1VNDA

Vnd/nk-2 protein (homeodomain), nmr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
77
structure length
77
Chain Sequence
ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional solution structure of the NK-2 homeodomain from Drosophila.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
molecule keywords VND/NK-2 PROTEIN
total genus 15
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1996-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1vndA00
3IH2A 2X6OA 1JT0A 2IEKA 4B1RA 3TW6A 1IC8A 1I6HJ 1TWGJ 2KDZA 3QPSA 2JA7J 3K7AJ 1ETKA 5C3EJ 2TCTA 4JP0A 2ID6A 2P81A 1MBJA 2HXOA 3BR6A 1MH3A 5M5YJ 3ZQIA 3A03A 4UUSA 1CQTA 3A01A 4V2GA 3ZQLA 1H89C 2ECBA 1NK3P 2COBA 2WV1A 2WAQN 1GV5A 2R5YA 1T56A 4DYRA 3UKGA 1Z77A 1W0UA 1NK2P 3RZDJ 3DEWA 1QRYA 5EZHA 4A3CJ 3B6AA 3S15J 2YU9J 4A3EJ 2LD5A 2E1OA 1A5JA 1GT0C 5K7ZA 5M3MJ 1OFCX 3GTLJ 1ZK8A 2G0EA 1BW5A 1GDTA 3H0GJ 2ME0A 4W1UA 1IJWC 1H8AC 1B72A 2OF7A 1UG2A 4IEJA 5EYRA 5F27A 2WB1N 2DA7A 4NDLA 3MN2A 4C2MJ 3ZOBA 2XRLA 1K61A 2XGEA 3DCFA 5F0FA 1MBEA 3L1PA 2N8GA 4S0HB 2R0QC 3BTJA 1FEXA 3BR5A 1RPWA 5JLXA 1SFOJ 3TEDA 1TC3C 1HF0A 1ETVA 3BR0A 1IG7A 3Q3SA 4AUXA 2D5VA 4X6AJ 2CQXA 5DS9A 3CCYA 2HYJA 3JRCA 1APLC 4IHVA 5EGOB 4MO7A 3M4OJ 1VNDA 3CQZJ 1XC5A 4AC0A 3GTOJ 2ME6A 4B3AA 2K9SA 1MSEC 2ECCA 4C3IJ 2GM4A 4XRSG 1AHDP 4UUTA 3B6CA 1ETWA 1WGXA 3A02A 2E19A 4QIWN 4DYQA 1UMQA 1ETYA 1I3QJ 2Y9YA 2YS9A 4MLOA 3BR1A 2EZLA 2IAIA 2HOSA 4D5FA 5F0CA 3PO2J 1VI0A 3HOZJ 3I4NJ 3QPLA 1ZKGA 1RESA 5EF6A 3HGYA 3OSFA 5JLWA 5F04A 1B8IB 3GTPJ 1Y1WJ 5FLVA 4XK4A 9ANTA 3GTQJ 3S1RJ 4DYCA 1AKHA 1MH4A 5E3OA 4FTHA 1FTZA 4D5CA 2CRGA 1O4XA 2L7FP 4IHWA 2NVQJ 5M5XJ 1TWAJ 5EEAA 4EEFG 4A3DJ 1OCPA 2DA1A 1B8IA 3W6VA 4A3GJ 3BQZA 1JKRC 3FISA 1LFUP 1JJ6C 1EF4A 4J19A 3BT9A 3TP0A 4X1EA 2NVYJ 4DZPA 4A3MJ 1AKHB 4DZJA 2MGQA 3Q0UA 4DW6A 4I76A 2Y9ZA 1BW6A 3K2AA 1JUPA 2DN0A 2VPRA 4M3EA 3PO3J 3FK7A 1GV2A 1JUSA 3Q0WA 2EZHA 1FTTA 2ID3A 2HDDA 2LY9A 1X2MA 1IDYA 5J1RA 1MBGA 1WI3A 2EH3A 2HOAA 1AU7A 1Q1VA 5E3LA 4A3IJ 3BG5A 5IP9J 1DU0A 4L5EA 2KT0A 3ZQGA 1D5YA 1XS9A 1LFBA 5GPAA 4MFEA 2LTPA 2HOTA 2OPTA 1IRZA 2NVXJ 4XIDA 3ZQCA 1IV6A 2NOGA 1JKQC 3JRGA 1JTXA 2K9QA 4D7MA 3OSGA 1Z0XA 2CQQA 2DMTA 2DMUA 1W0TA 4M3GA 1MBKA 3S14J 3CDLA 5IYCJ 3IH3A 2H1KA 1A6IA 2CUFA 4BKXA 2AO9A 3Q0VA 4D7NA 1E3OC 4V2FA 3BG9A 4A69C 1X58A 3F0CA 1F43A 4RBOA 2Y30A 1OCTC 2JWTA 4XRMA 3ZQHA 2M8GX 2FD5A 4M3FA 3WHBA 1ENHA 2W48A 1RR7A 5EGOA 2O8KA 1S7EA 2LK2A 3O8HA 3OOUA 5FKMA 5F0HA 1YRNB 2LKXA 3GTMJ 4MIMA 1JGGA 5FKLA 3HKZN 2E2JJ 3S2HJ 1TWHJ 3S16J 4M6VA 3HB9A 2M34A 2R7ZJ 4A3LJ 1GVDA 2L7MP 3LNQA 3OIOA 2DMQA 3LSJA 3FK6A 2EBIA 2VI6A 4FE7A 5EG0A 1WPKA 2IBDA 3A01B 1JKPC 3NAUA 2MW8A 2XGCA 2O7OA 2CJJA 2R93J 2VKVA 1BL0A 1Y1VJ 5E3MA 2EZKA 3M3YJ 2AHQA 4RDUA 1PUFA 4BXXJ 3HOWJ 1MBHA 3FIWA 3HGGA 1HCRA 1QVTA 5IYDJ 2PMZN 3VPRA 4BY1J 3S1NJ 2LVSA 2E2HJ 3IV5A 2R5YB 5EG0B 2H8RA 1ZTRA 3BTCA 5K7HA 2YUSA 4Y52J 1XG1A 2HXIA 4CYCB 4C3JJ 1PUFB 1JT6A 4CYCA 1TWFJ 2R92J 3MKLA 2Y31A 4GFBA 1TWCJ 3CMYA 4W97A 2VKEA 4XRSA 3GTJJ 2I10A 2XB5A 5FKNA 3G1OA 1LE8A 2XPUA 3H3VK 5IP7J 3G1LA 3GTGJ 1ZR2A 2O9LA 3TW7A 1MSFC 2ZB9A 1HDDC 2DA6A 5GP9A 3JRHA 3MVPA 1JJ8C 1HLVA 4HNVA 1ZGWA 3S17J 5HODA 3HEFA 2DA3A 1VF9A 1U8BA 3BR3A 1ETOA 3ZQFA 2LLKA 4B4CA 4JX6A 4JX5A 2VUMJ 4JX4A 5EZGA 5EDNA 4A3FJ 3JR9A 4XICA 2K9NA 5FKKA 2L0KA 2X9DA 3HOVJ 4FE4A 2L7ZA 1U78A 2RAEA 3S1QJ 5E3NA 4AYBN 2DA5A 2LR8A 2X48A 1ITYA 3HDDA 1ORKA 5K7FA 4I6ZA 1IDZA 5FKOA 5M5WJ 1T33A 3E7LA 3HM5A 1R9TJ 3RQIA 2NS8A 5F08A 1FIAA 5C4JJ 3HOYJ 5IOYA 2DMNA 3TP3A 1G2HA 1X2NA 1K83J 1WH7A 1JTYA 1OJLA 3LSGA 3BTIA 1GUUA 1P7IA 2TRTA 3G1MA 4LOCA 4A3BJ 3SDGA 5C44J 5FJ8J 2L9RA 4A3KJ 5DTDA 3JRFA 2DA2A 2M0CA 3RKQA 4BY7J 1QPIA 2JJ7A 4C3HJ 1WH5A 3FKIJ 1ZQ3P 1VFCA 3BTLA 2DJNA 2DA4A 2XGDA 1I50J 5GPCA 1HOMA 3GBGA 3JREA 2JA5J 2M9HA 4UUSB 5M3FJ 3SJMA 3IH4A 2JA6J 5IYBJ 3S2DJ 1BA5A 3NARA 3JRBA 1ETQA 3BQYA 3JRDA 1DU6A 1FJLA 1FIPA 5C4XJ 2JN6A 4A3JJ 2LP0A 1U9OA 2XPWA 5J3LA 4M3DA 1U9NA 3JRIA 4A93J 2R5ZA 1JUMA 2QCOA 4M3BA 2R5ZB 1F36A 3LSRA 2DTZA 2JK3A 1POGA 2NS7A 2MSYA 4BBSJ 4JYKA 1NTCA 1RKTA 1RETA 4MFDA 3SFIA 4QSHA 3BG3A 5IP6A 1BJZA 5IOZA 1H88C 3LSPA 2JMWA 2EQRA 2EZIA 4IHYA 1B72B 2LFBA 2DMPA 2NVTJ 2FQ4A 1RKWA 3QQAA 4Y7NJ 3GTKJ 1QVUA 1ZR4A 5J1YA 4QTRA 3S1MJ 3C2BA 1MNMC 1HDPA 2XB0X 2QF7A 3HOUJ 4IHXA 4FISA 4ABZA 2FX0A 1ETXA 2CU7A 4BBRJ 2B63J 2E2IJ 5FLMJ 2HI3A 2Y2ZA 3O8GA 2ELKA 2MG4A 3D1NI 1MBFA 3PM1A 2M2EA 3LOCA 4FCYA 3WHCA 2HQ5A 5IPAA 1IUFA 2JA8J 5J1UA 4G12A 1P7JA 1SANA 1LE8B 1JKOC 2GBYA 2K40A 2FJ1A 2XPVA 2Y0SN 3RZOJ 1IGNA 2XSDC 3I4MJ 1WCMJ 3HBLA 5F1JA 3BR2A 5BNGA 1YRNA 3HOXJ 2GLOA 1UHSA 2CUEA 3JRAA
chains in the Genus database with same CATH superfamily
4ESBA 4FX0A 5L3EA 3IH2A 2OTJI 1JT0A 3OYJA 4B1RA 3MD2A 2L5QA 4JOMA 2ZNYA 3K9TA 2HQAA 3WE2A 5FRNA 2AQEA 3BJ6A 3QP5A 1K78B 1ETKA 4B44A 1VZ0A 2TCTA 4RA2A 3HPGA 1MBJA 2BHZA 1MH3A 1IXCA 4ZYDA 5F64A 2QZ8A 1OISA 1LDDA 3A03A 5B3SH 3H5NA 2L02A 4BJ5C 1VQMI 4V2GA 4IQ4A 1TTYA 4AD9A 3CESA 1NK3P 2COBA 2LG4A 2WAQN 3M7GA 3PIPF 1R5GA 1TP4A 2R5YA 4XMYA 1ZG5A 4IHSA 4BEHA 3UKGA 2DPDA 3VYUB 4NC7A 1CF7A 3B6AA 1FOKA 3MCZA 4A3EJ 2GAUA 2E1OA 3SZTA 1KZHA 1OFCX 1OCRH 2G0EA 3GEZA 4ENKA 3GTLJ 1BW5A 1GDTA 2M7AA 5KAIC 1XPXA 5CVVA 2P5KA 3KYDB 3J7YJ 3CC4I 1H8AC 2CFOA 1YS7A 3OL3A 2VN2A 4Y17A 5BMZA 1SFXA 4C2MJ 2ZXWH 1OR7C 4Z6YA 2UV1A 1MBEA 5TISC 3CF5F 5AIPA 3B73A 3TEDA 3BR0A 3Q3SA 2X6YA 3M8JA 4PSXA 1W4MA 4MO7A 1VNDA 4HV5A 1XC5A 4PGGA 3RDIA 2K9SA 1XB4A 3C18A 4PSWA 4UUTA 3OYDA 2W24A 3A02A 2VJ4A 3DFGA 3LA3A 2E19A 4KIFA 4BQNA 1N25A 2YS9A 4B8XA 1X1CA 4DGWB 3PO2J 1FP1D 3H3UA 3ECOA 2ZSHB 2HVSA 1YHQI 3OSFA 1FY7A 2Q2EA 5JLWA 5FO5A 2NOJB 1O7FA 3OMYA 1R1TA 3KYCB 2F5VA 3QODA 4XK4A 1J09A 5HLTA 5E3OA 4FTHA 4F93B 1U2WA 4ZYAA 3ULQB 1X1DA 5D6FA 1TT5B 5M5XJ 1ZGAA 3MKYB 2XAGA 4HNTA 4A3DJ 4RS8A 2PX9A 4YFNF 3BQZA 4E7KA 2E34A 3FISA 2CV1A 2O0YA 4J19A 3BT9A 3TP0A 4OIQF 1F1ZA 3F8MA 2TDXA 4DZJA 5L3CA 4DW6A 2IT0A 3J80Z 4HF2A 3K2AA 5AIQA 1JI8A 3DV8A 4NC8A 1DUXC 1PDNC 2L4MA 2EB7A 2FQ3A 3BZCA 1KU9A 4OIRF 2IGKA 2XROA 4G6TB 2EZHA 1DDNA 5L3DA 3QYBA 4XL9A 2CUZA 2LY9A 3RJPA 1RUOA 4Y3OA 1WI3A 2EH3A 3CP2A 2XGXA 2WA0A 1Q1VA 1B9MA 4OOIA 4A3IJ 2EIJH 5CVRA 3BG5A 4IRGA 2HQNA 4L5EA 3KETA 2GZWA 1U8RA 4L9NA 4FT8A 4ZJZA 1XS9A 1ZG1A 4G94A 1HA8A 2DYRH 5GPAA 4MFEA 3I58A 4UV8A 3G2BA 1YOVB 5LRSA 3DPUA 2H27A 1IRZA 2NVXJ 2Y0SA 3FXQA 1VQNI 1W5TA 1IN8A 4LFUA 5JVGF 1KYWA 2D1HA 3BG7A 1KA8A 3K1MA 4WXDA 2VONA 1A6QA 3LFKA 4XNFA 5H20A 3PUFA 1FBSA 1W36D 2P6SA 2K9QA 2A69F 1VQKI 1FMVA 5JHFA 1T08B 1OCOH 2DMUA 4LLLA 1YFHA 2FEZA 4GRIA 3RYPA 3IH3A 4HG2A 1QNTA 2K27A 4FX4A 2AO9A 3Q0VA 3W2WA 5DCFA 1M1EB 4HW0A 4EGZA 3F0CA 1WRJA 1XSVA 4RBOA 3TMOA 2Y30A 2PJRA 5HNFA 4E70A 2XSJC 5ERIA 2FOKA 3ZQHA 3I55I 2ZJRF 2GXAA 3I0TA 3WHBA 4Y13A 3OYHA 1QA6A 1ENHA 2R7QA 3IRQA 2O8KA 3BZKA 1S7EA 2G7HA 2VIXA 1U0JA 3I71A 3A0BC 3O8HA 3RKYA 1ZRDA 1YRNB 1XSDA 2P7VB 4XSXF 1Y39A 5FKLA 3L2QA 2E1CA 2G7UA 3QWLA 2L7KA 1Z3YA 3KPHA 3HB9A 2B9SA 4A3LJ 2I5UA 4B09A 1BIAA 2DMQA 2EBIA 3LQRA 1F9NA 2XAHA 3O3KA 4LIUA 3E5QA 4NC6A 2BY1A 2OZ6A 2WC2A 2KIMA 2ZXJA 5D6EA 2JRMA 2K7LA 3ZP5A 3WTSC 3R0AA 2R93J 2MLGA 2V1XA 1I3AA 3FMQA 2AHQA 4BXXJ 2F4MB 3M8FA 5IYDJ 2PMZN 4BY1J 2LVSA 2E2HJ 3CMMA 3ELKA 4BUPA 5EG0B 2ACJA 3KEYA 5KK1A 5LFAA 1ZTRA 4QPQA 1IN6A 2QKMB 2NRAC 3T8TA 2V9PA 3FXUA 2A05A 4CCLA 4G9YA 4LITA 1O7LA 2QYOA 3HC7A 1TWFJ 2XF5A 3BROA 1E17A 1SFEA 3ZMZA 3MKLA 1HC8A 1EH8A 2PI0A 5F1RA 3GWZA 3DKWA 1BN5A 1Z7UA 2LREA 3TO9A 3RPQA 3PL8A 2Y48A 1ZGJA 2XB5A 5ICCA 3E0JB 3W2AA 5CQGA 3GFJA 1D1CA 3GTGJ 4PUSA 2XF6A 1MSFC 3VB2A 2ZB9A 1XCBA 1EJ9A 3E1SA 4A5MA 1JJ8C 2RV8A 3D5RC 3M07A 4RAGA 1HLVA 1I1SA 3ZGKA 2GXBA 4XLHA 1IW7F 4N4OB 2V6EA 3LA7A 4B3XA 2FUG2 2MABA 5K5OA 3P9IA 3ZQFA 2MD0A 4JX6A 1IUYA 5HS7A 3AG1H 2EFNA 1YX3A 3QU3A 1K4SA 4YFXF 5FKKA 4UUVA 3OS2A 1WJAA 4KA4A 1ZRFA 2X9DA 2H6BA 1IN5A 2IGNA 4AU7A 1J0RA 1U78A 3S1QJ 2CYYA 4KMUX 3KFWX 4YFKF 5E3NA 1YS6A 2VKDA 3GF2A 1F5TA 3CCRI 3CMEI 5K7FA 1TW2A 2KP6A 2RC4A 3KZZA 1IDZA 3ZR8X 4JBAA 1G3YA 1P4WA 1BJAA 4B43A 3E7LA 4M9XA 4OINF 3GYHX 3HM5A 1R9TJ 2UWMA 1GVJA 2DU9A 3K2ZA 3F8NA 5C4JJ 3HOYJ 3S8PA 5E1XA 3TP3A 5AONA 3FXMA 3ESWB 3LWFA 1JTYA 1QQIA 3FX3A 1P7IA 2TRTA 3S32A 2LY2A 1IAWA 1KGSA 5FJ8J 4KITB 3FHZA 4A3KJ 4E4HA 5FFXA 2LNBA 3CDHA 3HZJA 2D45A 4ETSA 1RR8C 5ILSA 3DPLC 1XGSA 4C3HJ 4WX9A 4IX7A 5BPDA 1R6RA 1OCCH 1AOYA 1ZQ3P 1VFCA 5HS8A 2QA4I 5JHUA 3BTLA 3I59B 2L3DA 4F7ZA 1FSHA 3DLLF 2XGDA 2QQ9A 1YW8A 3HRMA 4HQEA 1MJBA 3EDPA 1U6GA 4BJ6C 1R00A 2M9HA 3QPTA 3SEZA 5IYBJ 4AM3A 2LF8A 3EYYA 3JRBA 2BVMA 2HKXA 5J40A 4J01A 3ECHA 3EUKL 3GZ5A 1FZPB 5FRMA 2EV5A 1FOYA 2LP0A 2K86A 5J3LA 2R4GA 4Y4RA 1EKEA 2VT2A 4WCGA 1REPC 3S2WA 3GFIA 4L18B 1MJAA 3LSRA 3KE2A 3CP8A 2MSYA 2XASA 3HJEA 1RKTA 1RETA 2EV6A 3V8LA 1VQ5I 2DFHA 1IN4A 4AVPA 4E7SA 1W7PA 3RPUD 2ZMEA 1B72B 1B6AA 2A5WA 2H94A 2LBFA 4IQJA 4IO9F 4LG0B 2M87A 2KRFA 1ZREA 1PP7U 2NVTJ 3RCOA 1RKWA 3QQAA 1YJ9I 1HW5A 1QZEA 4QTRA 3S1MJ 1UB9A 4L5JA 5HNHA 2HU9A 4CUGA 3ERED 3JTGA 2QF7A 4IHXA 4ASNA 4ABZA 5D8KB 3OYNA 4BBRJ 2CU7A 2W4SA 5FLMJ 1DQUA 3AFHA 3K4NA 1R5ID 2MG4A 2ELHA 2V7FA 3D1NI 1VQOI 2RDPA 1MBFA 2F6CA 3AG4H 5B66C 2M2EA 1X1AA 4MTEA 4ITVA 2KZVA 2JA8J 2J5PA 5J1UA 3U1DA 3GZNB 3VDXA 1LE8B 4CDGA 3MMYB 2FJ1A 2ICWG 2XPVA 4AIHA 3CCSI 3OYAA 1FYLA 2XSDC 2JPCA 1LJ9A 2M1BA 4L9TA 2XHKA 1I39A 1A04A 2GOMA 2CUEA 2EFOA 5HDGA 4X0GA 4QLCU 5LHGA 2YX7A 4K2EA 1ACIA 3Q9SA 5DUKA 2ID6A 2H6CA 1HBXG 2K9LA 2M4GA 3BJAA 5HLGA 2PLYA 4YRVA 5E1WA 1PYVA 3ZQLA 3HXLA 2WV1A 1RC9A 1J75A 2R7UA 3ZXSA 2XIGA 1GV5A 1T56A 3AKZA 1EH7A 2F4IA 2LC2A 3ZMSA 1Z77A 3LA2A 1QRYA 3JSOA 4I7HA 1DPUA 2VT3A 5K7ZA 3DKXA 1ZK8A 3M8EA 5LD2C 2ME0A 2DCEA 1RRJA 3IP4B 4B47A 4U7DA 2OJED 1B72A 4UNOA 2PQ8A 1UG2A 4IEJA 5DYMA 3HSRA 5F27A 1CGPA 3FXOA 1TT0A 3ZPLA 3AL0C 3MQ0A 3E3VA 1K61A 2E5NA 2XGEA 3OV8A 3MZ8A 1DGWY 2RREA 1J2XA 1HW2A 2BW3A 2Y69H 4Q4ZF 1RPWA 3MFKA 1S3JA 1IG7A 1SVMA 3J81K 2D5VA 2R7FA 3T1BA 4HRIA 3HRUA 3JSPA 2RNJA 5DS9A 2HYJA 2HS5A 4BH9A 1KQ9A 2QKLB 2DBBA 4ON0A 4HSRA 2MC4A 3GTOJ 1T0FA 5EJCA 3V42A 3N4MA 2Q8KA 3S93A 1XGNA 2KLOA 3I9V2 2CSOA 2V9VA 4YIIA 2ECCA 3HRTA 2DW4A 1Y6IA 3L7WA 1NG7A 3KP5A 1P4AA 4XN0A 4DYQA 4QIWN 1ETYA 1OCZH 5FB2A 4MLOA 5DD8A 4LG3A 3BR1A 3WG7H 4KYWA 2GA2A 2R7SA 3OYFA 1LEBA 2QWWA 3I4NJ 4F3QA 4NNJA 1ZKGA 1ZHFA 1U5TB 3F9KA 1VQ8I 1V3FA 4L9JA 3RIRA 2LOOA 2FMYA 1I5ZA 3HRSA 5H6QA 2MYSA 4XOTA 9ANTA 1JHFA 1ON1A 2E71A 2HPIA 1AKHA 1MH4A 4P55A 3QRFF 3ZN1A 1D8JA 3WU2C 3S3MA 1WI9A 2CRGA 5LGNA 1X4PA 5J47A 4J00A 2NVQJ 2CH0A 2CQ7A 3P7NA 2VXDA 3SHFA 2QVOA 2DA1A 3W6VA 1R4MB 5GADJ 4EV0A 1JJ6C 3FKJA 1BC8C 1EF4A 2PG4A 2PFBA 3VYTB 4X1EA 2NVYJ 4EVIA 1AKHB 1XGMA 2HQRA 2MGQA 3KZIC 3T8RA 1LNWA 1BW6A 2OBPA 2MH2A 2QQBA 2R3SA 2FA5A 3BDDA 5J8FA 2P5VA 2R7WA 1QHGA 4M3EA 4BHPA 3WTWC 3FK7A 4BACA 3TOAA 2ZC2A 1GV2A 1JUSA 3GX4X 3RQ4A 3OYIA 1FTTA 1J9IA 3SXYA 2Z3YA 3KP6A 4HSTA 3I3LA 3D0SA 2KRCA 4GCVA 4S04A 2HOAA 2QQ8A 1YJNI 2XAQA 4DNCA 4YIFA 4FETA 1DU0A 2BHYA 1R5HA 4MHGA 4KT6A 1X19A 2H09A 1LFBA 2Q1ZB 1FSEA 4EQQA 4G8XA 2K9MA 4NQWA 4RM2A 3ZQCA 1IV6A 4G7ZF 2HR3A 3E6DA 1JKQC 2F5DA 3FHNA 2IGMA 2LKSA 2X1DA 3GCMA 2JT1A 3V8JA 1Z0XA 1VQ7I 2RQPA 4IZZA 1T0FC 1MBKA 4BS9A 2VODA 5FLXZ 5FROA 2H1KA 1P6RA 2M8EA 2DFIA 1A6IA 2CUFA 2ISYA 4DBQA 3J81Z 4TV7A 4D7NA 4V2FA 1E3OC 1MMNA 1MD0A 2D1VA 4A69C 1ZH5A 5A2QK 1F43A 1XTAA 1MMGA 3DU5A 2LSOA 3TQNA 2K4JA 1K79A 4HV6A 2M8GX 2F48A 3OOPA 1UCRA 3G4SI 1R4NB 3J7AY 2EFPA 1JHHA 4UB6C 4BQAA 5BS6A 3IAS2 2J5OA 4UHTA 1IXSB 2EA2A 2EFQA 3ZCOA 4LMYA 3MKWB 2PJRB 1B9NA 1RNLA 3CCEI 1BR4A 3QPHA 4AYBA 4KDPA 1ZG3A 3ASOH 3T5XA 3IKTA 2E2JJ 2WADA 2FBHA 3H5AA 1Q1HA 3KP3A 2BYVE 3IKVA 3WTTC 4M6VA 4GO1A 2KFDA 2R7ZJ 4MGRA 1BBYA 1BI0A 1K78A 3U2RA 2BVLA 4IXAA 3QOEA 2R7TA 3EYIA 1GXQA 4FE7A 3WTUC 3H35A 2Z5UA 1WPKA 1X4OA 4FASD 4L0YB 5GAGJ 2MH9A 2WV0A 2V79A 2A5YB 2XGCA 4CICA 1QGPA 2O7OA 3FM5A 1MKMA 2CJJA 2H8WA 2KPMA 1SAUA 2EZKA 1WFXA 5KCMA 4RDUA 3HOWJ 4BQQA 3ABMH 3HGGA 1HCRA 1QVTA 4G6DA 4RMNA 3IV5A 4CXFA 2DQLA 2EILH 4NQWB 1IN7A 3OYKA 2H8RA 3K4CA 2R7XA 1T2KA 5K7HA 2VASA 4BE2A 2HDCA 2OAZA 1HQCA 2W1OA 1QZZA 2HYFA 4Y52J 2HZDA 1TQPA 2CS3A 2HXIA 5HDKA 4CYCB 1HSJA 4C3JJ 3FZVA 4CYCA 2QSGX 2JZYA 1MGTA 2A68F 3VSKA 4XLPF 3LAJA 2QUFA 2WY7Q 4D0PA 5HVQC 1PP8F 4EM0B 3VEPA 5L3BA 4Q5SF 3C7JA 3OYCA 4I2OA 1EV7A 3LMMA 3QU6A 1YYVA 2XPUA 4PJMA 3EUAA 2FBKA 5CVUA 2BV6A 3WODF 5CVIA 1Y0UA 1TL8A 1XN7A 3F21A 5J6XA 3CO6C 2F5CA 4PFPA 3MVPA 5IY5H 4OAYA 5ED4A 1G3WA 4C2TA 2VOPA 4HNVA 2O5RA 2VLAA 5EEHA 1ZGWA 3HEFA 2DA3A 4UVAA 2GIVA 4YIRX 2ADUA 2BW3B 2YPRA 2FMLA 4ZH4F 2IA0A 4O5VA 4B4CA 1ZLKA 2OC6A 1K7AA 2X0LA 4JX5A 2VUMJ 4JX4A 5EZGA 3HHGA 5DD4A 3NEUA 5LBQA 2M5WA 3DLAA 5FLXK 4F55A 2EJRA 4H0EA 5LEJA 3FXLA 2L0KA 2OCEA 4AYBN 1RZ4A 2X48A 4NB5A 1N78A 2DI3A 3RTRA 2DDBA 2NNYA 3IL2A 1WJCA 3GO5A 1I6XA 1XMAA 2CQNA 3BZ6A 2OUMA 5FKOA 1QPMA 5M5WJ 4XRFA 1T33A 3L9FA 3RQIA 3CO7C 1QU3A 2HWVA 2QSFX 2Z16A 1VQ4I 4CZCA 2R7DA 5K5QA 4CCOA 2CW7A 5IOYA 2DMNA 1ODDA 1X2NA 1MMSA 1WH7A 3PIOF 1S7OA 1KU3A 1OJLA 1UG0A 2WTEA 2HEOA 4HLXA 4XKBA 3G1MA 4BDZA 2E35A 1UHWA 5C44J 3EUHA 4CCJA 1B1BA 5DTDA 4KISA 3CLOA 2X1CA 4R8HA 1QPIA 2CFXA 2STWA 1WJEA 3CD6I 4E7IA 2JJ7A 3V8KA 1WH5A 4DBRA 4RB2C 3L2VA 3JAMK 4Y15A 4HZFA 1FYMA 5FD6A 2JSPA 1LFPA 2V9KA 3RKWA 1IV8A 5EEGA 3BY6A 3K0LA 1HOMA 3K4JA 1O3SA 4UUSB 3SJMA 5M3FJ 5BPIA 3IH4A 3S2DJ 1PUEE 3CJTB 2FNAA 3F6VA 3G6EI 3FBIB 3CCVI 2FF4A 2PJPA 2A6EF 2DJIA 3Q9VA 1FIPA 1FJLA 1DU6A 5C4XJ 1X1BA 2JN6A 4A3JJ 1U9OA 2IP2A 3JRIA 1U5TA 3EETA 4A93J 4RM3A 2P8TA 2R5ZA 2LH9A 4I01A 3R0JA 2QCOA 3U21A 2R5ZB 1F36A 2M30A 4GYIA 3HIFA 2JK3A 1MNDA 4LJZF 1FLIA 4M9ZA 1LUJB 2P5LC 4BBSJ 3L2WA 3PNVA 3PFIA 2DPUA 4QSHA 3BG3A 2ZFUA 3CUOA 4A0YA 5IOZA 3WTVC 2JMWA 4IHYA 1G3SA 3DP7A 3BC8A 3P9CA 1D5VA 3MEXA 3SFZA 3F8FA 3ZRGA 2FQ4A 3CCJI 2Q0OA 1E0EA 2A07F 1ON2A 3LAPA 3ERMA 1IO2A 3HOUJ 2VB6A 1WJDA 1MIJA 3FM3A 2FX0A 3HUGA 4Q48A 3V7CA 5LHHA 1SFKA 2W84A 3FF5A 3RI4A 2E2IJ 1MDMA 3E97A 4EJUA 1BI3A 1BIBA 3CC7I 2CQKA 2W7NA 4BE0A 3PM1A 2LKPA 5KNLA 1WSUA 1B4AA 1FWZA 2IA2A 3WHCA 4ZZDA 5TRDA 2HQ5A 1IUFA 4M73A 1P7JA 2K3PA 2GBYA 5D8LB 1YITI 2P6TA 3FWEA 3HBLA 5F1JA 5BNGA 1YRNA 1FNNA 1V5GA 4E7JA 3HOXJ 3O6BB 2GLOA 4XQFA 2X6OA 5JR3A 4I0AA 1X3ZB 2IEKA 4KJZA 4M72A 3TW6A 2XKPA 1IC8A 1I6HJ 1TWGJ 2KDZA 3HPHA 3QPSA 2PMHA 5DDGA 2JA7J 3PJRA 5C3EJ 4JP0A 3WG9A 3G71I 2P81A 2Z33A 2Z9OA 1BOAA 1T95A 3ZQIA 5B1AH 4UUSA 1CQTA 3REOA 4ZTJA 2HDWA 4CCMA 4LB5A 4RAZA 2PN6A 3BCAA 4S05A 3W6KB 1P4XA 4DYRA 2KIUA 2HKOA 3NWTA 3RZDJ 1R71A 3ZMTA 1WHUA 5EZHA 4U0YA 4A3CJ 4GDFA 5ILVA 3S15J 5ICFA 1XD7A 4LK1F 1A5JA 1TLHB 1SD7A 2F5EA 3SZPA 4A2UA 3H0GJ 4HX8A 1FC3A 2O6GE 1LDJA 1I1GA 1R58A 2Z2SB 3ZMDA 1QHHD 4MNUA 2KZGA 1U5TC 2OF7A 5HOOA 2KHMA 4BHBA 2OQGA 3SEQA 4NDLA 3MN2A 3VYRB 3K1NA 1K6YA 1Z21A 4LGWA 3DCFA 2ZJPF 5E17F 3ZQ7A 1YE9A 3L1PA 4S0HB 2R0QC 3BTJA 1FEXA 2QQAA 3LSMA 3BR5A 1TC3C 1WWXA 1SFOJ 3JW4A 1ETVA 3HUGB 3GFMA 1YG2A 3VODA 3K4LA 3KP7A 2X85A 1R49A 2DT5A 2CQXA 5CQEA 3CCYA 3JRCA 1T38A 4P1WA 4ZYGA 5EGOB 3M4OJ 3H36A 1UHMA 1S9HA 3EUHC 3K69A 1D8KA 2M4KA 3ZQQA 3NRVA 1DGRM 2YSRA 3FMRA 4BQOA 1MSEC 1D1AA 3CJNA 2GM4A 3I54A 1AHDP 1R36A 2F2EA 4M71A 1ETWA 1BM9A 1WGXA 4HF1A 3R6SA 1UMQA 3KEOA 3CJRB 1N75A 3OYLA 3DEUA 4L0ZB 3MAJA 2EZLA 2IAIA 5J4VA 4D5FA 1Z7LA 4E7HA 1VI0A 3HOZJ 3V4GA 2Z1DA 3QPLA 5JFRA 5EF6A 3UR3C 1Z6RA 1RI7A 4XKCA 3PQKA 1QBJA 3DWLE 1B8IB 1RIOH 2R7OA 1YW7A 2OZUA 3E5UA 2EIKH 3S1RJ 2XC7A 4DYCA 3QYFA 1V5FA 1FTZA 4F52A 1ULYA 3TDUC 3R60A 1EH6A 3C1DA 3DTKA 3K10A 3A4CA 1MW7A 2L7FP 3H3ZA 4BEHB 5JI6A 3VFZA 4N9IA 1TWAJ 4HX7A 5EEAA 4MEYF 4EEFG 3FDYA 2E1NA 1EA3A 1OCPA 2JVGA 3GZ6A 1B8IA 2NYXA 1SVOA 3AG2H 3TDZC 4CYDA 4XLCA 1LFUP 1D3YA 2A6HF 4A6EA 1C0WA 4A3MJ 1KONA 2VQHA 2MBFA 3HOSA 3MZYA 1JUPA 2VQLA 2DYSH 2DN0A 3HG9A 2VPRA 2PEXA 4FHTA 2KKOA 3HOTA 4WF2A 3ASNH 1LQ1A 4XLFA 2E60A 3BJOA 1T8IA 4XN3A 2ZO4A 5E8GA 1Y8RB 2ID3A 3WU1B 1S72I 2CGPA 2HDDA 4KIBA 1K4TA 2P0WA 4CSWA 1IDYA 4BL0B 4P5OA 4P9FA 2DTRA 4EMSA 3R4KA 1JE8A 1G59A 2KT0A 3ZQGA 2UUZA 3H9JA 1FT9A 3IRRA 1A35A 1D5YA 2K5CA 2VJ5A 3A2KA 3H9QA 2DFFA 4C30A 2R7VA 2LTPA 4CCKA 2OPTA 4BAYA 2EIMH 1E3PA 1LKXA 2HZTA 2KDOA 3GFLA 2ZBKA 1PJRA 2NOGA 3SDBA 5IT9K 1FBQA 2JVHA 3IC7A 3JRGA 3WTZA 4RGRA 4CH7A 3OSGA 4KICA 4HF0A 2R7RA 1ZARA 1SEUA 3B02A 1WKMA 2CQQA 2DMTA 4AIJA 2ZMEB 4M3GA 4HDUA 2ZJQF 1T39A 2VJIA 3CDLA 5TGTA 2AXLA 4LK0F 4HAMA 3P9KA 5IYCJ 3AAFA 1YIJI 3OWTA 4BKXA 4RGXA 3SYTA 3BG9A 2L4AA 2VBXA 2DAOA 1HKSA 2H1LA 2K3FA 1OCTC 1J7KA 2DT7B 2HNHA 3GW2A 2OTLI 1BC7C 1L0OC 4M3FA 1LVKA 4RB1A 2W48A 3CCQI 1RR7A 3I5UA 2VQCA 1ZRCA 2LYCA 1O57A 2KRHA 2LK2A 1WJFA 5FKMA 2L9NA 5F0HA 3HL2A 3BWGA 2QLZA 1GXPA 3K4BA 2COMA 3GTMJ 1FP2A 2GOXB 3S2HJ 4LIVA 1F4KA 3G3ZA 3S16J 3I64A 2YU3A 2M34A 1O3TA 1GVDA 2L7MP 1V5EA 4AIDA 3D5SC 4XOPA 4KT5C 3MKZA 1R1UA 2JTVA 3OIOA 4BJTA 1A36A 4KNYA 4IHTA 1B59A 1O3QA 2WBMA 3FK6A 2HVRA 5EG0A 4M6XA 2F5FA 3FXJA 3A01B 3JAMZ 1JKPC 1BI1A 2MW8A 4PZJA 4G7OF 1D1BA 2IVMA 2VKVA 4L5IA 1Y1VJ 5E3MA 1A31A 4AVZA 1ONVA 2X6WA 1G8XA 1MBHA 3DTIA 3FIWA 2P7CB 3OYBA 2B7EA 4GYGA 3TO7A 3VPRA 3CLQA 3S1NJ 2OCCH 2R5YB 2O03A 2EV0A 1DP7P 2X51A 4IJAA 3LQQA 4PDKA 4PGHA 1LDKB 1XG1A 2GIZA 1SVLA 1JT6A 5KAFC 2R92J 2ELJA 4II2A 4PFOA 4F91B 3IUOA 1X3WB 2Y31A 4I98B 2CG4A 3QAHA 2UZKA 1W1WE 3WGIA 3H5RA 2XAFA 2X6XA 2GXGA 4M6YA 2OA4A 4W97A 4XKWA 4XRSA 2XDVA 3GTJJ 2I10A 4P9UA 5FKNA 3G1OA 2XKOA 3WE3A 1LE8A 3H3VK 5IP7J 1DP3A 1H9GA 2VBZA 1D0XA 4EJOA 4E6KG 3W6JB 3TW7A 4KFCA 2X1EA 1IXRC 1WJ5A 2E7WA 1HDDC 2DA6A 1SMYF 5GP9A 1FX7A 3HSEA 1P92A 6PAXA 3RSNA 3S17J 1AWCA 2B0LA 4LLGF 3KCCA 3TO6A 2X4HA 1MMDA 1SD5A 4OMYA 1ETOA 1SFUA 1VQ6I 3KLNA 3OIPA 2A3SA 2Z99A 2Y0MA 3E5XA 2LY1A 3GVAA 4A0XA 4A3FJ 2V4JC 5E8IA 4XICA 1ZLJA 3E6MA 3F6OA 1IRGA 1XDUA 2A61A 4ENMA 2K85A 2XUBA 4I99C 3SQNA 4FE4A 1BR1A 2L7ZA 3GLXA 3DPTA 3Q5FA 4ZZLA 1XMXA 5CLSA 1I27A 2DA5A 2KJBA 1YJWI 3LFUA 4O3MA 1ITYA 2IPQX 1BI2A 1SMTA 3F22A 1ORKA 3TKYA 5BOXA 2FRHA 5D4SA 3PSIA 3T0YA 1V54H 3X2QH 3CUQA 2DOEA 3L09A 3K70D 2CO5A 4RAYA 2GA1A 1TNTA 3BLYA 2BY2A 4BGDA 4XONA 2E1MB 2FE3A 4KMFA 1USSA 1W5SA 4P96A 1XGOA 5DEQA 4DIQA 1Z6TA 5D5WB 2MA3A 1E3HA 3LSGA 2BOLA 4HA8A 4DQ2A 4LOCA 2JSCA 4A3BJ 2KQRA 4Q47A 2DT6A 4MQVA 2VQGA 3A0HC 3LSTA 4FQGA 2DA2A 4PJLA 3DBHB 2JA2A 2HVQA 2XAJA 4II3A 4XM3A 3BP8A 3QYEA 4PJ0C 2RVCA 5B5EC 3QOPA 3LSKA 1FPQA 4CO8A 1SD4A 3NQOA 2DJNA 2W00A 1D0YA 1I50J 5GPCA 4HBLA 3HHHA 3F3XA 2KJCA 3GBGA 3JREA 5GTHC 2JA6J 2DLLA 3NARA 1YLFA 5H2FC 1ETQA 3BQYA 3CCLI 3I53A 1XSXA 2F4OB 4ZTFA 3DU6A 4E7ZA 1LPQA 2XPWA 4QWQA 3BPXA 2AS5F 4GXOA 4BNCA 2IXSA 3IAM2 1TBXA 2L9SA 2DTZA 2YR2A 3HYIA 3TOBA 3ZMUA 4EM1A 2VC1A 1POGA 5FFZA 4CZZA 4JYKA 5LEKA 1NTCA 1R22A 2M3AA 5L3FA 1MJ9A 4MFDA 3SFIA 5IP6A 1BJZA 1H88C 3IHUA 3LSPA 4XORA 4PCQA 4M9SA 2LFBA 4XBFA 4Y7NJ 1SAXA 3GTKJ 2MLKA 2V6CA 3PSFA 1ZR4A 5J1YA 4IKFA 5CJ9A 1MNMC 1HDPA 2XB0X 4XLAA 2V26A 1LB2A 1FYKA 4FISA 1ETXA 2L9VA 3H9GA 2BGCA 1YTYA 3W2VA 1K6OA 3GXOA 3O8GA 4ESFA 2ELKA 1AA7A 2V1UA 2VC0A 3AL0B 4BYYA 1U3EM 4RAFA 3LOCA 4FCYA 3LSHA 1MNEA 2MD5A 2ZNZA 5IPAA 5LGUA 1WZ2A 2MC3A 4G12A 1SANA 2ZXIA 4QPOA 1JKOC 1KQ8A 2AXTC 2Y0SN 3RZOJ 2LMDA 1IGNA 2BEOA 1WCMJ 3BR2A 3FXRA 3DQVC 2CV0A 1UHSA 2L54A 1ZN2A 1OQYA 4E7LA 1SD6A 3L00A 2STTA 2ESNA 2NVUB 4HX4A 3K7AJ 3D5LA 1DPRA 2E1MC 2HXOA 3BR6A 1P9QC 5M5YJ 2M0MA 4U7BA 3I56I 2IS6A 4WK8F 4ZDPA 3A01A 1NH3A 2LRDA 4I0BA 3DBRB 2UXNA 1H89C 2HFHA 2EFWA 2ECBA 2C6YA 2FSWA 2IJLA 5DV5A 1P2FA 5E79C 2QEXI 2IS1A 4YELA 3OS0A 2JUCA 4WWCA 3PUBA 3P5JA 4OU0A 2NXNB 1W0UA 1NK2P 4WXCA 4ESJA 3DEWA 1G4DA 2L2OA 2VXZA 4IRIA 2YU9J 1WQ2A 4N0BA 4RGUA 3J80K 2LD5A 4ANJA 1GT0C 1OYYA 4OAZA 1XCVA 2K02A 5M3MJ 5D5UB 1FOWA 2EINH 1ERDA 3ISPA 5IT9Z 4UV9A 2KIQA 4RB3C 2WY8Q 2IS4A 3DBLB 3TGNA 3K4KA 4W1UA 5EYRA 5D5VB 3M9AA 2WB1N 2DA7A 2CWEA 3CTAA 4B48A 1QZYA 3ZOBA 2XRLA 2VBYA 5F0FA 3UNGC 2KISA 2N8GA 1Z05A 2YX4A 5HLHA 2DQRA 1S29A 5JLXA 1HF0A 5CYVA 4ENJA 4AUXA 4HOBA 2DK8A 1IRFA 1IRXA 3E6BA 4X6AJ 2WAFA 1APLC 4IHVA 5J4YA 1J59A 2E36A 3J7AO 3CQZJ 5GAHJ 4CA0A 2IA1A 4RGSA 4KUMA 4AC0A 2CW0F 3HTSB 2PMZA 2ME6A 3OR1C 1TZLA 4B3AA 2FXAA 2OD5A 3U9GA 1KU7A 4IVNA 3OYMA 4C3IJ 3ML6A 4EGYA 4XRSG 1FMWA 1YI2I 4EJTA 3B6CA 4N9HA 4G7HF 2FNPA 4XKVA 1I3QJ 2Y9YA 3GUDA 4ZDLA 2BY3A 2HOSA 5F0CA 3RKXA 1YIOA 2VBWA 4A0ZA 1JGSA 4NBQA 1RESA 3HGYA 3ABTA 1VQLI 3R61A 5F04A 2PMUA 4RLFA 3GTPJ 5DCMA 1Y1WJ 4I02A 1KQ0A 5FLVA 3GTQJ 5DCMB 2QBYA 2ZKZA 5IT3A 3NWSA 4GGGA 4NUBA 1W36C 1UZCA 1YW9A 3RYRA 4D5CA 1O4XA 4IHWA 1W7PB 4EJVA 1TQMA 4OMZA 3KX2A 4C9YA 4A3GJ 1JKRC 5HLIA 2ZCWA 4R79A 3W3CA 2BXYA 4EM2A 1BR2A 2DK5A 2K4BA 4DZPA 3WTYC 3ABKH 4U0VA 4ZC3A 3L2CA 4BDYA 4KN7X 3Q0UA 3K70C 4I76A 2Y9ZA 2ZFWA 4BXUA 2FU4A 5KVRA 5JVTA 5ICEA 3V7SA 1V4RA 1VTNC 3ROUA 3DXJF 3PO3J 3FBNB 2XVCA 3Q0WA 1N77A 3O2PE 5FD5A 4F92B 4EJWA 4RB0A 2KMUA 1X2MA 2IGOA 3DKYA 3F23A 3N97A 1TNSA 5J1RA 2KL4A 1OKRA 1MBGA 1R7JA 5L3GA 2W85A 1FOXA 2GWRA 1AU7A 5E3LA 2EA4A 1Y0NA 2ZXHA 2VE8A 4UVCA 5IP9J 2DO7A 5K5RA 4HDVA 2IRFG 3BCBA 1LVAA 1VQ9I 1YO5C 2XRNA 2HOTA 1HW1A 1UELB 1X3UA 3H0DA 1TW3A 4HEA2 2ESHA 3C2GA 5HS9A 4XIDA 1H9TA 3U1KA 2BY0A 2OQRA 3KZYA 3COAC 1JTXA 2RN7A 5E18F 2WAEA 2BBYA 4KN4X 4D7MA 1HSTA 2EPFA 3DTEA 3I4PA 3BOQA 3WGGA 3J7ZI 1Z9CA 1NG6A 1W0TA 4LLNA 1SC7A 1MMAA 2OU2A 4LG0A 3S14J 2VOOA 2JPBA 3CCUI 2V1NA 1BOBA 3BPVA 3CDIA 1XMKA 2DXIA 1TQIA 2O8XA 1RUNA 1Z91A 3IWFA 4JQFA 1ZAOA 5DUIA 3JCUC 1UFMA 1X58A 3TBIA 2IS2A 4IPAA 1Z67A 4H4KC 3VYSB 2I8DA 2LF7A 4MEXF 2JWTA 3CMAI 4XRMA 1XDSA 3CCMI 5GAEJ 2FD5A 5DM7F 3GLLA 2D2WA 2ETHA 3K1PA 5EGOA 3FXKA 4U87A 1GLNA 4G6QA 2WWYA 3IWZA 3OYEA 3PQJA 1HXDA 4YEJA 3OOUA 4AWXB 5KHDA 4RLQA 5CKTA 2LKXA 3H92A 4MIMA 1JGGA 3CC2I 3HKZN 1TWHJ 1USTA 2CMPA 4A5NA 1PVEA 4KIGA 3L2UA 5D5XB 4IOAF 2MFZA 4D1QA 4HYEA 3KP2A 3S3OA 3LNQA 3CZ6A 4HNUA 3E6CC 1KU2A 3LSJA 5E1ZB 2E5ZA 5DM6F 1UJ8A 2DOAA 4Z2YA 4OIPF 2VI6A 5LGTA 3PFYA 5ICGA 3M1EA 2Q2EB 2BE5F 2IBDA 3S3NA 3NAUA 1YX5A 3EPZA 2JUGA 2W57A 4U88A 3FMSA 2IW5A 4ZDOA 2M45A 2M7BA 1BL0A 2OV7A 2L01A 4ZYEA 1Z3XA 3M3YJ 1PUFA 2QGUA 4UVBA 3OYGA 5CVJA 3JTHA 4C2UA 3F8BA 5ILUA 1Y8QB 5LLQA 3VSLA 4HQMA 2NNNA 3BTCA 3K4MA 2VJJA 2YUSA 1G6NA 5GTIC 2RQQA 2HYGD 4UY8I 1HKQA 3CUQC 5LRRA 2ZSIB 4R1HA 1PUFB 1OPCA 1Y56A 2ZMEC 3AG3H 1J5YA 4HLYA 4GFBA 4N4NB 1TWCJ 3CMYA 1ZELA 1LEAA 2VKEA 2JRTA 2ISZA 1WJBA 3RPUA 2HPMA 3VWBA 2RNGA 4CGZA 4YG2F 5F6FA 2XF7A 2O3FA 3G1LA 2XV4S 1MZBA 1ZR2A 4BE1A 2V1DA 5B1BH 3PNTA 2O9LA 4PJNA 1R23A 3LL7A 2FBIA 2CW8A 1S7AA 1V55H 4XSZF 2BXZA 3PNYA 3JRHA 5A2QZ 3F72A 2O61A 1S8NA 3BG6A 2RKHA 2DODA 2VE9A 5HODA 4EATA 1VF9A 2QSHX 1U8BA 3I59A 3BR3A 3ABUA 1T98A 2LLKA 5CPRB 5H6RA 2KIFA 2DFEA 5K1YA 2NAZA 5EDNA 3OR2C 4A12A 3JR9A 2K9NA 1JXSA 1OYWA 3CJQB 3L2RA 1S5LC 3HOVJ 1GHCA 2CUJA 2RAEA 3ZN0A 1W7PD 4I09A 5J8CA 5HDNA 2LR8A 2LBFB 3MZHA 2WB1A 2W82A 2HOEA 1E2XA 3HKZA 3HDDA 2ZJ2A 4I6ZA 3WTXC 1VQPI 3OL4A 4BHCA 4BXFA 4Y33A 3CUQB 4IRHA 1L3LA 3TL4X 2HTJA 2P4WA 3F8CA 2NS8A 5F08A 1FIAA 2E7XA 2PBIA 1KYZA 3WGHA 4U0WA 5BQTA 3OY9A 1G2HA 1K83J 2A6TA 1G3TA 1CF7B 4DJAA 3DF8A 2Y75A 3H1CA 3BTIA 1GUUA 3KYLA 1Z1DA 3SDGA 3N05A 2L9RA 2G9WA 3ONQA 3V7RA 4L9VA 3JRFA 4ENNA 2M0CA 1NHAA 1XX5A 3RKQA 4BY7J 3DEEA 5D4RA 4XLNF 4MTDA 4IOCF 1IF1A 3FKIJ 4CHUA 2VPLA 2NS0A 3HSFA 4D9JA 2WAQA 4UB8C 3QP6A 4PJJA 4HPQA 2DA4A 2DDAA 4UXNA 2HTSA 1QO0D 3SZGA 4NHJA 2XAUA 2GQQA 4M74A 2JA5J 2EK5A 5LHIA 2BZTA 4MQ9F 1BA5A 4BU2A 3OS1A 3JRDA 2JQ7A 3KP4A 3GMEA 4LB6B 1X1PA 4M3DA 1U9NA 1HKTA 1JUMA 2DOFA 4M3BA 1STZA 5TJJA 3WU0A 3G73A 2HGCA 4PK4A 1OR7A 2NS7A 2AQFA 1OLTA 3C3WA 4ZYHA 1D0ZA 1FBUA 1OMIA 5FGMA 2UXXA 4AIKA 4IL6C 1H0MA 4A6DA 2EQRA 2EZIA 2VKHA 3K6GA 1WVRA 2DMPA 2LDUA 2VL8A 3C2HA 4XR6A 1IZ1A 3OIQA 3HTUA 1QVUA 1YQAA 3ABLH 3EQLF 4IF4A 1OYIA 3M1CA 5E20A 4V19K 1T6SA 3ZMVA 2QBYB 3C2BA 2W25A 2QM3A 2EWNA 3VOEA 4LD5A 3A1YA 3KLOA 4O6JA 4CCNA 2B63J 4OWRB 2HI3A 2Y2ZA 3MWMA 1MDMB 1UAAA 4JK1X 1ZYRF 4WXHA 2CV2A 3CF2A 2QENA 1S6LA 4DOZA 3KEQA 1O3RA 2K40A 3KIOA 4XLEA 2FOWA 3I4MJ 2RGVA 1R1VA 4OIOF 1IJWC 1W5CC 3LSIA 3JRAA
chains in the Genus database with same CATH topology
3IH2A 2X6OA 1JT0A 2IEKA 4B1RA 3TW6A 1IC8A 1I6HJ 1TWGJ 2KDZA 3QPSA 2JA7J 3K7AJ 1ETKA 5C3EJ 2TCTA 4JP0A 2ID6A 2P81A 1MBJA 2HXOA 3BR6A 1MH3A 5M5YJ 3ZQIA 3A03A 4UUSA 1CQTA 3A01A 4V2GA 3ZQLA 1H89C 2ECBA 1NK3P 2COBA 2WV1A 2WAQN 1GV5A 2R5YA 1T56A 4DYRA 3UKGA 1Z77A 1W0UA 1NK2P 3RZDJ 3DEWA 1QRYA 5EZHA 4A3CJ 3B6AA 3S15J 2YU9J 4A3EJ 2LD5A 2E1OA 1A5JA 1GT0C 5K7ZA 5M3MJ 1OFCX 3GTLJ 1ZK8A 2G0EA 1BW5A 1GDTA 3H0GJ 2ME0A 4W1UA 1IJWC 1H8AC 1B72A 2OF7A 1UG2A 4IEJA 5EYRA 5F27A 2WB1N 2DA7A 4NDLA 3MN2A 4C2MJ 3ZOBA 2XRLA 1K61A 2XGEA 3DCFA 5F0FA 1MBEA 3L1PA 2N8GA 4S0HB 2R0QC 3BTJA 1FEXA 3BR5A 1RPWA 5JLXA 1SFOJ 3TEDA 1TC3C 1HF0A 1ETVA 3BR0A 1IG7A 3Q3SA 4AUXA 2D5VA 4X6AJ 2CQXA 5DS9A 3CCYA 2HYJA 3JRCA 1APLC 4IHVA 5EGOB 4MO7A 3M4OJ 1VNDA 3CQZJ 1XC5A 4AC0A 3GTOJ 2ME6A 4B3AA 2K9SA 1MSEC 2ECCA 4C3IJ 2GM4A 4XRSG 1AHDP 4UUTA 3B6CA 1ETWA 1WGXA 3A02A 2E19A 4QIWN 4DYQA 1UMQA 1ETYA 1I3QJ 2Y9YA 2YS9A 4MLOA 3BR1A 2EZLA 2IAIA 2HOSA 4D5FA 5F0CA 3PO2J 1VI0A 3HOZJ 3I4NJ 3QPLA 1ZKGA 1RESA 5EF6A 3HGYA 3OSFA 5JLWA 5F04A 1B8IB 3GTPJ 1Y1WJ 5FLVA 4XK4A 9ANTA 3GTQJ 3S1RJ 4DYCA 1AKHA 1MH4A 5E3OA 4FTHA 1FTZA 4D5CA 2CRGA 1O4XA 2L7FP 4IHWA 2NVQJ 5M5XJ 1TWAJ 5EEAA 4EEFG 4A3DJ 1OCPA 2DA1A 1B8IA 3W6VA 4A3GJ 3BQZA 1JKRC 3FISA 1LFUP 1JJ6C 1EF4A 4J19A 3BT9A 3TP0A 4X1EA 2NVYJ 4DZPA 4A3MJ 1AKHB 4DZJA 2MGQA 3Q0UA 4DW6A 4I76A 2Y9ZA 1BW6A 3K2AA 1JUPA 2DN0A 2VPRA 4M3EA 3PO3J 3FK7A 1GV2A 1JUSA 3Q0WA 2EZHA 1FTTA 2ID3A 2HDDA 2LY9A 1X2MA 1IDYA 5J1RA 1MBGA 1WI3A 2EH3A 2HOAA 1AU7A 1Q1VA 5E3LA 4A3IJ 3BG5A 5IP9J 1DU0A 4L5EA 2KT0A 3ZQGA 1D5YA 1XS9A 1LFBA 5GPAA 4MFEA 2LTPA 2HOTA 2OPTA 1IRZA 2NVXJ 4XIDA 3ZQCA 1IV6A 2NOGA 1JKQC 3JRGA 1JTXA 2K9QA 4D7MA 3OSGA 1Z0XA 2CQQA 2DMTA 2DMUA 1W0TA 4M3GA 1MBKA 3S14J 3CDLA 5IYCJ 3IH3A 2H1KA 1A6IA 2CUFA 4BKXA 2AO9A 3Q0VA 4D7NA 1E3OC 4V2FA 3BG9A 4A69C 1X58A 3F0CA 1F43A 4RBOA 2Y30A 1OCTC 2JWTA 4XRMA 3ZQHA 2M8GX 2FD5A 4M3FA 3WHBA 1ENHA 2W48A 1RR7A 5EGOA 2O8KA 1S7EA 2LK2A 3O8HA 3OOUA 5FKMA 5F0HA 1YRNB 2LKXA 3GTMJ 4MIMA 1JGGA 5FKLA 3HKZN 2E2JJ 3S2HJ 1TWHJ 3S16J 4M6VA 3HB9A 2M34A 2R7ZJ 4A3LJ 1GVDA 2L7MP 3LNQA 3OIOA 2DMQA 3LSJA 3FK6A 2EBIA 2VI6A 4FE7A 5EG0A 1WPKA 2IBDA 3A01B 1JKPC 3NAUA 2MW8A 2XGCA 2O7OA 2CJJA 2R93J 2VKVA 1BL0A 1Y1VJ 5E3MA 2EZKA 3M3YJ 2AHQA 4RDUA 1PUFA 4BXXJ 3HOWJ 1MBHA 3FIWA 3HGGA 1HCRA 1QVTA 5IYDJ 2PMZN 3VPRA 4BY1J 3S1NJ 2LVSA 2E2HJ 3IV5A 2R5YB 5EG0B 2H8RA 1ZTRA 3BTCA 5K7HA 2YUSA 4Y52J 1XG1A 2HXIA 4CYCB 4C3JJ 1PUFB 1JT6A 4CYCA 1TWFJ 2R92J 3MKLA 2Y31A 4GFBA 1TWCJ 3CMYA 4W97A 2VKEA 4XRSA 3GTJJ 2I10A 2XB5A 5FKNA 3G1OA 1LE8A 2XPUA 3H3VK 5IP7J 3G1LA 3GTGJ 1ZR2A 2O9LA 3TW7A 1MSFC 2ZB9A 1HDDC 2DA6A 5GP9A 3JRHA 3MVPA 1JJ8C 1HLVA 4HNVA 1ZGWA 3S17J 5HODA 3HEFA 2DA3A 1VF9A 1U8BA 3BR3A 1ETOA 3ZQFA 2LLKA 4B4CA 4JX6A 4JX5A 2VUMJ 4JX4A 5EZGA 5EDNA 4A3FJ 3JR9A 4XICA 2K9NA 5FKKA 2L0KA 2X9DA 3HOVJ 4FE4A 2L7ZA 1U78A 2RAEA 3S1QJ 5E3NA 4AYBN 2DA5A 2LR8A 2X48A 1ITYA 3HDDA 1ORKA 5K7FA 4I6ZA 1IDZA 5FKOA 5M5WJ 1T33A 3E7LA 3HM5A 1R9TJ 3RQIA 2NS8A 5F08A 1FIAA 5C4JJ 3HOYJ 5IOYA 2DMNA 3TP3A 1G2HA 1X2NA 1K83J 1WH7A 1JTYA 1OJLA 3LSGA 3BTIA 1GUUA 1P7IA 2TRTA 3G1MA 4LOCA 4A3BJ 3SDGA 5C44J 5FJ8J 2L9RA 4A3KJ 5DTDA 3JRFA 2DA2A 2M0CA 3RKQA 4BY7J 1QPIA 2JJ7A 4C3HJ 1WH5A 3FKIJ 1ZQ3P 1VFCA 3BTLA 2DJNA 2DA4A 2XGDA 1I50J 5GPCA 1HOMA 3GBGA 3JREA 2JA5J 2M9HA 4UUSB 5M3FJ 3SJMA 3IH4A 2JA6J 5IYBJ 3S2DJ 1BA5A 3NARA 3JRBA 1ETQA 3BQYA 3JRDA 1DU6A 1FJLA 1FIPA 5C4XJ 2JN6A 4A3JJ 2LP0A 1U9OA 2XPWA 5J3LA 4M3DA 1U9NA 3JRIA 4A93J 2R5ZA 1JUMA 2QCOA 4M3BA 2R5ZB 1F36A 3LSRA 2DTZA 2JK3A 1POGA 2NS7A 2MSYA 4BBSJ 4JYKA 1NTCA 1RKTA 1RETA 4MFDA 3SFIA 4QSHA 3BG3A 5IP6A 1BJZA 5IOZA 1H88C 3LSPA 2JMWA 2EQRA 2EZIA 4IHYA 1B72B 2LFBA 2DMPA 2NVTJ 2FQ4A 1RKWA 3QQAA 4Y7NJ 3GTKJ 1QVUA 1ZR4A 5J1YA 4QTRA 3S1MJ 3C2BA 1MNMC 1HDPA 2XB0X 2QF7A 3HOUJ 4IHXA 4FISA 4ABZA 2FX0A 1ETXA 2CU7A 4BBRJ 2B63J 2E2IJ 5FLMJ 2HI3A 2Y2ZA 3O8GA 2ELKA 2MG4A 3D1NI 1MBFA 3PM1A 2M2EA 3LOCA 4FCYA 3WHCA 2HQ5A 5IPAA 1IUFA 2JA8J 5J1UA 4G12A 1P7JA 1SANA 1LE8B 1JKOC 2GBYA 2K40A 2FJ1A 2XPVA 2Y0SN 3RZOJ 1IGNA 2XSDC 3I4MJ 1WCMJ 3HBLA 5F1JA 3BR2A 5BNGA 1YRNA 3HOXJ 2GLOA 1UHSA 2CUEA 3JRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH2 A;  2X6O A;  1JT0 A;  2IEK A;  4B1R A;  3TW6 A;  1IC8 A;  1I6H J;  1TWG J;  2KDZ A;  3QPS A;  2JA7 J;  3K7A J;  1ETK A;  5C3E J;  2TCT A;  4JP0 A;  2ID6 A;  2P81 A;  1MBJ A;  2HXO A;  3BR6 A;  1MH3 A;  5M5Y J;  3ZQI A;  3A03 A;  4UUS A;  1CQT A;  3A01 A;  4V2G A;  3ZQL A;  1H89 C;  2ECB A;  1NK3 P;  2COB A;  2WV1 A;  2WAQ N;  1GV5 A;  2R5Y A;  1T56 A;  4DYR A;  3UKG A;  1Z77 A;  1W0U A;  1NK2 P;  3RZD J;  3DEW A;  1QRY A;  5EZH A;  4A3C J;  3B6A A;  3S15 J;  2YU9 J;  4A3E J;  2LD5 A;  2E1O A;  1A5J A;  1GT0 C;  5K7Z A;  5M3M J;  1OFC X;  3GTL J;  1ZK8 A;  2G0E A;  1BW5 A;  1GDT A;  3H0G J;  2ME0 A;  4W1U A;  1IJW C;  1H8A C;  1B72 A;  2OF7 A;  1UG2 A;  4IEJ A;  5EYR A;  5F27 A;  2WB1 N;  2DA7 A;  4NDL A;  3MN2 A;  4C2M J;  3ZOB A;  2XRL A;  1K61 A;  2XGE A;  3DCF A;  5F0F A;  1MBE A;  3L1P A;  2N8G A;  4S0H B;  2R0Q C;  3BTJ A;  1FEX A;  3BR5 A;  1RPW A;  5JLX A;  1SFO J;  3TED A;  1TC3 C;  1HF0 A;  1ETV A;  3BR0 A;  1IG7 A;  3Q3S A;  4AUX A;  2D5V A;  4X6A J;  2CQX A;  5DS9 A;  3CCY A;  2HYJ A;  3JRC A;  1APL C;  4IHV A;  5EGO B;  4MO7 A;  3M4O J;  1VND A;  3CQZ J;  1XC5 A;  4AC0 A;  3GTO J;  2ME6 A;  4B3A A;  2K9S A;  1MSE C;  2ECC A;  4C3I J;  2GM4 A;  4XRS G;  1AHD P;  4UUT A;  3B6C A;  1ETW A;  1WGX A;  3A02 A;  2E19 A;  4QIW N;  4DYQ A;  1UMQ A;  1ETY A;  1I3Q J;  2Y9Y A;  2YS9 A;  4MLO A;  3BR1 A;  2EZL A;  2IAI A;  2HOS A;  4D5F A;  5F0C A;  3PO2 J;  1VI0 A;  3HOZ J;  3I4N J;  3QPL A;  1ZKG A;  1RES A;  5EF6 A;  3HGY A;  3OSF A;  5JLW A;  5F04 A;  1B8I B;  3GTP J;  1Y1W J;  5FLV A;  4XK4 A;  9ANT A;  3GTQ J;  3S1R J;  4DYC A;  1AKH A;  1MH4 A;  5E3O A;  4FTH A;  1FTZ A;  4D5C A;  2CRG A;  1O4X A;  2L7F P;  4IHW A;  2NVQ J;  5M5X J;  1TWA J;  5EEA A;  4EEF G;  4A3D J;  1OCP A;  2DA1 A;  1B8I A;  3W6V A;  4A3G J;  3BQZ A;  1JKR C;  3FIS A;  1LFU P;  1JJ6 C;  1EF4 A;  4J19 A;  3BT9 A;  3TP0 A;  4X1E A;  2NVY J;  4DZP A;  4A3M J;  1AKH B;  4DZJ A;  2MGQ A;  3Q0U A;  4DW6 A;  4I76 A;  2Y9Z A;  1BW6 A;  3K2A A;  1JUP A;  2DN0 A;  2VPR A;  4M3E A;  3PO3 J;  3FK7 A;  1GV2 A;  1JUS A;  3Q0W A;  2EZH A;  1FTT A;  2ID3 A;  2HDD A;  2LY9 A;  1X2M A;  1IDY A;  5J1R A;  1MBG A;  1WI3 A;  2EH3 A;  2HOA A;  1AU7 A;  1Q1V A;  5E3L A;  4A3I J;  3BG5 A;  5IP9 J;  1DU0 A;  4L5E A;  2KT0 A;  3ZQG A;  1D5Y A;  1XS9 A;  1LFB A;  5GPA A;  4MFE A;  2LTP A;  2HOT A;  2OPT A;  1IRZ A;  2NVX J;  4XID A;  3ZQC A;  1IV6 A;  2NOG A;  1JKQ C;  3JRG A;  1JTX A;  2K9Q A;  4D7M A;  3OSG A;  1Z0X A;  2CQQ A;  2DMT A;  2DMU A;  1W0T A;  4M3G A;  1MBK A;  3S14 J;  3CDL A;  5IYC J;  3IH3 A;  2H1K A;  1A6I A;  2CUF A;  4BKX A;  2AO9 A;  3Q0V A;  4D7N A;  1E3O C;  4V2F A;  3BG9 A;  4A69 C;  1X58 A;  3F0C A;  1F43 A;  4RBO A;  2Y30 A;  1OCT C;  2JWT A;  4XRM A;  3ZQH A;  2M8G X;  2FD5 A;  4M3F A;  3WHB A;  1ENH A;  2W48 A;  1RR7 A;  5EGO A;  2O8K A;  1S7E A;  2LK2 A;  3O8H A;  3OOU A;  5FKM A;  5F0H A;  1YRN B;  2LKX A;  3GTM J;  4MIM A;  1JGG A;  5FKL A;  3HKZ N;  2E2J J;  3S2H J;  1TWH J;  3S16 J;  4M6V A;  3HB9 A;  2M34 A;  2R7Z J;  4A3L J;  1GVD A;  2L7M P;  3LNQ A;  3OIO A;  2DMQ A;  3LSJ A;  3FK6 A;  2EBI A;  2VI6 A;  4FE7 A;  5EG0 A;  1WPK A;  2IBD A;  3A01 B;  1JKP C;  3NAU A;  2MW8 A;  2XGC A;  2O7O A;  2CJJ A;  2R93 J;  2VKV A;  1BL0 A;  1Y1V J;  5E3M A;  2EZK A;  3M3Y J;  2AHQ A;  4RDU A;  1PUF A;  4BXX J;  3HOW J;  1MBH A;  3FIW A;  3HGG A;  1HCR A;  1QVT A;  5IYD J;  2PMZ N;  3VPR A;  4BY1 J;  3S1N J;  2LVS A;  2E2H J;  3IV5 A;  2R5Y B;  5EG0 B;  2H8R A;  1ZTR A;  3BTC A;  5K7H A;  2YUS A;  4Y52 J;  1XG1 A;  2HXI A;  4CYC B;  4C3J J;  1PUF B;  1JT6 A;  4CYC A;  1TWF J;  2R92 J;  3MKL A;  2Y31 A;  4GFB A;  1TWC J;  3CMY A;  4W97 A;  2VKE A;  4XRS A;  3GTJ J;  2I10 A;  2XB5 A;  5FKN A;  3G1O A;  1LE8 A;  2XPU A;  3H3V K;  5IP7 J;  3G1L A;  3GTG J;  1ZR2 A;  2O9L A;  3TW7 A;  1MSF C;  2ZB9 A;  1HDD C;  2DA6 A;  5GP9 A;  3JRH A;  3MVP A;  1JJ8 C;  1HLV A;  4HNV A;  1ZGW A;  3S17 J;  5HOD A;  3HEF A;  2DA3 A;  1VF9 A;  1U8B A;  3BR3 A;  1ETO A;  3ZQF A;  2LLK A;  4B4C A;  4JX6 A;  4JX5 A;  2VUM J;  4JX4 A;  5EZG A;  5EDN A;  4A3F J;  3JR9 A;  4XIC A;  2K9N A;  5FKK A;  2L0K A;  2X9D A;  3HOV J;  4FE4 A;  2L7Z A;  1U78 A;  2RAE A;  3S1Q J;  5E3N A;  4AYB N;  2DA5 A;  2LR8 A;  2X48 A;  1ITY A;  3HDD A;  1ORK A;  5K7F A;  4I6Z A;  1IDZ A;  5FKO A;  5M5W J;  1T33 A;  3E7L A;  3HM5 A;  1R9T J;  3RQI A;  2NS8 A;  5F08 A;  1FIA A;  5C4J J;  3HOY J;  5IOY A;  2DMN A;  3TP3 A;  1G2H A;  1X2N A;  1K83 J;  1WH7 A;  1JTY A;  1OJL A;  3LSG A;  3BTI A;  1GUU A;  1P7I A;  2TRT A;  3G1M A;  4LOC A;  4A3B J;  3SDG A;  5C44 J;  5FJ8 J;  2L9R A;  4A3K J;  5DTD A;  3JRF A;  2DA2 A;  2M0C A;  3RKQ A;  4BY7 J;  1QPI A;  2JJ7 A;  4C3H J;  1WH5 A;  3FKI J;  1ZQ3 P;  1VFC A;  3BTL A;  2DJN A;  2DA4 A;  2XGD A;  1I50 J;  5GPC A;  1HOM A;  3GBG A;  3JRE A;  2JA5 J;  2M9H A;  4UUS B;  5M3F J;  3SJM A;  3IH4 A;  2JA6 J;  5IYB J;  3S2D J;  1BA5 A;  3NAR A;  3JRB A;  1ETQ A;  3BQY A;  3JRD A;  1DU6 A;  1FJL A;  1FIP A;  5C4X J;  2JN6 A;  4A3J J;  2LP0 A;  1U9O A;  2XPW A;  5J3L A;  4M3D A;  1U9N A;  3JRI A;  4A93 J;  2R5Z A;  1JUM A;  2QCO A;  4M3B A;  2R5Z B;  1F36 A;  3LSR A;  2DTZ A;  2JK3 A;  1POG A;  2NS7 A;  2MSY A;  4BBS J;  4JYK A;  1NTC A;  1RKT A;  1RET A;  4MFD A;  3SFI A;  4QSH A;  3BG3 A;  5IP6 A;  1BJZ A;  5IOZ A;  1H88 C;  3LSP A;  2JMW A;  2EQR A;  2EZI A;  4IHY A;  1B72 B;  2LFB A;  2DMP A;  2NVT J;  2FQ4 A;  1RKW A;  3QQA A;  4Y7N J;  3GTK J;  1QVU A;  1ZR4 A;  5J1Y A;  4QTR A;  3S1M J;  3C2B A;  1MNM C;  1HDP A;  2XB0 X;  2QF7 A;  3HOU J;  4IHX A;  4FIS A;  4ABZ A;  2FX0 A;  1ETX A;  2CU7 A;  4BBR J;  2B63 J;  2E2I J;  5FLM J;  2HI3 A;  2Y2Z A;  3O8G A;  2ELK A;  2MG4 A;  3D1N I;  1MBF A;  3PM1 A;  2M2E A;  3LOC A;  4FCY A;  3WHC A;  2HQ5 A;  5IPA A;  1IUF A;  2JA8 J;  5J1U A;  4G12 A;  1P7J A;  1SAN A;  1LE8 B;  1JKO C;  2GBY A;  2K40 A;  2FJ1 A;  2XPV A;  2Y0S N;  3RZO J;  1IGN A;  2XSD C;  3I4M J;  1WCM J;  3HBL A;  5F1J A;  3BR2 A;  5BNG A;  1YRN A;  3HOX J;  2GLO A;  1UHS A;  2CUE A;  3JRA A; 
#chains in the Genus database with same CATH topology
 4ESB A;  4FX0 A;  5L3E A;  3IH2 A;  2OTJ I;  1JT0 A;  3OYJ A;  4B1R A;  3MD2 A;  2L5Q A;  4JOM A;  2ZNY A;  3K9T A;  2HQA A;  3WE2 A;  5FRN A;  2AQE A;  3BJ6 A;  3QP5 A;  1K78 B;  1ETK A;  4B44 A;  1VZ0 A;  2TCT A;  4RA2 A;  3HPG A;  1MBJ A;  2BHZ A;  1MH3 A;  1IXC A;  4ZYD A;  5F64 A;  2QZ8 A;  1OIS A;  1LDD A;  3A03 A;  5B3S H;  3H5N A;  2L02 A;  4BJ5 C;  1VQM I;  4V2G A;  4IQ4 A;  1TTY A;  4AD9 A;  3CES A;  1NK3 P;  2COB A;  2LG4 A;  2WAQ N;  3M7G A;  3PIP F;  1R5G A;  1TP4 A;  2R5Y A;  4XMY A;  1ZG5 A;  4IHS A;  4BEH A;  3UKG A;  2DPD A;  3VYU B;  4NC7 A;  1CF7 A;  3B6A A;  1FOK A;  3MCZ A;  4A3E J;  2GAU A;  2E1O A;  3SZT A;  1KZH A;  1OFC X;  1OCR H;  2G0E A;  3GEZ A;  4ENK A;  3GTL J;  1BW5 A;  1GDT A;  2M7A A;  5KAI C;  1XPX A;  5CVV A;  2P5K A;  3KYD B;  3J7Y J;  3CC4 I;  1H8A C;  2CFO A;  1YS7 A;  3OL3 A;  2VN2 A;  4Y17 A;  5BMZ A;  1SFX A;  4C2M J;  2ZXW H;  1OR7 C;  4Z6Y A;  2UV1 A;  1MBE A;  5TIS C;  3CF5 F;  5AIP A;  3B73 A;  3TED A;  3BR0 A;  3Q3S A;  2X6Y A;  3M8J A;  4PSX A;  1W4M A;  4MO7 A;  1VND A;  4HV5 A;  1XC5 A;  4PGG A;  3RDI A;  2K9S A;  1XB4 A;  3C18 A;  4PSW A;  4UUT A;  3OYD A;  2W24 A;  3A02 A;  2VJ4 A;  3DFG A;  3LA3 A;  2E19 A;  4KIF A;  4BQN A;  1N25 A;  2YS9 A;  4B8X A;  1X1C A;  4DGW B;  3PO2 J;  1FP1 D;  3H3U A;  3ECO A;  2ZSH B;  2HVS A;  1YHQ I;  3OSF A;  1FY7 A;  2Q2E A;  5JLW A;  5FO5 A;  2NOJ B;  1O7F A;  3OMY A;  1R1T A;  3KYC B;  2F5V A;  3QOD A;  4XK4 A;  1J09 A;  5HLT A;  5E3O A;  4FTH A;  4F93 B;  1U2W A;  4ZYA A;  3ULQ B;  1X1D A;  5D6F A;  1TT5 B;  5M5X J;  1ZGA A;  3MKY B;  2XAG A;  4HNT A;  4A3D J;  4RS8 A;  2PX9 A;  4YFN F;  3BQZ A;  4E7K A;  2E34 A;  3FIS A;  2CV1 A;  2O0Y A;  4J19 A;  3BT9 A;  3TP0 A;  4OIQ F;  1F1Z A;  3F8M A;  2TDX A;  4DZJ A;  5L3C A;  4DW6 A;  2IT0 A;  3J80 Z;  4HF2 A;  3K2A A;  5AIQ A;  1JI8 A;  3DV8 A;  4NC8 A;  1DUX C;  1PDN C;  2L4M A;  2EB7 A;  2FQ3 A;  3BZC A;  1KU9 A;  4OIR F;  2IGK A;  2XRO A;  4G6T B;  2EZH A;  1DDN A;  5L3D A;  3QYB A;  4XL9 A;  2CUZ A;  2LY9 A;  3RJP A;  1RUO A;  4Y3O A;  1WI3 A;  2EH3 A;  3CP2 A;  2XGX A;  2WA0 A;  1Q1V A;  1B9M A;  4OOI A;  4A3I J;  2EIJ H;  5CVR A;  3BG5 A;  4IRG A;  2HQN A;  4L5E A;  3KET A;  2GZW A;  1U8R A;  4L9N A;  4FT8 A;  4ZJZ A;  1XS9 A;  1ZG1 A;  4G94 A;  1HA8 A;  2DYR H;  5GPA A;  4MFE A;  3I58 A;  4UV8 A;  3G2B A;  1YOV B;  5LRS A;  3DPU A;  2H27 A;  1IRZ A;  2NVX J;  2Y0S A;  3FXQ A;  1VQN I;  1W5T A;  1IN8 A;  4LFU A;  5JVG F;  1KYW A;  2D1H A;  3BG7 A;  1KA8 A;  3K1M A;  4WXD A;  2VON A;  1A6Q A;  3LFK A;  4XNF A;  5H20 A;  3PUF A;  1FBS A;  1W36 D;  2P6S A;  2K9Q A;  2A69 F;  1VQK I;  1FMV A;  5JHF A;  1T08 B;  1OCO H;  2DMU A;  4LLL A;  1YFH A;  2FEZ A;  4GRI A;  3RYP A;  3IH3 A;  4HG2 A;  1QNT A;  2K27 A;  4FX4 A;  2AO9 A;  3Q0V A;  3W2W A;  5DCF A;  1M1E B;  4HW0 A;  4EGZ A;  3F0C A;  1WRJ A;  1XSV A;  4RBO A;  3TMO A;  2Y30 A;  2PJR A;  5HNF A;  4E70 A;  2XSJ C;  5ERI A;  2FOK A;  3ZQH A;  3I55 I;  2ZJR F;  2GXA A;  3I0T A;  3WHB A;  4Y13 A;  3OYH A;  1QA6 A;  1ENH A;  2R7Q A;  3IRQ A;  2O8K A;  3BZK A;  1S7E A;  2G7H A;  2VIX A;  1U0J A;  3I71 A;  3A0B C;  3O8H A;  3RKY A;  1ZRD A;  1YRN B;  1XSD A;  2P7V B;  4XSX F;  1Y39 A;  5FKL A;  3L2Q A;  2E1C A;  2G7U A;  3QWL A;  2L7K A;  1Z3Y A;  3KPH A;  3HB9 A;  2B9S A;  4A3L J;  2I5U A;  4B09 A;  1BIA A;  2DMQ A;  2EBI A;  3LQR A;  1F9N A;  2XAH A;  3O3K A;  4LIU A;  3E5Q A;  4NC6 A;  2BY1 A;  2OZ6 A;  2WC2 A;  2KIM A;  2ZXJ A;  5D6E A;  2JRM A;  2K7L A;  3ZP5 A;  3WTS C;  3R0A A;  2R93 J;  2MLG A;  2V1X A;  1I3A A;  3FMQ A;  2AHQ A;  4BXX J;  2F4M B;  3M8F A;  5IYD J;  2PMZ N;  4BY1 J;  2LVS A;  2E2H J;  3CMM A;  3ELK A;  4BUP A;  5EG0 B;  2ACJ A;  3KEY A;  5KK1 A;  5LFA A;  1ZTR A;  4QPQ A;  1IN6 A;  2QKM B;  2NRA C;  3T8T A;  2V9P A;  3FXU A;  2A05 A;  4CCL A;  4G9Y A;  4LIT A;  1O7L A;  2QYO A;  3HC7 A;  1TWF J;  2XF5 A;  3BRO A;  1E17 A;  1SFE A;  3ZMZ A;  3MKL A;  1HC8 A;  1EH8 A;  2PI0 A;  5F1R A;  3GWZ A;  3DKW A;  1BN5 A;  1Z7U A;  2LRE A;  3TO9 A;  3RPQ A;  3PL8 A;  2Y48 A;  1ZGJ A;  2XB5 A;  5ICC A;  3E0J B;  3W2A A;  5CQG A;  3GFJ A;  1D1C A;  3GTG J;  4PUS A;  2XF6 A;  1MSF C;  3VB2 A;  2ZB9 A;  1XCB A;  1EJ9 A;  3E1S A;  4A5M A;  1JJ8 C;  2RV8 A;  3D5R C;  3M07 A;  4RAG A;  1HLV A;  1I1S A;  3ZGK A;  2GXB A;  4XLH A;  1IW7 F;  4N4O B;  2V6E A;  3LA7 A;  4B3X A;  2FUG 2;  2MAB A;  5K5O A;  3P9I A;  3ZQF A;  2MD0 A;  4JX6 A;  1IUY A;  5HS7 A;  3AG1 H;  2EFN A;  1YX3 A;  3QU3 A;  1K4S A;  4YFX F;  5FKK A;  4UUV A;  3OS2 A;  1WJA A;  4KA4 A;  1ZRF A;  2X9D A;  2H6B A;  1IN5 A;  2IGN A;  4AU7 A;  1J0R A;  1U78 A;  3S1Q J;  2CYY A;  4KMU X;  3KFW X;  4YFK F;  5E3N A;  1YS6 A;  2VKD A;  3GF2 A;  1F5T A;  3CCR I;  3CME I;  5K7F A;  1TW2 A;  2KP6 A;  2RC4 A;  3KZZ A;  1IDZ A;  3ZR8 X;  4JBA A;  1G3Y A;  1P4W A;  1BJA A;  4B43 A;  3E7L A;  4M9X A;  4OIN F;  3GYH X;  3HM5 A;  1R9T J;  2UWM A;  1GVJ A;  2DU9 A;  3K2Z A;  3F8N A;  5C4J J;  3HOY J;  3S8P A;  5E1X A;  3TP3 A;  5AON A;  3FXM A;  3ESW B;  3LWF A;  1JTY A;  1QQI A;  3FX3 A;  1P7I A;  2TRT A;  3S32 A;  2LY2 A;  1IAW A;  1KGS A;  5FJ8 J;  4KIT B;  3FHZ A;  4A3K J;  4E4H A;  5FFX A;  2LNB A;  3CDH A;  3HZJ A;  2D45 A;  4ETS A;  1RR8 C;  5ILS A;  3DPL C;  1XGS A;  4C3H J;  4WX9 A;  4IX7 A;  5BPD A;  1R6R A;  1OCC H;  1AOY A;  1ZQ3 P;  1VFC A;  5HS8 A;  2QA4 I;  5JHU A;  3BTL A;  3I59 B;  2L3D A;  4F7Z A;  1FSH A;  3DLL F;  2XGD A;  2QQ9 A;  1YW8 A;  3HRM A;  4HQE A;  1MJB A;  3EDP A;  1U6G A;  4BJ6 C;  1R00 A;  2M9H A;  3QPT A;  3SEZ A;  5IYB J;  4AM3 A;  2LF8 A;  3EYY A;  3JRB A;  2BVM A;  2HKX A;  5J40 A;  4J01 A;  3ECH A;  3EUK L;  3GZ5 A;  1FZP B;  5FRM A;  2EV5 A;  1FOY A;  2LP0 A;  2K86 A;  5J3L A;  2R4G A;  4Y4R A;  1EKE A;  2VT2 A;  4WCG A;  1REP C;  3S2W A;  3GFI A;  4L18 B;  1MJA A;  3LSR A;  3KE2 A;  3CP8 A;  2MSY A;  2XAS A;  3HJE A;  1RKT A;  1RET A;  2EV6 A;  3V8L A;  1VQ5 I;  2DFH A;  1IN4 A;  4AVP A;  4E7S A;  1W7P A;  3RPU D;  2ZME A;  1B72 B;  1B6A A;  2A5W A;  2H94 A;  2LBF A;  4IQJ A;  4IO9 F;  4LG0 B;  2M87 A;  2KRF A;  1ZRE A;  1PP7 U;  2NVT J;  3RCO A;  1RKW A;  3QQA A;  1YJ9 I;  1HW5 A;  1QZE A;  4QTR A;  3S1M J;  1UB9 A;  4L5J A;  5HNH A;  2HU9 A;  4CUG A;  3ERE D;  3JTG A;  2QF7 A;  4IHX A;  4ASN A;  4ABZ A;  5D8K B;  3OYN A;  4BBR J;  2CU7 A;  2W4S A;  5FLM J;  1DQU A;  3AFH A;  3K4N A;  1R5I D;  2MG4 A;  2ELH A;  2V7F A;  3D1N I;  1VQO I;  2RDP A;  1MBF A;  2F6C A;  3AG4 H;  5B66 C;  2M2E A;  1X1A A;  4MTE A;  4ITV A;  2KZV A;  2JA8 J;  2J5P A;  5J1U A;  3U1D A;  3GZN B;  3VDX A;  1LE8 B;  4CDG A;  3MMY B;  2FJ1 A;  2ICW G;  2XPV A;  4AIH A;  3CCS I;  3OYA A;  1FYL A;  2XSD C;  2JPC A;  1LJ9 A;  2M1B A;  4L9T A;  2XHK A;  1I39 A;  1A04 A;  2GOM A;  2CUE A;  2EFO A;  5HDG A;  4X0G A;  4QLC U;  5LHG A;  2YX7 A;  4K2E A;  1ACI A;  3Q9S A;  5DUK A;  2ID6 A;  2H6C A;  1HBX G;  2K9L A;  2M4G A;  3BJA A;  5HLG A;  2PLY A;  4YRV A;  5E1W A;  1PYV A;  3ZQL A;  3HXL A;  2WV1 A;  1RC9 A;  1J75 A;  2R7U A;  3ZXS A;  2XIG A;  1GV5 A;  1T56 A;  3AKZ A;  1EH7 A;  2F4I A;  2LC2 A;  3ZMS A;  1Z77 A;  3LA2 A;  1QRY A;  3JSO A;  4I7H A;  1DPU A;  2VT3 A;  5K7Z A;  3DKX A;  1ZK8 A;  3M8E A;  5LD2 C;  2ME0 A;  2DCE A;  1RRJ A;  3IP4 B;  4B47 A;  4U7D A;  2OJE D;  1B72 A;  4UNO A;  2PQ8 A;  1UG2 A;  4IEJ A;  5DYM A;  3HSR A;  5F27 A;  1CGP A;  3FXO A;  1TT0 A;  3ZPL A;  3AL0 C;  3MQ0 A;  3E3V A;  1K61 A;  2E5N A;  2XGE A;  3OV8 A;  3MZ8 A;  1DGW Y;  2RRE A;  1J2X A;  1HW2 A;  2BW3 A;  2Y69 H;  4Q4Z F;  1RPW A;  3MFK A;  1S3J A;  1IG7 A;  1SVM A;  3J81 K;  2D5V A;  2R7F A;  3T1B A;  4HRI A;  3HRU A;  3JSP A;  2RNJ A;  5DS9 A;  2HYJ A;  2HS5 A;  4BH9 A;  1KQ9 A;  2QKL B;  2DBB A;  4ON0 A;  4HSR A;  2MC4 A;  3GTO J;  1T0F A;  5EJC A;  3V42 A;  3N4M A;  2Q8K A;  3S93 A;  1XGN A;  2KLO A;  3I9V 2;  2CSO A;  2V9V A;  4YII A;  2ECC A;  3HRT A;  2DW4 A;  1Y6I A;  3L7W A;  1NG7 A;  3KP5 A;  1P4A A;  4XN0 A;  4DYQ A;  4QIW N;  1ETY A;  1OCZ H;  5FB2 A;  4MLO A;  5DD8 A;  4LG3 A;  3BR1 A;  3WG7 H;  4KYW A;  2GA2 A;  2R7S A;  3OYF A;  1LEB A;  2QWW A;  3I4N J;  4F3Q A;  4NNJ A;  1ZKG A;  1ZHF A;  1U5T B;  3F9K A;  1VQ8 I;  1V3F A;  4L9J A;  3RIR A;  2LOO A;  2FMY A;  1I5Z A;  3HRS A;  5H6Q A;  2MYS A;  4XOT A;  9ANT A;  1JHF A;  1ON1 A;  2E71 A;  2HPI A;  1AKH A;  1MH4 A;  4P55 A;  3QRF F;  3ZN1 A;  1D8J A;  3WU2 C;  3S3M A;  1WI9 A;  2CRG A;  5LGN A;  1X4P A;  5J47 A;  4J00 A;  2NVQ J;  2CH0 A;  2CQ7 A;  3P7N A;  2VXD A;  3SHF A;  2QVO A;  2DA1 A;  3W6V A;  1R4M B;  5GAD J;  4EV0 A;  1JJ6 C;  3FKJ A;  1BC8 C;  1EF4 A;  2PG4 A;  2PFB A;  3VYT B;  4X1E A;  2NVY J;  4EVI A;  1AKH B;  1XGM A;  2HQR A;  2MGQ A;  3KZI C;  3T8R A;  1LNW A;  1BW6 A;  2OBP A;  2MH2 A;  2QQB A;  2R3S A;  2FA5 A;  3BDD A;  5J8F A;  2P5V A;  2R7W A;  1QHG A;  4M3E A;  4BHP A;  3WTW C;  3FK7 A;  4BAC A;  3TOA A;  2ZC2 A;  1GV2 A;  1JUS A;  3GX4 X;  3RQ4 A;  3OYI A;  1FTT A;  1J9I A;  3SXY A;  2Z3Y A;  3KP6 A;  4HST A;  3I3L A;  3D0S A;  2KRC A;  4GCV A;  4S04 A;  2HOA A;  2QQ8 A;  1YJN I;  2XAQ A;  4DNC A;  4YIF A;  4FET A;  1DU0 A;  2BHY A;  1R5H A;  4MHG A;  4KT6 A;  1X19 A;  2H09 A;  1LFB A;  2Q1Z B;  1FSE A;  4EQQ A;  4G8X A;  2K9M A;  4NQW A;  4RM2 A;  3ZQC A;  1IV6 A;  4G7Z F;  2HR3 A;  3E6D A;  1JKQ C;  2F5D A;  3FHN A;  2IGM A;  2LKS A;  2X1D A;  3GCM A;  2JT1 A;  3V8J A;  1Z0X A;  1VQ7 I;  2RQP A;  4IZZ A;  1T0F C;  1MBK A;  4BS9 A;  2VOD A;  5FLX Z;  5FRO A;  2H1K A;  1P6R A;  2M8E A;  2DFI A;  1A6I A;  2CUF A;  2ISY A;  4DBQ A;  3J81 Z;  4TV7 A;  4D7N A;  4V2F A;  1E3O C;  1MMN A;  1MD0 A;  2D1V A;  4A69 C;  1ZH5 A;  5A2Q K;  1F43 A;  1XTA A;  1MMG A;  3DU5 A;  2LSO A;  3TQN A;  2K4J A;  1K79 A;  4HV6 A;  2M8G X;  2F48 A;  3OOP A;  1UCR A;  3G4S I;  1R4N B;  3J7A Y;  2EFP A;  1JHH A;  4UB6 C;  4BQA A;  5BS6 A;  3IAS 2;  2J5O A;  4UHT A;  1IXS B;  2EA2 A;  2EFQ A;  3ZCO A;  4LMY A;  3MKW B;  2PJR B;  1B9N A;  1RNL A;  3CCE I;  1BR4 A;  3QPH A;  4AYB A;  4KDP A;  1ZG3 A;  3ASO H;  3T5X A;  3IKT A;  2E2J J;  2WAD A;  2FBH A;  3H5A A;  1Q1H A;  3KP3 A;  2BYV E;  3IKV A;  3WTT C;  4M6V A;  4GO1 A;  2KFD A;  2R7Z J;  4MGR A;  1BBY A;  1BI0 A;  1K78 A;  3U2R A;  2BVL A;  4IXA A;  3QOE A;  2R7T A;  3EYI A;  1GXQ A;  4FE7 A;  3WTU C;  3H35 A;  2Z5U A;  1WPK A;  1X4O A;  4FAS D;  4L0Y B;  5GAG J;  2MH9 A;  2WV0 A;  2V79 A;  2A5Y B;  2XGC A;  4CIC A;  1QGP A;  2O7O A;  3FM5 A;  1MKM A;  2CJJ A;  2H8W A;  2KPM A;  1SAU A;  2EZK A;  1WFX A;  5KCM A;  4RDU A;  3HOW J;  4BQQ A;  3ABM H;  3HGG A;  1HCR A;  1QVT A;  4G6D A;  4RMN A;  3IV5 A;  4CXF A;  2DQL A;  2EIL H;  4NQW B;  1IN7 A;  3OYK A;  2H8R A;  3K4C A;  2R7X A;  1T2K A;  5K7H A;  2VAS A;  4BE2 A;  2HDC A;  2OAZ A;  1HQC A;  2W1O A;  1QZZ A;  2HYF A;  4Y52 J;  2HZD A;  1TQP A;  2CS3 A;  2HXI A;  5HDK A;  4CYC B;  1HSJ A;  4C3J J;  3FZV A;  4CYC A;  2QSG X;  2JZY A;  1MGT A;  2A68 F;  3VSK A;  4XLP F;  3LAJ A;  2QUF A;  2WY7 Q;  4D0P A;  5HVQ C;  1PP8 F;  4EM0 B;  3VEP A;  5L3B A;  4Q5S F;  3C7J A;  3OYC A;  4I2O A;  1EV7 A;  3LMM A;  3QU6 A;  1YYV A;  2XPU A;  4PJM A;  3EUA A;  2FBK A;  5CVU A;  2BV6 A;  3WOD F;  5CVI A;  1Y0U A;  1TL8 A;  1XN7 A;  3F21 A;  5J6X A;  3CO6 C;  2F5C A;  4PFP A;  3MVP A;  5IY5 H;  4OAY A;  5ED4 A;  1G3W A;  4C2T A;  2VOP A;  4HNV A;  2O5R A;  2VLA A;  5EEH A;  1ZGW A;  3HEF A;  2DA3 A;  4UVA A;  2GIV A;  4YIR X;  2ADU A;  2BW3 B;  2YPR A;  2FML A;  4ZH4 F;  2IA0 A;  4O5V A;  4B4C A;  1ZLK A;  2OC6 A;  1K7A A;  2X0L A;  4JX5 A;  2VUM J;  4JX4 A;  5EZG A;  3HHG A;  5DD4 A;  3NEU A;  5LBQ A;  2M5W A;  3DLA A;  5FLX K;  4F55 A;  2EJR A;  4H0E A;  5LEJ A;  3FXL A;  2L0K A;  2OCE A;  4AYB N;  1RZ4 A;  2X48 A;  4NB5 A;  1N78 A;  2DI3 A;  3RTR A;  2DDB A;  2NNY A;  3IL2 A;  1WJC A;  3GO5 A;  1I6X A;  1XMA A;  2CQN A;  3BZ6 A;  2OUM A;  5FKO A;  1QPM A;  5M5W J;  4XRF A;  1T33 A;  3L9F A;  3RQI A;  3CO7 C;  1QU3 A;  2HWV A;  2QSF X;  2Z16 A;  1VQ4 I;  4CZC A;  2R7D A;  5K5Q A;  4CCO A;  2CW7 A;  5IOY A;  2DMN A;  1ODD A;  1X2N A;  1MMS A;  1WH7 A;  3PIO F;  1S7O A;  1KU3 A;  1OJL A;  1UG0 A;  2WTE A;  2HEO A;  4HLX A;  4XKB A;  3G1M A;  4BDZ A;  2E35 A;  1UHW A;  5C44 J;  3EUH A;  4CCJ A;  1B1B A;  5DTD A;  4KIS A;  3CLO A;  2X1C A;  4R8H A;  1QPI A;  2CFX A;  2STW A;  1WJE A;  3CD6 I;  4E7I A;  2JJ7 A;  3V8K A;  1WH5 A;  4DBR A;  4RB2 C;  3L2V A;  3JAM K;  4Y15 A;  4HZF A;  1FYM A;  5FD6 A;  2JSP A;  1LFP A;  2V9K A;  3RKW A;  1IV8 A;  5EEG A;  3BY6 A;  3K0L A;  1HOM A;  3K4J A;  1O3S A;  4UUS B;  3SJM A;  5M3F J;  5BPI A;  3IH4 A;  3S2D J;  1PUE E;  3CJT B;  2FNA A;  3F6V A;  3G6E I;  3FBI B;  3CCV I;  2FF4 A;  2PJP A;  2A6E F;  2DJI A;  3Q9V A;  1FIP A;  1FJL A;  1DU6 A;  5C4X J;  1X1B A;  2JN6 A;  4A3J J;  1U9O A;  2IP2 A;  3JRI A;  1U5T A;  3EET A;  4A93 J;  4RM3 A;  2P8T A;  2R5Z A;  2LH9 A;  4I01 A;  3R0J A;  2QCO A;  3U21 A;  2R5Z B;  1F36 A;  2M30 A;  4GYI A;  3HIF A;  2JK3 A;  1MND A;  4LJZ F;  1FLI A;  4M9Z A;  1LUJ B;  2P5L C;  4BBS J;  3L2W A;  3PNV A;  3PFI A;  2DPU A;  4QSH A;  3BG3 A;  2ZFU A;  3CUO A;  4A0Y A;  5IOZ A;  3WTV C;  2JMW A;  4IHY A;  1G3S A;  3DP7 A;  3BC8 A;  3P9C A;  1D5V A;  3MEX A;  3SFZ A;  3F8F A;  3ZRG A;  2FQ4 A;  3CCJ I;  2Q0O A;  1E0E A;  2A07 F;  1ON2 A;  3LAP A;  3ERM A;  1IO2 A;  3HOU J;  2VB6 A;  1WJD A;  1MIJ A;  3FM3 A;  2FX0 A;  3HUG A;  4Q48 A;  3V7C A;  5LHH A;  1SFK A;  2W84 A;  3FF5 A;  3RI4 A;  2E2I J;  1MDM A;  3E97 A;  4EJU A;  1BI3 A;  1BIB A;  3CC7 I;  2CQK A;  2W7N A;  4BE0 A;  3PM1 A;  2LKP A;  5KNL A;  1WSU A;  1B4A A;  1FWZ A;  2IA2 A;  3WHC A;  4ZZD A;  5TRD A;  2HQ5 A;  1IUF A;  4M73 A;  1P7J A;  2K3P A;  2GBY A;  5D8L B;  1YIT I;  2P6T A;  3FWE A;  3HBL A;  5F1J A;  5BNG A;  1YRN A;  1FNN A;  1V5G A;  4E7J A;  3HOX J;  3O6B B;  2GLO A;  4XQF A;  2X6O A;  5JR3 A;  4I0A A;  1X3Z B;  2IEK A;  4KJZ A;  4M72 A;  3TW6 A;  2XKP A;  1IC8 A;  1I6H J;  1TWG J;  2KDZ A;  3HPH A;  3QPS A;  2PMH A;  5DDG A;  2JA7 J;  3PJR A;  5C3E J;  4JP0 A;  3WG9 A;  3G71 I;  2P81 A;  2Z33 A;  2Z9O A;  1BOA A;  1T95 A;  3ZQI A;  5B1A H;  4UUS A;  1CQT A;  3REO A;  4ZTJ A;  2HDW A;  4CCM A;  4LB5 A;  4RAZ A;  2PN6 A;  3BCA A;  4S05 A;  3W6K B;  1P4X A;  4DYR A;  2KIU A;  2HKO A;  3NWT A;  3RZD J;  1R71 A;  3ZMT A;  1WHU A;  5EZH A;  4U0Y A;  4A3C J;  4GDF A;  5ILV A;  3S15 J;  5ICF A;  1XD7 A;  4LK1 F;  1A5J A;  1TLH B;  1SD7 A;  2F5E A;  3SZP A;  4A2U A;  3H0G J;  4HX8 A;  1FC3 A;  2O6G E;  1LDJ A;  1I1G A;  1R58 A;  2Z2S B;  3ZMD A;  1QHH D;  4MNU A;  2KZG A;  1U5T C;  2OF7 A;  5HOO A;  2KHM A;  4BHB A;  2OQG A;  3SEQ A;  4NDL A;  3MN2 A;  3VYR B;  3K1N A;  1K6Y A;  1Z21 A;  4LGW A;  3DCF A;  2ZJP F;  5E17 F;  3ZQ7 A;  1YE9 A;  3L1P A;  4S0H B;  2R0Q C;  3BTJ A;  1FEX A;  2QQA A;  3LSM A;  3BR5 A;  1TC3 C;  1WWX A;  1SFO J;  3JW4 A;  1ETV A;  3HUG B;  3GFM A;  1YG2 A;  3VOD A;  3K4L A;  3KP7 A;  2X85 A;  1R49 A;  2DT5 A;  2CQX A;  5CQE A;  3CCY A;  3JRC A;  1T38 A;  4P1W A;  4ZYG A;  5EGO B;  3M4O J;  3H36 A;  1UHM A;  1S9H A;  3EUH C;  3K69 A;  1D8K A;  2M4K A;  3ZQQ A;  3NRV A;  1DGR M;  2YSR A;  3FMR A;  4BQO A;  1MSE C;  1D1A A;  3CJN A;  2GM4 A;  3I54 A;  1AHD P;  1R36 A;  2F2E A;  4M71 A;  1ETW A;  1BM9 A;  1WGX A;  4HF1 A;  3R6S A;  1UMQ A;  3KEO A;  3CJR B;  1N75 A;  3OYL A;  3DEU A;  4L0Z B;  3MAJ A;  2EZL A;  2IAI A;  5J4V A;  4D5F A;  1Z7L A;  4E7H A;  1VI0 A;  3HOZ J;  3V4G A;  2Z1D A;  3QPL A;  5JFR A;  5EF6 A;  3UR3 C;  1Z6R A;  1RI7 A;  4XKC A;  3PQK A;  1QBJ A;  3DWL E;  1B8I B;  1RIO H;  2R7O A;  1YW7 A;  2OZU A;  3E5U A;  2EIK H;  3S1R J;  2XC7 A;  4DYC A;  3QYF A;  1V5F A;  1FTZ A;  4F52 A;  1ULY A;  3TDU C;  3R60 A;  1EH6 A;  3C1D A;  3DTK A;  3K10 A;  3A4C A;  1MW7 A;  2L7F P;  3H3Z A;  4BEH B;  5JI6 A;  3VFZ A;  4N9I A;  1TWA J;  4HX7 A;  5EEA A;  4MEY F;  4EEF G;  3FDY A;  2E1N A;  1EA3 A;  1OCP A;  2JVG A;  3GZ6 A;  1B8I A;  2NYX A;  1SVO A;  3AG2 H;  3TDZ C;  4CYD A;  4XLC A;  1LFU P;  1D3Y A;  2A6H F;  4A6E A;  1C0W A;  4A3M J;  1KON A;  2VQH A;  2MBF A;  3HOS A;  3MZY A;  1JUP A;  2VQL A;  2DYS H;  2DN0 A;  3HG9 A;  2VPR A;  2PEX A;  4FHT A;  2KKO A;  3HOT A;  4WF2 A;  3ASN H;  1LQ1 A;  4XLF A;  2E60 A;  3BJO A;  1T8I A;  4XN3 A;  2ZO4 A;  5E8G A;  1Y8R B;  2ID3 A;  3WU1 B;  1S72 I;  2CGP A;  2HDD A;  4KIB A;  1K4T A;  2P0W A;  4CSW A;  1IDY A;  4BL0 B;  4P5O A;  4P9F A;  2DTR A;  4EMS A;  3R4K A;  1JE8 A;  1G59 A;  2KT0 A;  3ZQG A;  2UUZ A;  3H9J A;  1FT9 A;  3IRR A;  1A35 A;  1D5Y A;  2K5C A;  2VJ5 A;  3A2K A;  3H9Q A;  2DFF A;  4C30 A;  2R7V A;  2LTP A;  4CCK A;  2OPT A;  4BAY A;  2EIM H;  1E3P A;  1LKX A;  2HZT A;  2KDO A;  3GFL A;  2ZBK A;  1PJR A;  2NOG A;  3SDB A;  5IT9 K;  1FBQ A;  2JVH A;  3IC7 A;  3JRG A;  3WTZ A;  4RGR A;  4CH7 A;  3OSG A;  4KIC A;  4HF0 A;  2R7R A;  1ZAR A;  1SEU A;  3B02 A;  1WKM A;  2CQQ A;  2DMT A;  4AIJ A;  2ZME B;  4M3G A;  4HDU A;  2ZJQ F;  1T39 A;  2VJI A;  3CDL A;  5TGT A;  2AXL A;  4LK0 F;  4HAM A;  3P9K A;  5IYC J;  3AAF A;  1YIJ I;  3OWT A;  4BKX A;  4RGX A;  3SYT A;  3BG9 A;  2L4A A;  2VBX A;  2DAO A;  1HKS A;  2H1L A;  2K3F A;  1OCT C;  1J7K A;  2DT7 B;  2HNH A;  3GW2 A;  2OTL I;  1BC7 C;  1L0O C;  4M3F A;  1LVK A;  4RB1 A;  2W48 A;  3CCQ I;  1RR7 A;  3I5U A;  2VQC A;  1ZRC A;  2LYC A;  1O57 A;  2KRH A;  2LK2 A;  1WJF A;  5FKM A;  2L9N A;  5F0H A;  3HL2 A;  3BWG A;  2QLZ A;  1GXP A;  3K4B A;  2COM A;  3GTM J;  1FP2 A;  2GOX B;  3S2H J;  4LIV A;  1F4K A;  3G3Z A;  3S16 J;  3I64 A;  2YU3 A;  2M34 A;  1O3T A;  1GVD A;  2L7M P;  1V5E A;  4AID A;  3D5S C;  4XOP A;  4KT5 C;  3MKZ A;  1R1U A;  2JTV A;  3OIO A;  4BJT A;  1A36 A;  4KNY A;  4IHT A;  1B59 A;  1O3Q A;  2WBM A;  3FK6 A;  2HVR A;  5EG0 A;  4M6X A;  2F5F A;  3FXJ A;  3A01 B;  3JAM Z;  1JKP C;  1BI1 A;  2MW8 A;  4PZJ A;  4G7O F;  1D1B A;  2IVM A;  2VKV A;  4L5I A;  1Y1V J;  5E3M A;  1A31 A;  4AVZ A;  1ONV A;  2X6W A;  1G8X A;  1MBH A;  3DTI A;  3FIW A;  2P7C B;  3OYB A;  2B7E A;  4GYG A;  3TO7 A;  3VPR A;  3CLQ A;  3S1N J;  2OCC H;  2R5Y B;  2O03 A;  2EV0 A;  1DP7 P;  2X51 A;  4IJA A;  3LQQ A;  4PDK A;  4PGH A;  1LDK B;  1XG1 A;  2GIZ A;  1SVL A;  1JT6 A;  5KAF C;  2R92 J;  2ELJ A;  4II2 A;  4PFO A;  4F91 B;  3IUO A;  1X3W B;  2Y31 A;  4I98 B;  2CG4 A;  3QAH A;  2UZK A;  1W1W E;  3WGI A;  3H5R A;  2XAF A;  2X6X A;  2GXG A;  4M6Y A;  2OA4 A;  4W97 A;  4XKW A;  4XRS A;  2XDV A;  3GTJ J;  2I10 A;  4P9U A;  5FKN A;  3G1O A;  2XKO A;  3WE3 A;  1LE8 A;  3H3V K;  5IP7 J;  1DP3 A;  1H9G A;  2VBZ A;  1D0X A;  4EJO A;  4E6K G;  3W6J B;  3TW7 A;  4KFC A;  2X1E A;  1IXR C;  1WJ5 A;  2E7W A;  1HDD C;  2DA6 A;  1SMY F;  5GP9 A;  1FX7 A;  3HSE A;  1P92 A;  6PAX A;  3RSN A;  3S17 J;  1AWC A;  2B0L A;  4LLG F;  3KCC A;  3TO6 A;  2X4H A;  1MMD A;  1SD5 A;  4OMY A;  1ETO A;  1SFU A;  1VQ6 I;  3KLN A;  3OIP A;  2A3S A;  2Z99 A;  2Y0M A;  3E5X A;  2LY1 A;  3GVA A;  4A0X A;  4A3F J;  2V4J C;  5E8I A;  4XIC A;  1ZLJ A;  3E6M A;  3F6O A;  1IRG A;  1XDU A;  2A61 A;  4ENM A;  2K85 A;  2XUB A;  4I99 C;  3SQN A;  4FE4 A;  1BR1 A;  2L7Z A;  3GLX A;  3DPT A;  3Q5F A;  4ZZL A;  1XMX A;  5CLS A;  1I27 A;  2DA5 A;  2KJB A;  1YJW I;  3LFU A;  4O3M A;  1ITY A;  2IPQ X;  1BI2 A;  1SMT A;  3F22 A;  1ORK A;  3TKY A;  5BOX A;  2FRH A;  5D4S A;  3PSI A;  3T0Y A;  1V54 H;  3X2Q H;  3CUQ A;  2DOE A;  3L09 A;  3K70 D;  2CO5 A;  4RAY A;  2GA1 A;  1TNT A;  3BLY A;  2BY2 A;  4BGD A;  4XON A;  2E1M B;  2FE3 A;  4KMF A;  1USS A;  1W5S A;  4P96 A;  1XGO A;  5DEQ A;  4DIQ A;  1Z6T A;  5D5W B;  2MA3 A;  1E3H A;  3LSG A;  2BOL A;  4HA8 A;  4DQ2 A;  4LOC A;  2JSC A;  4A3B J;  2KQR A;  4Q47 A;  2DT6 A;  4MQV A;  2VQG A;  3A0H C;  3LST A;  4FQG A;  2DA2 A;  4PJL A;  3DBH B;  2JA2 A;  2HVQ A;  2XAJ A;  4II3 A;  4XM3 A;  3BP8 A;  3QYE A;  4PJ0 C;  2RVC A;  5B5E C;  3QOP A;  3LSK A;  1FPQ A;  4CO8 A;  1SD4 A;  3NQO A;  2DJN A;  2W00 A;  1D0Y A;  1I50 J;  5GPC A;  4HBL A;  3HHH A;  3F3X A;  2KJC A;  3GBG A;  3JRE A;  5GTH C;  2JA6 J;  2DLL A;  3NAR A;  1YLF A;  5H2F C;  1ETQ A;  3BQY A;  3CCL I;  3I53 A;  1XSX A;  2F4O B;  4ZTF A;  3DU6 A;  4E7Z A;  1LPQ A;  2XPW A;  4QWQ A;  3BPX A;  2AS5 F;  4GXO A;  4BNC A;  2IXS A;  3IAM 2;  1TBX A;  2L9S A;  2DTZ A;  2YR2 A;  3HYI A;  3TOB A;  3ZMU A;  4EM1 A;  2VC1 A;  1POG A;  5FFZ A;  4CZZ A;  4JYK A;  5LEK A;  1NTC A;  1R22 A;  2M3A A;  5L3F A;  1MJ9 A;  4MFD A;  3SFI A;  5IP6 A;  1BJZ A;  1H88 C;  3IHU A;  3LSP A;  4XOR A;  4PCQ A;  4M9S A;  2LFB A;  4XBF A;  4Y7N J;  1SAX A;  3GTK J;  2MLK A;  2V6C A;  3PSF A;  1ZR4 A;  5J1Y A;  4IKF A;  5CJ9 A;  1MNM C;  1HDP A;  2XB0 X;  4XLA A;  2V26 A;  1LB2 A;  1FYK A;  4FIS A;  1ETX A;  2L9V A;  3H9G A;  2BGC A;  1YTY A;  3W2V A;  1K6O A;  3GXO A;  3O8G A;  4ESF A;  2ELK A;  1AA7 A;  2V1U A;  2VC0 A;  3AL0 B;  4BYY A;  1U3E M;  4RAF A;  3LOC A;  4FCY A;  3LSH A;  1MNE A;  2MD5 A;  2ZNZ A;  5IPA A;  5LGU A;  1WZ2 A;  2MC3 A;  4G12 A;  1SAN A;  2ZXI A;  4QPO A;  1JKO C;  1KQ8 A;  2AXT C;  2Y0S N;  3RZO J;  2LMD A;  1IGN A;  2BEO A;  1WCM J;  3BR2 A;  3FXR A;  3DQV C;  2CV0 A;  1UHS A;  2L54 A;  1ZN2 A;  1OQY A;  4E7L A;  1SD6 A;  3L00 A;  2STT A;  2ESN A;  2NVU B;  4HX4 A;  3K7A J;  3D5L A;  1DPR A;  2E1M C;  2HXO A;  3BR6 A;  1P9Q C;  5M5Y J;  2M0M A;  4U7B A;  3I56 I;  2IS6 A;  4WK8 F;  4ZDP A;  3A01 A;  1NH3 A;  2LRD A;  4I0B A;  3DBR B;  2UXN A;  1H89 C;  2HFH A;  2EFW A;  2ECB A;  2C6Y A;  2FSW A;  2IJL A;  5DV5 A;  1P2F A;  5E79 C;  2QEX I;  2IS1 A;  4YEL A;  3OS0 A;  2JUC A;  4WWC A;  3PUB A;  3P5J A;  4OU0 A;  2NXN B;  1W0U A;  1NK2 P;  4WXC A;  4ESJ A;  3DEW A;  1G4D A;  2L2O A;  2VXZ A;  4IRI A;  2YU9 J;  1WQ2 A;  4N0B A;  4RGU A;  3J80 K;  2LD5 A;  4ANJ A;  1GT0 C;  1OYY A;  4OAZ A;  1XCV A;  2K02 A;  5M3M J;  5D5U B;  1FOW A;  2EIN H;  1ERD A;  3ISP A;  5IT9 Z;  4UV9 A;  2KIQ A;  4RB3 C;  2WY8 Q;  2IS4 A;  3DBL B;  3TGN A;  3K4K A;  4W1U A;  5EYR A;  5D5V B;  3M9A A;  2WB1 N;  2DA7 A;  2CWE A;  3CTA A;  4B48 A;  1QZY A;  3ZOB A;  2XRL A;  2VBY A;  5F0F A;  3UNG C;  2KIS A;  2N8G A;  1Z05 A;  2YX4 A;  5HLH A;  2DQR A;  1S29 A;  5JLX A;  1HF0 A;  5CYV A;  4ENJ A;  4AUX A;  4HOB A;  2DK8 A;  1IRF A;  1IRX A;  3E6B A;  4X6A J;  2WAF A;  1APL C;  4IHV A;  5J4Y A;  1J59 A;  2E36 A;  3J7A O;  3CQZ J;  5GAH J;  4CA0 A;  2IA1 A;  4RGS A;  4KUM A;  4AC0 A;  2CW0 F;  3HTS B;  2PMZ A;  2ME6 A;  3OR1 C;  1TZL A;  4B3A A;  2FXA A;  2OD5 A;  3U9G A;  1KU7 A;  4IVN A;  3OYM A;  4C3I J;  3ML6 A;  4EGY A;  4XRS G;  1FMW A;  1YI2 I;  4EJT A;  3B6C A;  4N9H A;  4G7H F;  2FNP A;  4XKV A;  1I3Q J;  2Y9Y A;  3GUD A;  4ZDL A;  2BY3 A;  2HOS A;  5F0C A;  3RKX A;  1YIO A;  2VBW A;  4A0Z A;  1JGS A;  4NBQ A;  1RES A;  3HGY A;  3ABT A;  1VQL I;  3R61 A;  5F04 A;  2PMU A;  4RLF A;  3GTP J;  5DCM A;  1Y1W J;  4I02 A;  1KQ0 A;  5FLV A;  3GTQ J;  5DCM B;  2QBY A;  2ZKZ A;  5IT3 A;  3NWS A;  4GGG A;  4NUB A;  1W36 C;  1UZC A;  1YW9 A;  3RYR A;  4D5C A;  1O4X A;  4IHW A;  1W7P B;  4EJV A;  1TQM A;  4OMZ A;  3KX2 A;  4C9Y A;  4A3G J;  1JKR C;  5HLI A;  2ZCW A;  4R79 A;  3W3C A;  2BXY A;  4EM2 A;  1BR2 A;  2DK5 A;  2K4B A;  4DZP A;  3WTY C;  3ABK H;  4U0V A;  4ZC3 A;  3L2C A;  4BDY A;  4KN7 X;  3Q0U A;  3K70 C;  4I76 A;  2Y9Z A;  2ZFW A;  4BXU A;  2FU4 A;  5KVR A;  5JVT A;  5ICE A;  3V7S A;  1V4R A;  1VTN C;  3ROU A;  3DXJ F;  3PO3 J;  3FBN B;  2XVC A;  3Q0W A;  1N77 A;  3O2P E;  5FD5 A;  4F92 B;  4EJW A;  4RB0 A;  2KMU A;  1X2M A;  2IGO A;  3DKY A;  3F23 A;  3N97 A;  1TNS A;  5J1R A;  2KL4 A;  1OKR A;  1MBG A;  1R7J A;  5L3G A;  2W85 A;  1FOX A;  2GWR A;  1AU7 A;  5E3L A;  2EA4 A;  1Y0N A;  2ZXH A;  2VE8 A;  4UVC A;  5IP9 J;  2DO7 A;  5K5R A;  4HDV A;  2IRF G;  3BCB A;  1LVA A;  1VQ9 I;  1YO5 C;  2XRN A;  2HOT A;  1HW1 A;  1UEL B;  1X3U A;  3H0D A;  1TW3 A;  4HEA 2;  2ESH A;  3C2G A;  5HS9 A;  4XID A;  1H9T A;  3U1K A;  2BY0 A;  2OQR A;  3KZY A;  3COA C;  1JTX A;  2RN7 A;  5E18 F;  2WAE A;  2BBY A;  4KN4 X;  4D7M A;  1HST A;  2EPF A;  3DTE A;  3I4P A;  3BOQ A;  3WGG A;  3J7Z I;  1Z9C A;  1NG6 A;  1W0T A;  4LLN A;  1SC7 A;  1MMA A;  2OU2 A;  4LG0 A;  3S14 J;  2VOO A;  2JPB A;  3CCU I;  2V1N A;  1BOB A;  3BPV A;  3CDI A;  1XMK A;  2DXI A;  1TQI A;  2O8X A;  1RUN A;  1Z91 A;  3IWF A;  4JQF A;  1ZAO A;  5DUI A;  3JCU C;  1UFM A;  1X58 A;  3TBI A;  2IS2 A;  4IPA A;  1Z67 A;  4H4K C;  3VYS B;  2I8D A;  2LF7 A;  4MEX F;  2JWT A;  3CMA I;  4XRM A;  1XDS A;  3CCM I;  5GAE J;  2FD5 A;  5DM7 F;  3GLL A;  2D2W A;  2ETH A;  3K1P A;  5EGO A;  3FXK A;  4U87 A;  1GLN A;  4G6Q A;  2WWY A;  3IWZ A;  3OYE A;  3PQJ A;  1HXD A;  4YEJ A;  3OOU A;  4AWX B;  5KHD A;  4RLQ A;  5CKT A;  2LKX A;  3H92 A;  4MIM A;  1JGG A;  3CC2 I;  3HKZ N;  1TWH J;  1UST A;  2CMP A;  4A5N A;  1PVE A;  4KIG A;  3L2U A;  5D5X B;  4IOA F;  2MFZ A;  4D1Q A;  4HYE A;  3KP2 A;  3S3O A;  3LNQ A;  3CZ6 A;  4HNU A;  3E6C C;  1KU2 A;  3LSJ A;  5E1Z B;  2E5Z A;  5DM6 F;  1UJ8 A;  2DOA A;  4Z2Y A;  4OIP F;  2VI6 A;  5LGT A;  3PFY A;  5ICG A;  3M1E A;  2Q2E B;  2BE5 F;  2IBD A;  3S3N A;  3NAU A;  1YX5 A;  3EPZ A;  2JUG A;  2W57 A;  4U88 A;  3FMS A;  2IW5 A;  4ZDO A;  2M45 A;  2M7B A;  1BL0 A;  2OV7 A;  2L01 A;  4ZYE A;  1Z3X A;  3M3Y J;  1PUF A;  2QGU A;  4UVB A;  3OYG A;  5CVJ A;  3JTH A;  4C2U A;  3F8B A;  5ILU A;  1Y8Q B;  5LLQ A;  3VSL A;  4HQM A;  2NNN A;  3BTC A;  3K4M A;  2VJJ A;  2YUS A;  1G6N A;  5GTI C;  2RQQ A;  2HYG D;  4UY8 I;  1HKQ A;  3CUQ C;  5LRR A;  2ZSI B;  4R1H A;  1PUF B;  1OPC A;  1Y56 A;  2ZME C;  3AG3 H;  1J5Y A;  4HLY A;  4GFB A;  4N4N B;  1TWC J;  3CMY A;  1ZEL A;  1LEA A;  2VKE A;  2JRT A;  2ISZ A;  1WJB A;  3RPU A;  2HPM A;  3VWB A;  2RNG A;  4CGZ A;  4YG2 F;  5F6F A;  2XF7 A;  2O3F A;  3G1L A;  2XV4 S;  1MZB A;  1ZR2 A;  4BE1 A;  2V1D A;  5B1B H;  3PNT A;  2O9L A;  4PJN A;  1R23 A;  3LL7 A;  2FBI A;  2CW8 A;  1S7A A;  1V55 H;  4XSZ F;  2BXZ A;  3PNY A;  3JRH A;  5A2Q Z;  3F72 A;  2O61 A;  1S8N A;  3BG6 A;  2RKH A;  2DOD A;  2VE9 A;  5HOD A;  4EAT A;  1VF9 A;  2QSH X;  1U8B A;  3I59 A;  3BR3 A;  3ABU A;  1T98 A;  2LLK A;  5CPR B;  5H6R A;  2KIF A;  2DFE A;  5K1Y A;  2NAZ A;  5EDN A;  3OR2 C;  4A12 A;  3JR9 A;  2K9N A;  1JXS A;  1OYW A;  3CJQ B;  3L2R A;  1S5L C;  3HOV J;  1GHC A;  2CUJ A;  2RAE A;  3ZN0 A;  1W7P D;  4I09 A;  5J8C A;  5HDN A;  2LR8 A;  2LBF B;  3MZH A;  2WB1 A;  2W82 A;  2HOE A;  1E2X A;  3HKZ A;  3HDD A;  2ZJ2 A;  4I6Z A;  3WTX C;  1VQP I;  3OL4 A;  4BHC A;  4BXF A;  4Y33 A;  3CUQ B;  4IRH A;  1L3L A;  3TL4 X;  2HTJ A;  2P4W A;  3F8C A;  2NS8 A;  5F08 A;  1FIA A;  2E7X A;  2PBI A;  1KYZ A;  3WGH A;  4U0W A;  5BQT A;  3OY9 A;  1G2H A;  1K83 J;  2A6T A;  1G3T A;  1CF7 B;  4DJA A;  3DF8 A;  2Y75 A;  3H1C A;  3BTI A;  1GUU A;  3KYL A;  1Z1D A;  3SDG A;  3N05 A;  2L9R A;  2G9W A;  3ONQ A;  3V7R A;  4L9V A;  3JRF A;  4ENN A;  2M0C A;  1NHA A;  1XX5 A;  3RKQ A;  4BY7 J;  3DEE A;  5D4R A;  4XLN F;  4MTD A;  4IOC F;  1IF1 A;  3FKI J;  4CHU A;  2VPL A;  2NS0 A;  3HSF A;  4D9J A;  2WAQ A;  4UB8 C;  3QP6 A;  4PJJ A;  4HPQ A;  2DA4 A;  2DDA A;  4UXN A;  2HTS A;  1QO0 D;  3SZG A;  4NHJ A;  2XAU A;  2GQQ A;  4M74 A;  2JA5 J;  2EK5 A;  5LHI A;  2BZT A;  4MQ9 F;  1BA5 A;  4BU2 A;  3OS1 A;  3JRD A;  2JQ7 A;  3KP4 A;  3GME A;  4LB6 B;  1X1P A;  4M3D A;  1U9N A;  1HKT A;  1JUM A;  2DOF A;  4M3B A;  1STZ A;  5TJJ A;  3WU0 A;  3G73 A;  2HGC A;  4PK4 A;  1OR7 A;  2NS7 A;  2AQF A;  1OLT A;  3C3W A;  4ZYH A;  1D0Z A;  1FBU A;  1OMI A;  5FGM A;  2UXX A;  4AIK A;  4IL6 C;  1H0M A;  4A6D A;  2EQR A;  2EZI A;  2VKH A;  3K6G A;  1WVR A;  2DMP A;  2LDU A;  2VL8 A;  3C2H A;  4XR6 A;  1IZ1 A;  3OIQ A;  3HTU A;  1QVU A;  1YQA A;  3ABL H;  3EQL F;  4IF4 A;  1OYI A;  3M1C A;  5E20 A;  4V19 K;  1T6S A;  3ZMV A;  2QBY B;  3C2B A;  2W25 A;  2QM3 A;  2EWN A;  3VOE A;  4LD5 A;  3A1Y A;  3KLO A;  4O6J A;  4CCN A;  2B63 J;  4OWR B;  2HI3 A;  2Y2Z A;  3MWM A;  1MDM B;  1UAA A;  4JK1 X;  1ZYR F;  4WXH A;  2CV2 A;  3CF2 A;  2QEN A;  1S6L A;  4DOZ A;  3KEQ A;  1O3R A;  2K40 A;  3KIO A;  4XLE A;  2FOW A;  3I4M J;  2RGV A;  1R1V A;  4OIO F;  1IJW C;  1W5C C;  3LSI A;  3JRA A; 
#chains in the Genus database with same CATH homology
 3IH2 A;  2X6O A;  1JT0 A;  2IEK A;  4B1R A;  3TW6 A;  1IC8 A;  1I6H J;  1TWG J;  2KDZ A;  3QPS A;  2JA7 J;  3K7A J;  1ETK A;  5C3E J;  2TCT A;  4JP0 A;  2ID6 A;  2P81 A;  1MBJ A;  2HXO A;  3BR6 A;  1MH3 A;  5M5Y J;  3ZQI A;  3A03 A;  4UUS A;  1CQT A;  3A01 A;  4V2G A;  3ZQL A;  1H89 C;  2ECB A;  1NK3 P;  2COB A;  2WV1 A;  2WAQ N;  1GV5 A;  2R5Y A;  1T56 A;  4DYR A;  3UKG A;  1Z77 A;  1W0U A;  1NK2 P;  3RZD J;  3DEW A;  1QRY A;  5EZH A;  4A3C J;  3B6A A;  3S15 J;  2YU9 J;  4A3E J;  2LD5 A;  2E1O A;  1A5J A;  1GT0 C;  5K7Z A;  5M3M J;  1OFC X;  3GTL J;  1ZK8 A;  2G0E A;  1BW5 A;  1GDT A;  3H0G J;  2ME0 A;  4W1U A;  1IJW C;  1H8A C;  1B72 A;  2OF7 A;  1UG2 A;  4IEJ A;  5EYR A;  5F27 A;  2WB1 N;  2DA7 A;  4NDL A;  3MN2 A;  4C2M J;  3ZOB A;  2XRL A;  1K61 A;  2XGE A;  3DCF A;  5F0F A;  1MBE A;  3L1P A;  2N8G A;  4S0H B;  2R0Q C;  3BTJ A;  1FEX A;  3BR5 A;  1RPW A;  5JLX A;  1SFO J;  3TED A;  1TC3 C;  1HF0 A;  1ETV A;  3BR0 A;  1IG7 A;  3Q3S A;  4AUX A;  2D5V A;  4X6A J;  2CQX A;  5DS9 A;  3CCY A;  2HYJ A;  3JRC A;  1APL C;  4IHV A;  5EGO B;  4MO7 A;  3M4O J;  1VND A;  3CQZ J;  1XC5 A;  4AC0 A;  3GTO J;  2ME6 A;  4B3A A;  2K9S A;  1MSE C;  2ECC A;  4C3I J;  2GM4 A;  4XRS G;  1AHD P;  4UUT A;  3B6C A;  1ETW A;  1WGX A;  3A02 A;  2E19 A;  4QIW N;  4DYQ A;  1UMQ A;  1ETY A;  1I3Q J;  2Y9Y A;  2YS9 A;  4MLO A;  3BR1 A;  2EZL A;  2IAI A;  2HOS A;  4D5F A;  5F0C A;  3PO2 J;  1VI0 A;  3HOZ J;  3I4N J;  3QPL A;  1ZKG A;  1RES A;  5EF6 A;  3HGY A;  3OSF A;  5JLW A;  5F04 A;  1B8I B;  3GTP J;  1Y1W J;  5FLV A;  4XK4 A;  9ANT A;  3GTQ J;  3S1R J;  4DYC A;  1AKH A;  1MH4 A;  5E3O A;  4FTH A;  1FTZ A;  4D5C A;  2CRG A;  1O4X A;  2L7F P;  4IHW A;  2NVQ J;  5M5X J;  1TWA J;  5EEA A;  4EEF G;  4A3D J;  1OCP A;  2DA1 A;  1B8I A;  3W6V A;  4A3G J;  3BQZ A;  1JKR C;  3FIS A;  1LFU P;  1JJ6 C;  1EF4 A;  4J19 A;  3BT9 A;  3TP0 A;  4X1E A;  2NVY J;  4DZP A;  4A3M J;  1AKH B;  4DZJ A;  2MGQ A;  3Q0U A;  4DW6 A;  4I76 A;  2Y9Z A;  1BW6 A;  3K2A A;  1JUP A;  2DN0 A;  2VPR A;  4M3E A;  3PO3 J;  3FK7 A;  1GV2 A;  1JUS A;  3Q0W A;  2EZH A;  1FTT A;  2ID3 A;  2HDD A;  2LY9 A;  1X2M A;  1IDY A;  5J1R A;  1MBG A;  1WI3 A;  2EH3 A;  2HOA A;  1AU7 A;  1Q1V A;  5E3L A;  4A3I J;  3BG5 A;  5IP9 J;  1DU0 A;  4L5E A;  2KT0 A;  3ZQG A;  1D5Y A;  1XS9 A;  1LFB A;  5GPA A;  4MFE A;  2LTP A;  2HOT A;  2OPT A;  1IRZ A;  2NVX J;  4XID A;  3ZQC A;  1IV6 A;  2NOG A;  1JKQ C;  3JRG A;  1JTX A;  2K9Q A;  4D7M A;  3OSG A;  1Z0X A;  2CQQ A;  2DMT A;  2DMU A;  1W0T A;  4M3G A;  1MBK A;  3S14 J;  3CDL A;  5IYC J;  3IH3 A;  2H1K A;  1A6I A;  2CUF A;  4BKX A;  2AO9 A;  3Q0V A;  4D7N A;  1E3O C;  4V2F A;  3BG9 A;  4A69 C;  1X58 A;  3F0C A;  1F43 A;  4RBO A;  2Y30 A;  1OCT C;  2JWT A;  4XRM A;  3ZQH A;  2M8G X;  2FD5 A;  4M3F A;  3WHB A;  1ENH A;  2W48 A;  1RR7 A;  5EGO A;  2O8K A;  1S7E A;  2LK2 A;  3O8H A;  3OOU A;  5FKM A;  5F0H A;  1YRN B;  2LKX A;  3GTM J;  4MIM A;  1JGG A;  5FKL A;  3HKZ N;  2E2J J;  3S2H J;  1TWH J;  3S16 J;  4M6V A;  3HB9 A;  2M34 A;  2R7Z J;  4A3L J;  1GVD A;  2L7M P;  3LNQ A;  3OIO A;  2DMQ A;  3LSJ A;  3FK6 A;  2EBI A;  2VI6 A;  4FE7 A;  5EG0 A;  1WPK A;  2IBD A;  3A01 B;  1JKP C;  3NAU A;  2MW8 A;  2XGC A;  2O7O A;  2CJJ A;  2R93 J;  2VKV A;  1BL0 A;  1Y1V J;  5E3M A;  2EZK A;  3M3Y J;  2AHQ A;  4RDU A;  1PUF A;  4BXX J;  3HOW J;  1MBH A;  3FIW A;  3HGG A;  1HCR A;  1QVT A;  5IYD J;  2PMZ N;  3VPR A;  4BY1 J;  3S1N J;  2LVS A;  2E2H J;  3IV5 A;  2R5Y B;  5EG0 B;  2H8R A;  1ZTR A;  3BTC A;  5K7H A;  2YUS A;  4Y52 J;  1XG1 A;  2HXI A;  4CYC B;  4C3J J;  1PUF B;  1JT6 A;  4CYC A;  1TWF J;  2R92 J;  3MKL A;  2Y31 A;  4GFB A;  1TWC J;  3CMY A;  4W97 A;  2VKE A;  4XRS A;  3GTJ J;  2I10 A;  2XB5 A;  5FKN A;  3G1O A;  1LE8 A;  2XPU A;  3H3V K;  5IP7 J;  3G1L A;  3GTG J;  1ZR2 A;  2O9L A;  3TW7 A;  1MSF C;  2ZB9 A;  1HDD C;  2DA6 A;  5GP9 A;  3JRH A;  3MVP A;  1JJ8 C;  1HLV A;  4HNV A;  1ZGW A;  3S17 J;  5HOD A;  3HEF A;  2DA3 A;  1VF9 A;  1U8B A;  3BR3 A;  1ETO A;  3ZQF A;  2LLK A;  4B4C A;  4JX6 A;  4JX5 A;  2VUM J;  4JX4 A;  5EZG A;  5EDN A;  4A3F J;  3JR9 A;  4XIC A;  2K9N A;  5FKK A;  2L0K A;  2X9D A;  3HOV J;  4FE4 A;  2L7Z A;  1U78 A;  2RAE A;  3S1Q J;  5E3N A;  4AYB N;  2DA5 A;  2LR8 A;  2X48 A;  1ITY A;  3HDD A;  1ORK A;  5K7F A;  4I6Z A;  1IDZ A;  5FKO A;  5M5W J;  1T33 A;  3E7L A;  3HM5 A;  1R9T J;  3RQI A;  2NS8 A;  5F08 A;  1FIA A;  5C4J J;  3HOY J;  5IOY A;  2DMN A;  3TP3 A;  1G2H A;  1X2N A;  1K83 J;  1WH7 A;  1JTY A;  1OJL A;  3LSG A;  3BTI A;  1GUU A;  1P7I A;  2TRT A;  3G1M A;  4LOC A;  4A3B J;  3SDG A;  5C44 J;  5FJ8 J;  2L9R A;  4A3K J;  5DTD A;  3JRF A;  2DA2 A;  2M0C A;  3RKQ A;  4BY7 J;  1QPI A;  2JJ7 A;  4C3H J;  1WH5 A;  3FKI J;  1ZQ3 P;  1VFC A;  3BTL A;  2DJN A;  2DA4 A;  2XGD A;  1I50 J;  5GPC A;  1HOM A;  3GBG A;  3JRE A;  2JA5 J;  2M9H A;  4UUS B;  5M3F J;  3SJM A;  3IH4 A;  2JA6 J;  5IYB J;  3S2D J;  1BA5 A;  3NAR A;  3JRB A;  1ETQ A;  3BQY A;  3JRD A;  1DU6 A;  1FJL A;  1FIP A;  5C4X J;  2JN6 A;  4A3J J;  2LP0 A;  1U9O A;  2XPW A;  5J3L A;  4M3D A;  1U9N A;  3JRI A;  4A93 J;  2R5Z A;  1JUM A;  2QCO A;  4M3B A;  2R5Z B;  1F36 A;  3LSR A;  2DTZ A;  2JK3 A;  1POG A;  2NS7 A;  2MSY A;  4BBS J;  4JYK A;  1NTC A;  1RKT A;  1RET A;  4MFD A;  3SFI A;  4QSH A;  3BG3 A;  5IP6 A;  1BJZ A;  5IOZ A;  1H88 C;  3LSP A;  2JMW A;  2EQR A;  2EZI A;  4IHY A;  1B72 B;  2LFB A;  2DMP A;  2NVT J;  2FQ4 A;  1RKW A;  3QQA A;  4Y7N J;  3GTK J;  1QVU A;  1ZR4 A;  5J1Y A;  4QTR A;  3S1M J;  3C2B A;  1MNM C;  1HDP A;  2XB0 X;  2QF7 A;  3HOU J;  4IHX A;  4FIS A;  4ABZ A;  2FX0 A;  1ETX A;  2CU7 A;  4BBR J;  2B63 J;  2E2I J;  5FLM J;  2HI3 A;  2Y2Z A;  3O8G A;  2ELK A;  2MG4 A;  3D1N I;  1MBF A;  3PM1 A;  2M2E A;  3LOC A;  4FCY A;  3WHC A;  2HQ5 A;  5IPA A;  1IUF A;  2JA8 J;  5J1U A;  4G12 A;  1P7J A;  1SAN A;  1LE8 B;  1JKO C;  2GBY A;  2K40 A;  2FJ1 A;  2XPV A;  2Y0S N;  3RZO J;  1IGN A;  2XSD C;  3I4M J;  1WCM J;  3HBL A;  5F1J A;  3BR2 A;  5BNG A;  1YRN A;  3HOX J;  2GLO A;  1UHS A;  2CUE A;  3JRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...