1VPCA

C-terminal domain (52-96) of the hiv-1 regulatory protein vpr, nmr, 1 structure
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
45
structure length
45
Chain Sequence
DTWTGVEALIRILQQLLFIHFRIGCRHSRIGIIQQRRTRNGASKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VPR PROTEIN
publication title NMR structure of the (52-96) C-terminal domain of the HIV-1 regulatory protein Vpr: molecular insights into its biological functions.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Regulatory protein
total genus 11
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1998-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.90 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1vpcA00
1X9VA 1VPCA
chains in the Genus database with same CATH superfamily
2OTJP 4EDFA 4D6TG 1VQ9P 3HD7C 5AVRB 4GODA 1DH3A 2OQQA 1JMBA 3GMAA 1DIPA 1TU3F 3B5NA 1SQVD 3AEFC 3UIAA 4ASWA 1KQGB 3NTNA 1ZXGA 3A2AA 1N86A 2KK7A 1FZEA 1SQPK 3HD7B 1CSBA 1IFIA 1Y47A 1CW5A 1L0LJ 1CI6A 3E1IA 2NZ2A 5KLVJ 1Y8AA 1MZ9A 3H1IG 4HB1A 4IFFA 4NPDA 2QM8A 3SSUA 3FXEA 3CCMP 3AE5C 2HR3A 3H1KE 4IL6H 1HH0A 2PRRA 2W27A 4MN4C 4W7ZA 1PGOA 2JJLA 3GLMA 2H8PD 1PPJD 4UB8E 4PD4H 4C7NA 3R4YA 5AVQB 2H43A 3B4SA 3H1LG 1KFNA 4H44C 1KB9I 3HUSC 4Z1MH 4N6JA 2FYNC 3HRNA 2E74C 4B86A 1T2KC 2FYZA 1SQXG 3C1LA 3JCUE 1HGVA 2XNXA 1IK9A 3RK3C 1JTHB 2QJPC 1X79B 2W90A 1SS1A 2ZAEB 2L5GB 4XA4A 3TGUE 2KZJA 4KHXA 2WPSA 3BCCG 3IR9A 3CC2P 3HUSB 2E42A 2FYNB 2E74B 3AE4C 2NPSA 1GL2D 1T3JA 3F5HA 2BCCD 3AECC 1AVOA 1PP9E 2BEQD 4GDOA 2IBZG 3RK3B 1IC2A 4NPFX 1JO5A 1HVVA 2QJPB 3IFMA 1UIIA 1LTJA 1X9VA 1NWQA 1FAVA 3Q3DA 3RGUA 3M9QA 3HTKA 4Y99C 1S72P 3KYQA 1MUUA 3CXHE 1M1JC 5GTHH 1T8ZA 1QLED 1BE3E 5GTIH 5AW3B 2Y0EA 4KT0J 1YJ9P 3L75E 3AE3C 1NH4A 2C0XA 1NKNA 2OYOA 4Y99B 2B9BA 1BSNA 2QIWA 4I1LA 1NO4A 1M1JB 3M9BA 1PP9D 2N1TD 1OWAA 3CWBE 4L76A 1OW6A 1SQPE 1KV4A 1JY2N 1SFCA 1VQ5P 3A0HE 4WB4A 5BU8B 2CPSA 2ZXEB 3G3ZA 3WUVA 1L0NJ 3CXHD 3H1JE 1P84E 1SVFA 2IZ0A 1H89A 3ZDMA 2XNDH 2O1KA 5KLIC 1LT9B 2O01J 2E75C 2ITAA 3AEBC 5CCGD 4UB6E 1MFTA 2ZT9B 3LW5J 1VQ4P 2QM7A 2FFDC 2OGUA 2IPPA 1FDMA 4RJTA 1LJ2A 3GHGA 1BGYJ 3JSVC 1KYOH 5KJ7A 1GU4A 5KLIB 2J5UA 1X8YA 2YKQA 3L72J 3D71A 1DD4A 2E75B 2I1JA 2E5YA 3RL0C 2E43A 1SQPD 5DJTB 3TNUB 2FFDB 2ZYDA 4IFMA 2KB7P 3AE9C 3FGAD 5AW7B 2KNCA 1IFNA 3KPEA 3H1JD 1P84D 3FWLA 3O6QB 3T97A 4PD4D 1NTZJ 2POHA 3RL0B 2P1JA 5AVXB 5AW2B 1M56D 3H1HG 1H0TB 2R5BA 1JY3P 2OTLP 3TYYA 2QRXA 1FOSE 2B87A 4C7RA 1ZOYC 1BCCJ 1FZCC 4WY4C 2P2UA 3L70E 1GW3A 3H1IJ 1LWUA 1X0TA 4OGQC 1GZLA 2N9BA 2HFED 4IFDK 1N7SA 3CI9A 1SQBK 1OW8A 1FZCB 4WY4B 5APSA 1HJ0A 1L0LG 2G8YA 1OVVA 3GG2A 5KLVG 3NXSA 2JWDA 2Q9IA 3RBZA 2C9LY 1VQOP 3H1HD 4OGQB 3WUTA 1T6AA 4O9BA 3H1KJ 3H6PA 4YXDC 2P67A 1VQLP 1NTKJ 3HE5B 2W6AA 4HH2A 1GL2C 2YO2A 5AW6B 3L71J 2E5TA 5E79E 3L70D 3HD7A 4QMAA 4LC1A 1KQSO 2O01H 1KILD 1URQD 5B5EH 1GMJA 3L74J 3TF5A 1RF1B 1NJIQ 2AEMA 3LW5H 3R2PA 1DEEG 2B88A 2KS1B 2D2CD 3CX5E 3S1KA 1GL2B 1JEKA 1X22A 3WMM0 3MUDC 1KQFB 4U3FE 4DT0A 3W67A 2YKPA 1ZW0A 5AW4B 3L73E 1KN7A 2I8DA 2WSCH 2ZXXA 2Z4EA 2A45H 2MJZA 1JCCA 3TDKA 5APTA 2K9YA 1PL5A 4HJGH 1MKMA 1EDLA 1OX3A 1VQPP 3N7NA 2O3JA 5KTBA 1JTHA 4KJMA 3CPWO 4R4MA 4JYBA 1YBKA 2FBWC 1VQNP 3N4XA 3TK1A 3HUSA 4U3FD 1KYOD 2JP3A 1KC8Q 4EOTA 2AEFA 5APVA 1RQVA 2KI7B 5APYA 1SQXK 1PGQA 2KSEA 2GM4A 4K3AA 1LTAC 2PGDA 2DW3A 2ZVOB 1L4AD 2P7JA 1EZVG 4XFJA 1S2EA 1SLQA 1LP1A 1ZR4A 3LIDA 1ZR2A 3VP9A 1SQBE 5AW8B 1RF0C 1NTMJ 3PJSK 4AUWA 5H2FH 4YTPC 1DEBA 1L0NG 3PRJA 4HYTB 2KP8A 1OZHA 4H0LC 1KD1Q 4TLFA 1XTGB 1HGZA 3KZIH 1JM0A 1R8EA 1M1JA 1EDIA 3C9IA 3V6IA 5AVYB 3FX0A 2JKVA 1HBWA 4H0LB 3SFEC 1BGYG 1FZAA 3CCSP 2KLVA 2WSSH 3U1AA 2YMKA 3L72G 4D6TE 3AEDC 1SQQJ 1WMKA 1SQBD 1N8RQ 2GUVA 4L75A 1WRGA 2Y9ZA 5L8RJ 1PPJE 2A45G 3Q5RA 2LR2A 3MZWB 3OA7A 1NTZG 1L2PA 1JUNA 3M0DC 3VMAA 3CCLP 1QVFO 3M9HA 2OYHC 2JDIH 2W6BA 1QL1A 2E76C 1BCCG 3CXHI 3HE4B 1Q90D 4DCKA 2A06G 2FFDA 3GF3A 2QE7H 3BRTB 3AEGC 4D6TD 1D7MA 3O6QA 1S5LH 3MP7B 1JY3N 4BXLA 3C8VA 2D2CC 2OYHB 1G2CA 3G9RA 1ZLLA 5AVSB 2E76B 2BCCE 1H0TA 1RE3C 5KAIH 1URQB 2WZ7A 1VPCA 3A0BH 1KB9H 3CC7P 4PJ0H 1ZV8A 3CCUP 3CCVP 3WU2H 3Q1MA 3H1KG 1SQXE 2D2CB 2M8RA 1NTKG 5AVZB 1PIXA 3H1ID 4OH8B 5CMZA 1P84I 3L71G 5M1BA 2QVAA 2XDJA 2NPSD 1FZCA 2V7QJ 4WY4A 2K9JB 3L74G 2WITA 5B66H 2GUSA 2C0WA 4EIJA 1MV8A 3VYIA 1YYCA 2IBZE 2FYUJ 2K37A 1VF5D 3HE5A 1LT1A 3H1LD 1FS0E 1HUCA 3EWKA 1OVRA 1RE4C 1SQXD 4GIFA 3P8CD 1L0LK 1KFMA 3USSA 1LTIC 1AVYA 2KS1A 1USEA 4ZMDA 1GL2A 1M7LA 3BCCD 2QA4P 1NYHA 1UIXA 1EXIA 5CCHC 2KSJA 5TISH 1NKZB 1HJBA 2OYIC 1MFZA 4GKGA 3H32B 1FDIA 3IF4A 3RK2D 1JOCA 1NU1J 1SFCD 2IBZD 2AXTH 3M06A 1L4AB 4ZKPA 1LT9C 3NFQA 3KXDA 4BRYA 3MUDA 3B71A 1S3JA 3L75G 2ZT9C 3L4FA 4IL6E 4ZKUA 2Y9YA 2OYIB 4C46A 1RHZB 3RL0g 4PV1D 2HLOA 4PD4E 1CZQA 1AV1A 4OVNF 1AA0A 2WSEJ 1N73B 5KJ7D 3O8ZA 2HODB 2RMZA 1NTMG 3V2QA 1VQ7P 1ZN5A 1SQVJ 1NVOA 3VMZA 1Q2NA 2V7QH 2FXOA 3L35A 3I55P 3A7OA 1J2JB 4EI2A 5B66E 2QJYC 4JQ0D 3SWFA 1IFDA 1Z56A 3CX5I 3WUUA 4AQRD 2P58A 1YTZT 1BDCA 2RN0A 1CI6B 5APQA 3G4SP 3Q5SA 1KB9D 1FBMA 1E5WA 2IZ1A 3H1HE 1AQTA 2Q7CA 1FC2C 1K05A 1QL2A 1SQQG 1VDFA 1NTMD 2QJYB 4GOFA 3KHUA 5GTHE 1ZMEC 5CBNA 5GTIE 4WWIA 2HPCB 1RF0A 1YIJP 2AXCA 1KILE 4DJGA 1J1DC 2PAJA 1K04A 4YPCA 1JMMA 1L0LE 2WMMA 1L0NK 1RQUA 1K73Q 1RF1C 1J1DB 1HWTC 2IFMA 2PFXA 2Z5IA 2BCCJ 3VN0A 5CHXA 2O01N 4IL6X 2WVRA 2NPSB 3OW2O 4LLHA 4IOIH 5AW5B 3VMYA 5AVUB 4RO0A 2WSEH 3I56P 2WT7B 1GU5A 3CC4P 3HE4A 1G1JA 1Q7YQ 1R5LA 2LXBA 2HYNA 2R3SA 2SPZA 1L0LD 3PP5A 3HTKB 3W68A 2IDBA 1VF5B 5KLVD 3M0DA 5KAFH 1OMIA 1KYOE 2OYHA 4HKZH 1NTZK 2YNYA 3TGUJ 3VP8A 1FZGA 1FZFA 2JR8A 2ZVNB 3OAKA 5AW9B 3RK2C 1FE6A 2Q3EA 1PP9J 4N78E 3KDPB 2YXRB 2FYUG 4I2LC 3ABVC 4XE5B 3VTPC 2N1TC 3L73G 1GK4A 4H44D 2H89C 1H88A 2NRGA 3SFDC 2G3AA 3Q2YA 2Y0CA 2E74D 1RE3A 2I1KA 1JCDA 2QSIA 3E7KA 3RK2B 4W7YA 5C39A 3PH0A 2XZRA 2K9JA 1BE3J 2YO3A 3RK3D 1VQ6P 3V4WA 3CCQP 1PV3A 3G71P 2N1TB 2WWWA 5CCGC 3L75J 2R5DA 1AFOA 4TT3H 2N9YB 1KMIZ 1NTKK 3IN6A 2XV5A 3AE2C 3I5CA 2M5AB 3CCJP 2WSFJ 1YTZI 1NU1G 4N78D 4PV1B 2ZYAA 1KORA 3AE1C 1EZVE 1FOSF 4I6MC 3CWBJ 1SQPJ 3LIEA 4H13D 1SP4A 3KQGA 2M3EA 1Q86Q 1VL2A 1Q82Q 3V2PA 1L0NE 1EC5A 3H1JJ 2FKWB 1T3UA 4UB8H 1OIPA 1KZUB 2KXPB 2IYOA 4R4LA 4Y28J 1RE4A 1VQ8P 2FXMA 2QG4A 2KNCB 2P10A 3AEAC 5B5EE 3H32A 1GDTA 1GD2E 3E1RA 1KQLA 1KTMA 3S9OA 3JCUH 1NU1D 1OVUA 1N7LA 1BGYE 4A7PA 1FJPA 5APXA 4WBAA 5CCHA 1EZVD 1SQVG 1IJDB 2OYIA 3D6YA 3B5ND 2VRSA 1NGMB 2Q6QA 4WVZA 1G1IA 1LT9A 2YIUC 3G6EP 4OWFA 1L0ND 1FZBA 2RKLA 2IBZI 4W80A 1S9KE 1NTZE 2HODA 4U7JA 3QH9A 1Q81Q 1HTLC 1U57A 3CMAP 1BCCE 3CXHH 1LTSC 2YIUB 2ZFCA 2A06E 3L70J 1ZP0C 2ZJSE 3H1IE 1BGYD 1IFPA 1PPJG 3TNUA 3D70A 1KILC 1URQC 3L72D 3RL0D 3BVHA 2QEXP 1JB0J 1USDA 2V4HA 3JC22 1NTMK 3K5BA 2H7HA 1JY2O 1OW7A 2WSFH 2OTKE 1S9KD 2ZYGA 1K9MQ 3AE8C 1KILB 1QX8A 3H1LE 1NTZD 4K35A 3CMEP 2KYVA 3A0HH 3V2NA 3MGNA 2BEZF 4ZNCA 5K5GB 4DZOA 1NTKE 1FJKA 2HPCA 1BCCD 4N3YB 3OJAB 4WY4D 3P8CE 1P84H 2M0BA 2WPRA 3L71E 2A06D 5H2FE 3F89A 2BCCG 3TSIA 4OGQD 3KZIE 4UB6H 3L74E 4PD4I 1H8AA 3CCEP 3BCCE 3A5TA 1S1CX 1FU1A 1SQQK 1AJYA 3L36A 4AYCA 2KZIA 1M57D 1YQ4C 4U3FJ 3Q5PA 3P32A 4ASVA 1YHQP 3L73J 2YXQB 1K8AQ 4H44B 3PTZA 3H1KD 1LNQA 3TGUG 1VQKP 1W2EA 2LXCB 1NTKD 4I7ZC 3L71D 2AEJA 1RF1A 2WT7A 2IX7C 3BASA 4BWNA 1PP9G 1OXZA 3B8EB 3D6ZA 5KLVK 1L4AC 4JBZA 1W2BO 1IK7A 3L74D 4H13C 3RBXA 3A3YB 2IYPA 4GOEA 2Q3IA 4CPGA 1YJWP 1LP1B 1U7JA 3GW6A 3H25A 4I7ZB 2KIKA 1PZQA 2L91A 1BE3G 1EDKA 2RH0A 3VMXA 5APUA 5APWA 5AVWB 3TGUD 4H13B 1PFIA 1N73C 1S5LE 1YQ3C 2J58A 3S4RA 4RESB 2MKVA 5AW1B 3GF7A 5KAIE 3A0BE 1KB9E 4PJ0E 3CWBG 3B5NC 1BDDA 1SQPG 1SQBJ 3MD0A 2QJKC 3WU2E 1DX7A 2Y0DA 1NTME 2N1TA 1AQ5A 5E79H 1BE3D 1EQ7A 1QGKB 2FYUK 3H1JG 3CCRP 1NHLA 3L75D 1QEXA 1W5CE 4GT1A 2M5AA 1ZRTE 3B5NB 4JYCA 1JNMA 2YKOA 2QJKB 3CX5H 2JEEA 3AE6C 2FXPA 5CCGA 1DD3A 2B89A 2HG5D 2W8ZA 2GA1A 1KYOI 3CWBD 2PP6A 4D6TJ 2WSCJ 1SQQE 3V4QA 2BASA 2W6JH 3MHVA 1YJNP 4YXWH 1EDJA 1NU1K 4H0LD 1LGHB 3II6A 1G2CB 1R5SA 1N7SD 3SWKA 1NAFA 2KOGA 1ZRTD 2R44A 4C7NB 3EQ2A 5TISE 2WTYA 3VOPA 5BU5A 5KLVE 3L37A 3L70G 2AXTE 1GK6A 1NOHA 4L73A 2H88C 1Y9BA 2NPSC 2WQYC 2CK3H 1SQQD 3PLNA 1BSHA 3HD7D 1LTJC 1PGPA 2FY8A 3IAOA 1RH5B 3U59A 1VF5C 2YMYA 3BATA 3MIWA 1SQVK 1S5LX 3QWOC 3H1LJ 2WPVB 1EZVI 4L74A 2IFNA 2OARA 2R3CA 1SQXJ 1S4XA 1LTJB 2E76D 3EFGA 4NPEA 2K3RA 1M1KQ 1IFMA 2W83C 3RK3E 2Q5UA 3BCCJ 3V5BA 3BRVB 5CBOA 1VQMP 1M8OB 3AE7C 1WT6A 3SWYA 2J59M 1KILA 1URQA 2FYUE 1SFCC 2M3BA 4U3FG 2KUBA 1IFJA 1IO4A 1FDOA 2Z5HA 1QVGO 2Q1KA 1YITP 1A02F 1RY3A 3M91A 4M3LA 3U1CA 4BRYB 1T2KD 1GTWA 3AEEC 1SFCB 3EFFK 1LTTC 2A45I 3CD6P 1OFCX 4PV1C 3CL3D 1M90Q 2C9NY 1XTCC 1YI2P 1IZNB 1JY2P 1PGJA 3GHGC 4JF7A 5KJ7C 3CX5D 1GW4A 2K88A 1J1EC 2XU6A 4RKUJ 1NU1E 3FWNA 2FYUD 1JY3O 3L73D 3P8MC 3GHGB 3V2RA 5KKZC 5CJ4A 1U7MA 3M0AA 3MTUE 3ITKA 5CJ0A 3PHLA 1NAYA 4JPZB 1J1EB 1N2DC 2O1JA 1EXJA 5AVVB 2R32A 1E79H 3P7KA 2UWJE 3FXDA 5KKZB 3T97B 5CCHD 1LWUC 3CLQA 1L4AA 1LTGC 1SQBG 1A02J 2LKMA 4DOJA 1SQVE 1N7SC 2B87B 2K1AA 5KAFE 3L72E 2KLUA 4EYYQ 2ZT9D 1LWUB 2JO1A 3NMDA 2JWAA 5AVTB 5DJUB 5TJHA 5EFWB 1LTBC 2XKMA 1N7SB 1N73A 4LGDE 1HF9A 5AW0B 2WPQA 3H1HJ 2E75D 2CPBA 5BVZA
chains in the Genus database with same CATH topology
1QL2A 1RF1A 2WT7A 1JCCA 2IX7C 3BASA 3B8EB 1OXZA 3HD7C 5AVRB 5KLVK 1VDFA 1L4AC 5APTA 1DH3A 3A3YB 3N7NA 3B5NA 3UIAA 5KTBA 1JTHA 2HPCB 1RF0A 2Q3IA 3NTNA 4JYBA 3A2AA 1N86A 1J1DC 2PAJA 3N4XA 1FZEA 1SQPK 3TK1A 3HUSA 3HD7B 1CSBA 1JMMA 1IFIA 1CW5A 3VMXA 1CI6A 5APUA 5APWA 5AVWB 4EOTA 3E1IA 1L0NK 1PFIA 1MZ9A 1N73C 5APVA 5APYA 1SQXK 4IFFA 2J58A 2QM8A 2GM4A 4RESB 1RF1C 1J1DB 1HWTC 5AW1B 1LTAC 1HH0A 2W27A 2IFMA 1L4AD 2P7JA 4W7ZA 2Z5IA 1SLQA 2JJLA 3VN0A 2H8PD 5CHXA 1ZR4A 3LIDA 3B5NC 3VP9A 1ZR2A 4C7NA 3MD0A 5AW8B 1DX7A 1RF0C 2NPSB 4LLHA 2N1TA 1AQ5A 5AVQB 4AUWA 5AW5B 2H43A 3VMYA 5AVUB 2WSEH 1KFNA 1DEBA 1EQ7A 2WT7B 4HYTB 1GU5A 2FYUK 2KP8A 3HE4A 3HUSC 1G1JA 4N6JA 1XTGB 3HRNA 2HYNA 4B86A 1HGZA 1T2KC 1NHLA 2FYZA 3PP5A 1HGVA 1M1JA 3HTKB 2XNXA 4GT1A 3C9IA 3B5NB 1IK9A 3RK3C 4JYCA 1JNMA 2YKOA 3M0DA 1JTHB 5AVYB 1X79B 2JEEA 2OYHA 2L5GB 1NTZK 2YNYA 4XA4A 5CCGA 4KHXA 2WPSA 1HBWA 3IR9A 3HUSB 3VP8A 1FZGA 1FZFA 2E42A 2HG5D 1FZAA 2KLVA 3OAKA 5AW9B 3RK2C 2NPSA 1GL2D 1T3JA 3U1AA 2PP6A 3V4QA 4N78E 3KDPB 2BASA 3RK3B 1IC2A 4I2LC 1JO5A 1HVVA 3IFMA 4XE5B 3VTPC 2N1TC 1LTJA 1X9VA 1NWQA 1FAVA 2GUVA 1GK4A 3M9QA 1H88A 1WRGA 1NU1K 2A45G 3HTKA 1LGHB 3II6A 4Y99C 1G2CB 1N7SD 1RE3A 3KYQA 1MUUA 1JCDA 2I1KA 3RK2B 4W7YA 1M1JC 1NAFA 1T8ZA 2XZRA 3OA7A 2KOGA 2YO3A 5AW3B 3RK3D 1JUNA 3M0DC 4C7NB 3M9HA 3V4WA 3EQ2A 2WTYA 2OYHC 2N1TB 2W6BA 1QL1A 2WWWA 5CCGC 3VOPA 5BU5A 3HE4B 2R5DA 1NH4A 2C0XA 3L37A 1NKNA 4Y99B 2FFDA 1AFOA 1GK6A 1NOHA 4I1LA 1NO4A 1NTKK 2NPSC 1M1JB 3BRTB 2XV5A 3I5CA 3M9BA 1YTZI 4N78D 1JY3N 3HD7D 1LTJC 2OYHB 2N1TD 1G2CA 1ZLLA 1FOSF 5AVSB 4I6MC 1OWAA 3U59A 1JY2N 3LIEA 1SFCA 4WB4A 5BU8B 1SP4A 2YMYA 3BATA 3MIWA 1RE3C 1SQVK 3KQGA 2CPSA 1URQB 2WZ7A 1VPCA 2ZXEB 3G3ZA 3V2PA 2IFNA 2OARA 1ZV8A 1SVFA 2FKWB 1T3UA 2R3CA 1KZUB 1H89A 1RE4A 2O1KA 2M8RA 1LT9B 1LTJB 2FXMA 5CCGD 3EFGA 3H32A 5AVZB 1GDTA 1GD2E 1IFMA 4OH8B 5CMZA 2QM7A 2FFDC 2Q5UA 2IPPA 2XDJA 1KQLA 2NPSD 1FDMA 1FZCA 4WY4A 1N7LA 3V5BA 3BRVB 3GHGA 2WITA 1FJPA 5APXA 5KJ7A 4WBAA 5CCHA 1GU4A 2GUSA 2C0WA 4EIJA 3SWYA 1WT6A 1IJDB 1MV8A 1X8YA 2YKQA 2OYIA 2J59M 3VYIA 1KILA 1URQA 2I1JA 3RL0C 1YYCA 2E43A 1SFCC 2M3BA 3TNUB 3B5ND 2FFDB 2VRSA 3HE5A 4IFMA 1G1IA 1LT9A 2KB7P 5AW7B 1IFJA 1IO4A 3KPEA 1IFNA 2Z5HA 1HUCA 1FZBA 4W80A 1S9KE 1RY3A 1A02F 3T97A 1RE4C 3M91A 4GIFA 4M3LA 3U1CA 2HODA 1T2KD 1GTWA 3P8CD 2POHA 3RL0B 1L0LK 2P1JA 5AVXB 1KFMA 5AW2B 1SFCB 1LTTC 2A45I 2R5BA 1JY3P 1LTIC 3TYYA 1FOSE 1HTLC 3CL3D 4C7RA 2C9NY 1LTSC 1FZCC 1GL2A 4WY4C 1XTCC 2ZFCA 1M7LA 1JY2P 2P2UA 3GHGC 4JF7A 1GW3A 5KJ7C 5CCHC 2KSJA 1NKZB 3TNUA 1LWUA 1HJBA 2OYIC 1GW4A 1MFZA 1KILC 1URQC 4GKGA 1J1EC 3H32B 2XU6A 3RL0D 3RK2D 1JOCA 3BVHA 1SFCD 1GZLA 2N9BA 1JY3O 2HFED 4IFDK 3M06A 1L4AB 1N7SA 4ZKPA 3CI9A 1SQBK 1LT9C 3NFQA 1FZCB 1NTMK 4WY4B 5APSA 2H7HA 1JY2O 3MUDA 3P8MC 2WSFH 3GHGB 3V2RA 5CJ4A 3L4FA 1S9KD 3M0AA 3NXSA 3MTUE 2Q9IA 4ZKUA 2OYIB 5CJ0A 1KILB 2C9LY 1J1EB 1N2DC 2O1JA 4C46A 4O9BA 2KYVA 3V2NA 3H6PA 3MGNA 5AVVB 2P67A 2R32A 4DZOA 3HE5B 2HLOA 2W6AA 1FJKA 4HH2A 2HPCA 1GL2C 1CZQA 2YO2A 3OJAB 3P7KA 4N3YB 4WY4D 5AW6B 3P8CE 2WPRA 1N73B 3TSIA 5KJ7D 5CCHD 3O8ZA 3HD7A 1LWUC 3CLQA 4LC1A 1L4AA 2O01H 2HODB 1KILD 1URQD 1LTGC 1H8AA 1RF1B 1A02J 2LKMA 3V2QA 3LW5H 3A5TA 4DOJA 1ZN5A 3R2PA 1FU1A 1SQQK 1N7SC 3VMZA 1GL2B 3WMM0 3L35A 3L36A 4AYCA 3A7OA 1J2JB 1LWUB 3P32A 2YKPA 3NMDA 5AW4B 1IFDA 3SWFA 1Z56A 5AVTB 4AQRD 2WSCH 1LTBC 2Z4EA 2XKMA 1YTZT 1N7SB 1N73A 1W2EA 4LGDE 1CI6B 5APQA 5AW0B 2A45H 2WPQA 2MJZA 1FBMA 1E5WA 5BVZA 2CPBA 2Q7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9V A;  1VPC A; 
#chains in the Genus database with same CATH topology
 2OTJ P;  4EDF A;  4D6T G;  1VQ9 P;  3HD7 C;  5AVR B;  4GOD A;  1DH3 A;  2OQQ A;  1JMB A;  3GMA A;  1DIP A;  1TU3 F;  3B5N A;  1SQV D;  3AEF C;  3UIA A;  4ASW A;  1KQG B;  3NTN A;  1ZXG A;  3A2A A;  1N86 A;  2KK7 A;  1FZE A;  1SQP K;  3HD7 B;  1CSB A;  1IFI A;  1Y47 A;  1CW5 A;  1L0L J;  1CI6 A;  3E1I A;  2NZ2 A;  5KLV J;  1Y8A A;  1MZ9 A;  3H1I G;  4HB1 A;  4IFF A;  4NPD A;  2QM8 A;  3SSU A;  3FXE A;  3CCM P;  3AE5 C;  2HR3 A;  3H1K E;  4IL6 H;  1HH0 A;  2PRR A;  2W27 A;  4MN4 C;  4W7Z A;  1PGO A;  2JJL A;  3GLM A;  2H8P D;  1PPJ D;  4UB8 E;  4PD4 H;  4C7N A;  3R4Y A;  5AVQ B;  2H43 A;  3B4S A;  3H1L G;  1KFN A;  4H44 C;  1KB9 I;  3HUS C;  4Z1M H;  4N6J A;  2FYN C;  3HRN A;  2E74 C;  4B86 A;  1T2K C;  2FYZ A;  1SQX G;  3C1L A;  3JCU E;  1HGV A;  2XNX A;  1IK9 A;  3RK3 C;  1JTH B;  2QJP C;  1X79 B;  2W90 A;  1SS1 A;  2ZAE B;  2L5G B;  4XA4 A;  3TGU E;  2KZJ A;  4KHX A;  2WPS A;  3BCC G;  3IR9 A;  3CC2 P;  3HUS B;  2E42 A;  2FYN B;  2E74 B;  3AE4 C;  2NPS A;  1GL2 D;  1T3J A;  3F5H A;  2BCC D;  3AEC C;  1AVO A;  1PP9 E;  2BEQ D;  4GDO A;  2IBZ G;  3RK3 B;  1IC2 A;  4NPF X;  1JO5 A;  1HVV A;  2QJP B;  3IFM A;  1UII A;  1LTJ A;  1X9V A;  1NWQ A;  1FAV A;  3Q3D A;  3RGU A;  3M9Q A;  3HTK A;  4Y99 C;  1S72 P;  3KYQ A;  1MUU A;  3CXH E;  1M1J C;  5GTH H;  1T8Z A;  1QLE D;  1BE3 E;  5GTI H;  5AW3 B;  2Y0E A;  4KT0 J;  1YJ9 P;  3L75 E;  3AE3 C;  1NH4 A;  2C0X A;  1NKN A;  2OYO A;  4Y99 B;  2B9B A;  1BSN A;  2QIW A;  4I1L A;  1NO4 A;  1M1J B;  3M9B A;  1PP9 D;  2N1T D;  1OWA A;  3CWB E;  4L76 A;  1OW6 A;  1SQP E;  1KV4 A;  1JY2 N;  1SFC A;  1VQ5 P;  3A0H E;  4WB4 A;  5BU8 B;  2CPS A;  2ZXE B;  3G3Z A;  3WUV A;  1L0N J;  3CXH D;  3H1J E;  1P84 E;  1SVF A;  2IZ0 A;  1H89 A;  3ZDM A;  2XND H;  2O1K A;  5KLI C;  1LT9 B;  2O01 J;  2E75 C;  2ITA A;  3AEB C;  5CCG D;  4UB6 E;  1MFT A;  2ZT9 B;  3LW5 J;  1VQ4 P;  2QM7 A;  2FFD C;  2OGU A;  2IPP A;  1FDM A;  4RJT A;  1LJ2 A;  3GHG A;  1BGY J;  3JSV C;  1KYO H;  5KJ7 A;  1GU4 A;  5KLI B;  2J5U A;  1X8Y A;  2YKQ A;  3L72 J;  3D71 A;  1DD4 A;  2E75 B;  2I1J A;  2E5Y A;  3RL0 C;  2E43 A;  1SQP D;  5DJT B;  3TNU B;  2FFD B;  2ZYD A;  4IFM A;  2KB7 P;  3AE9 C;  3FGA D;  5AW7 B;  2KNC A;  1IFN A;  3KPE A;  3H1J D;  1P84 D;  3FWL A;  3O6Q B;  3T97 A;  4PD4 D;  1NTZ J;  2POH A;  3RL0 B;  2P1J A;  5AVX B;  5AW2 B;  1M56 D;  3H1H G;  1H0T B;  2R5B A;  1JY3 P;  2OTL P;  3TYY A;  2QRX A;  1FOS E;  2B87 A;  4C7R A;  1ZOY C;  1BCC J;  1FZC C;  4WY4 C;  2P2U A;  3L70 E;  1GW3 A;  3H1I J;  1LWU A;  1X0T A;  4OGQ C;  1GZL A;  2N9B A;  2HFE D;  4IFD K;  1N7S A;  3CI9 A;  1SQB K;  1OW8 A;  1FZC B;  4WY4 B;  5APS A;  1HJ0 A;  1L0L G;  2G8Y A;  1OVV A;  3GG2 A;  5KLV G;  3NXS A;  2JWD A;  2Q9I A;  3RBZ A;  2C9L Y;  1VQO P;  3H1H D;  4OGQ B;  3WUT A;  1T6A A;  4O9B A;  3H1K J;  3H6P A;  4YXD C;  2P67 A;  1VQL P;  1NTK J;  3HE5 B;  2W6A A;  4HH2 A;  1GL2 C;  2YO2 A;  5AW6 B;  3L71 J;  2E5T A;  5E79 E;  3L70 D;  3HD7 A;  4QMA A;  4LC1 A;  1KQS O;  2O01 H;  1KIL D;  1URQ D;  5B5E H;  1GMJ A;  3L74 J;  3TF5 A;  1RF1 B;  1NJI Q;  2AEM A;  3LW5 H;  3R2P A;  1DEE G;  2B88 A;  2KS1 B;  2D2C D;  3CX5 E;  3S1K A;  1GL2 B;  1JEK A;  1X22 A;  3WMM 0;  3MUD C;  1KQF B;  4U3F E;  4DT0 A;  3W67 A;  2YKP A;  1ZW0 A;  5AW4 B;  3L73 E;  1KN7 A;  2I8D A;  2WSC H;  2ZXX A;  2Z4E A;  2A45 H;  2MJZ A;  1JCC A;  3TDK A;  5APT A;  2K9Y A;  1PL5 A;  4HJG H;  1MKM A;  1EDL A;  1OX3 A;  1VQP P;  3N7N A;  2O3J A;  5KTB A;  1JTH A;  4KJM A;  3CPW O;  4R4M A;  4JYB A;  1YBK A;  2FBW C;  1VQN P;  3N4X A;  3TK1 A;  3HUS A;  4U3F D;  1KYO D;  2JP3 A;  1KC8 Q;  4EOT A;  2AEF A;  5APV A;  1RQV A;  2KI7 B;  5APY A;  1SQX K;  1PGQ A;  2KSE A;  2GM4 A;  4K3A A;  1LTA C;  2PGD A;  2DW3 A;  2ZVO B;  1L4A D;  2P7J A;  1EZV G;  4XFJ A;  1S2E A;  1SLQ A;  1LP1 A;  1ZR4 A;  3LID A;  1ZR2 A;  3VP9 A;  1SQB E;  5AW8 B;  1RF0 C;  1NTM J;  3PJS K;  4AUW A;  5H2F H;  4YTP C;  1DEB A;  1L0N G;  3PRJ A;  4HYT B;  2KP8 A;  1OZH A;  4H0L C;  1KD1 Q;  4TLF A;  1XTG B;  1HGZ A;  3KZI H;  1JM0 A;  1R8E A;  1M1J A;  1EDI A;  3C9I A;  3V6I A;  5AVY B;  3FX0 A;  2JKV A;  1HBW A;  4H0L B;  3SFE C;  1BGY G;  1FZA A;  3CCS P;  2KLV A;  2WSS H;  3U1A A;  2YMK A;  3L72 G;  4D6T E;  3AED C;  1SQQ J;  1WMK A;  1SQB D;  1N8R Q;  2GUV A;  4L75 A;  1WRG A;  2Y9Z A;  5L8R J;  1PPJ E;  2A45 G;  3Q5R A;  2LR2 A;  3MZW B;  3OA7 A;  1NTZ G;  1L2P A;  1JUN A;  3M0D C;  3VMA A;  3CCL P;  1QVF O;  3M9H A;  2OYH C;  2JDI H;  2W6B A;  1QL1 A;  2E76 C;  1BCC G;  3CXH I;  3HE4 B;  1Q90 D;  4DCK A;  2A06 G;  2FFD A;  3GF3 A;  2QE7 H;  3BRT B;  3AEG C;  4D6T D;  1D7M A;  3O6Q A;  1S5L H;  3MP7 B;  1JY3 N;  4BXL A;  3C8V A;  2D2C C;  2OYH B;  1G2C A;  3G9R A;  1ZLL A;  5AVS B;  2E76 B;  2BCC E;  1H0T A;  1RE3 C;  5KAI H;  1URQ B;  2WZ7 A;  1VPC A;  3A0B H;  1KB9 H;  3CC7 P;  4PJ0 H;  1ZV8 A;  3CCU P;  3CCV P;  3WU2 H;  3Q1M A;  3H1K G;  1SQX E;  2D2C B;  2M8R A;  1NTK G;  5AVZ B;  1PIX A;  3H1I D;  4OH8 B;  5CMZ A;  1P84 I;  3L71 G;  5M1B A;  2QVA A;  2XDJ A;  2NPS D;  1FZC A;  2V7Q J;  4WY4 A;  2K9J B;  3L74 G;  2WIT A;  5B66 H;  2GUS A;  2C0W A;  4EIJ A;  1MV8 A;  3VYI A;  1YYC A;  2IBZ E;  2FYU J;  2K37 A;  1VF5 D;  3HE5 A;  1LT1 A;  3H1L D;  1FS0 E;  1HUC A;  3EWK A;  1OVR A;  1RE4 C;  1SQX D;  4GIF A;  3P8C D;  1L0L K;  1KFM A;  3USS A;  1LTI C;  1AVY A;  2KS1 A;  1USE A;  4ZMD A;  1GL2 A;  1M7L A;  3BCC D;  2QA4 P;  1NYH A;  1UIX A;  1EXI A;  5CCH C;  2KSJ A;  5TIS H;  1NKZ B;  1HJB A;  2OYI C;  1MFZ A;  4GKG A;  3H32 B;  1FDI A;  3IF4 A;  3RK2 D;  1JOC A;  1NU1 J;  1SFC D;  2IBZ D;  2AXT H;  3M06 A;  1L4A B;  4ZKP A;  1LT9 C;  3NFQ A;  3KXD A;  4BRY A;  3MUD A;  3B71 A;  1S3J A;  3L75 G;  2ZT9 C;  3L4F A;  4IL6 E;  4ZKU A;  2Y9Y A;  2OYI B;  4C46 A;  1RHZ B;  3RL0 g;  4PV1 D;  2HLO A;  4PD4 E;  1CZQ A;  1AV1 A;  4OVN F;  1AA0 A;  2WSE J;  1N73 B;  5KJ7 D;  3O8Z A;  2HOD B;  2RMZ A;  1NTM G;  3V2Q A;  1VQ7 P;  1ZN5 A;  1SQV J;  1NVO A;  3VMZ A;  1Q2N A;  2V7Q H;  2FXO A;  3L35 A;  3I55 P;  3A7O A;  1J2J B;  4EI2 A;  5B66 E;  2QJY C;  4JQ0 D;  3SWF A;  1IFD A;  1Z56 A;  3CX5 I;  3WUU A;  4AQR D;  2P58 A;  1YTZ T;  1BDC A;  2RN0 A;  1CI6 B;  5APQ A;  3G4S P;  3Q5S A;  1KB9 D;  1FBM A;  1E5W A;  2IZ1 A;  3H1H E;  1AQT A;  2Q7C A;  1FC2 C;  1K05 A;  1QL2 A;  1SQQ G;  1VDF A;  1NTM D;  2QJY B;  4GOF A;  3KHU A;  5GTH E;  1ZME C;  5CBN A;  5GTI E;  4WWI A;  2HPC B;  1RF0 A;  1YIJ P;  2AXC A;  1KIL E;  4DJG A;  1J1D C;  2PAJ A;  1K04 A;  4YPC A;  1JMM A;  1L0L E;  2WMM A;  1L0N K;  1RQU A;  1K73 Q;  1RF1 C;  1J1D B;  1HWT C;  2IFM A;  2PFX A;  2Z5I A;  2BCC J;  3VN0 A;  5CHX A;  2O01 N;  4IL6 X;  2WVR A;  2NPS B;  3OW2 O;  4LLH A;  4IOI H;  5AW5 B;  3VMY A;  5AVU B;  4RO0 A;  2WSE H;  3I56 P;  2WT7 B;  1GU5 A;  3CC4 P;  3HE4 A;  1G1J A;  1Q7Y Q;  1R5L A;  2LXB A;  2HYN A;  2R3S A;  2SPZ A;  1L0L D;  3PP5 A;  3HTK B;  3W68 A;  2IDB A;  1VF5 B;  5KLV D;  3M0D A;  5KAF H;  1OMI A;  1KYO E;  2OYH A;  4HKZ H;  1NTZ K;  2YNY A;  3TGU J;  3VP8 A;  1FZG A;  1FZF A;  2JR8 A;  2ZVN B;  3OAK A;  5AW9 B;  3RK2 C;  1FE6 A;  2Q3E A;  1PP9 J;  4N78 E;  3KDP B;  2YXR B;  2FYU G;  4I2L C;  3ABV C;  4XE5 B;  3VTP C;  2N1T C;  3L73 G;  1GK4 A;  4H44 D;  2H89 C;  1H88 A;  2NRG A;  3SFD C;  2G3A A;  3Q2Y A;  2Y0C A;  2E74 D;  1RE3 A;  2I1K A;  1JCD A;  2QSI A;  3E7K A;  3RK2 B;  4W7Y A;  5C39 A;  3PH0 A;  2XZR A;  2K9J A;  1BE3 J;  2YO3 A;  3RK3 D;  1VQ6 P;  3V4W A;  3CCQ P;  1PV3 A;  3G71 P;  2N1T B;  2WWW A;  5CCG C;  3L75 J;  2R5D A;  1AFO A;  4TT3 H;  2N9Y B;  1KMI Z;  1NTK K;  3IN6 A;  2XV5 A;  3AE2 C;  3I5C A;  2M5A B;  3CCJ P;  2WSF J;  1YTZ I;  1NU1 G;  4N78 D;  4PV1 B;  2ZYA A;  1KOR A;  3AE1 C;  1EZV E;  1FOS F;  4I6M C;  3CWB J;  1SQP J;  3LIE A;  4H13 D;  1SP4 A;  3KQG A;  2M3E A;  1Q86 Q;  1VL2 A;  1Q82 Q;  3V2P A;  1L0N E;  1EC5 A;  3H1J J;  2FKW B;  1T3U A;  4UB8 H;  1OIP A;  1KZU B;  2KXP B;  2IYO A;  4R4L A;  4Y28 J;  1RE4 A;  1VQ8 P;  2FXM A;  2QG4 A;  2KNC B;  2P10 A;  3AEA C;  5B5E E;  3H32 A;  1GDT A;  1GD2 E;  3E1R A;  1KQL A;  1KTM A;  3S9O A;  3JCU H;  1NU1 D;  1OVU A;  1N7L A;  1BGY E;  4A7P A;  1FJP A;  5APX A;  4WBA A;  5CCH A;  1EZV D;  1SQV G;  1IJD B;  2OYI A;  3D6Y A;  3B5N D;  2VRS A;  1NGM B;  2Q6Q A;  4WVZ A;  1G1I A;  1LT9 A;  2YIU C;  3G6E P;  4OWF A;  1L0N D;  1FZB A;  2RKL A;  2IBZ I;  4W80 A;  1S9K E;  1NTZ E;  2HOD A;  4U7J A;  3QH9 A;  1Q81 Q;  1HTL C;  1U57 A;  3CMA P;  1BCC E;  3CXH H;  1LTS C;  2YIU B;  2ZFC A;  2A06 E;  3L70 J;  1ZP0 C;  2ZJS E;  3H1I E;  1BGY D;  1IFP A;  1PPJ G;  3TNU A;  3D70 A;  1KIL C;  1URQ C;  3L72 D;  3RL0 D;  3BVH A;  2QEX P;  1JB0 J;  1USD A;  2V4H A;  3JC2 2;  1NTM K;  3K5B A;  2H7H A;  1JY2 O;  1OW7 A;  2WSF H;  2OTK E;  1S9K D;  2ZYG A;  1K9M Q;  3AE8 C;  1KIL B;  1QX8 A;  3H1L E;  1NTZ D;  4K35 A;  3CME P;  2KYV A;  3A0H H;  3V2N A;  3MGN A;  2BEZ F;  4ZNC A;  5K5G B;  4DZO A;  1NTK E;  1FJK A;  2HPC A;  1BCC D;  4N3Y B;  3OJA B;  4WY4 D;  3P8C E;  1P84 H;  2M0B A;  2WPR A;  3L71 E;  2A06 D;  5H2F E;  3F89 A;  2BCC G;  3TSI A;  4OGQ D;  3KZI E;  4UB6 H;  3L74 E;  4PD4 I;  1H8A A;  3CCE P;  3BCC E;  3A5T A;  1S1C X;  1FU1 A;  1SQQ K;  1AJY A;  3L36 A;  4AYC A;  2KZI A;  1M57 D;  1YQ4 C;  4U3F J;  3Q5P A;  3P32 A;  4ASV A;  1YHQ P;  3L73 J;  2YXQ B;  1K8A Q;  4H44 B;  3PTZ A;  3H1K D;  1LNQ A;  3TGU G;  1VQK P;  1W2E A;  2LXC B;  1NTK D;  4I7Z C;  3L71 D;  2AEJ A;  1RF1 A;  2WT7 A;  2IX7 C;  3BAS A;  4BWN A;  1PP9 G;  1OXZ A;  3B8E B;  3D6Z A;  5KLV K;  1L4A C;  4JBZ A;  1W2B O;  1IK7 A;  3L74 D;  4H13 C;  3RBX A;  3A3Y B;  2IYP A;  4GOE A;  2Q3I A;  4CPG A;  1YJW P;  1LP1 B;  1U7J A;  3GW6 A;  3H25 A;  4I7Z B;  2KIK A;  1PZQ A;  2L91 A;  1BE3 G;  1EDK A;  2RH0 A;  3VMX A;  5APU A;  5APW A;  5AVW B;  3TGU D;  4H13 B;  1PFI A;  1N73 C;  1S5L E;  1YQ3 C;  2J58 A;  3S4R A;  4RES B;  2MKV A;  5AW1 B;  3GF7 A;  5KAI E;  3A0B E;  1KB9 E;  4PJ0 E;  3CWB G;  3B5N C;  1BDD A;  1SQP G;  1SQB J;  3MD0 A;  2QJK C;  3WU2 E;  1DX7 A;  2Y0D A;  1NTM E;  2N1T A;  1AQ5 A;  5E79 H;  1BE3 D;  1EQ7 A;  1QGK B;  2FYU K;  3H1J G;  3CCR P;  1NHL A;  3L75 D;  1QEX A;  1W5C E;  4GT1 A;  2M5A A;  1ZRT E;  3B5N B;  4JYC A;  1JNM A;  2YKO A;  2QJK B;  3CX5 H;  2JEE A;  3AE6 C;  2FXP A;  5CCG A;  1DD3 A;  2B89 A;  2HG5 D;  2W8Z A;  2GA1 A;  1KYO I;  3CWB D;  2PP6 A;  4D6T J;  2WSC J;  1SQQ E;  3V4Q A;  2BAS A;  2W6J H;  3MHV A;  1YJN P;  4YXW H;  1EDJ A;  1NU1 K;  4H0L D;  1LGH B;  3II6 A;  1G2C B;  1R5S A;  1N7S D;  3SWK A;  1NAF A;  2KOG A;  1ZRT D;  2R44 A;  4C7N B;  3EQ2 A;  5TIS E;  2WTY A;  3VOP A;  5BU5 A;  5KLV E;  3L37 A;  3L70 G;  2AXT E;  1GK6 A;  1NOH A;  4L73 A;  2H88 C;  1Y9B A;  2NPS C;  2WQY C;  2CK3 H;  1SQQ D;  3PLN A;  1BSH A;  3HD7 D;  1LTJ C;  1PGP A;  2FY8 A;  3IAO A;  1RH5 B;  3U59 A;  1VF5 C;  2YMY A;  3BAT A;  3MIW A;  1SQV K;  1S5L X;  3QWO C;  3H1L J;  2WPV B;  1EZV I;  4L74 A;  2IFN A;  2OAR A;  2R3C A;  1SQX J;  1S4X A;  1LTJ B;  2E76 D;  3EFG A;  4NPE A;  2K3R A;  1M1K Q;  1IFM A;  2W83 C;  3RK3 E;  2Q5U A;  3BCC J;  3V5B A;  3BRV B;  5CBO A;  1VQM P;  1M8O B;  3AE7 C;  1WT6 A;  3SWY A;  2J59 M;  1KIL A;  1URQ A;  2FYU E;  1SFC C;  2M3B A;  4U3F G;  2KUB A;  1IFJ A;  1IO4 A;  1FDO A;  2Z5H A;  1QVG O;  2Q1K A;  1YIT P;  1A02 F;  1RY3 A;  3M91 A;  4M3L A;  3U1C A;  4BRY B;  1T2K D;  1GTW A;  3AEE C;  1SFC B;  3EFF K;  1LTT C;  2A45 I;  3CD6 P;  1OFC X;  4PV1 C;  3CL3 D;  1M90 Q;  2C9N Y;  1XTC C;  1YI2 P;  1IZN B;  1JY2 P;  1PGJ A;  3GHG C;  4JF7 A;  5KJ7 C;  3CX5 D;  1GW4 A;  2K88 A;  1J1E C;  2XU6 A;  4RKU J;  1NU1 E;  3FWN A;  2FYU D;  1JY3 O;  3L73 D;  3P8M C;  3GHG B;  3V2R A;  5KKZ C;  5CJ4 A;  1U7M A;  3M0A A;  3MTU E;  3ITK A;  5CJ0 A;  3PHL A;  1NAY A;  4JPZ B;  1J1E B;  1N2D C;  2O1J A;  1EXJ A;  5AVV B;  2R32 A;  1E79 H;  3P7K A;  2UWJ E;  3FXD A;  5KKZ B;  3T97 B;  5CCH D;  1LWU C;  3CLQ A;  1L4A A;  1LTG C;  1SQB G;  1A02 J;  2LKM A;  4DOJ A;  1SQV E;  1N7S C;  2B87 B;  2K1A A;  5KAF E;  3L72 E;  2KLU A;  4EYY Q;  2ZT9 D;  1LWU B;  2JO1 A;  3NMD A;  2JWA A;  5AVT B;  5DJU B;  5TJH A;  5EFW B;  1LTB C;  2XKM A;  1N7S B;  1N73 A;  4LGD E;  1HF9 A;  5AW0 B;  2WPQ A;  3H1H J;  2E75 D;  2CPB A;  5BVZ A; 
#chains in the Genus database with same CATH homology
 1QL2 A;  1RF1 A;  2WT7 A;  1JCC A;  2IX7 C;  3BAS A;  3B8E B;  1OXZ A;  3HD7 C;  5AVR B;  5KLV K;  1VDF A;  1L4A C;  5APT A;  1DH3 A;  3A3Y B;  3N7N A;  3B5N A;  3UIA A;  5KTB A;  1JTH A;  2HPC B;  1RF0 A;  2Q3I A;  3NTN A;  4JYB A;  3A2A A;  1N86 A;  1J1D C;  2PAJ A;  3N4X A;  1FZE A;  1SQP K;  3TK1 A;  3HUS A;  3HD7 B;  1CSB A;  1JMM A;  1IFI A;  1CW5 A;  3VMX A;  1CI6 A;  5APU A;  5APW A;  5AVW B;  4EOT A;  3E1I A;  1L0N K;  1PFI A;  1MZ9 A;  1N73 C;  5APV A;  5APY A;  1SQX K;  4IFF A;  2J58 A;  2QM8 A;  2GM4 A;  4RES B;  1RF1 C;  1J1D B;  1HWT C;  5AW1 B;  1LTA C;  1HH0 A;  2W27 A;  2IFM A;  1L4A D;  2P7J A;  4W7Z A;  2Z5I A;  1SLQ A;  2JJL A;  3VN0 A;  2H8P D;  5CHX A;  1ZR4 A;  3LID A;  3B5N C;  3VP9 A;  1ZR2 A;  4C7N A;  3MD0 A;  5AW8 B;  1DX7 A;  1RF0 C;  2NPS B;  4LLH A;  2N1T A;  1AQ5 A;  5AVQ B;  4AUW A;  5AW5 B;  2H43 A;  3VMY A;  5AVU B;  2WSE H;  1KFN A;  1DEB A;  1EQ7 A;  2WT7 B;  4HYT B;  1GU5 A;  2FYU K;  2KP8 A;  3HE4 A;  3HUS C;  1G1J A;  4N6J A;  1XTG B;  3HRN A;  2HYN A;  4B86 A;  1HGZ A;  1T2K C;  1NHL A;  2FYZ A;  3PP5 A;  1HGV A;  1M1J A;  3HTK B;  2XNX A;  4GT1 A;  3C9I A;  3B5N B;  1IK9 A;  3RK3 C;  4JYC A;  1JNM A;  2YKO A;  3M0D A;  1JTH B;  5AVY B;  1X79 B;  2JEE A;  2OYH A;  2L5G B;  1NTZ K;  2YNY A;  4XA4 A;  5CCG A;  4KHX A;  2WPS A;  1HBW A;  3IR9 A;  3HUS B;  3VP8 A;  1FZG A;  1FZF A;  2E42 A;  2HG5 D;  1FZA A;  2KLV A;  3OAK A;  5AW9 B;  3RK2 C;  2NPS A;  1GL2 D;  1T3J A;  3U1A A;  2PP6 A;  3V4Q A;  4N78 E;  3KDP B;  2BAS A;  3RK3 B;  1IC2 A;  4I2L C;  1JO5 A;  1HVV A;  3IFM A;  4XE5 B;  3VTP C;  2N1T C;  1LTJ A;  1X9V A;  1NWQ A;  1FAV A;  2GUV A;  1GK4 A;  3M9Q A;  1H88 A;  1WRG A;  1NU1 K;  2A45 G;  3HTK A;  1LGH B;  3II6 A;  4Y99 C;  1G2C B;  1N7S D;  1RE3 A;  3KYQ A;  1MUU A;  1JCD A;  2I1K A;  3RK2 B;  4W7Y A;  1M1J C;  1NAF A;  1T8Z A;  2XZR A;  3OA7 A;  2KOG A;  2YO3 A;  5AW3 B;  3RK3 D;  1JUN A;  3M0D C;  4C7N B;  3M9H A;  3V4W A;  3EQ2 A;  2WTY A;  2OYH C;  2N1T B;  2W6B A;  1QL1 A;  2WWW A;  5CCG C;  3VOP A;  5BU5 A;  3HE4 B;  2R5D A;  1NH4 A;  2C0X A;  3L37 A;  1NKN A;  4Y99 B;  2FFD A;  1AFO A;  1GK6 A;  1NOH A;  4I1L A;  1NO4 A;  1NTK K;  2NPS C;  1M1J B;  3BRT B;  2XV5 A;  3I5C A;  3M9B A;  1YTZ I;  4N78 D;  1JY3 N;  3HD7 D;  1LTJ C;  2OYH B;  2N1T D;  1G2C A;  1ZLL A;  1FOS F;  5AVS B;  4I6M C;  1OWA A;  3U59 A;  1JY2 N;  3LIE A;  1SFC A;  4WB4 A;  5BU8 B;  1SP4 A;  2YMY A;  3BAT A;  3MIW A;  1RE3 C;  1SQV K;  3KQG A;  2CPS A;  1URQ B;  2WZ7 A;  1VPC A;  2ZXE B;  3G3Z A;  3V2P A;  2IFN A;  2OAR A;  1ZV8 A;  1SVF A;  2FKW B;  1T3U A;  2R3C A;  1KZU B;  1H89 A;  1RE4 A;  2O1K A;  2M8R A;  1LT9 B;  1LTJ B;  2FXM A;  5CCG D;  3EFG A;  3H32 A;  5AVZ B;  1GDT A;  1GD2 E;  1IFM A;  4OH8 B;  5CMZ A;  2QM7 A;  2FFD C;  2Q5U A;  2IPP A;  2XDJ A;  1KQL A;  2NPS D;  1FDM A;  1FZC A;  4WY4 A;  1N7L A;  3V5B A;  3BRV B;  3GHG A;  2WIT A;  1FJP A;  5APX A;  5KJ7 A;  4WBA A;  5CCH A;  1GU4 A;  2GUS A;  2C0W A;  4EIJ A;  3SWY A;  1WT6 A;  1IJD B;  1MV8 A;  1X8Y A;  2YKQ A;  2OYI A;  2J59 M;  3VYI A;  1KIL A;  1URQ A;  2I1J A;  3RL0 C;  1YYC A;  2E43 A;  1SFC C;  2M3B A;  3TNU B;  3B5N D;  2FFD B;  2VRS A;  3HE5 A;  4IFM A;  1G1I A;  1LT9 A;  2KB7 P;  5AW7 B;  1IFJ A;  1IO4 A;  3KPE A;  1IFN A;  2Z5H A;  1HUC A;  1FZB A;  4W80 A;  1S9K E;  1RY3 A;  1A02 F;  3T97 A;  1RE4 C;  3M91 A;  4GIF A;  4M3L A;  3U1C A;  2HOD A;  1T2K D;  1GTW A;  3P8C D;  2POH A;  3RL0 B;  1L0L K;  2P1J A;  5AVX B;  1KFM A;  5AW2 B;  1SFC B;  1LTT C;  2A45 I;  2R5B A;  1JY3 P;  1LTI C;  3TYY A;  1FOS E;  1HTL C;  3CL3 D;  4C7R A;  2C9N Y;  1LTS C;  1FZC C;  1GL2 A;  4WY4 C;  1XTC C;  2ZFC A;  1M7L A;  1JY2 P;  2P2U A;  3GHG C;  4JF7 A;  1GW3 A;  5KJ7 C;  5CCH C;  2KSJ A;  1NKZ B;  3TNU A;  1LWU A;  1HJB A;  2OYI C;  1GW4 A;  1MFZ A;  1KIL C;  1URQ C;  4GKG A;  1J1E C;  3H32 B;  2XU6 A;  3RL0 D;  3RK2 D;  1JOC A;  3BVH A;  1SFC D;  1GZL A;  2N9B A;  1JY3 O;  2HFE D;  4IFD K;  3M06 A;  1L4A B;  1N7S A;  4ZKP A;  3CI9 A;  1SQB K;  1LT9 C;  3NFQ A;  1FZC B;  1NTM K;  4WY4 B;  5APS A;  2H7H A;  1JY2 O;  3MUD A;  3P8M C;  2WSF H;  3GHG B;  3V2R A;  5CJ4 A;  3L4F A;  1S9K D;  3M0A A;  3NXS A;  3MTU E;  2Q9I A;  4ZKU A;  2OYI B;  5CJ0 A;  1KIL B;  2C9L Y;  1J1E B;  1N2D C;  2O1J A;  4C46 A;  4O9B A;  2KYV A;  3V2N A;  3H6P A;  3MGN A;  5AVV B;  2P67 A;  2R32 A;  4DZO A;  3HE5 B;  2HLO A;  2W6A A;  1FJK A;  4HH2 A;  2HPC A;  1GL2 C;  1CZQ A;  2YO2 A;  3OJA B;  3P7K A;  4N3Y B;  4WY4 D;  5AW6 B;  3P8C E;  2WPR A;  1N73 B;  3TSI A;  5KJ7 D;  5CCH D;  3O8Z A;  3HD7 A;  1LWU C;  3CLQ A;  4LC1 A;  1L4A A;  2O01 H;  2HOD B;  1KIL D;  1URQ D;  1LTG C;  1H8A A;  1RF1 B;  1A02 J;  2LKM A;  3V2Q A;  3LW5 H;  3A5T A;  4DOJ A;  1ZN5 A;  3R2P A;  1FU1 A;  1SQQ K;  1N7S C;  3VMZ A;  1GL2 B;  3WMM 0;  3L35 A;  3L36 A;  4AYC A;  3A7O A;  1J2J B;  1LWU B;  3P32 A;  2YKP A;  3NMD A;  5AW4 B;  1IFD A;  3SWF A;  1Z56 A;  5AVT B;  4AQR D;  2WSC H;  1LTB C;  2Z4E A;  2XKM A;  1YTZ T;  1N7S B;  1N73 A;  1W2E A;  4LGD E;  1CI6 B;  5APQ A;  5AW0 B;  2A45 H;  2WPQ A;  2MJZ A;  1FBM A;  1E5W A;  5BVZ A;  2CPB A;  2Q7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...