1VOLB

Tfiib (human core domain)/tbp (a.thaliana)/tata element ternary complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
187
structure length
187
Chain Sequence
VDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a TFIIB-TBP-TATA-element ternary complex.
pubmed doi rcsb
molecule keywords DNA (5'-D(*GP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*GP*CP*TP*G)-3
molecule tags Transcription/dna
source organism Homo sapiens
total genus 41
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 1996-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1volB01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1volB02
1E42A 2Z8UA 3HS9A 1TBAB 3H1ZA 1KYFA 1KYUA 2IV9A 3HS8A 1VTOA 1TGHA 1VOLB 3VN5A 4B0AA 1QN3A 1KY6A 1QNEA 1QN7A 1TBPA 1D3UA 1QNAA 1YTBA 1KYDA 1NGMA 2D0BA 3EIKA 1QTPA 1QN5A 2D0AA 1QN8A 1QN6A 1QTSA 2IV8A 5IYCP 1QNBA 1PCZA 3OC3C 1QNCA 4WZSD 4ROEB 4RODB 1C9BB 1QN4A 1KY7A 1VTLE 1VOKA 2G30A 1QN9A 4PY5A 5IYDP 1PZDA 1NH2A 2MJ7A 2D0CA 1AISA 1MP9A 1YTFA 1R4XA 2VJ0A 1B9KA 3ASMA 4ROCB 1W80A 1NVPA 1JFIC 1CDWA 1RM1A 3OCIA 5IYBP
chains in the Genus database with same CATH superfamily
2HL9A 1YQKA 2Z8UA 3HS9A 1KYUA 1HU0A 1VTOA 3OSEA 1M3QA 1EBMA 1VOLB 3ENCA 2H5AX 1PVSA 3DPUA 4B0AA 1QN3A 2JPIA 1QNEA 4EAGA 2V92A 2OOYA 4Q11A 1YQLA 3OSMA 3TDHA 4CFFA 2IV8A 1QNCA 2NOZA 3NA5A 2FKMX 4WZSD 4RODB 2NOIA 1KFQA 3RSMA 1QN9A 4PY5A 2R5XA 4QG5A 5JMVD 1RM1A 4WX8A 1J3MA 2NOHA 3SNSA 2JHJA 1YTFA 3OSTA 1PCJX 1NVPA 3UW2A 3OCIA 2NOLA 3I3WA 4MRQA 1EUVA 3KRMA 1TBAB 3I0WA 2IV9A 3HS8A 2V9JA 4IL8A 3KTUA 1LWYA 2DKAA 3VN5A 1LWVA 1VKLA 2NVMA 2DKDA 2Y8QA 1M3HA 5BMPA 1LXTA 1TBPA 3PDKA 1FN7A 1D3UA 1QNAA 1KFIA 4DULA 3EIKA 2JOIA 2D0AA 2NOFA 5IYCP 2QRDA 1N3CA 2YH5A 3D4VA 2I5WA 1VTLE 2LAEA 2HL8A 5IYDP 2OOXA 1PZDA 1NH2A 3N89A 2D0CA 4EAKA 3CW7A 3RPJA 1MP9A 5F9CA 1AISA 2DKCA 1R4XA 2VJ0A 3T4NA 4TPSA 3F10A 1PCMX 4EAJA 2ZFDB 2NOBA 1N39A 1QN7A 2HKPA 4HJHA 1LWWA 3CWUA 2JHNA 3TE5A 4D7QA 4EJYA 2HZSA 1DIZA 1YTBA 5HSHA 1KO9A 1KYDA 1MPGA 1NGMA 1QN5A 1QN8A 2V8QA 1QN6A 2QLVA 1QNBA 3OC3C 2XHIA 1C9BB 2PWWA 1TUOA 1QN4A 1KY7A 1P5GX 5EPCA 3IH7A 3DPTA 3ENOC 4EALA 2NWVA 3OGDA 3C04A 1C47A 2NOEA 2O3OA 3OH9A 3CWSA 1Q9UA 5BMNA 1B9KA 3ASMA 1W80A 4EAIA 3BKQX 5IYBP 3ULXA 2EHBD 1E42A 1JDYA 3H1ZA 1KYFA 1UL7A 2FGTA 1TGHA 1V5SA 5AN4A 4I8OA 3CVTA 2NLVA 3F0ZA 1UT7A 4D7RA 1YQMA 3CWTA 1KY6A 3EAYA 2H4LX 1WJWA 2Z0FA 3CVSA 1YQRA 3OLPA 1UT4A 2QR1A 3OH6A 2D0BA 1P5DX 1QTPA 2F7LA 2MZ8A 1T6AA 1QTSA 2QREA 2YA3A 1PCZA 3PMGA 1K35A 1WQAA 3D7QA 4ROEB 1N3AA 1VOKA 2G30A 2QRCA 4WXAA 3I0XA 2HZMA 4BJUA 2MJ7A 2FUVA 4C7PA 4EJZA 3CWAA 2Y8LA 1CDWA 4ROCB 1JFIC 1K2YX 2FKFA 5KL0A 1C4GA 1M5Q1 5JN5A 1XSZA
chains in the Genus database with same CATH topology
1YQKA 2Z8UA 3HS9A 1KYUA 1HU0A 1VTOA 1M3QA 1EBMA 1VOLB 4B0AA 1QN3A 3DPUA 1QNEA 4Q11A 1YQLA 3OSMA 2IV8A 1QNCA 2NOZA 4WZSD 4RODB 2NOIA 1QN9A 4PY5A 2NOHA 3SNSA 1YTFA 3OSTA 1NVPA 3OCIA 2NOLA 3KRMA 1TBAB 3I0WA 2IV9A 3HS8A 3KTUA 1LWYA 3VN5A 1LWVA 1M3HA 1FN7A 1TBPA 1D3UA 1QNAA 4DULA 3EIKA 2JOIA 2D0AA 2NOFA 5IYCP 1N3CA 2YH5A 2I5WA 1VTLE 2LAEA 5IYDP 1PZDA 1NH2A 3N89A 2D0CA 3RPJA 1MP9A 1AISA 1R4XA 2VJ0A 4TPSA 3F10A 2NOBA 1N39A 1QN7A 1LWWA 4EJYA 2HZSA 1YTBA 1KO9A 1KYDA 1NGMA 1QN5A 1QN8A 1QN6A 1QNBA 3OC3C 2XHIA 1C9BB 1QN4A 1KY7A 3IH7A 3DPTA 2NOEA 2O3OA 1B9KA 3ASMA 1W80A 5IYBP 3ULXA 1E42A 3H1ZA 1KYFA 2FGTA 1TGHA 5AN4A 4I8OA 3F0ZA 1UT7A 1YQMA 1KY6A 1YQRA 1UT4A 2D0BA 1QTPA 2MZ8A 1QTSA 1PCZA 4ROEB 1N3AA 1VOKA 2G30A 3I0XA 2HZMA 2MJ7A 4EJZA 1CDWA 4ROCB 1JFIC 1RM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E42 A;  2Z8U A;  3HS9 A;  1TBA B;  3H1Z A;  1KYF A;  1KYU A;  2IV9 A;  3HS8 A;  1VTO A;  1TGH A;  1VOL B;  3VN5 A;  4B0A A;  1QN3 A;  1KY6 A;  1QNE A;  1QN7 A;  1TBP A;  1D3U A;  1QNA A;  1YTB A;  1KYD A;  1NGM A;  2D0B A;  3EIK A;  1QTP A;  1QN5 A;  2D0A A;  1QN8 A;  1QN6 A;  1QTS A;  2IV8 A;  5IYC P;  1QNB A;  1PCZ A;  3OC3 C;  1QNC A;  4WZS D;  4ROE B;  4ROD B;  1C9B B;  1QN4 A;  1KY7 A;  1VTL E;  1VOK A;  2G30 A;  1QN9 A;  4PY5 A;  5IYD P;  1PZD A;  1NH2 A;  2MJ7 A;  2D0C A;  1AIS A;  1MP9 A;  1YTF A;  1R4X A;  2VJ0 A;  1B9K A;  3ASM A;  4ROC B;  1W80 A;  1NVP A;  1JFI C;  1CDW A;  1RM1 A;  3OCI A;  5IYB P; 
#chains in the Genus database with same CATH topology
 2HL9 A;  1YQK A;  2Z8U A;  3HS9 A;  1KYU A;  1HU0 A;  1VTO A;  3OSE A;  1M3Q A;  1EBM A;  1VOL B;  3ENC A;  2H5A X;  1PVS A;  3DPU A;  4B0A A;  1QN3 A;  2JPI A;  1QNE A;  4EAG A;  2V92 A;  2OOY A;  4Q11 A;  1YQL A;  3OSM A;  3TDH A;  4CFF A;  2IV8 A;  1QNC A;  2NOZ A;  3NA5 A;  2FKM X;  4WZS D;  4ROD B;  2NOI A;  1KFQ A;  3RSM A;  1QN9 A;  4PY5 A;  2R5X A;  4QG5 A;  5JMV D;  1RM1 A;  4WX8 A;  1J3M A;  2NOH A;  3SNS A;  2JHJ A;  1YTF A;  3OST A;  1PCJ X;  1NVP A;  3UW2 A;  3OCI A;  2NOL A;  3I3W A;  4MRQ A;  1EUV A;  3KRM A;  1TBA B;  3I0W A;  2IV9 A;  3HS8 A;  2V9J A;  4IL8 A;  3KTU A;  1LWY A;  2DKA A;  3VN5 A;  1LWV A;  1VKL A;  2NVM A;  2DKD A;  2Y8Q A;  1M3H A;  5BMP A;  1LXT A;  1TBP A;  3PDK A;  1FN7 A;  1D3U A;  1QNA A;  1KFI A;  4DUL A;  3EIK A;  2JOI A;  2D0A A;  2NOF A;  5IYC P;  2QRD A;  1N3C A;  2YH5 A;  3D4V A;  2I5W A;  1VTL E;  2LAE A;  2HL8 A;  5IYD P;  2OOX A;  1PZD A;  1NH2 A;  3N89 A;  2D0C A;  4EAK A;  3CW7 A;  3RPJ A;  1MP9 A;  5F9C A;  1AIS A;  2DKC A;  1R4X A;  2VJ0 A;  3T4N A;  4TPS A;  3F10 A;  1PCM X;  4EAJ A;  2ZFD B;  2NOB A;  1N39 A;  1QN7 A;  2HKP A;  4HJH A;  1LWW A;  3CWU A;  2JHN A;  3TE5 A;  4D7Q A;  4EJY A;  2HZS A;  1DIZ A;  1YTB A;  5HSH A;  1KO9 A;  1KYD A;  1MPG A;  1NGM A;  1QN5 A;  1QN8 A;  2V8Q A;  1QN6 A;  2QLV A;  1QNB A;  3OC3 C;  2XHI A;  1C9B B;  2PWW A;  1TUO A;  1QN4 A;  1KY7 A;  1P5G X;  5EPC A;  3IH7 A;  3DPT A;  3ENO C;  4EAL A;  2NWV A;  3OGD A;  3C04 A;  1C47 A;  2NOE A;  2O3O A;  3OH9 A;  3CWS A;  1Q9U A;  5BMN A;  1B9K A;  3ASM A;  1W80 A;  4EAI A;  3BKQ X;  5IYB P;  3ULX A;  2EHB D;  1E42 A;  1JDY A;  3H1Z A;  1KYF A;  1UL7 A;  2FGT A;  1TGH A;  1V5S A;  5AN4 A;  4I8O A;  3CVT A;  2NLV A;  3F0Z A;  1UT7 A;  4D7R A;  1YQM A;  3CWT A;  1KY6 A;  3EAY A;  2H4L X;  1WJW A;  2Z0F A;  3CVS A;  1YQR A;  3OLP A;  1UT4 A;  2QR1 A;  3OH6 A;  2D0B A;  1P5D X;  1QTP A;  2F7L A;  2MZ8 A;  1T6A A;  1QTS A;  2QRE A;  2YA3 A;  1PCZ A;  3PMG A;  1K35 A;  1WQA A;  3D7Q A;  4ROE B;  1N3A A;  1VOK A;  2G30 A;  2QRC A;  4WXA A;  3I0X A;  2HZM A;  4BJU A;  2MJ7 A;  2FUV A;  4C7P A;  4EJZ A;  3CWA A;  2Y8L A;  1CDW A;  4ROC B;  1JFI C;  1K2Y X;  2FKF A;  5KL0 A;  1C4G A;  1M5Q 1;  5JN5 A;  1XSZ A; 
#chains in the Genus database with same CATH homology
 1YQK A;  2Z8U A;  3HS9 A;  1KYU A;  1HU0 A;  1VTO A;  1M3Q A;  1EBM A;  1VOL B;  4B0A A;  1QN3 A;  3DPU A;  1QNE A;  4Q11 A;  1YQL A;  3OSM A;  2IV8 A;  1QNC A;  2NOZ A;  4WZS D;  4ROD B;  2NOI A;  1QN9 A;  4PY5 A;  2NOH A;  3SNS A;  1YTF A;  3OST A;  1NVP A;  3OCI A;  2NOL A;  3KRM A;  1TBA B;  3I0W A;  2IV9 A;  3HS8 A;  3KTU A;  1LWY A;  3VN5 A;  1LWV A;  1M3H A;  1FN7 A;  1TBP A;  1D3U A;  1QNA A;  4DUL A;  3EIK A;  2JOI A;  2D0A A;  2NOF A;  5IYC P;  1N3C A;  2YH5 A;  2I5W A;  1VTL E;  2LAE A;  5IYD P;  1PZD A;  1NH2 A;  3N89 A;  2D0C A;  3RPJ A;  1MP9 A;  1AIS A;  1R4X A;  2VJ0 A;  4TPS A;  3F10 A;  2NOB A;  1N39 A;  1QN7 A;  1LWW A;  4EJY A;  2HZS A;  1YTB A;  1KO9 A;  1KYD A;  1NGM A;  1QN5 A;  1QN8 A;  1QN6 A;  1QNB A;  3OC3 C;  2XHI A;  1C9B B;  1QN4 A;  1KY7 A;  3IH7 A;  3DPT A;  2NOE A;  2O3O A;  1B9K A;  3ASM A;  1W80 A;  5IYB P;  3ULX A;  1E42 A;  3H1Z A;  1KYF A;  2FGT A;  1TGH A;  5AN4 A;  4I8O A;  3F0Z A;  1UT7 A;  1YQM A;  1KY6 A;  1YQR A;  1UT4 A;  2D0B A;  1QTP A;  2MZ8 A;  1QTS A;  1PCZ A;  4ROE B;  1N3A A;  1VOK A;  2G30 A;  3I0X A;  2HZM A;  2MJ7 A;  4EJZ A;  1CDW A;  4ROC B;  1JFI C;  1RM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...