1VPCA

C-terminal domain (52-96) of the hiv-1 regulatory protein vpr, nmr, 1 structure
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
45
structure length
45
Chain Sequence
DTWTGVEALIRILQQLLFIHFRIGCRHSRIGIIQQRRTRNGASKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure of the (52-96) C-terminal domain of the HIV-1 regulatory protein Vpr: molecular insights into its biological functions.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Regulatory protein
molecule keywords VPR PROTEIN
total genus 11
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1998-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.90 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1vpcA00
1VPCA 1X9VA
chains in the Genus database with same CATH superfamily
2K9JA 4H44D 2WWWA 1ZN5A 4NPEA 1SQBE 2GUSA 1UIXA 2PRRA 1YI2P 2WPRA 3TSIA 1IC2A 1M8OB 2C0XA 3HD7A 2B87B 2IX7C 5TJHA 2WTYA 3LW5H 1RE4C 3AEFC 1EXJA 1RE3A 3R2PA 1HF9A 1NTZD 3A7OA 1NH4A 5AW8B 3RK2C 2N1TD 2QJKC 5CCGC 1IFPA 1BE3D 3SWYA 1LT9B 1R5SA 2KZIA 3H1HJ 1IK7A 3M06A 4I1LA 4JBZA 4D6TJ 3PRJA 2OTJP 1A02J 1DD3A 1K73Q 1FAVA 1NTZJ 1JY3P 2AXTE 3V2PA 5KKZB 4IL6X 3CC7P 3RK3E 3B5ND 1K05A 3FXDA 3A0HE 2IZ1A 3L75D 2G3AA 1JUNA 3IR9A 1EDKA 1LTBC 5AW3B 4B86A 5TISH 1JTHA 1GW4A 2N1TC 3AEDC 2JWAA 5CCGD 1KZUB 1OW6A 2KS1A 1L4AC 2Q7CA 3G9RA 1VPCA 2E75D 3KQGA 1HGVA 2I1KA 1LWUB 3M9HA 4HKZH 2PP6A 3QH9A 4IFFA 5CHXA 1YIJP 2H43A 1E79H 1JTHB 1JMMA 2IFMA 4RJTA 4XFJA 2P2UA 1SQXK 4W7ZA 4WVZA 1QX8A 1NTMG 1Q2NA 1OVVA 2QG4A 2YIUC 1ZW0A 3VTPC 4L75A 1M1KQ 1VQ4P 4C46A 1QLED 1ZRTD 2LXBA 2NZ2A 1BDDA 3H1KJ 1QGKB 3L4FA 3CC2P 1EDLA 1N86A 1G2CA 1FZEA 1SFCB 1X9VA 1N7SD 3PH0A 4GOFA 3V4QA 1HH0A 1PP9G 1RH5B 1Q90D 1JY3N 3VMAA 1OVRA 1BCCE 1NU1G 1PGOA 3C1LA 2PFXA 1M56D 3H1IE 4JYBA 5H2FE 1SQBD 3NMDA 2AXCA 5KAIE 1HJBA 3VP9A 1JMBA 2HPCA 2FYUJ 3VMXA 1YJNP 2OTLP 4AYCA 1KN7A 4H0LD 1J2JB 1MV8A 3B71A 1OIPA 1Q81Q 1P84E 3D70A 1VQNP 2GUVA 5AW4B 1X8YA 1S5LE 4NPDA 1S5LH 2A45I 2C9NY 1CSBA 1S5LX 2YKQA 1PP9D 3CC4P 2AEJA 3F89A 2V7QJ 3HUSA 1OMIA 1KB9D 1NTKD 3S4RA 3UIAA 1SQBG 1SQBJ 2M0BA 3H1ID 1EZVG 3N7NA 2JDIH 2ZXEB 5B66E 2FY8A 1M90Q 1EDJA 4IOIH 2KI7B 1N7SA 1KB9E 2O1KA 3HE4A 1HVVA 1X79B 5B5EH 1VQ7P 3RK2B 1J1DC 5E79H 1HBWA 1JM0A 2O01H 4PV1B 1KV4A 3CCRP 3FX0A 2CK3H 2FKWB 1NGMB 3VMYA 2J5UA 4DT0A 1U7MA 2HLOA 2Q6QA 2H8PD 1CI6A 3EFGA 3H1KD 1X0TA 3HD7B 1FDOA 1KORA 4QMAA 3GF7A 1KQFB 3RBXA 1DEBA 1MUUA 3II6A 3EWKA 3V2RA 4C7RA 2JP3A 1PZQA 3FWLA 1EZVD 3TNUB 1NTMD 1RF0A 1YITP 3GHGC 3TGUJ 3H1KE 2KLVA 2NPSD 1JY2N 1N73C 1LP1B 3L70D 1J1EB 2G8YA 4BXLA 3N4XA 2QSIA 4DCKA 1BE3G 3RL0g 1FC2C 2WSFH 3A0BH 3FGAD 4ASWA 4O9BA 1T2KD 2ZAEB 1ZMEC 3TNUA 2BCCJ 3SFDC 3L75J 3PLNA 1NTZE 3USSA 1VQLP 1NTMJ 2NPSC 1K04A 1HGZA 2QE7H 3HUSB 3KPEA 4HH2A 5AW9B 4ZNCA 3Q2YA 2W8ZA 2WSCH 2E43A 2Y0CA 4PD4I 3E7KA 4D6TD 1NHLA 1NU1D 1AA0A 1VQPP 3U1CA 3FXEA 5KLVD 3H1HD 3M0DC 1BE3J 1N7SB 4JYCA 2QM7A 2WSEJ 3CCVP 1D7MA 1PP9E 2ZYAA 3MP7B 1FZFA 1FOSF 1SQVJ 1KILC 3HD7D 3SSUA 2R5BA 2L5GB 3KHUA 1ZP0C 3G71P 2ZT9C 1BCCG 1NU1E 1SQXE 3EQ2A 1P84D 1VL2A 3AECC 3CWBE 1Z56A 3T97B 3H1IJ 1FZCB 5APWA 1KILB 4OVNF 3L35A 2B89A 3H32B 1T2KC 4LGDE 3JCUH 4UB8H 1L4AD 4LC1A 2NRGA 4H44C 5GTIH 1K9MQ 2K9YA 3CWBD 1M7LA 4BRYA 1H8AA 5AVXB 1OW8A 3H1LE 3G3ZA 4U7JA 1BE3E 2KSEA 3VYIA 1S9KD 3Q1MA 3H32A 2E5TA 1ZRTE 3PTZA 4H13B 4L76A 4OGQD 2Q9IA 3IN6A 2FYUD 3P7KA 2R3SA 5KKZC 2OYIA 5TISE 1FJPA 3VMZA 3MIWA 5KJ7C 1EZVE 3SWKA 1NAYA 2KUBA 1LWUC 5AVQB 3AEGC 3ITKA 2Z5HA 3S9OA 1NTKG 3H1JG 1MKMA 3Q5SA 3RK3C 2XV5A 1BCCD 1SFCA 2N1TB 5AVSB 2E76C 1PL5A 2FYUK 1W5CE 2XZRA 4H44B 1OW7A 3WUTA 4DOJA 1LTIC 3W67A 4EI2A 3CCJP 2JR8A 1QVGO 2KNCB 4R4LA 2A06G 3L72J 5APQA 1SQQJ 1NVOA 2KXPB 2RMZA 3L70E 3I55P 5H2FH 5AW1B 1IK9A 1AVYA 1ZOYC 2AEFA 3AE7C 1Q82Q 1BSNA 4H0LB 2IBZE 4I7ZC 3AE4C 1GL2B 4W80A 1VQ8P 1L4AB 1RF1B 2W83C 4EIJA 2K88A 1N73B 1AVOA 4JQ0D 1YTZI 2Z5IA 1YBKA 4KT0J 2KIKA 2IDBA 2IZ0A 3QWOC 3TF5A 4HB1A 2LXCB 1DD4A 4UB8E 1Q7YQ 2QIWA 3HE5B 4A7PA 3HTKA 2Q1KA 3KDPB 1HTLC 2E74B 1OX3A 4D6TE 1L0LJ 4WB4A 2GA1A 2Q3EA 2WPQA 3HD7C 5KLVE 1FZGA 4MN4C 1CZQA 2M5AA 2K9JB 1RE3C 4GDOA 3RBZA 2Q5UA 3RL0D 1LT9A 3F5HA 4UB6H 2C0WA 2FBWC 2V7QH 1ZV8A 3BCCJ 4OGQB 4WY4B 5CCGA 4PV1D 5KLIC 5BU5A 3H1LJ 1HWTC 1DX7A 4I7ZB 1BGYG 3IFMA 1USEA 1YJ9P 1VQ6P 3CCQP 1S9KE 5CCHA 2WT7A 2O1JA 4DZOA 2I1JA 3AE1C 1LTJB 1NTZK 2QA4P 2Y9ZA 3CL3D 3BATA 1JOCA 1SQXG 4GODA 2QEXP 1KB9H 2IFNA 2KP8A 1KYOE 2YNYA 3A2AA 3K5BA 3P32A 3D71A 1JB0J 2YXQB 1GZLA 4W7YA 1FE6A 5AVUB 1GU4A 1NJIQ 2OYHA 2E76B 1L2PA 2N1TA 1VF5B 2W6JH 3CXHI 3H6PA 4M3LA 3RL0C 3AEBC 2FYUG 1L4AA 2MKVA 1RF1A 2H7HA 1GD2E 3PJSK 2P10A 1SQQE 2FYZA 3CXHD 2V4HA 2P7JA 4H13D 2N9BA 2PAJA 1NU1K 1SQPJ 5AVTB 5AVWB 1VQMP 1FS0E 3OA7A 5DJUB 3OW2O 1R8EA 2XU6A 1EZVI 1PGPA 1GMJA 1FBMA 1CW5A 3BRVB 3CX5E 2IBZD 1GL2A 5AW2B 4YTPC 4R4MA 4DJGA 5CCHD 1QL2A 3WMM0 4Y28J 5APSA 4AUWA 1VQ9P 5GTHH 3A0BE 1SQXD 1VF5C 3RK3B 5CMZA 4GKGA 3L36A 5AVZB 2D2CD 4LLHA 1PIXA 3JSVC 3RGUA 3B5NC 3CXHE 1SVFA 2YIUB 3E1IA 4XE5B 3MUDA 3VN0A 1M57D 4CPGA 2JJLA 5CJ0A 1L0NK 1AQTA 5M1BA 2HR3A 3TYYA 3L71J 1VQ5P 1NKZB 3BVHA 3WUVA 1ZXGA 1FZAA 3IAOA 1VQKP 1KB9I 2IBZG 4IL6H 5KAIH 4ZMDA 2E76D 4IL6E 5KLIB 2RH0A 2K3RA 2WPSA 1KQLA 2FYUE 1KYOH 4RKUJ 1LNQA 5APYA 1L0LD 3H1HE 2YXRB 3L74G 1SQQG 2KK7A 2P58A 3GLMA 2DW3A 2VRSA 2Y0DA 3HUSC 5AW6B 2IYOA 1PPJD 1KFNA 1EC5A 2P67A 1NYHA 4XA4A 1NTZG 1S2EA 2ZT9B 1KMIZ 5AW0B 3CCUP 3JCUE 1VQOP 1BDCA 3LW5J 1KQGB 4AQRD 2FYNC 4D6TG 1L0LE 1T8ZA 2IYPA 2WVRA 2RN0A 3L75G 3TDKA 3U59A 2WT7B 1IFNA 2OYHB 1N7SC 3GF3A 3BCCE 3M91A 3RL0B 3CCEP 1JO5A 3O6QB 1FZCA 1Y9BA 2FFDB 2JEEA 1FJKA 2MJZA 5K5GB 2KSJA 2YKOA 3CX5H 4U3FJ 4U3FG 4H0LC 2C9LY 1SQQD 1PFIA 1RHZB 2E74C 2LKMA 2ZVOB 1BGYD 1H0TA 5KLVK 1OWAA 1RQVA 2CPBA 4K35A 1S72P 3H1JD 3GHGA 3P8CD 2FFDC 3CPWO 1M1JA 1URQC 2J58A 4PV1C 1OFCX 1N2DC 3MZWB 4WWIA 4WY4C 1VDFA 3HE4B 3PHLA 3CMAP 3H1IG 4C7NA 1LT1A 2QJYB 1LTJA 1JY3O 1LTSC 3MHVA 4OWFA 3V5BA 3SFEC 1FDMA 4YXDC 3CX5I 3V2NA 1X22A 1SQVG 1KC8Q 4I2LC 3L72E 5L8RJ 4KHXA 5APXA 2WQYC 1T3UA 1M1JB 2ZXXA 1U7JA 1AV1A 2Z4EA 1FOSE 3H1JE 1SP4A 3BCCG 3B4SA 3U1AA 4EDFA 2E75C 1J1DB 3NXSA 2HYNA 1H89A 2OGUA 2YMKA 3M0DA 2ZT9D 3OAKA 3CMEP 2B88A 2UWJE 2M3BA 3BASA 3CD6P 1HJ0A 1SQQK 1DIPA 1L0NJ 2A06E 1RE4A 1AQ5A 4ZKUA 4PD4D 1L0ND 1FU1A 1SQVD 1DEEG 1PPJG 2R32A 3GG2A 1USDA 1KTMA 3WU2H 5B5EE 3KYQA 1QL1A 5KLVJ 1OZHA 3BRTB 3H1LD 1NU1J 1SQPK 1UIIA 3A3YB 3AE5C 3L73J 4TLFA 3BCCD 4BRYB 1S1CX 1WT6A 3ABVC 3CLQA 3TGUG 1G2CB 1YTZT 3FWNA 3L73G 3PP5A 1N8RQ 3NFQA 4IFDK 1MFTA 1GDTA 1PV3A 3AE9C 1K8AQ 3GMAA 3CI9A 4ASVA 2O01N 3CX5D 5KJ7D 1EDIA 2J59M 2BCCD 1U57A 3KXDA 3H1KG 3VP8A 3L72G 2NPSB 3GW6A 1ZR4A 4PD4E 1L0NE 2ZVNB 2ITAA 2N9YB 2XDJA 3I5CA 3KZIH 2OYIC 4RESB 3CCMP 3L70J 3H25A 3P8CE 2BCCE 2KS1B 2KYVA 3M9BA 1MZ9A 1SFCC 3TGUD 3H1JJ 1EQ7A 4WBAA 2B9BA 1DH3A 1BGYE 1BGYJ 1KILE 4NPFX 3GHGB 1GTWA 5DJTB 5CBNA 2M5AB 3L37A 1NKNA 2LR2A 1RQUA 3L72D 1IFIA 3CXHH 5AVRB 1A02F 3S1KA 3V6IA 2I8DA 4U3FD 1E5WA 1L0LK 1KILD 1T6AA 3MGNA 1IFMA 4HYTB 3ZDMA 2BEZF 2P1JA 3L73E 1QVFO 2SPZA 2XKMA 2YMYA 4N78E 5APVA 3T97A 1RF1C 4PJ0E 2E42A 3CCLP 4IFMA 3V2QA 1NAFA 1NTMK 2XNXA 2R3CA 2YO3A 3C9IA 3C8VA 3D6YA 5KAFH 2A06D 2HODA 1SQVE 1KD1Q 1PP9J 1YYCA 1VF5D 1AFOA 4EYYQ 5GTIE 3HE5A 1IFDA 3D6ZA 1LTGC 1URQD 3AE8C 1PGQA 1SQPG 2D2CC 4Z1MH 3CWBJ 2OQQA 3G6EP 1LT9C 2FXOA 2CPSA 2QRXA 3AEEC 3JC22 3TK1A 1P84I 2KOGA 3L73D 3RK3D 5B66H 4N78D 1LGHB 2KB7P 2W6BA 2GM4A 1PGJA 4UB6E 1LTAC 1MFZA 3HRNA 4Y99B 5CCHC 1KYOD 2PGDA 5KTBA 3MTUE 2AXTH 1NTKE 5E79E 1N7LA 3B8EB 1WRGA 2QM8A 2WSSH 1PPJE 1JY2O 3CWBG 3R4YA 1SQXJ 2KNCA 1GL2D 1GW3A 2IBZI 2OYHC 1YQ4C 2D2CB 3O8ZA 3TGUE 4OH8B 2O3JA 3Q5PA 3NTNA 2ZYGA 4K3AA 5EFWB 2HODB 1SQBK 2Y0EA 1ZLLA 3H1LG 3KZIE 3L71G 4L73A 2ZJSE 5C39A 2HFED 1RF0C 1S4XA 1XTGB 2WPVB 1T3JA 3V4WA 4GIFA 1Y47A 2FXPA 2QJPB 2H89C 2ZFCA 4JF7A 3W68A 1N73A 1L0NG 1FDIA 1NWQA 1L0LG 1LP1A 2WITA 1GL2C 3E1RA 1NO4A 1SQPE 2A45G 3AE3C 3L75E 2H88C 3IF4A 4BWNA 1GK4A 2OYOA 2FYNB 1ZR2A 2HPCB 5APUA 2WZ7A 2R5DA 2BEQD 2BASA 2XNDH 3AE6C 2ZYDA 3LIEA 4HJGH 2NPSA 4N3YB 4U3FE 2KZJA 2POHA 2A45H 3HTKB 3A5TA 4KJMA 2Y9YA 2R44A 1SS1A 1WMKA 3B5NA 3M9QA 1KQSO 3MUDC 1JEKA 3WUUA 1JCCA 1JY2P 3RK2D 3L70G 2FFDA 1JNMA 1KFMA 1OVUA 2QVAA 4TT3H 1FZBA 1KILA 2WMMA 2L91A 5KAFE 1EXIA 3L71E 1GU5A 1RY3A 2W6AA 5BU8B 2OYIB 3B5NB 3LIDA 4H13C 2RKLA 5APTA 1XTCC 1YQ3C 3OJAB 4PJ0H 3WU2E 2B87A 4L74A 1NOHA 1NTKJ 3G4SP 2WSEH 1G1JA 1BSHA 4PD4H 5AVVB 1CI6B 2W27A 2JKVA 5KLVG 2E75B 3I56P 4N6JA 2K37A 3Q3DA 1W2BO 4YXWH 3VOPA 4RO0A 1YHQP 1J1EC 3EFFK 1G1IA 1FZCC 2QJPC 3CCSP 1IFJA 1GK6A 3AE2C 1NTME 2E74D 4JPZB 3L71D 1JCDA 5AW5B 2WSCJ 2Q3IA 1AJYA 3Q5RA 1R5LA 5KJ7A 1IO4A 1IZNB 1LWUA 2HG5D 2WSFJ 4Y99C 1HUCA 1SQVK 3AEAC 4GT1A 1H0TB 4EOTA 5AVYB 4ZKPA 1SFCD 4WY4D 1SLQA 5CBOA 4OGQC 2W90A 3L74D 3L74J 3M0AA 1S3JA 1Q86Q 5BVZA 1BCCJ 1LJ2A 1URQA 1W2EA 1M1JC 1OXZA 2FXMA 3A0HH 2KLUA 1LTTC 2QJKB 3P8MC 2OARA 4WY4A 2E5YA 5CJ4A 3O6QA 2JWDA 1LTJC 4GOEA 2M8RA 2IPPA 2K1AA 5AW7B 1SQPD 1IJDB 1NTKK 2AEMA 4C7NB 1Y8AA 2M3EA 1YJWP 2O01J 2YO2A 2QJYC 4I6MC 1KYOI 3SWFA 1H88A 1TU3F 1URQB 2YKPA 2OTKE 1QEXA 2JO1A 3H1HG 3L74E 2BCCG 3MD0A 4YPCA 5GTHE 1P84H
chains in the Genus database with same CATH topology
2WWWA 1ZN5A 2GUSA 2WPRA 3TSIA 1IC2A 2C0XA 3HD7A 2IX7C 2WTYA 3LW5H 1RE4C 1RE3A 3R2PA 3A7OA 5AW8B 1NH4A 3RK2C 3SWYA 2N1TD 5CCGC 2C9NY 1LT9B 3M06A 4I1LA 1A02J 1FAVA 1JY3P 3V2PA 3B5ND 1JUNA 3IR9A 1LTBC 5AW3B 4B86A 1JTHA 1GW4A 2N1TC 5CCGD 1KZUB 1L4AC 2Q7CA 1RF1C 1VPCA 3KQGA 1HGVA 2I1KA 1LWUB 3M9HA 4IFFA 2PP6A 5CHXA 2H43A 1JTHB 1JMMA 2IFMA 2P2UA 1SQXK 4W7ZA 3VTPC 4C46A 3L4FA 1N86A 1G2CA 1FZEA 1SFCB 1X9VA 1N7SD 3V4QA 1HH0A 1JY3N 4JYBA 3NMDA 1HJBA 3VP9A 2HPCA 3VMXA 4AYCA 1J2JB 1MV8A 2GUVA 5AW4B 1X8YA 2A45I 1CSBA 2YKQA 3HUSA 3UIAA 3N7NA 2ZXEB 1N7SA 3HE4A 2O1KA 1HVVA 1X79B 3RK2B 1J1DC 1HBWA 2O01H 2FKWB 3VMYA 2HLOA 3HD7B 2H8PD 1CI6A 3EFGA 1DEBA 1MUUA 3II6A 3V2RA 4C7RA 3TNUB 1RF0A 3GHGC 2KLVA 2NPSD 1JY2N 1N73C 1J1EB 3N4XA 2WSFH 1T2KD 4O9BA 3TNUA 2NPSC 3KPEA 1HGZA 3HUSB 4HH2A 5AW9B 2WSCH 2E43A 2FFDC 1NHLA 3U1CA 3M0DC 1N7SB 4JYCA 2QM7A 1FOSF 1FZFA 3HD7D 1KILC 2R5BA 2L5GB 3EQ2A 1Z56A 1FZCB 5APWA 1KILB 3L35A 3H32B 1T2KC 4LGDE 1L4AD 4LC1A 1M7LA 1H8AA 5AVXB 3G3ZA 3VYIA 1S9KD 3H32A 2Q9IA 3P7KA 2OYIA 1FJPA 3VMZA 3MIWA 5KJ7C 1LWUC 5AVQB 2Z5HA 3RK3C 2XV5A 1SFCA 5AVSB 2N1TB 4AQRD 2FYUK 2XZRA 4DOJA 1LTIC 5APQA 5AW1B 1IK9A 4W80A 1GL2B 1L4AB 1RF1B 4EIJA 1N73B 1YTZI 2Z5IA 3HE5B 3HTKA 3KDPB 1HTLC 4WB4A 3HD7C 2WPQA 1FZGA 1CZQA 1RE3C 2Q5UA 3RL0D 1LT9A 2C0WA 4WY4B 5CCGA 1ZV8A 5BU5A 1HWTC 1DX7A 3IFMA 1S9KE 5CCHA 2WT7A 2O1JA 4DZOA 2I1JA 1LTJB 1NTZK 3CL3D 3BATA 1JOCA 2IFNA 2YNYA 2KP8A 3A2AA 3P32A 4W7YA 1GZLA 5AVUB 1GU4A 2OYHA 2N1TA 3H6PA 4M3LA 3RL0C 1L4AA 1RF1A 2H7HA 1GD2E 2FYZA 2P7JA 5AVTB 2N9BA 2PAJA 1NU1K 5AVWB 3OA7A 2XU6A 1CW5A 1FBMA 3BRVB 1GL2A 5AW2B 5CCHD 4AUWA 1QL2A 3WMM0 5APSA 3RK3B 5CMZA 4GKGA 3L36A 5AVZB 4LLHA 3B5NC 1SVFA 3E1IA 4XE5B 3MUDA 3VN0A 2JJLA 5CJ0A 1L0NK 3TYYA 1NKZB 3BVHA 1FZAA 2WPSA 1KQLA 5APYA 2VRSA 3HUSC 5AW6B 1KFNA 2P67A 4XA4A 5AW0B 4EOTA 1T8ZA 2WT7B 3U59A 1IFNA 2OYHB 1N7SC 3M91A 1JO5A 3RL0B 1FZCA 2FFDB 2JEEA 1FJKA 2MJZA 2KSJA 2YKOA 2C9LY 1PFIA 2LKMA 5KLVK 1OWAA 2CPBA 3GHGA 3P8CD 1M1JA 1URQC 2J58A 1N2DC 4WY4C 1VDFA 3HE4B 4C7NA 3V5BA 1LTJA 1JY3O 1LTSC 1FDMA 3V2NA 4I2LC 4KHXA 5APXA 1T3UA 1M1JB 2Z4EA 1FOSE 1SP4A 3U1AA 3NXSA 1J1DB 2HYNA 1H89A 3M0DA 3OAKA 2M3BA 3BASA 1SQQK 1RE4A 1AQ5A 4ZKUA 1FU1A 2R32A 3KYQA 1QL1A 3BRTB 1SQPK 3A3YB 1WT6A 3CLQA 4IFDK 1G2CB 1YTZT 3PP5A 3NFQA 1GDTA 3CI9A 5KJ7D 2J59M 3VP8A 1ZR4A 2NPSB 2XDJA 3I5CA 2OYIC 4RESB 3P8CE 3M9BA 2KYVA 1MZ9A 1SFCC 1EQ7A 4WBAA 1DH3A 1GTWA 3GHGB 3L37A 1NKNA 1IFIA 5AVRB 1A02F 1E5WA 1L0LK 1KILD 3MGNA 1IFMA 4HYTB 2P1JA 2XKMA 4N78E 2YMYA 5APVA 3T97A 2E42A 4IFMA 3V2QA 1NAFA 1NTMK 2XNXA 2R3CA 2YO3A 3C9IA 2HODA 1YYCA 1AFOA 3HE5A 1IFDA 1LTGC 1URQD 1LT9C 3TK1A 2CPSA 2KOGA 3RK3D 4N78D 1LGHB 2KB7P 2W6BA 2GM4A 1LTAC 1MFZA 3HRNA 4Y99B 5CCHC 5KTBA 3MTUE 1N7LA 3B8EB 1WRGA 2QM8A 1JY2O 1GL2D 1GW3A 2OYHC 4OH8B 3NTNA 2HODB 1SQBK 1ZLLA 2HFED 1RF0C 1XTGB 3V4WA 1T3JA 4GIFA 4JF7A 1N73A 2ZFCA 1NWQA 2WITA 1GL2C 1NO4A 2A45G 1GK4A 1ZR2A 2HPCB 5APUA 2WZ7A 2R5DA 2BASA 4N3YB 3LIEA 2NPSA 2POHA 2A45H 3HTKB 3A5TA 3B5NA 3M9QA 1JY2P 1JCCA 3RK2D 2FFDA 1JNMA 1KFMA 1FZBA 1KILA 1GU5A 1RY3A 2W6AA 5BU8B 2OYIB 3B5NB 3LIDA 5APTA 1XTCC 3OJAB 1NOHA 2WSEH 1G1JA 5AVVB 1CI6B 2W27A 4N6JA 3VOPA 1J1EC 1FZCC 1G1IA 1IFJA 1GK6A 5AW5B 1JCDA 2Q3IA 1IO4A 5KJ7A 1LWUA 2HG5D 4Y99C 1HUCA 1SQVK 4GT1A 5AVYB 4ZKPA 1SFCD 4WY4D 1SLQA 3M0AA 5BVZA 1M1JC 1OXZA 1URQA 1W2EA 2FXMA 3P8MC 5CJ4A 1LTTC 4WY4A 2OARA 1LTJC 2M8RA 2IPPA 5AW7B 1IJDB 1NTKK 4C7NB 4I6MC 2YO2A 3SWFA 1H88A 1URQB 2YKPA 3MD0A 3O8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VPC A;  1X9V A; 
#chains in the Genus database with same CATH topology
 2K9J A;  4H44 D;  2WWW A;  1ZN5 A;  4NPE A;  1SQB E;  2GUS A;  1UIX A;  2PRR A;  1YI2 P;  2WPR A;  3TSI A;  1IC2 A;  1M8O B;  2C0X A;  3HD7 A;  2B87 B;  2IX7 C;  5TJH A;  2WTY A;  3LW5 H;  1RE4 C;  3AEF C;  1EXJ A;  1RE3 A;  3R2P A;  1HF9 A;  1NTZ D;  3A7O A;  1NH4 A;  5AW8 B;  3RK2 C;  2N1T D;  2QJK C;  5CCG C;  1IFP A;  1BE3 D;  3SWY A;  1LT9 B;  1R5S A;  2KZI A;  3H1H J;  1IK7 A;  3M06 A;  4I1L A;  4JBZ A;  4D6T J;  3PRJ A;  2OTJ P;  1A02 J;  1DD3 A;  1K73 Q;  1FAV A;  1NTZ J;  1JY3 P;  2AXT E;  3V2P A;  5KKZ B;  4IL6 X;  3CC7 P;  3RK3 E;  3B5N D;  1K05 A;  3FXD A;  3A0H E;  2IZ1 A;  3L75 D;  2G3A A;  1JUN A;  3IR9 A;  1EDK A;  1LTB C;  5AW3 B;  4B86 A;  5TIS H;  1JTH A;  1GW4 A;  2N1T C;  3AED C;  2JWA A;  5CCG D;  1KZU B;  1OW6 A;  2KS1 A;  1L4A C;  2Q7C A;  3G9R A;  1VPC A;  2E75 D;  3KQG A;  1HGV A;  2I1K A;  1LWU B;  3M9H A;  4HKZ H;  2PP6 A;  3QH9 A;  4IFF A;  5CHX A;  1YIJ P;  2H43 A;  1E79 H;  1JTH B;  1JMM A;  2IFM A;  4RJT A;  4XFJ A;  2P2U A;  1SQX K;  4W7Z A;  4WVZ A;  1QX8 A;  1NTM G;  1Q2N A;  1OVV A;  2QG4 A;  2YIU C;  1ZW0 A;  3VTP C;  4L75 A;  1M1K Q;  1VQ4 P;  4C46 A;  1QLE D;  1ZRT D;  2LXB A;  2NZ2 A;  1BDD A;  3H1K J;  1QGK B;  3L4F A;  3CC2 P;  1EDL A;  1N86 A;  1G2C A;  1FZE A;  1SFC B;  1X9V A;  1N7S D;  3PH0 A;  4GOF A;  3V4Q A;  1HH0 A;  1PP9 G;  1RH5 B;  1Q90 D;  1JY3 N;  3VMA A;  1OVR A;  1BCC E;  1NU1 G;  1PGO A;  3C1L A;  2PFX A;  1M56 D;  3H1I E;  4JYB A;  5H2F E;  1SQB D;  3NMD A;  2AXC A;  5KAI E;  1HJB A;  3VP9 A;  1JMB A;  2HPC A;  2FYU J;  3VMX A;  1YJN P;  2OTL P;  4AYC A;  1KN7 A;  4H0L D;  1J2J B;  1MV8 A;  3B71 A;  1OIP A;  1Q81 Q;  1P84 E;  3D70 A;  1VQN P;  2GUV A;  5AW4 B;  1X8Y A;  1S5L E;  4NPD A;  1S5L H;  2A45 I;  2C9N Y;  1CSB A;  1S5L X;  2YKQ A;  1PP9 D;  3CC4 P;  2AEJ A;  3F89 A;  2V7Q J;  3HUS A;  1OMI A;  1KB9 D;  1NTK D;  3S4R A;  3UIA A;  1SQB G;  1SQB J;  2M0B A;  3H1I D;  1EZV G;  3N7N A;  2JDI H;  2ZXE B;  5B66 E;  2FY8 A;  1M90 Q;  1EDJ A;  4IOI H;  2KI7 B;  1N7S A;  1KB9 E;  2O1K A;  3HE4 A;  1HVV A;  1X79 B;  5B5E H;  1VQ7 P;  3RK2 B;  1J1D C;  5E79 H;  1HBW A;  1JM0 A;  2O01 H;  4PV1 B;  1KV4 A;  3CCR P;  3FX0 A;  2CK3 H;  2FKW B;  1NGM B;  3VMY A;  2J5U A;  4DT0 A;  1U7M A;  2HLO A;  2Q6Q A;  2H8P D;  1CI6 A;  3EFG A;  3H1K D;  1X0T A;  3HD7 B;  1FDO A;  1KOR A;  4QMA A;  3GF7 A;  1KQF B;  3RBX A;  1DEB A;  1MUU A;  3II6 A;  3EWK A;  3V2R A;  4C7R A;  2JP3 A;  1PZQ A;  3FWL A;  1EZV D;  3TNU B;  1NTM D;  1RF0 A;  1YIT P;  3GHG C;  3TGU J;  3H1K E;  2KLV A;  2NPS D;  1JY2 N;  1N73 C;  1LP1 B;  3L70 D;  1J1E B;  2G8Y A;  4BXL A;  3N4X A;  2QSI A;  4DCK A;  1BE3 G;  3RL0 g;  1FC2 C;  2WSF H;  3A0B H;  3FGA D;  4ASW A;  4O9B A;  1T2K D;  2ZAE B;  1ZME C;  3TNU A;  2BCC J;  3SFD C;  3L75 J;  3PLN A;  1NTZ E;  3USS A;  1VQL P;  1NTM J;  2NPS C;  1K04 A;  1HGZ A;  2QE7 H;  3HUS B;  3KPE A;  4HH2 A;  5AW9 B;  4ZNC A;  3Q2Y A;  2W8Z A;  2WSC H;  2E43 A;  2Y0C A;  4PD4 I;  3E7K A;  4D6T D;  1NHL A;  1NU1 D;  1AA0 A;  1VQP P;  3U1C A;  3FXE A;  5KLV D;  3H1H D;  3M0D C;  1BE3 J;  1N7S B;  4JYC A;  2QM7 A;  2WSE J;  3CCV P;  1D7M A;  1PP9 E;  2ZYA A;  3MP7 B;  1FZF A;  1FOS F;  1SQV J;  1KIL C;  3HD7 D;  3SSU A;  2R5B A;  2L5G B;  3KHU A;  1ZP0 C;  3G71 P;  2ZT9 C;  1BCC G;  1NU1 E;  1SQX E;  3EQ2 A;  1P84 D;  1VL2 A;  3AEC C;  3CWB E;  1Z56 A;  3T97 B;  3H1I J;  1FZC B;  5APW A;  1KIL B;  4OVN F;  3L35 A;  2B89 A;  3H32 B;  1T2K C;  4LGD E;  3JCU H;  4UB8 H;  1L4A D;  4LC1 A;  2NRG A;  4H44 C;  5GTI H;  1K9M Q;  2K9Y A;  3CWB D;  1M7L A;  4BRY A;  1H8A A;  5AVX B;  1OW8 A;  3H1L E;  3G3Z A;  4U7J A;  1BE3 E;  2KSE A;  3VYI A;  1S9K D;  3Q1M A;  3H32 A;  2E5T A;  1ZRT E;  3PTZ A;  4H13 B;  4L76 A;  4OGQ D;  2Q9I A;  3IN6 A;  2FYU D;  3P7K A;  2R3S A;  5KKZ C;  2OYI A;  5TIS E;  1FJP A;  3VMZ A;  3MIW A;  5KJ7 C;  1EZV E;  3SWK A;  1NAY A;  2KUB A;  1LWU C;  5AVQ B;  3AEG C;  3ITK A;  2Z5H A;  3S9O A;  1NTK G;  3H1J G;  1MKM A;  3Q5S A;  3RK3 C;  2XV5 A;  1BCC D;  1SFC A;  2N1T B;  5AVS B;  2E76 C;  1PL5 A;  2FYU K;  1W5C E;  2XZR A;  4H44 B;  1OW7 A;  3WUT A;  4DOJ A;  1LTI C;  3W67 A;  4EI2 A;  3CCJ P;  2JR8 A;  1QVG O;  2KNC B;  4R4L A;  2A06 G;  3L72 J;  5APQ A;  1SQQ J;  1NVO A;  2KXP B;  2RMZ A;  3L70 E;  3I55 P;  5H2F H;  5AW1 B;  1IK9 A;  1AVY A;  1ZOY C;  2AEF A;  3AE7 C;  1Q82 Q;  1BSN A;  4H0L B;  2IBZ E;  4I7Z C;  3AE4 C;  1GL2 B;  4W80 A;  1VQ8 P;  1L4A B;  1RF1 B;  2W83 C;  4EIJ A;  2K88 A;  1N73 B;  1AVO A;  4JQ0 D;  1YTZ I;  2Z5I A;  1YBK A;  4KT0 J;  2KIK A;  2IDB A;  2IZ0 A;  3QWO C;  3TF5 A;  4HB1 A;  2LXC B;  1DD4 A;  4UB8 E;  1Q7Y Q;  2QIW A;  3HE5 B;  4A7P A;  3HTK A;  2Q1K A;  3KDP B;  1HTL C;  2E74 B;  1OX3 A;  4D6T E;  1L0L J;  4WB4 A;  2GA1 A;  2Q3E A;  2WPQ A;  3HD7 C;  5KLV E;  1FZG A;  4MN4 C;  1CZQ A;  2M5A A;  2K9J B;  1RE3 C;  4GDO A;  3RBZ A;  2Q5U A;  3RL0 D;  1LT9 A;  3F5H A;  4UB6 H;  2C0W A;  2FBW C;  2V7Q H;  1ZV8 A;  3BCC J;  4OGQ B;  4WY4 B;  5CCG A;  4PV1 D;  5KLI C;  5BU5 A;  3H1L J;  1HWT C;  1DX7 A;  4I7Z B;  1BGY G;  3IFM A;  1USE A;  1YJ9 P;  1VQ6 P;  3CCQ P;  1S9K E;  5CCH A;  2WT7 A;  2O1J A;  4DZO A;  2I1J A;  3AE1 C;  1LTJ B;  1NTZ K;  2QA4 P;  2Y9Z A;  3CL3 D;  3BAT A;  1JOC A;  1SQX G;  4GOD A;  2QEX P;  1KB9 H;  2IFN A;  2KP8 A;  1KYO E;  2YNY A;  3A2A A;  3K5B A;  3P32 A;  3D71 A;  1JB0 J;  2YXQ B;  1GZL A;  4W7Y A;  1FE6 A;  5AVU B;  1GU4 A;  1NJI Q;  2OYH A;  2E76 B;  1L2P A;  2N1T A;  1VF5 B;  2W6J H;  3CXH I;  3H6P A;  4M3L A;  3RL0 C;  3AEB C;  2FYU G;  1L4A A;  2MKV A;  1RF1 A;  2H7H A;  1GD2 E;  3PJS K;  2P10 A;  1SQQ E;  2FYZ A;  3CXH D;  2V4H A;  2P7J A;  4H13 D;  2N9B A;  2PAJ A;  1NU1 K;  1SQP J;  5AVT B;  5AVW B;  1VQM P;  1FS0 E;  3OA7 A;  5DJU B;  3OW2 O;  1R8E A;  2XU6 A;  1EZV I;  1PGP A;  1GMJ A;  1FBM A;  1CW5 A;  3BRV B;  3CX5 E;  2IBZ D;  1GL2 A;  5AW2 B;  4YTP C;  4R4M A;  4DJG A;  5CCH D;  1QL2 A;  3WMM 0;  4Y28 J;  5APS A;  4AUW A;  1VQ9 P;  5GTH H;  3A0B E;  1SQX D;  1VF5 C;  3RK3 B;  5CMZ A;  4GKG A;  3L36 A;  5AVZ B;  2D2C D;  4LLH A;  1PIX A;  3JSV C;  3RGU A;  3B5N C;  3CXH E;  1SVF A;  2YIU B;  3E1I A;  4XE5 B;  3MUD A;  3VN0 A;  1M57 D;  4CPG A;  2JJL A;  5CJ0 A;  1L0N K;  1AQT A;  5M1B A;  2HR3 A;  3TYY A;  3L71 J;  1VQ5 P;  1NKZ B;  3BVH A;  3WUV A;  1ZXG A;  1FZA A;  3IAO A;  1VQK P;  1KB9 I;  2IBZ G;  4IL6 H;  5KAI H;  4ZMD A;  2E76 D;  4IL6 E;  5KLI B;  2RH0 A;  2K3R A;  2WPS A;  1KQL A;  2FYU E;  1KYO H;  4RKU J;  1LNQ A;  5APY A;  1L0L D;  3H1H E;  2YXR B;  3L74 G;  1SQQ G;  2KK7 A;  2P58 A;  3GLM A;  2DW3 A;  2VRS A;  2Y0D A;  3HUS C;  5AW6 B;  2IYO A;  1PPJ D;  1KFN A;  1EC5 A;  2P67 A;  1NYH A;  4XA4 A;  1NTZ G;  1S2E A;  2ZT9 B;  1KMI Z;  5AW0 B;  3CCU P;  3JCU E;  1VQO P;  1BDC A;  3LW5 J;  1KQG B;  4AQR D;  2FYN C;  4D6T G;  1L0L E;  1T8Z A;  2IYP A;  2WVR A;  2RN0 A;  3L75 G;  3TDK A;  3U59 A;  2WT7 B;  1IFN A;  2OYH B;  1N7S C;  3GF3 A;  3BCC E;  3M91 A;  3RL0 B;  3CCE P;  1JO5 A;  3O6Q B;  1FZC A;  1Y9B A;  2FFD B;  2JEE A;  1FJK A;  2MJZ A;  5K5G B;  2KSJ A;  2YKO A;  3CX5 H;  4U3F J;  4U3F G;  4H0L C;  2C9L Y;  1SQQ D;  1PFI A;  1RHZ B;  2E74 C;  2LKM A;  2ZVO B;  1BGY D;  1H0T A;  5KLV K;  1OWA A;  1RQV A;  2CPB A;  4K35 A;  1S72 P;  3H1J D;  3GHG A;  3P8C D;  2FFD C;  3CPW O;  1M1J A;  1URQ C;  2J58 A;  4PV1 C;  1OFC X;  1N2D C;  3MZW B;  4WWI A;  4WY4 C;  1VDF A;  3HE4 B;  3PHL A;  3CMA P;  3H1I G;  4C7N A;  1LT1 A;  2QJY B;  1LTJ A;  1JY3 O;  1LTS C;  3MHV A;  4OWF A;  3V5B A;  3SFE C;  1FDM A;  4YXD C;  3CX5 I;  3V2N A;  1X22 A;  1SQV G;  1KC8 Q;  4I2L C;  3L72 E;  5L8R J;  4KHX A;  5APX A;  2WQY C;  1T3U A;  1M1J B;  2ZXX A;  1U7J A;  1AV1 A;  2Z4E A;  1FOS E;  3H1J E;  1SP4 A;  3BCC G;  3B4S A;  3U1A A;  4EDF A;  2E75 C;  1J1D B;  3NXS A;  2HYN A;  1H89 A;  2OGU A;  2YMK A;  3M0D A;  2ZT9 D;  3OAK A;  3CME P;  2B88 A;  2UWJ E;  2M3B A;  3BAS A;  3CD6 P;  1HJ0 A;  1SQQ K;  1DIP A;  1L0N J;  2A06 E;  1RE4 A;  1AQ5 A;  4ZKU A;  4PD4 D;  1L0N D;  1FU1 A;  1SQV D;  1DEE G;  1PPJ G;  2R32 A;  3GG2 A;  1USD A;  1KTM A;  3WU2 H;  5B5E E;  3KYQ A;  1QL1 A;  5KLV J;  1OZH A;  3BRT B;  3H1L D;  1NU1 J;  1SQP K;  1UII A;  3A3Y B;  3AE5 C;  3L73 J;  4TLF A;  3BCC D;  4BRY B;  1S1C X;  1WT6 A;  3ABV C;  3CLQ A;  3TGU G;  1G2C B;  1YTZ T;  3FWN A;  3L73 G;  3PP5 A;  1N8R Q;  3NFQ A;  4IFD K;  1MFT A;  1GDT A;  1PV3 A;  3AE9 C;  1K8A Q;  3GMA A;  3CI9 A;  4ASV A;  2O01 N;  3CX5 D;  5KJ7 D;  1EDI A;  2J59 M;  2BCC D;  1U57 A;  3KXD A;  3H1K G;  3VP8 A;  3L72 G;  2NPS B;  3GW6 A;  1ZR4 A;  4PD4 E;  1L0N E;  2ZVN B;  2ITA A;  2N9Y B;  2XDJ A;  3I5C A;  3KZI H;  2OYI C;  4RES B;  3CCM P;  3L70 J;  3H25 A;  3P8C E;  2BCC E;  2KS1 B;  2KYV A;  3M9B A;  1MZ9 A;  1SFC C;  3TGU D;  3H1J J;  1EQ7 A;  4WBA A;  2B9B A;  1DH3 A;  1BGY E;  1BGY J;  1KIL E;  4NPF X;  3GHG B;  1GTW A;  5DJT B;  5CBN A;  2M5A B;  3L37 A;  1NKN A;  2LR2 A;  1RQU A;  3L72 D;  1IFI A;  3CXH H;  5AVR B;  1A02 F;  3S1K A;  3V6I A;  2I8D A;  4U3F D;  1E5W A;  1L0L K;  1KIL D;  1T6A A;  3MGN A;  1IFM A;  4HYT B;  3ZDM A;  2BEZ F;  2P1J A;  3L73 E;  1QVF O;  2SPZ A;  2XKM A;  2YMY A;  4N78 E;  5APV A;  3T97 A;  1RF1 C;  4PJ0 E;  2E42 A;  3CCL P;  4IFM A;  3V2Q A;  1NAF A;  1NTM K;  2XNX A;  2R3C A;  2YO3 A;  3C9I A;  3C8V A;  3D6Y A;  5KAF H;  2A06 D;  2HOD A;  1SQV E;  1KD1 Q;  1PP9 J;  1YYC A;  1VF5 D;  1AFO A;  4EYY Q;  5GTI E;  3HE5 A;  1IFD A;  3D6Z A;  1LTG C;  1URQ D;  3AE8 C;  1PGQ A;  1SQP G;  2D2C C;  4Z1M H;  3CWB J;  2OQQ A;  3G6E P;  1LT9 C;  2FXO A;  2CPS A;  2QRX A;  3AEE C;  3JC2 2;  3TK1 A;  1P84 I;  2KOG A;  3L73 D;  3RK3 D;  5B66 H;  4N78 D;  1LGH B;  2KB7 P;  2W6B A;  2GM4 A;  1PGJ A;  4UB6 E;  1LTA C;  1MFZ A;  3HRN A;  4Y99 B;  5CCH C;  1KYO D;  2PGD A;  5KTB A;  3MTU E;  2AXT H;  1NTK E;  5E79 E;  1N7L A;  3B8E B;  1WRG A;  2QM8 A;  2WSS H;  1PPJ E;  1JY2 O;  3CWB G;  3R4Y A;  1SQX J;  2KNC A;  1GL2 D;  1GW3 A;  2IBZ I;  2OYH C;  1YQ4 C;  2D2C B;  3O8Z A;  3TGU E;  4OH8 B;  2O3J A;  3Q5P A;  3NTN A;  2ZYG A;  4K3A A;  5EFW B;  2HOD B;  1SQB K;  2Y0E A;  1ZLL A;  3H1L G;  3KZI E;  3L71 G;  4L73 A;  2ZJS E;  5C39 A;  2HFE D;  1RF0 C;  1S4X A;  1XTG B;  2WPV B;  1T3J A;  3V4W A;  4GIF A;  1Y47 A;  2FXP A;  2QJP B;  2H89 C;  2ZFC A;  4JF7 A;  3W68 A;  1N73 A;  1L0N G;  1FDI A;  1NWQ A;  1L0L G;  1LP1 A;  2WIT A;  1GL2 C;  3E1R A;  1NO4 A;  1SQP E;  2A45 G;  3AE3 C;  3L75 E;  2H88 C;  3IF4 A;  4BWN A;  1GK4 A;  2OYO A;  2FYN B;  1ZR2 A;  2HPC B;  5APU A;  2WZ7 A;  2R5D A;  2BEQ D;  2BAS A;  2XND H;  3AE6 C;  2ZYD A;  3LIE A;  4HJG H;  2NPS A;  4N3Y B;  4U3F E;  2KZJ A;  2POH A;  2A45 H;  3HTK B;  3A5T A;  4KJM A;  2Y9Y A;  2R44 A;  1SS1 A;  1WMK A;  3B5N A;  3M9Q A;  1KQS O;  3MUD C;  1JEK A;  3WUU A;  1JCC A;  1JY2 P;  3RK2 D;  3L70 G;  2FFD A;  1JNM A;  1KFM A;  1OVU A;  2QVA A;  4TT3 H;  1FZB A;  1KIL A;  2WMM A;  2L91 A;  5KAF E;  1EXI A;  3L71 E;  1GU5 A;  1RY3 A;  2W6A A;  5BU8 B;  2OYI B;  3B5N B;  3LID A;  4H13 C;  2RKL A;  5APT A;  1XTC C;  1YQ3 C;  3OJA B;  4PJ0 H;  3WU2 E;  2B87 A;  4L74 A;  1NOH A;  1NTK J;  3G4S P;  2WSE H;  1G1J A;  1BSH A;  4PD4 H;  5AVV B;  1CI6 B;  2W27 A;  2JKV A;  5KLV G;  2E75 B;  3I56 P;  4N6J A;  2K37 A;  3Q3D A;  1W2B O;  4YXW H;  3VOP A;  4RO0 A;  1YHQ P;  1J1E C;  3EFF K;  1G1I A;  1FZC C;  2QJP C;  3CCS P;  1IFJ A;  1GK6 A;  3AE2 C;  1NTM E;  2E74 D;  4JPZ B;  3L71 D;  1JCD A;  5AW5 B;  2WSC J;  2Q3I A;  1AJY A;  3Q5R A;  1R5L A;  5KJ7 A;  1IO4 A;  1IZN B;  1LWU A;  2HG5 D;  2WSF J;  4Y99 C;  1HUC A;  1SQV K;  3AEA C;  4GT1 A;  1H0T B;  4EOT A;  5AVY B;  4ZKP A;  1SFC D;  4WY4 D;  1SLQ A;  5CBO A;  4OGQ C;  2W90 A;  3L74 D;  3L74 J;  3M0A A;  1S3J A;  1Q86 Q;  5BVZ A;  1BCC J;  1LJ2 A;  1URQ A;  1W2E A;  1M1J C;  1OXZ A;  2FXM A;  3A0H H;  2KLU A;  1LTT C;  2QJK B;  3P8M C;  2OAR A;  4WY4 A;  2E5Y A;  5CJ4 A;  3O6Q A;  2JWD A;  1LTJ C;  4GOE A;  2M8R A;  2IPP A;  2K1A A;  5AW7 B;  1SQP D;  1IJD B;  1NTK K;  2AEM A;  4C7N B;  1Y8A A;  2M3E A;  1YJW P;  2O01 J;  2YO2 A;  2QJY C;  4I6M C;  1KYO I;  3SWF A;  1H88 A;  1TU3 F;  1URQ B;  2YKP A;  2OTK E;  1QEX A;  2JO1 A;  3H1H G;  3L74 E;  2BCC G;  3MD0 A;  4YPC A;  5GTH E;  1P84 H; 
#chains in the Genus database with same CATH homology
 2WWW A;  1ZN5 A;  2GUS A;  2WPR A;  3TSI A;  1IC2 A;  2C0X A;  3HD7 A;  2IX7 C;  2WTY A;  3LW5 H;  1RE4 C;  1RE3 A;  3R2P A;  3A7O A;  5AW8 B;  1NH4 A;  3RK2 C;  3SWY A;  2N1T D;  5CCG C;  2C9N Y;  1LT9 B;  3M06 A;  4I1L A;  1A02 J;  1FAV A;  1JY3 P;  3V2P A;  3B5N D;  1JUN A;  3IR9 A;  1LTB C;  5AW3 B;  4B86 A;  1JTH A;  1GW4 A;  2N1T C;  5CCG D;  1KZU B;  1L4A C;  2Q7C A;  1RF1 C;  1VPC A;  3KQG A;  1HGV A;  2I1K A;  1LWU B;  3M9H A;  4IFF A;  2PP6 A;  5CHX A;  2H43 A;  1JTH B;  1JMM A;  2IFM A;  2P2U A;  1SQX K;  4W7Z A;  3VTP C;  4C46 A;  3L4F A;  1N86 A;  1G2C A;  1FZE A;  1SFC B;  1X9V A;  1N7S D;  3V4Q A;  1HH0 A;  1JY3 N;  4JYB A;  3NMD A;  1HJB A;  3VP9 A;  2HPC A;  3VMX A;  4AYC A;  1J2J B;  1MV8 A;  2GUV A;  5AW4 B;  1X8Y A;  2A45 I;  1CSB A;  2YKQ A;  3HUS A;  3UIA A;  3N7N A;  2ZXE B;  1N7S A;  3HE4 A;  2O1K A;  1HVV A;  1X79 B;  3RK2 B;  1J1D C;  1HBW A;  2O01 H;  2FKW B;  3VMY A;  2HLO A;  3HD7 B;  2H8P D;  1CI6 A;  3EFG A;  1DEB A;  1MUU A;  3II6 A;  3V2R A;  4C7R A;  3TNU B;  1RF0 A;  3GHG C;  2KLV A;  2NPS D;  1JY2 N;  1N73 C;  1J1E B;  3N4X A;  2WSF H;  1T2K D;  4O9B A;  3TNU A;  2NPS C;  3KPE A;  1HGZ A;  3HUS B;  4HH2 A;  5AW9 B;  2WSC H;  2E43 A;  2FFD C;  1NHL A;  3U1C A;  3M0D C;  1N7S B;  4JYC A;  2QM7 A;  1FOS F;  1FZF A;  3HD7 D;  1KIL C;  2R5B A;  2L5G B;  3EQ2 A;  1Z56 A;  1FZC B;  5APW A;  1KIL B;  3L35 A;  3H32 B;  1T2K C;  4LGD E;  1L4A D;  4LC1 A;  1M7L A;  1H8A A;  5AVX B;  3G3Z A;  3VYI A;  1S9K D;  3H32 A;  2Q9I A;  3P7K A;  2OYI A;  1FJP A;  3VMZ A;  3MIW A;  5KJ7 C;  1LWU C;  5AVQ B;  2Z5H A;  3RK3 C;  2XV5 A;  1SFC A;  5AVS B;  2N1T B;  4AQR D;  2FYU K;  2XZR A;  4DOJ A;  1LTI C;  5APQ A;  5AW1 B;  1IK9 A;  4W80 A;  1GL2 B;  1L4A B;  1RF1 B;  4EIJ A;  1N73 B;  1YTZ I;  2Z5I A;  3HE5 B;  3HTK A;  3KDP B;  1HTL C;  4WB4 A;  3HD7 C;  2WPQ A;  1FZG A;  1CZQ A;  1RE3 C;  2Q5U A;  3RL0 D;  1LT9 A;  2C0W A;  4WY4 B;  5CCG A;  1ZV8 A;  5BU5 A;  1HWT C;  1DX7 A;  3IFM A;  1S9K E;  5CCH A;  2WT7 A;  2O1J A;  4DZO A;  2I1J A;  1LTJ B;  1NTZ K;  3CL3 D;  3BAT A;  1JOC A;  2IFN A;  2YNY A;  2KP8 A;  3A2A A;  3P32 A;  4W7Y A;  1GZL A;  5AVU B;  1GU4 A;  2OYH A;  2N1T A;  3H6P A;  4M3L A;  3RL0 C;  1L4A A;  1RF1 A;  2H7H A;  1GD2 E;  2FYZ A;  2P7J A;  5AVT B;  2N9B A;  2PAJ A;  1NU1 K;  5AVW B;  3OA7 A;  2XU6 A;  1CW5 A;  1FBM A;  3BRV B;  1GL2 A;  5AW2 B;  5CCH D;  4AUW A;  1QL2 A;  3WMM 0;  5APS A;  3RK3 B;  5CMZ A;  4GKG A;  3L36 A;  5AVZ B;  4LLH A;  3B5N C;  1SVF A;  3E1I A;  4XE5 B;  3MUD A;  3VN0 A;  2JJL A;  5CJ0 A;  1L0N K;  3TYY A;  1NKZ B;  3BVH A;  1FZA A;  2WPS A;  1KQL A;  5APY A;  2VRS A;  3HUS C;  5AW6 B;  1KFN A;  2P67 A;  4XA4 A;  5AW0 B;  4EOT A;  1T8Z A;  2WT7 B;  3U59 A;  1IFN A;  2OYH B;  1N7S C;  3M91 A;  1JO5 A;  3RL0 B;  1FZC A;  2FFD B;  2JEE A;  1FJK A;  2MJZ A;  2KSJ A;  2YKO A;  2C9L Y;  1PFI A;  2LKM A;  5KLV K;  1OWA A;  2CPB A;  3GHG A;  3P8C D;  1M1J A;  1URQ C;  2J58 A;  1N2D C;  4WY4 C;  1VDF A;  3HE4 B;  4C7N A;  3V5B A;  1LTJ A;  1JY3 O;  1LTS C;  1FDM A;  3V2N A;  4I2L C;  4KHX A;  5APX A;  1T3U A;  1M1J B;  2Z4E A;  1FOS E;  1SP4 A;  3U1A A;  3NXS A;  1J1D B;  2HYN A;  1H89 A;  3M0D A;  3OAK A;  2M3B A;  3BAS A;  1SQQ K;  1RE4 A;  1AQ5 A;  4ZKU A;  1FU1 A;  2R32 A;  3KYQ A;  1QL1 A;  3BRT B;  1SQP K;  3A3Y B;  1WT6 A;  3CLQ A;  4IFD K;  1G2C B;  1YTZ T;  3PP5 A;  3NFQ A;  1GDT A;  3CI9 A;  5KJ7 D;  2J59 M;  3VP8 A;  1ZR4 A;  2NPS B;  2XDJ A;  3I5C A;  2OYI C;  4RES B;  3P8C E;  3M9B A;  2KYV A;  1MZ9 A;  1SFC C;  1EQ7 A;  4WBA A;  1DH3 A;  1GTW A;  3GHG B;  3L37 A;  1NKN A;  1IFI A;  5AVR B;  1A02 F;  1E5W A;  1L0L K;  1KIL D;  3MGN A;  1IFM A;  4HYT B;  2P1J A;  2XKM A;  4N78 E;  2YMY A;  5APV A;  3T97 A;  2E42 A;  4IFM A;  3V2Q A;  1NAF A;  1NTM K;  2XNX A;  2R3C A;  2YO3 A;  3C9I A;  2HOD A;  1YYC A;  1AFO A;  3HE5 A;  1IFD A;  1LTG C;  1URQ D;  1LT9 C;  3TK1 A;  2CPS A;  2KOG A;  3RK3 D;  4N78 D;  1LGH B;  2KB7 P;  2W6B A;  2GM4 A;  1LTA C;  1MFZ A;  3HRN A;  4Y99 B;  5CCH C;  5KTB A;  3MTU E;  1N7L A;  3B8E B;  1WRG A;  2QM8 A;  1JY2 O;  1GL2 D;  1GW3 A;  2OYH C;  4OH8 B;  3NTN A;  2HOD B;  1SQB K;  1ZLL A;  2HFE D;  1RF0 C;  1XTG B;  3V4W A;  1T3J A;  4GIF A;  4JF7 A;  1N73 A;  2ZFC A;  1NWQ A;  2WIT A;  1GL2 C;  1NO4 A;  2A45 G;  1GK4 A;  1ZR2 A;  2HPC B;  5APU A;  2WZ7 A;  2R5D A;  2BAS A;  4N3Y B;  3LIE A;  2NPS A;  2POH A;  2A45 H;  3HTK B;  3A5T A;  3B5N A;  3M9Q A;  1JY2 P;  1JCC A;  3RK2 D;  2FFD A;  1JNM A;  1KFM A;  1FZB A;  1KIL A;  1GU5 A;  1RY3 A;  2W6A A;  5BU8 B;  2OYI B;  3B5N B;  3LID A;  5APT A;  1XTC C;  3OJA B;  1NOH A;  2WSE H;  1G1J A;  5AVV B;  1CI6 B;  2W27 A;  4N6J A;  3VOP A;  1J1E C;  1FZC C;  1G1I A;  1IFJ A;  1GK6 A;  5AW5 B;  1JCD A;  2Q3I A;  1IO4 A;  5KJ7 A;  1LWU A;  2HG5 D;  4Y99 C;  1HUC A;  1SQV K;  4GT1 A;  5AVY B;  4ZKP A;  1SFC D;  4WY4 D;  1SLQ A;  3M0A A;  5BVZ A;  1M1J C;  1OXZ A;  1URQ A;  1W2E A;  2FXM A;  3P8M C;  5CJ4 A;  1LTT C;  4WY4 A;  2OAR A;  1LTJ C;  2M8R A;  2IPP A;  5AW7 B;  1IJD B;  1NTK K;  4C7N B;  4I6M C;  2YO2 A;  3SWF A;  1H88 A;  1URQ B;  2YKP A;  3MD0 A;  3O8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...