  5HGQ A;  2Q8T A;  1Y8P B;  1D5M C;  4LF9 L;  1N32 Q;  4GKJ L;  1PTO H;  1STH A;  1T5X D;  5C0X H;  4JI7 Q;  2MP1 A;  4JV5 Q;  2Z4H A;  3HOY B;  1BKB A;  4EQO A;  5JJZ A;  2P5Z X;  5LL6 S;  3FHW A;  1QNU A;  3DMU A;  4MTK A;  1VQ4 A;  4AYB B;  1IHZ A;  4LNQ A;  5KEE A;  2L4N A;  5EGT A;  3VR4 A;  3T53 B;  3BG3 A;  2ZJP A;  3P1H A;  4IN3 A;  4LK1 C;  1RKN A;  1FL0 A;  3NBH B;  3D4W A;  2MO0 A;  2JA5 H;  3LWU A;  4AIM A;  4A3D B;  5JVG 3;  3EIV A;  2Y0S G;  2PPB C;  2VS1 A;  3BJU A;  5I4D A;  3M7G A;  3MHB A;  5I9O A;  4KLK A;  5EJW A;  3F2B A;  2HHH Q;  5JJK A;  4K6L A;  2XVS A;  1A3U A;  1CFM A;  1CHQ D;  3ER0 A;  4Q0F A;  3OTO Q;  4BY1 G;  4A93 G;  1VQ9 A;  5C3E H;  2N3S A;  3E9I A;  2CQA A;  1TVX A;  3SXH A;  4LF9 Q;  5C3X A;  4K5V A;  2JA8 G;  1CKN A;  3FKI B;  2E2I B;  3I70 A;  4QIW B;  4HN7 A;  3J81 L;  2KEN A;  3V96 A;  3L0O A;  4EQ5 A;  4K0K Q;  2O5I C;  2NUC A;  1E22 A;  4OHJ A;  1SR3 A;  3I55 A;  3H3V I;  2A69 C;  4BBR G;  2K5D A;  2KEE A;  1GO3 E;  5JEA J;  2NVQ B;  4ME5 A;  1ILQ A;  1K28 A;  4B3S Q;  3SEB A;  1TT2 A;  3J81 i;  4LF4 L;  1H9R A;  3HOW G;  3S2H H;  1Y8O B;  3L2P A;  1KRS A;  1L1O A;  3GTL B;  1IBL Q;  2F0W A;  2EYO A;  1BNZ A;  2DUD A;  5FOB B;  1TY0 A;  4XYO A;  5G3L D;  1HNZ Q;  5M5Y B;  2OCE A;  2J4X A;  2NVX B;  5JPM C;  2MHV A;  3PUW A;  3KK7 A;  5AJ3 L;  1G6Z A;  2R6G A;  3AQQ A;  1H9S A;  3RNU A;  1SYG A;  4IFD J;  2OQK A;  1TWH H;  1F9R A;  2HQE A;  3NP8 A;  1HH2 P;  3Q23 A;  2PZT A;  2BOS A;  2ZXP A;  4HMJ A;  1FGB D;  4ZKC B;  1G8Z D;  4BBS H;  2R93 H;  4Q5V A;  1KIX A;  1F9Q A;  2VQE Q;  3HOV G;  3I4N B;  1U5K A;  2CH4 W;  3S1M B;  4GNX A;  2I5L X;  2VQE L;  2GVA A;  1SE4 A;  2R3Z A;  1E3P A;  2PQA B;  3T51 B;  1PH2 A;  3TP6 A;  1EYC A;  1M90 C;  4JOI C;  3OWE B;  4L5Q A;  5M5W H;  3H0G B;  2ENB A;  1DD2 A;  3CRL C;  3RMH A;  4IUP A;  1B50 A;  2D5D A;  4RGM A;  5AJ3 Q;  2FFK B;  2Y0S B;  1LTG D;  4LAA A;  3M4O B;  1BBW A;  4TRD A;  1NAP A;  3UDF A;  2ICI A;  3VYT A;  4RKL A;  4BY1 B;  1Y1V H;  4LWC A;  1DGS A;  4BBS B;  1IBK Q;  1HNZ L;  4C3J G;  4BXX H;  1JT8 A;  2PW7 A;  5IE8 A;  4Y7N H;  4N9T A;  4JI1 Q;  2DY7 A;  1IBL L;  2OTL A;  2JA7 G;  4RHS A;  3ITP A;  3Q6S A;  2RKS A;  4DR4 Q;  4U67 3;  4JYA L;  2F0H A;  4ZUI A;  1CZG A;  1NCV A;  1STY A;  3K81 C;  1SNP A;  3RLN A;  4YCW A;  4LUZ A;  3KYH C;  3KF8 B;  3BYT B;  5IT9 c;  5IT9 E;  1PTO F;  3Q8D A;  2I0Q A;  4DUY L;  2QKI C;  1TXY A;  2HCI A;  1NNX A;  2F0O A;  2K33 A;  3CW2 C;  3BS1 A;  3P20 A;  1VQG A;  5LMU Q;  1AZP A;  3NEN A;  1QUQ B;  3GTP B;  1HUM A;  2NYZ D;  2EJG C;  2DN8 A;  2YU9 B;  2SEB D;  3J81 E;  1CSP A;  1Q86 C;  4X64 Q;  3I72 A;  2R92 B;  4FXG C;  3A56 A;  3L3O C;  2VUM B;  1SFO H;  3PUZ A;  3VR5 A;  5COR A;  5CC4 A;  3VR3 A;  1IW7 D;  2F0Q A;  3VA5 A;  4FYD A;  1N36 Q;  5LMN Q;  4YHH L;  1Q7Y C;  2NZH A;  2RDG A;  4QUC A;  3S2D H;  3J7Y W;  4PQX A;  4DA2 A;  4KKS A;  3MEF A;  2PI2 A;  2L1B A;  5ELD A;  1L0W A;  1A15 A;  1RTO A;  2AKW B;  3CCV A;  4V0B A;  1B3A A;  2WP8 J;  1VQH A;  1QZH A;  3J7A F;  3J7Z C;  4FF4 A;  3GTK B;  4CDE C;  2G9D A;  1RL2 A;  2VQF L;  4DKA C;  1MD2 D;  1KTK A;  3HOW B;  3OIQ A;  2C9O A;  3U9S A;  2NN6 G;  4X3S A;  3S9W A;  3U4V A;  2B63 B;  4C3J H;  1MIU A;  2K75 A;  3AYH B;  4MHE A;  2VL6 A;  2K5V A;  4BBR B;  2B29 A;  3FDT A;  3QO2 A;  4X3U A;  3TP7 A;  3UDI A;  3M3Y H;  1X3E A;  4KK7 A;  5DM6 3;  1CSQ A;  3BZC A;  1CI3 M;  4C3I H;  1EU4 A;  1T5E A;  4K2L A;  4A3F G;  4F87 A;  2ZXR A;  4QY7 A;  1EL0 A;  3BZD B;  2K14 A;  3M9B A;  1JOK A;  1F2Z A;  1EEI D;  1LT3 D;  1Y14 B;  4JI0 L;  4AQY Q;  4A3J B;  1LT4 D;  5I6Y A;  1NMG A;  3KF6 A;  1HZC A;  5M3F B;  1FYC A;  3S14 H;  4P71 A;  2R93 G;  2KVM A;  3NEL A;  1NUC A;  2Q2H A;  4XQQ A;  1F2L A;  1CQV A;  2WB1 E;  3PO2 H;  3BVM A;  1E24 A;  1LAC A;  1CT1 D;  3QIA A;  1NMF A;  1EUJ A;  1S4Z A;  2K7V A;  5E7N A;  5LL6 X;  2MGS A;  1ESF A;  2AQ2 B;  4PG3 A;  2DNE A;  4TSS A;  5M5Y H;  2WFW A;  3FEW X;  1KRT A;  3ZYY X;  5I9P A;  1HTL D;  5EBD A;  2NBF A;  4JW0 A;  3S14 B;  2K5H A;  1PTO C;  1B7Y B;  4JI3 Q;  4NW2 A;  3TS0 A;  4YY3 Q;  5I2X A;  1LLR D;  1C48 A;  4DAM A;  2I5H A;  1PFN A;  4YHH Q;  3GTO H;  1HTP A;  1L0Y B;  4ILW A;  1II3 A;  1D2B A;  4ULL A;  3MFG A;  1PA6 A;  3ZJY C;  3UDG A;  5CV6 A;  4FF1 A;  1B2T A;  1VQB A;  3PIP 3;  3T13 A;  1VQK A;  1IL8 A;  1UEB A;  3CPF A;  1PH3 A;  1J6Q A;  2LKV A;  1PYW D;  3E3X A;  4L6T B;  1CQF A;  4AYB E;  2F0F A;  5BR8 L;  2L11 A;  5BN3 A;  2ZM6 Q;  1IYV A;  3ICE A;  4I7A A;  4BY1 H;  1VQ5 A;  4IPD A;  3EA6 A;  1V1P A;  1JC7 A;  3BDC A;  4OON A;  4LF5 L;  1SLJ A;  4KD3 A;  3HOZ G;  3MXN B;  2RSO A;  4YWK A;  1LTR D;  4GZY C;  4YWM A;  4JG2 A;  3MC0 B;  2D62 A;  3RN5 A;  5DM7 3;  4OEM B;  3VYR A;  3L7Z C;  3M4Y A;  1F9S A;  1WJJ A;  4DU9 A;  5IWA L;  2F0G A;  2JP1 A;  3HOU H;  4HJ5 A;  1X55 A;  3GV6 A;  2A6E D;  4DV2 L;  2WAC A;  1A0I A;  2KCC A;  1GXD C;  3CC7 A;  4A3K B;  1B9N A;  1A62 A;  2AWO A;  1EWH A;  5C0X G;  3J7A 5;  1V1P B;  1CZW A;  1JB3 A;  5E4X A;  5C0X J;  2O2L D;  2CW0 C;  1I4X A;  2HT1 A;  2BA0 A;  1K83 B;  2MNA A;  4LF7 L;  4IUV A;  4MN3 A;  5K5P A;  1PRT C;  3J80 L;  2FMC A;  3A0J A;  2A6E C;  2L9H A;  4JC0 A;  3GTP H;  2Z9H A;  4JI8 L;  4RWS C;  5C3E G;  3MWY W;  3CP0 A;  3GTQ H;  3EVQ A;  1QWY A;  1CTM A;  4DR5 L;  4EVO A;  3IKJ A;  3NSW A;  5ELF A;  1EIG A;  3KOJ A;  3PMF A;  1STG A;  1VQC A;  4KV6 A;  2G5D A;  2JA8 B;  4JI5 L;  4DV5 Q;  2HQL A;  2PZU A;  4F8M A;  3PF4 A;  1JR0 D;  2Z6K A;  3K58 A;  1JQY D;  2VNU D;  3HOZ B;  2E2D C;  3K7U C;  5C4J B;  1IKL A;  3GTK H;  3DWP A;  4DR2 Q;  2HUG A;  1RHP A;  2EQS A;  4RFB A;  4K0K L;  2EY6 A;  1J9O A;  4KKU A;  1I3Q H;  1JB7 A;  3S1R B;  4A3D G;  1XYI A;  2I5M X;  4X3T A;  2F0I A;  2AUK A;  5M3M B;  3DM3 A;  1RIP A;  2WB1 G;  3M3Y B;  1SNC A;  2NVQ H;  3DUZ A;  4G7H C;  3IFD A;  3S16 B;  4P73 A;  2F0S A;  1TQO A;  3FRP B;  4NXN L;  4HCS A;  1OXV A;  1VF7 A;  2E75 C;  2R7D A;  1HZB A;  4GKK Q;  2NVX H;  3S17 H;  1SSO A;  4L5R C;  3S1N B;  3DLL A;  2B2T A;  1KQS A;  1E1O A;  4PMC A;  4R4T A;  1SXT A;  2BH2 A;  2A8V A;  1UEA B;  3CQZ B;  1KC8 C;  3IL8 A;  4ABN A;  2PO4 A;  4UAI A;  4DN4 M;  2EXD A;  2F0L A;  2PYK A;  2A6H D;  2CQO A;  1VQE A;  2EYJ A;  4KMU C;  1UNS A;  4NXM L;  4J8Q A;  4R9W A;  3LWE A;  4JI4 Q;  4O42 A;  1QG7 A;  4O1N A;  3HOV B;  1AN8 A;  1MI2 A;  3K6O A;  3QB3 A;  3HKZ G;  4DAV A;  1SMY C;  1MHW C;  3PQI A;  2IW3 A;  2WKD A;  4JI2 L;  4DV3 Q;  4A3F B;  3ND8 A;  1K8O A;  1IYJ B;  1PXU A;  2JXM B;  5IYB H;  4A3B B;  1L1O B;  5TSS A;  2PW5 A;  1LTA D;  4JOI A;  1WCM G;  1YNX A;  1ENC A;  4WFN 3;  5EPK A;  1I94 Q;  1GD7 A;  1SNM A;  3M4O H;  4NMZ A;  1WTQ A;  2KED A;  4Y7N B;  3HKZ B;  1JJG A;  1UE7 A;  1U4L A;  3HOV H;  4H0L C;  1FR3 A;  5IYC G;  1ENF A;  1IL2 A;  3QOL A;  4X66 L;  2IHE A;  4GNX C;  2M2L A;  1ASY A;  2MUY A;  4DAP A;  2WKC A;  2QDL A;  1V1O A;  5CV8 A;  2KOL A;  1TWF B;  4DFA A;  4L63 B;  1MSG A;  2HIV A;  4M1U B;  3TSS A;  3SE0 A;  1ONL A;  1BBX C;  1DON A;  1NBW A;  5A2Q L;  4DR7 Q;  1E1T A;  2CWA A;  5BN5 A;  1XMO Q;  2X69 A;  3HOU G;  3EJI A;  4NXM Q;  1EYG A;  3QG1 A;  2KHI A;  1ZKO A;  1U0L A;  1KLU D;  3DWQ A;  1RTN A;  2TMP A;  3HOW H;  1BBU A;  5COY A;  4C1N I;  1Y1W B;  1PTO B;  5IGE A;  2F0T A;  1JJ2 A;  1H9J A;  3A54 A;  3BZK A;  4RH6 A;  4A76 A;  3MZ5 A;  1ET6 A;  2B2Y A;  2R92 H;  1BF4 A;  1XMQ Q;  4KY7 A;  4A3I G;  4FDB A;  3DEP A;  1I50 B;  4DNT B;  3NWS A;  3E0J A;  1X6O A;  2ALY B;  4O2D A;  1AE3 A;  2QEJ C;  2QGQ A;  4V19 0;  3HOY G;  4A3I H;  2L15 A;  2AMC B;  4X62 Q;  1KNE A;  1B44 D;  4DV7 L;  1HR0 W;  2Y0S E;  3VR6 A;  2NZO A;  4N8X 1;  1B3Q A;  2JE6 I;  1VQD A;  2F0K A;  1CKM A;  1Q90 A;  1SE8 A;  4NP5 A;  1IBM L;  3G6J B;  4OWT B;  1FJG Q;  1I4H A;  2YTY A;  2IHF A;  5C6A A;  2R61 A;  1YJ9 A;  5C3E B;  3K0Y A;  4OWX B;  1GUO A;  1CA6 A;  2AUJ D;  2N55 A;  3WWV A;  1Q12 A;  4DR5 Q;  2AQ1 B;  1C8C A;  5JPN C;  4HIO A;  4C3I B;  4R4Q A;  1GUT A;  2JQO A;  1ET9 A;  2QEX A;  3EFX D;  1LV9 A;  5GAD C;  3H0G G;  2K28 A;  1QJO A;  2B3G A;  2AWN A;  4LFA Q;  4L8J A;  2A19 A;  3U9O A;  2YV5 A;  3BU2 A;  3HGB A;  4OX9 L;  4DV6 L;  3T1H Q;  1OO9 B;  1F9P A;  1YEZ A;  4DPG A;  4K2K A;  1UWV A;  4A3F H;  1QZG A;  5EBC A;  2F0P A;  4A3M H;  1G51 A;  1TWG H;  2XIW A;  3HP3 A;  2E74 C;  3MTS A;  5CBE E;  4QJF A;  4A3J H;  2NZ1 D;  3C1F A;  4N8F A;  5GRO A;  2R7Z G;  1TS3 A;  1MBY A;  3SVM A;  4KY5 A;  1RD9 D;  3HEJ A;  3VA7 A;  5IGG A;  1D1K A;  2UXB L;  2CHB D;  4GN4 B;  1FD7 D;  2N78 A;  1TWF H;  4GN3 B;  2E5L L;  2RVL A;  2CFM A;  4UP8 A;  1DOL A;  3OMC A;  2JEB I;  1QVG A;  1EY8 A;  2JEA I;  1ENA A;  4A3E B;  4QCL A;  2NVT B;  3PIO A;  1EY9 A;  1S5F D;  2F52 A;  3H6M A;  2K04 A;  3R2I A;  1YVC A;  2RF4 A;  3K59 A;  1N8R C;  2IJ0 A;  3SK5 A;  5JEA G;  3SDZ A;  1HUN A;  1HNX Q;  3H09 A;  4GOP A;  3EN2 A;  4A3D H;  2UXD L;  3D0F A;  3M4P A;  5J39 A;  5LHY 1;  5CR3 A;  1XTC D;  5NUC A;  3I4M G;  1JE4 A;  3G4S A;  3I56 A;  2ES2 A;  4LFC Q;  4C56 C;  1XNR L;  2RBM A;  2IT1 A;  2NVY H;  3G71 A;  2N49 A;  1UE6 A;  1I6H H;  1JWM D;  3R8B A;  2OEO A;  1AH9 A;  3KLR A;  3BYY B;  4G7Z C;  1WYD A;  3D8G A;  3D6C A;  2EXZ A;  4YY3 L;  4A93 B;  1NY4 A;  3I4L A;  3OYY A;  3H91 A;  2UXC L;  3FPP A;  1JCK B;  4HR7 B;  1L0X B;  4KHV A;  2PCF B;  1EQR A;  5I6W A;  1DZ1 A;  1HR0 L;  5LMN W;  2KUM A;  2SDF A;  5IIF A;  2F4V Q;  4GOP B;  3UE0 A;  1HFG A;  2PQE A;  5C44 G;  2YU9 H;  2F4V L;  1JOQ A;  2DY8 A;  2HD3 A;  4IJL A;  1QIL A;  2NVY B;  3K7A B;  1XX8 A;  3KLS X;  4APV A;  1YIJ A;  5JJI A;  3K80 C;  4LF8 L;  4OGQ C;  5C4X H;  3OOC A;  2JA5 B;  4JI6 Q;  1H9M A;  3CPW A;  1H95 A;  3S2D B;  5FLX E;  1SMY D;  3CCU A;  3NXW A;  2Q2U A;  1PRT D;  1KDB A;  4HJ8 A;  3JAM c;  3PGZ A;  4FVM A;  4FXK C;  3D6W A;  4DXG A;  1XMO L;  3X3M A;  1Q81 C;  1EWC A;  3NBI A;  2EE1 A;  4LF6 Q;  5EAY A;  2KCT A;  1TWH B;  1JE5 A;  1PFM A;  4ZUJ A;  2B63 G;  3H15 A;  5KND A;  1PH6 A;  4ZRZ A;  4FXD A;  1G29 1;  3GTM B;  2BA1 A;  1LYL A;  5EPL A;  4X66 Q;  5CV7 A;  4KHP Q;  2ICE C;  4C3J B;  4A3C G;  3MXP A;  1DCZ A;  1Q82 C;  4RKB A;  4DR1 Q;  5C44 B;  1PHJ A;  1JWS D;  2NWG A;  3C1E A;  3HOX G;  2MQH A;  4B3T L;  5C4H A;  4I65 A;  1PVO A;  1TWC B;  2D0O A;  2VQF Q;  1FNU A;  2K52 A;  4JI2 Q;  3TEH B;  3J81 j;  4CDD C;  4XQN A;  2SNM A;  3I3C A;  1I4P A;  4DR3 Q;  1GM5 A;  2PMZ B;  4X65 Q;  3S2H B;  1EIH A;  1E7Z A;  1SND A;  2UXB Q;  2I46 A;  2KA7 A;  4HIK A;  5M9O A;  1EQT A;  1YJN A;  2UU9 Q;  1N33 L;  1S5D D;  5C4J H;  4LFB L;  4WOR A;  1D7Q A;  1EFI D;  4CGY B;  1A3T A;  1SYF A;  1D5X C;  1KAA A;  2B8G A;  2K4K A;  4JI6 L;  3VR2 A;  2NVT H;  3S24 A;  1PH4 A;  1BCP C;  1F77 A;  1N36 L;  1VQP A;  3W3A A;  3ND9 A;  1P8L A;  2F0E A;  2F0V A;  3K5L A;  4JBW A;  1HPC A;  1TR5 A;  3SK4 A;  4FO2 A;  3T1H L;  4DV6 Q;  1WCM B;  2K50 A;  2ZTC A;  4OX9 Q;  1D6E C;  4DV4 Q;  4X64 L;  3ERQ A;  2J0T D;  1HNW L;  3CQZ H;  1HR0 Q;  3JAM E;  4R8I A;  1DYQ A;  5LMU L;  3I4M B;  3NQI A;  4P72 A;  2HCC A;  2CWP A;  2H5X A;  3S17 B;  3K8A A;  1DJR D;  4RCO A;  2EY1 A;  1BCP D;  2A73 B;  2OF1 A;  3MEH A;  4BY7 H;  2XWJ B;  4F7X A;  2JA7 B;  4PV1 C;  3PO2 G;  3U58 A;  1K9M C;  5I2Y A;  1X3F A;  2EYM A;  3GTG H;  4JPB W;  1FJG L;  4POF A;  1QNK A;  2IX3 A;  4TQU S;  4ZLT F;  2EJF C;  3PCO B;  4JI1 L;  5FLX L;  4WRD A;  2IX0 A;  1HNX L;  2PZW A;  4G4K A;  4ZAI A;  4IO9 A;  3DXJ C;  2B39 A;  4A4I A;  4TKO B;  1STA A;  4XQJ A;  2YYZ A;  1EQQ A;  3K5O A;  3QWN A;  3GV3 A;  1EYD A;  5GQO A;  4A3G B;  1PV4 A;  1AFP A;  5IYD H;  2JA6 B;  3D4R A;  2D0P A;  1VQA A;  4QL5 A;  2O4X A;  4OEL B;  2NB0 A;  5L37 A;  4JI8 Q;  4C3H H;  5JEA H;  4KN7 C;  1SNO A;  2VZA A;  1PZK D;  2ZTE A;  1ZXT A;  2VUM H;  3CHB D;  5E1F A;  3STB D;  3WOF A;  1XMQ L;  2EVB A;  1DXM A;  5HGT A;  2NN6 H;  1SBB B;  2KBN A;  1PH8 A;  1UE1 A;  4CJ1 B;  4B3R L;  1S40 A;  5T1I A;  1Y69 U;  1WFQ A;  1TKW B;  1M8A A;  1LTL A;  2B2W C;  3CRK C;  5ELN A;  2F1M A;  1UUP A;  4DV0 L;  3RZO B;  1KHI A;  3PIP A;  5D14 A;  4J15 A;  3W2D A;  2K5N A;  3LX0 A;  1VQ6 A;  4B3R Q;  4ZKB B;  1FGU A;  4DAY B;  4UDU C;  4C2M B;  4NB3 A;  1CKN B;  1R9T B;  1N33 Q;  4DR7 L;  1EY4 A;  4E6I A;  1Y1V G;  4QB4 A;  2EYL A;  1VS0 A;  3NHH A;  2A74 C;  4HIM A;  1NR4 A;  2XNA C;  3IRB A;  3V2T A;  4DR3 L;  1NJI C;  4DR6 L;  1BDO A;  2F3W A;  1PYS B;  3F1Z A;  1A63 A;  2RCF A;  1R4Q B;  4IOC A;  2B63 H;  3NUC A;  1VQM A;  1ZEQ X;  3I91 A;  1SRO A;  2E2J H;  3MFY A;  3H0G H;  4ALP A;  2HDL A;  4IQZ A;  3C46 A;  3DWA A;  2QIL A;  1IZ6 A;  2EZV A;  3S1Q B;  1JWU D;  2EY2 A;  3GTO B;  2WAQ B;  3GTL H;  3IAY A;  5M5X H;  4IUR A;  4YCV A;  2LY7 A;  1IBM Q;  2WII B;  2A5H A;  1A8V A;  3DEO A;  1FVI A;  1LO5 D;  3KUP A;  4KHZ A;  3A5Z B;  1DOK A;  3KLW A;  2UUB Q;  2Z8L A;  2HHH L;  2L5T A;  4FP5 D;  3URY A;  1PH9 A;  4IFD I;  1HQM C;  3A55 A;  5FLM G;  1XXG A;  2K1B A;  1BOS A;  3CU7 A;  1U4P A;  5J1Z A;  3C3L A;  1EY6 A;  1G6P A;  1K8A C;  3ERS X;  4JI3 L;  3U50 C;  4K6D A;  1N34 L;  3PO2 B;  2B2V A;  4BXX G;  2WAQ G;  4K8I A;  3I90 A;  1O7I A;  2Z1C A;  2CKZ B;  4UHV A;  4GKK L;  1SDF A;  3MXG A;  3HG9 A;  4DV4 L;  4NXN Q;  1SJH D;  3HOY H;  1SYC A;  2K6A A;  4B3M Q;  1HZ9 A;  2IL8 A;  4OL7 A;  1PYB A;  5G3L F;  3U4Z A;  3WOE A;  1X56 A;  1NR2 A;  1FNV A;  1CKO A;  1Z6H A;  4DV1 Q;  1N34 Q;  1H9K A;  3A7L A;  1ZYR C;  3TZD A;  2EOT A;  1WTR A;  3CC4 A;  3PF5 A;  2F0J A;  4OO1 I;  2NTS A;  1LUZ A;  2LFN A;  2R92 G;  2X6G A;  4KJN A;  1EY0 A;  4LFB Q;  3OWF A;  3ULP A;  2WV6 D;  1PMR A;  2UU9 L;  1KD1 C;  3OW2 A;  2B8F A;  4RMF A;  1HA6 A;  1YNN D;  5KNB A;  2UXD Q;  5JAV A;  1XNQ Q;  5GAG C;  3O13 A;  4DK0 A;  4C3H B;  4A3B H;  1EEF D;  4LMQ D;  2F0N A;  1LT6 D;  3MVV A;  3TBI B;  4PMW A;  3ULL A;  5FJ8 G;  1STE A;  2H4O A;  4LW1 A;  1XPU A;  3PUY A;  2VXW A;  3TP5 A;  2MPM A;  1EY7 A;  4GOP C;  3TZU A;  4EQP A;  3I4N G;  4EQN A;  4DF7 A;  1Q46 A;  1EIY B;  1HCZ A;  1VF5 C;  2F3I A;  2RCN A;  4NDX A;  5ELE A;  3HOX B;  2R7Z H;  3CMA A;  2CCZ A;  2ASB A;  4A3J G;  4R4O A;  1HHV A;  4BBR H;  1X3G A;  4KJO A;  2RHS B;  1UAP A;  2DGY A;  2F3V A;  3LNN A;  4CJ0 B;  1EU3 A;  2AHO B;  1B8A A;  3I7F A;  3W5O A;  3PO3 H;  3BVZ A;  2LXJ A;  3G6E A;  3TRZ A;  4A3G G;  1U4M A;  2FXQ A;  1FNW A;  1WVL A;  2VY3 A;  3CCQ A;  5IYB G;  1SFO B;  1VQJ A;  1RDP D;  1SN8 A;  4XIG S;  3PO3 G;  5IGF A;  5K36 H;  4A93 H;  2B2T C;  3OPO A;  3BVG A;  1TWA B;  5IP9 H;  1L2F A;  5F2D A;  1E2W A;  2EPB A;  1EOV A;  2ZXO A;  3KF8 A;  5M3M H;  3IFT A;  4RGO S;  3A8J E;  4RHR A;  4GLV B;  3RZD H;  3A5U A;  4IUU A;  3PUX A;  1I3Q B;  2F0D A;  2FHT A;  1M4V A;  2DJG C;  3PUV A;  5M3F G;  2JA5 G;  5IWA Q;  4L5S A;  1P16 A;  1T9H A;  3GTJ H;  1PLF A;  2EIF A;  5D3I B;  1H9S B;  3NWT A;  4DNI A;  2XRQ D;  3W1B A;  2OQ0 A;  1SMX A;  1I4Q A;  2UXC Q;  1B9M A;  1E0B A;  3T4A C;  4ZCK A;  1BVS A;  1TWA H;  1O80 A;  1NE3 A;  4PZ8 A;  5JOB A;  3NK9 A;  1Y8N B;  4QUF A;  4LF5 Q;  2C5C A;  4JBJ A;  2L12 A;  2RA4 A;  4X3K A;  1YBY A;  5FLX c;  4FNF A;  2A69 D;  2HDM A;  1J5E L;  3HZX A;  3QOJ A;  2ZM6 L;  4K8J A;  1JMC A;  5EKK A;  3VYS A;  4LJZ C;  2B2U C;  4JYA Q;  5IP9 G;  3A8K E;  3GTJ B;  1QE6 A;  4DV5 L;  1Q1B A;  4IFD G;  5C0X I;  2LMC B;  5A2Q E;  2K32 A;  2ZTD A;  3BDO A;  4JBK A;  4F88 A;  1J5E Q;  1IBK L;  2K5W A;  2Z6K C;  5DLQ E;  1JIC A;  5KNC A;  4R8N A;  4X62 L;  1W6J A;  4KKT A;  1G2T A;  3E0E A;  1S5E D;  1I4G A;  3KFU A;  1W3S A;  3SK8 A;  1KAB A;  1BR9 A;  3S1Q H;  2B2Y C;  4XDX A;  4HJA A;  3AU7 A;  4O0A A;  2RQX A;  2RSN A;  2E2J B;  2YTV A;  2IWH A;  2OT2 A;  5C3W A;  1IYU A;  3PSI A;  1VDZ A;  3CCJ A;  2LS0 1;  4LF7 Q;  5EKL A;  1N9W A;  5FLM H;  2H1E A;  3F2D A;  3VDY A;  2VB2 X;  5CMD A;  3N6R A;  4A3B G;  1C9O A;  4DXF A;  3OMG A;  1VQF A;  4PMB A;  5EPJ A;  3RLF A;  5HY6 A;  3HRZ C;  1VMP A;  2PI2 E;  2QA4 A;  2EYP A;  5HUR A;  3L9A X;  4ID6 A;  1EWI A;  1I5F A;  3GO5 A;  1HA5 A;  4EGV A;  5IOD A;  5IYC H;  2BCO A;  4ZK9 B;  4WJ3 M;  1K8M A;  2C35 B;  3GD7 A;  2Z4I A;  3RLO A;  1GUS A;  3KDF B;  4ZYS A;  4B3S L;  4B3T Q;  2CW0 D;  3P75 A;  4XYQ A;  1Q3L A;  4UP9 A;  1X32 A;  4QIW E;  2KHJ A;  4IZ8 A;  4ODG A;  1SNQ A;  1OXU A;  4BY7 B;  1ILP A;  3HKS A;  2EDG A;  2K5Q A;  3M85 A;  1QOH A;  3TS2 A;  4KHP L;  4B9W A;  1MJC A;  4K5X A;  1Y1W G;  1K0S A;  1HJP A;  5FO8 B;  5FKA C;  3GDE A;  3J81 c;  1VCI A;  5KIX A;  3EQL C;  5AFW A;  3UE1 A;  1OXT A;  4G7O C;  1V1Q A;  1K3R A;  3JC6 6;  1O7Y A;  4CKE A;  1TS2 A;  2GVB A;  4LF6 L;  1G2S A;  1QB5 D;  2B2V C;  2ZJQ A;  1PZJ D;  4MIU A;  1RF2 D;  3R2T A;  4DV7 Q;  5CV4 A;  4JCV E;  1OXX K;  1EZ8 A;  1BQQ T;  5KRU A;  2SNS A;  4HAE A;  2K01 A;  4IFD H;  4DNR B;  1RCV D;  1PH1 A;  4A3K H;  3M4Q A;  4DV1 L;  4CJ2 C;  3STB C;  4LF8 Q;  3Q22 A;  1X9N A;  1GOZ A;  1SAP A;  4C1N K;  1SJE D;  4IUN A;  5KYI A;  3S1R H;  2BE5 C;  4A3E G;  4B3M L;  5IYD G;  4WJW A;  1S5B D;  1V43 A;  1PFS A;  4CKC A;  4MNO A;  5IP7 H;  1NTG A;  4YIJ A;  3SHL A;  3CXC A;  4A75 A;  4KY6 A;  4JI7 L;  4JV5 L;  2M9V A;  1YJW A;  5DAU A;  2ZT9 C;  3FPU B;  2L0C A;  4OIJ A;  4FF2 A;  2ID0 A;  3KJP A;  4KD4 A;  2K05 A;  3A74 A;  1B70 B;  2E2H H;  1S72 A;  4P2C B;  1WD1 A;  1TS4 A;  3CAM A;  3ONA B;  3MAQ A;  2UUB L;  5C4Z A;  1EY5 A;  3QJY A;  1XNR Q;  3KBG A;  1MGS A;  4CHT B;  4HSP A;  5KGU A;  5M3M G;  3TP8 A;  5CYU A;  4J1M A;  3G7L A;  2UUC L;  2A68 C;  4HMI A;  3TRE A;  2JA6 G;  2A6H C;  3HS0 C;  4JI5 Q;  3AMU A;  2JK8 A;  3J7A V;  2UUA Q;  2JA9 A;  2JYO A;  1K3B C;  4L5T A;  3CC2 A;  1EYA A;  4JVZ A;  3D31 A;  1O7L A;  2SOB A;  1I6V C;  1S3O A;  4K5W A;  1CHP D;  3HFZ B;  4NKL A;  5E4W C;  5M5X B;  4C3I G;  1KDC A;  4C3H G;  3KF6 B;  3NE5 B;  1SYD A;  1TWC H;  2MJ8 A;  4B08 A;  4DR6 Q;  4HJ9 A;  1TY2 A;  3E6Z X;  4XT3 B;  3DM1 A;  3I73 A;  4ZQ3 A;  5IT9 L;  3Q0A A;  3I4N H;  1XPO A;  2PQA A;  3JAM L;  1HQR D;  3GTQ B;  2L55 A;  5FJ8 H;  4AYB G;  1STB A;  4RA8 A;  4DV0 Q;  4GNX B;  5D65 A;  1A2U A;  2EJM A;  4H13 C;  4A3I B;  2F0M A;  2JA6 H;  4RGT A;  3NPP A;  3CD6 A;  4I7Z C;  5M5W B;  5LMN L;  1F2M A;  4HID A;  5ELO A;  4DGZ A;  4DV2 Q;  4PNY A;  4BA2 I;  1WTW A;  3S15 H;  1WTX A;  3E9H A;  4RAU C;  1KLG D;  2CVR A;  1EOT A;  3HOZ H;  3CCR A;  3PIO 3;  4LFA L;  5ELC A;  5A35 A;  2EY5 A;  3R93 A;  4IPH A;  3SR1 A;  1RJT A;  2BH8 A;  3KJO A;  3B6Y A;  1BCP B;  4X6A H;  2XWB B;  1WTV A;  1KDA A;  1SYB A;  1LTB D;  2PNR C;  1O78 A;  1CM9 A;  2Z6B A;  4RGN A;  3J80 E;  2BDO A;  3J80 c;  3TN2 A;  5IGB A;  2KJX A;  1R9T H;  4IOA A;  3S15 B;  4CKB A;  4HED A;  2J7Z A;  1VQN A;  4A3L G;  1VQ7 A;  1WTH A;  3HOU B;  4A3K G;  2GN5 A;  2QDB A;  1YZ6 A;  2K03 A;  4OIK A;  4AH6 A;  4DR4 L;  5BN4 A;  5H1S E;  2YTX A;  2IX1 A;  3GTG B;  4CDF C;  5DNF A;  3S1M H;  4R4C A;  5EKI A;  4K14 A;  4NPS A;  3T56 B;  5GAE C;  1YHQ A;  3RUZ A;  1NSN S;  4HJ7 A;  1ICF B;  1YI2 A;  1VQI A;  2JJQ A;  1YIT A;  1MSH A;  3H94 A;  2R7Z B;  2I07 B;  1YNJ D;  3HOX H;  4A3L H;  1Y1W H;  1K0R A;  1EZ6 A;  2F0U A;  3FKI G;  1HNW Q;  1M1K C;  2VW9 A;  2FIN B;  5FO9 B;  3PO3 B;  3TME A;  2XTI A;  3R3O A;  4M8A A;  1OXS C;  3EBE A;  4A3C H;  4QMG A;  3A8I E;  4H7B A;  1A6X A;  5C4X B;  2DNC A;  1BUV T;  4RG1 A;  2XGT A;  1WD0 A;  1N32 L;  3I4M H;  2TSS A;  5JVH 3;  5DEH A;  4S3S A;  5T1G A;  2KQ3 A;  1SE2 A;  2ATW A;  1YNJ C;  4JI0 Q;  1WOC A;  2WB1 B;  3RZD B;  3FKI H;  4BBS G;  3UI2 A;  3D3R A;  1C0A A;  1JJC B;  1LAB A;  2EYH A;  5ISR A;  1GHJ A;  1YNN C;  1HFN A;  2N8N A;  1U9R A;  2QF7 A;  4X65 L;  1Z9F A;  1EFW A;  1B1Z A;  2Z0S A;  5CGK A;  4P74 A;  1SRU A;  1U4R A;  2UUC Q;  1TII D;  1B4O A;  3OIP A;  3X3N A;  5C5L A;  1I6H B;  2RHQ B;  4QQB X;  2B2W A;  3KBX A;  2A1A A;  3K5N A;  1A2T A;  1TU2 B;  5C44 H;  4DR1 L;  1SE3 A;  3RR5 A;  1YHB A;  5EQ0 A;  2E2H B;  4KI0 A;  2MO1 A;  3HKZ E;  2OXP A;  3E5S A;  4IPC A;  1XTD A;  4CDC C;  5GAH C;  2IY5 B;  4LUV A;  1PRT B;  4MTN A;  4IJH A;  5D3D A;  1HZA A;  5FO7 B;  3FVQ A;  4DV3 L;  1BO0 A;  1X3Q A;  1LTT D;  4DK1 A;  2NN6 I;  2OTJ A;  1D5Z C;  1VQL A;  4JK1 C;  3T1Y Q;  1F2Y A;  4HCE A;  1Z7T A;  3S16 H;  2E2I H;  2R93 B;  1G91 A;  4JI4 L;  3LGJ A;  1WTP A;  4YWL A;  2B2U A;  1KNA A;  1WTO A;  2AQ3 B;  1GHK A;  4IPG A;  2JSO A;  3F8T A;  1V9P A;  1JOO A;  1HXY D;  3OHX C;  1XWE A;  4DK3 C;  5KYL A;  3I4O A;  4EX5 A;  1Q8K A;  2Q8I B;  1QVF A;  1MJE A;  3UDX A;  2KCM A;  2XN9 C;  2BDN A;  5JJL A;  1K83 H;  3CCE A;  4J6H A;  1VQ8 A;  3PV0 A;  1XPR A;  3WDN A;  1D8L A;  1J8I A;  4BY7 G;  4IAL A;  3ERO A;  2IPK D;  1CUK A;  1Q1E A;  4GKJ Q;  4BWG B;  2CH4 A;  1ML0 D;  1ROD A;  3MA2 B; 
#chains in the Genus database with same CATH homology
 1Q8I A;  3K57 A;  3NTI A;  1SYE A;  3P7J A;  3OW7 A;  3CKI B;  2FMM A;  2GA4 B;  5E3F A;  2KEC A;  4KTA A;  3SK6 A;  5K36 G;  1GUG A;  1LT5 D;  2D2C C;  3VYU A;  3RD4 A;  2FJ2 A;  3NTK A;  2XRS D;  2QCP X;  3N52 A;  2VB3 X;  4XXE A;  2RDH A;  1I4R A;  3V05 A;  1AP0 A;  1BXT A;  3C2P A;  4KN4 C;  1DOM A;  2RDF A;  5CBA E;  5ELB A;  3TDQ A;  1AZQ A;  1PFB A;  1PTO D;  4H44 C;  2NTT A;  1ESR A;  2D9U A;  1X3P A;  1PZI D;  4IUQ A;  3M7N A;  3FMC A;  2Q8R E;  1A3V A;  2E76 C;  4OO1 H;  1PDQ A;  3DHQ A;  4HTH A;  2KHS A;  5IOC A;  3NBH A;  2WIN B;  2KCN A;  2M00 A;  1B53 A;  1O7Z A;  3GP7 A;  1ICW A;  1VMC A;  5CV9 A;  1CK1 A;  2EYF A;  5J22 A;  4IUT A;  1EQV A;  1AW7 A;  4RCN A;  1DM0 B;  1E2V A;  4CBV A;  1GJX A;  4OO1 G;  1AEX A;  3Q24 A;  2G9H D;  3OSO A;  1QCB D;  4B9X A;  4XTC S;  1TS5 A;  1TWG B;  4DAY A;  2N88 A;  4A3M B;  1HRJ A;  1JOR A;  2V4D A;  2X6L A;  1LTS D;  4QF4 A;  2BE5 D;  1STN A;  3D4D A;  4BA1 I;  3K5M A;  1V8Q A;  1GUN A;  3GQB A;  3H3V C;  5IGD A;  1IW7 C;  1GUW A;  1E2Z A;  4BS9 A;  4U68 A;  3BDL A;  1Z47 A;  2O5J C;  5C5M A;  1LTI D;  3AB9 A;  1W6K A;  4G57 A;  1S5C D;  5IGC A;  4FF3 A;  5CV5 A;  3MXU A;  1ZYR D;  5FK9 C;  3MXN A;  4HSV A;  2F4I A;  4XT1 B;  2A68 D;  1IKM A;  3F2U A;  3T16 A;  3NTH A;  1SEB D;  3A7A B;  4Z9C B;  1C4Q A;  1Y1V B;  2F03 A;  1BCP F;  2XSC A;  1R4P B;  3I8Z A;  4N9P A;  1PRT F;  1D1I A;  3KLS A;  3NQT A;  1CA5 A;  2Q8T A;  1Y8P B;  1D5M C;  1PTO H;  1STH A;  5C0X H;  1T5X D;  2MP1 A;  2Z4H A;  3HOY B;  4EQO A;  5JJZ A;  5LL6 S;  1QNU A;  3DMU A;  4AYB B;  1IHZ A;  5KEE A;  2L4N A;  5EGT A;  3VR4 A;  3T53 B;  3BG3 A;  3P1H A;  4IN3 A;  4LK1 C;  1RKN A;  3D4W A;  3LWU A;  4A3D B;  5JVG 3;  2PPB C;  5I4D A;  3M7G A;  3MHB A;  5I9O A;  5EJW A;  4K6L A;  2XVS A;  1A3U A;  1CFM A;  1CHQ D;  4Q0F A;  2CQA A;  1TVX A;  3SXH A;  5C3X A;  4K5V A;  3FKI B;  2E2I B;  3I70 A;  4QIW B;  4HN7 A;  3J81 L;  3V96 A;  2O5I C;  2NUC A;  4OHJ A;  2A69 C;  2K5D A;  2KEE A;  5JEA J;  2NVQ B;  4ME5 A;  1ILQ A;  3SEB A;  1TT2 A;  1H9R A;  1Y8O B;  3GTL B;  2F0W A;  2EYO A;  1BNZ A;  5FOB B;  1TY0 A;  4XYO A;  5G3L D;  5M5Y B;  2J4X A;  2NVX B;  5JPM C;  2MHV A;  3PUW A;  3KK7 A;  1G6Z A;  2R6G A;  1H9S A;  1SYG A;  4IFD J;  1F9R A;  2HQE A;  3NP8 A;  3Q23 A;  2PZT A;  2BOS A;  2ZXP A;  4HMJ A;  1FGB D;  4ZKC B;  1G8Z D;  4Q5V A;  1F9Q A;  3I4N B;  3S1M B;  1SE4 A;  2R3Z A;  3T51 B;  3TP6 A;  1EYC A;  3OWE B;  3H0G B;  2ENB A;  1DD2 A;  3CRL C;  3RMH A;  4IUP A;  1B50 A;  2D5D A;  4RGM A;  2FFK B;  2Y0S B;  1LTG D;  4LAA A;  3M4O B;  3VYT A;  4TRD A;  1NAP A;  2ICI A;  4RKL A;  4BY1 B;  4BBS B;  4C3J G;  2PW7 A;  4N9T A;  2DY7 A;  4RHS A;  3ITP A;  3Q6S A;  2RKS A;  4U67 3;  2F0H A;  4ZUI A;  1CZG A;  1NCV A;  1STY A;  1SNP A;  3BYT B;  5IT9 E;  1PTO F;  2QKI C;  2HCI A;  2F0O A;  2K33 A;  3BS1 A;  3P20 A;  1AZP A;  3GTP B;  1HUM A;  2NYZ D;  2EJG C;  2DN8 A;  2YU9 B;  2SEB D;  3J81 E;  3I72 A;  2R92 B;  4FXG C;  3A56 A;  3L3O C;  2VUM B;  3PUZ A;  3VR5 A;  5COR A;  5CC4 A;  3VR3 A;  1IW7 D;  2F0Q A;  3VA5 A;  4FYD A;  2RDG A;  4QUC A;  3J7Y W;  4PQX A;  4DA2 A;  4KKS A;  2L1B A;  5ELD A;  1A15 A;  1RTO A;  4V0B A;  1B3A A;  2WP8 J;  3J7A F;  4FF4 A;  3GTK B;  2G9D A;  1MD2 D;  1KTK A;  3HOW B;  3OIQ A;  3U9S A;  2C9O A;  2NN6 G;  4X3S A;  3S9W A;  2B63 B;  4MHE A;  4BBR B;  3FDT A;  3TP7 A;  3QO2 A;  4X3U A;  4KK7 A;  5DM6 3;  1CI3 M;  1EU4 A;  1T5E A;  4K2L A;  4F87 A;  2ZXR A;  1EL0 A;  3BZD B;  1JOK A;  1F2Z A;  1EEI D;  1LT3 D;  4A3J B;  1LT4 D;  5I6Y A;  5M3F B;  1FYC A;  2KVM A;  1NUC A;  4XQQ A;  1F2L A;  1CQV A;  3BVM A;  1LAC A;  1CT1 D;  3QIA A;  1S4Z A;  2K7V A;  5LL6 X;  2MGS A;  1ESF A;  2AQ2 B;  2DNE A;  4TSS A;  3FEW X;  3ZYY X;  5I9P A;  1HTL D;  5EBD A;  2NBF A;  3S14 B;  1PTO C;  4NW2 A;  5I2X A;  1LLR D;  1C48 A;  1PFN A;  1HTP A;  1L0Y B;  4ILW A;  1II3 A;  1D2B A;  4ULL A;  3MFG A;  5CV6 A;  4FF1 A;  1B2T A;  3PIP 3;  3T13 A;  1IL8 A;  2LKV A;  1PYW D;  4L6T B;  1CQF A;  2F0F A;  2L11 A;  5BN3 A;  1IYV A;  3EA6 A;  1V1P A;  1JC7 A;  3BDC A;  4KD3 A;  2RSO A;  1LTR D;  4GZY C;  3MC0 B;  2D62 A;  5DM7 3;  3VYR A;  3L7Z C;  3M4Y A;  1F9S A;  4DU9 A;  2F0G A;  2JP1 A;  3GV6 A;  2A6E D;  2WAC A;  2KCC A;  1GXD C;  4A3K B;  1B9N A;  2AWO A;  1EWH A;  5C0X G;  1V1P B;  1CZW A;  1JB3 A;  5E4X A;  5C0X J;  2O2L D;  2CW0 C;  1I4X A;  2BA0 A;  1K83 B;  3J80 L;  4IUV A;  4MN3 A;  1PRT C;  5K5P A;  2FMC A;  2A6E C;  2L9H A;  4RWS C;  3MWY W;  3EVQ A;  1QWY A;  1CTM A;  4EVO A;  3IKJ A;  3NSW A;  5ELF A;  1EIG A;  3PMF A;  1STG A;  4KV6 A;  2JA8 B;  2PZU A;  4F8M A;  1JR0 D;  3K58 A;  1JQY D;  2VNU D;  3HOZ B;  2E2D C;  5C4J B;  1IKL A;  3DWP A;  2HUG A;  1RHP A;  4RFB A;  2EY6 A;  1J9O A;  4KKU A;  3S1R B;  1XYI A;  4X3T A;  2F0I A;  2AUK A;  5M3M B;  3M3Y B;  1SNC A;  3DUZ A;  4G7H C;  3IFD A;  3S16 B;  2F0S A;  1TQO A;  3FRP B;  4HCS A;  1OXV A;  1VF7 A;  2E75 C;  1SSO A;  3S1N B;  2B2T A;  4PMC A;  1SXT A;  1UEA B;  3CQZ B;  3IL8 A;  4ABN A;  2PO4 A;  4UAI A;  4DN4 M;  2F0L A;  2PYK A;  2A6H D;  2EYJ A;  4KMU C;  1UNS A;  4J8Q A;  4R9W A;  3LWE A;  4O42 A;  1QG7 A;  4O1N A;  3HOV B;  1AN8 A;  1MI2 A;  3K6O A;  3QB3 A;  4DAV A;  1SMY C;  2IW3 A;  2WKD A;  4A3F B;  3ND8 A;  1K8O A;  1PXU A;  2JXM B;  4A3B B;  5TSS A;  2PW5 A;  1LTA D;  1ENC A;  4WFN 3;  5EPK A;  1SNM A;  4NMZ A;  1WTQ A;  2KED A;  4Y7N B;  3HKZ B;  1U4L A;  4H0L C;  1FR3 A;  1ENF A;  3QOL A;  2M2L A;  2MUY A;  4DAP A;  2WKC A;  1V1O A;  5CV8 A;  2KOL A;  1TWF B;  4DFA A;  4L63 B;  1MSG A;  4M1U B;  3TSS A;  1DON A;  3SE0 A;  1ONL A;  1BBX C;  5A2Q L;  5BN5 A;  2X69 A;  3EJI A;  3QG1 A;  1ZKO A;  1KLU D;  3DWQ A;  1RTN A;  2TMP A;  4C1N I;  5COY A;  1Y1W B;  1PTO B;  5IGE A;  2F0T A;  1H9J A;  3A54 A;  4RH6 A;  3MZ5 A;  1ET6 A;  2B2Y A;  1BF4 A;  4KY7 A;  3DEP A;  1I50 B;  4DNT B;  3NWS A;  3E0J A;  2QEJ C;  4V19 0;  1KNE A;  1B44 D;  3VR6 A;  2JE6 I;  2F0K A;  1Q90 A;  4NP5 A;  3G6J B;  1I4H A;  5C6A A;  2R61 A;  5C3E B;  3K0Y A;  1GUO A;  1CA6 A;  2AUJ D;  2N55 A;  1Q12 A;  2AQ1 B;  1C8C A;  5JPN C;  4C3I B;  1GUT A;  1ET9 A;  3EFX D;  1LV9 A;  2K28 A;  1QJO A;  2AWN A;  4L8J A;  3U9O A;  3HGB A;  1OO9 B;  1F9P A;  4K2K A;  5EBC A;  2F0P A;  2XIW A;  3HP3 A;  2E74 C;  3MTS A;  5CBE E;  2NZ1 D;  3C1F A;  1TS3 A;  1MBY A;  3SVM A;  4KY5 A;  1RD9 D;  3HEJ A;  3VA7 A;  5IGG A;  1D1K A;  2CHB D;  1FD7 D;  2RVL A;  1DOL A;  3OMC A;  2JEB I;  1EY8 A;  2JEA I;  1ENA A;  4A3E B;  4QCL A;  2NVT B;  1EY9 A;  1S5F D;  3H6M A;  2K04 A;  3R2I A;  3K59 A;  2IJ0 A;  3SK5 A;  5JEA G;  3SDZ A;  1HUN A;  3H09 A;  5J39 A;  5LHY 1;  5CR3 A;  1XTC D;  5NUC A;  1JE4 A;  4C56 C;  2RBM A;  2IT1 A;  1JWM D;  3R8B A;  2OEO A;  3KLR A;  3BYY B;  4G7Z C;  3D8G A;  3D6C A;  2EXZ A;  4A93 B;  3I4L A;  3H91 A;  3FPP A;  1JCK B;  4HR7 B;  1L0X B;  4KHV A;  2PCF B;  5I6W A;  1DZ1 A;  2KUM A;  2SDF A;  5IIF A;  1HFG A;  2PQE A;  1JOQ A;  2DY8 A;  1QIL A;  2NVY B;  3K7A B;  1XX8 A;  3KLS X;  4OGQ C;  3OOC A;  2JA5 B;  1H9M A;  3S2D B;  5FLX E;  1SMY D;  3NXW A;  1PRT D;  1KDB A;  4FVM A;  4FXK C;  3D6W A;  4DXG A;  3X3M A;  1EWC A;  3NBI A;  2EE1 A;  1TWH B;  1PFM A;  4ZUJ A;  5KND A;  4ZRZ A;  4FXD A;  1G29 1;  3GTM B;  2BA1 A;  5EPL A;  5CV7 A;  2ICE C;  4C3J B;  3MXP A;  1DCZ A;  4RKB A;  5C44 B;  1JWS D;  2NWG A;  3C1E A;  5C4H A;  4I65 A;  1TWC B;  1FNU A;  4XQN A;  2SNM A;  3I3C A;  1I4P A;  2PMZ B;  3S2H B;  1EIH A;  1SND A;  2I46 A;  2KA7 A;  5M9O A;  1EQT A;  1S5D D;  4WOR A;  1EFI D;  4CGY B;  1A3T A;  1SYF A;  1D5X C;  1KAA A;  2B8G A;  3VR2 A;  1BCP C;  1F77 A;  3W3A A;  3ND9 A;  2F0E A;  2F0V A;  3K5L A;  4JBW A;  1HPC A;  1TR5 A;  3SK4 A;  4FO2 A;  1WCM B;  1D6E C;  3ERQ A;  2J0T D;  3JAM E;  4R8I A;  1DYQ A;  3I4M B;  3NQI A;  2HCC A;  3S17 B;  1DJR D;  4RCO A;  2EY1 A;  1BCP D;  2A73 B;  2OF1 A;  3MEH A;  2XWJ B;  4F7X A;  2JA7 B;  4PV1 C;  5I2Y A;  2EYM A;  1QNK A;  2IX3 A;  4TQU S;  4ZLT F;  2EJF C;  5FLX L;  4WRD A;  2IX0 A;  2PZW A;  4G4K A;  4ZAI A;  3DXJ C;  2B39 A;  4TKO B;  1STA A;  4XQJ A;  2YYZ A;  3K5O A;  3QWN A;  3GV3 A;  1EYD A;  4A3G B;  1AFP A;  2JA6 B;  3D4R A;  2O4X A;  2NB0 A;  5JEA H;  4KN7 C;  1SNO A;  1PZK D;  1ZXT A;  3CHB D;  5E1F A;  3WOF A;  2EVB A;  1DXM A;  5HGT A;  2NN6 H;  1SBB B;  4CJ1 B;  5T1I A;  1Y69 U;  1TKW B;  1M8A A;  2B2W C;  3CRK C;  2F1M A;  1UUP A;  3RZO B;  5D14 A;  3W2D A;  3LX0 A;  4ZKB B;  4C2M B;  4UDU C;  1R9T B;  1EY4 A;  4E6I A;  4QB4 A;  2EYL A;  3NHH A;  2A74 C;  1NR4 A;  2XNA C;  3V2T A;  1BDO A;  2F3W A;  1R4Q B;  3NUC A;  1ZEQ X;  3I91 A;  3MFY A;  2HDL A;  4IQZ A;  3C46 A;  3DWA A;  2QIL A;  2EZV A;  3S1Q B;  1JWU D;  2EY2 A;  3GTO B;  2WAQ B;  3IAY A;  4IUR A;  2LY7 A;  2WII B;  2A5H A;  3DEO A;  1LO5 D;  3KUP A;  4KHZ A;  1DOK A;  2Z8L A;  2L5T A;  4FP5 D;  3URY A;  4IFD I;  1HQM C;  3A55 A;  1XXG A;  2K1B A;  1BOS A;  3CU7 A;  1U4P A;  5J1Z A;  3C3L A;  1EY6 A;  4K6D A;  3PO2 B;  2B2V A;  4K8I A;  3I90 A;  2Z1C A;  1SDF A;  3MXG A;  3HG9 A;  1SJH D;  1SYC A;  2K6A A;  2IL8 A;  4OL7 A;  5G3L F;  3WOE A;  1NR2 A;  1FNV A;  1Z6H A;  1H9K A;  3A7L A;  1ZYR C;  3TZD A;  2EOT A;  1WTR A;  2F0J A;  4OO1 I;  2NTS A;  2LFN A;  2X6G A;  4KJN A;  1EY0 A;  3OWF A;  2WV6 D;  1PMR A;  2B8F A;  1HA6 A;  1YNN D;  5KNB A;  5JAV A;  3O13 A;  4DK0 A;  4C3H B;  1EEF D;  4LMQ D;  2F0N A;  1LT6 D;  3MVV A;  3TBI B;  4PMW A;  1STE A;  2H4O A;  3PUY A;  2VXW A;  3TP5 A;  2MPM A;  1EY7 A;  3TZU A;  4EQP A;  4EQN A;  4DF7 A;  1HCZ A;  1VF5 C;  5ELE A;  4NDX A;  3HOX B;  1HHV A;  4KJO A;  1UAP A;  2F3V A;  3LNN A;  4CJ0 B;  1EU3 A;  3BVZ A;  1U4M A;  1FNW A;  1WVL A;  1SFO B;  1RDP D;  4XIG S;  5IGF A;  5K36 H;  2B2T C;  3OPO A;  3BVG A;  1TWA B;  5F2D A;  1E2W A;  2EPB A;  2ZXO A;  3KF8 A;  3IFT A;  4RGO S;  3A8J E;  4RHR A;  4IUU A;  3PUX A;  1I3Q B;  2F0D A;  2FHT A;  1M4V A;  3PUV A;  1PLF A;  5D3I B;  1H9S B;  3NWT A;  2XRQ D;  1I4Q A;  1B9M A;  1E0B A;  3T4A C;  1O80 A;  5JOB A;  3NK9 A;  1Y8N B;  4QUF A;  2C5C A;  2L12 A;  2RA4 A;  4X3K A;  4FNF A;  2A69 D;  2HDM A;  3HZX A;  3QOJ A;  4K8J A;  5EKK A;  3VYS A;  4LJZ C;  2B2U C;  3A8K E;  3GTJ B;  1QE6 A;  1Q1B A;  4IFD G;  5C0X I;  2LMC B;  5A2Q E;  2K32 A;  3BDO A;  4F88 A;  2K5W A;  1JIC A;  5KNC A;  4R8N A;  1W6J A;  4KKT A;  1G2T A;  1S5E D;  1I4G A;  3SK8 A;  1KAB A;  1BR9 A;  2B2Y C;  4XDX A;  3AU7 A;  2RQX A;  2RSN A;  2E2J B;  2IWH A;  2OT2 A;  5C3W A;  1IYU A;  1VDZ A;  2LS0 1;  5EKL A;  2H1E A;  2VB2 X;  5CMD A;  3N6R A;  4DXF A;  3OMG A;  4PMB A;  5EPJ A;  3RLF A;  3HRZ C;  1VMP A;  2EYP A;  5HUR A;  3L9A X;  4ID6 A;  3GO5 A;  1HA5 A;  4EGV A;  5IOD A;  2BCO A;  4ZK9 B;  1K8M A;  3GD7 A;  2Z4I A;  1GUS A;  4ZYS A;  2CW0 D;  3P75 A;  4XYQ A;  1Q3L A;  1X32 A;  4ODG A;  4IZ8 A;  1SNQ A;  1OXU A;  4BY7 B;  1ILP A;  2EDG A;  2K5Q A;  3M85 A;  1QOH A;  4B9W A;  4K5X A;  5FO8 B;  5FKA C;  1VCI A;  5KIX A;  3EQL C;  5AFW A;  1OXT A;  4G7O C;  1O7Y A;  4CKE A;  1TS2 A;  1G2S A;  1QB5 D;  2B2V C;  1PZJ D;  4MIU A;  1RF2 D;  3R2T A;  5CV4 A;  1OXX K;  1EZ8 A;  1BQQ T;  5KRU A;  2SNS A;  4HAE A;  2K01 A;  4IFD H;  4DNR B;  1RCV D;  4CJ2 C;  3Q22 A;  1GOZ A;  1SAP A;  4C1N K;  1SJE D;  4IUN A;  5KYI A;  2BE5 C;  4WJW A;  1S5B D;  1V43 A;  4CKC A;  4YIJ A;  3SHL A;  4KY6 A;  2M9V A;  5DAU A;  2ZT9 C;  3FPU B;  2L0C A;  4OIJ A;  4FF2 A;  2ID0 A;  4KD4 A;  2K05 A;  4P2C B;  1WD1 A;  1TS4 A;  3ONA B;  3MAQ A;  5C4Z A;  1EY5 A;  3QJY A;  3KBG A;  1MGS A;  4CHT B;  4HSP A;  5KGU A;  3TP8 A;  5CYU A;  4J1M A;  3G7L A;  2A68 C;  4HMI A;  2A6H C;  3HS0 C;  3AMU A;  3J7A V;  2JYO A;  1EYA A;  3D31 A;  1O7L A;  2SOB A;  1I6V C;  1CHP D;  4K5W A;  4NKL A;  5E4W C;  5M5X B;  4C3I G;  1KDC A;  4C3H G;  3NE5 B;  1SYD A;  2MJ8 A;  4B08 A;  1TY2 A;  3E6Z X;  4XT3 B;  3DM1 A;  3I73 A;  4ZQ3 A;  5IT9 L;  3Q0A A;  3JAM L;  1HQR D;  3GTQ B;  2L55 A;  1STB A;  4RA8 A;  5D65 A;  1A2U A;  2EJM A;  4H13 C;  4A3I B;  2F0M A;  4RGT A;  3NPP A;  4I7Z C;  5M5W B;  1F2M A;  4DGZ A;  4PNY A;  4BA2 I;  1WTW A;  1WTX A;  4RAU C;  1KLG D;  2CVR A;  1EOT A;  3PIO 3;  5ELC A;  5A35 A;  2EY5 A;  3R93 A;  3SR1 A;  1RJT A;  1BCP B;  2XWB B;  1WTV A;  1KDA A;  1SYB A;  1LTB D;  2PNR C;  1O78 A;  1CM9 A;  4RGN A;  3J80 E;  2BDO A;  3TN2 A;  5IGB A;  2KJX A;  3S15 B;  4CKB A;  4HED A;  2J7Z A;  3HOU B;  2QDB A;  2K03 A;  4OIK A;  5BN4 A;  2IX1 A;  3GTG B;  5DNF A;  5EKI A;  4K14 A;  3T56 B;  3RUZ A;  1NSN S;  1MSH A;  3H94 A;  2R7Z B;  2I07 B;  1YNJ D;  1EZ6 A;  2F0U A;  2FIN B;  5FO9 B;  3PO3 B;  3TME A;  3R3O A;  4M8A A;  1OXS C;  4QMG A;  3A8I E;  4H7B A;  1A6X A;  5C4X B;  2DNC A;  1BUV T;  1WD0 A;  2TSS A;  5JVH 3;  5DEH A;  4S3S A;  5T1G A;  2KQ3 A;  1SE2 A;  1YNJ C;  2WB1 B;  3RZD B;  3UI2 A;  3D3R A;  1LAB A;  2EYH A;  5ISR A;  1GHJ A;  1YNN C;  1HFN A;  1U9R A;  2QF7 A;  1B1Z A;  5CGK A;  1U4R A;  1TII D;  1B4O A;  3OIP A;  3X3N A;  5C5L A;  1I6H B;  2B2W A;  3KBX A;  3K5N A;  1A2T A;  1TU2 B;  1SE3 A;  5EQ0 A;  2E2H B;  4KI0 A;  2OXP A;  3E5S A;  1PRT B;  5D3D A;  5FO7 B;  3FVQ A;  1BO0 A;  1X3Q A;  1LTT D;  4DK1 A;  2NN6 I;  1D5Z C;  4JK1 C;  1F2Y A;  4HCE A;  1Z7T A;  2R93 B;  1G91 A;  1WTP A;  2B2U A;  1KNA A;  1WTO A;  2AQ3 B;  1GHK A;  2JSO A;  1JOO A;  1HXY D;  3OHX C;  1XWE A;  5KYL A;  2Q8I B;  2XN9 C;  2BDN A;  4J6H A;  3PV0 A;  3WDN A;  1J8I A;  4IAL A;  3ERO A;  2IPK D;  1Q1E A;  4BWG B;  1ML0 D;  1ROD A;  3MA2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...