1VPEA

Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
398
structure length
398
Chain Sequence
EKMTIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKIDLAKELVEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAAVNKFGLEDKFSHVSTGGGASLEFLEGKELPGIASMRIKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOGLYCERATE KINASE
publication title Closed structure of phosphoglycerate kinase from Thermotoga maritima reveals the catalytic mechanism and determinants of thermal stability.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 148
structure length 398
sequence length 398
ec nomenclature ec 2.7.2.3: Phosphoglycerate kinase.
pdb deposition date 1997-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00162 PGK Phosphoglycerate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vpeA01
3.40.50.1260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vpeA02
1VJDA 4FEYA 2PAAA 2Y3IA 1LTKA 4O33A 2ZGVA 2YBEA 3Q3VA 1HDIA 2X15A 2WZCA 1VJCA 3C3BA 2X13A 3UWDA 4DG5A 3C39A 2WZDA 3OZAA 1FW8A 16PKA 13PKA 2XE6A 2XE8A 3PGKA 2WZBA 4AXXA 2P9QA 1PHPA 3C3AA 1QPGA 4O3FA 1VPEA 1ZMRA 2XE7A 3OZ7A 4EHJA 2P9TA 5BT8A 2X14A 3ZLBA 3ZOZA 1KF0A 1V6SA 4NG4A 3C3CA 2IE8A 2CUNA
chains in the Genus database with same CATH superfamily
2BEKA 4KYUA 2BE7A 4Z5XA 1CY8A 2WWVD 1FX1A 4LCEA 1I2MA 2VHZA 3EGDB 5DU2A 1NBHA 2P5UA 4B3FX 4CODB 1Z2PX 3HEMA 3BEOA 4O2AA 1SCUB 4N6NA 2RSLA 4RTRA 2OXRA 4TS1A 4EABA 5LQJA 3IQHX 2C4MA 2QM8A 4L5AA 4D3FA 1C9NA 2PWZA 3R4VA 1VJRA 3ZHCA 4EOGA 3K32A 4DIKA 2HJRA 3KQTA 1TT5A 1V1RA 2OP1A 3UMJA 3W9UA 3WHPA 3D6HA 4M8NE 1JHPA 1J8VA 3OCVA 4NFSA 3DZIA 2JI6A 2JI9A 1Q1QA 1U7UA 2JFWA 2MYNA 3ABSB 4LYEA 3SS7X 3SEAA 4JXZA 2JZCA 1TEXA 1C7JA 5I51A 4P92A 4CV3A 4E6PA 5IEBA 1NFQA 2JLWA 2WG1A 1X94A 1E3DA 4PZCA 2O8BB 1OX4B 1RFGE 2CBXA 3PC2A 5ESXA 2FWRA 4GMKA 2G0NA 3G9QA 5BYKA 3HCAA 4PZAA 2W58A 3O4HA 4J2TA 1JAHA 4MWGA 3VNSA 3N1UA 4DM3A 2WWFA 1T8TA 1H05A 1VLHA 4WOBA 4F5EA 2BFDA 2G77B 1KJYA 5AOBA 3QXSA 5EY5B 1Z45A 1H9BA 2FQXA 1XX6A 3L8HA 4U63A 2VDWA 1ZGZA 2FCAA 1YVDA 2C96A 3A6DA 3JVVA 4OXRA 3GJRA 4L07A 4LC0A 5K0EA 3STUA 4MJLA 3KVVA 1R37A 2OHJA 3ONNA 4QL3A 2IXBA 3MB5A 4MW1A 5COAA 3SI7A 3IXMA 2KI5A 2R751 5IJ0B 4CEHA 5EHXA 4NRDA 2XB9A 3WL6A 2A92A 2P35A 1WPXA 1ZONA 1PI3A 3QY9A 1U94A 1KWGA 2JFUA 2DOKA 2JRCA 3PGXA 2BFCA 2HF2A 3IMKA 2QDKA 4IQGA 3A37A 3AEZA 1N0VC 3QPVA 4IHKA 5FNZA 2I6UA 4B7XA 1AG9A 2Y6UA 1W35A 3OJLA 3KEGA 2ORYA 3WB2A 2VF4X 3U4IA 3TJMA 5KYYA 5EJFA 4Q18A 1NXWA 3PC6A 1HNWB 3NVKI 5ECWA 2CE7A 5DZSA 1DE0A 1ZJ4A 3ESBA 4EHDA 4YT5A 1M83A 3UJCA 3BFJA 5B4UA 3L6CA 4RXTA 4UEOA 4DA9A 4YRBA 2WVHA 5K2OA 1PSWA 2GAIA 3HPRA 1E4YA 1P9WA 3JQ6A 2GERA 1Z6GA 4GD3Q 3T3MB 1U7ZA 3IIKA 3KRTA 4FYMA 5F9FA 2Q6KA 2Q7DA 1TA9A 3E0XA 5CXUA 1EXDA 4KSYA 3V3KA 1ZMBA 1OPRA 3NFRA 1VLQA 3NTOA 2GARA 5J5AA 1W36D 3I23A 3K15A 3S0JA 5CGQB 5TXGA 2UUAB 5EJAA 4FYKA 4OKNA 1QTNA 2E21A 3AO0B 3FJYA 3LOQA 2QZ4A 3LUDA 1LBHA 4LEIA 3ZCVA 4WZZA 4KWTA 5CDHA 2I76A 3B13B 5E8RA 1ZVMA 5FADA 5HKKD 3BGSA 2YZ7A 3HXOA 3KLOA 3TL2A 1RRCA 1C8LA 2P11A 2XEDA 3QEJA 1LSUA 4NMLA 4XPZA 3SMVA 1PFGA 3ZW7A 3IHLA 4LS3A 4AY5A 1IHDA 1OWMA 2ZVJA 2GETA 3C6YA 5EJ2A 3RAGA 4RS4A 1ZGGA 3IEKA 3F6RA 3TN7A 3BZWA 4RTPA 2AXPA 3AKCA 3KALA 4AQYB 2JZOA 4I81A 3DJYA 2CDRA 3CVVA 1XZQA 5SZJA 2JKZA 3FTFA 1DC5A 1Q91A 4ZEMA 1DHRA 1EINA 2J3EA 2WJIA 4F3CA 1L8QA 4CLOB 2PH1A 2YFYA 2WOOA 1J0DA 3V2UA 4C0SA 4JOSA 4ER3A 5LXTB 1XQ6A 3M6IA 2O7RA 3M6VA 5I3ZA 3T15A 4D45A 3NWOA 2OAEA 3ABIA 4IO1A 3TR6A 1V41E 5AP9A 4N5NA 1U7DA 2ZG6A 1ZNWA 1PG5A 3LLSA 1NRIA 3SYTA 1SCQA 3OO0A 4RULA 4RVDA 4C03A 2I4RA 1RWQA 3OOHA 1GGVA 1VMEA 3Q6MA 3PA6A 5F5NA 2YC2C 3NXSA 4UU7A 2QUIA 3GJTA 3UC9A 3WJ7A 4MS3B 1R6AA 1E2JA 2VSXA 3JZMA 2IHUA 4LDPA 4AO8A 5D5PA 1IM2A 2X0EA 4NF2A 3HUFA 4TTVA 4YP5A 1WLYA 1HTWA 4LJYA 3GLFB 5DLPA 4UEWA 1J1IA 1V71A 2EQBA 2YBDA 4Y2GA 2PL3A 4LN1A 4YB8A 1UFRA 3V3TA 2FPPA 2XECA 1OJLA 1ENOA 4HMPA 3R3JA 1ZJYA 1J1UA 1BMTA 2I8AA 5CFZA 5CU7A 3U5TA 5ALXA 4EO9A 1YCHA 3OVMA 1OXTA 1PL8A 4KIFA 3TIXB 2DPGA 3R9WA 1JYFA 3UB2A 5KMGB 3Q8LA 10MHA 4PTYA 3FIJA 2PWPA 1ES9A 3FCOA 1E2IA 4KFUA 5E2BA 4IPTA 1RLMA 2ORWA 4WGFA 3ONVA 1JQEA 1JH8A 1Y6QA 3U31A 4EY7A 3OFNA 2JFHA 1YZNA 2J4DA 2X22A 4AVYA 3V8EA 4E12A 3IIMA 2NAFA 3DE6X 4H7PA 4U2BA 1DDIA 2NLOA 4EB8A 1TC2A 4RHXA 3UCFA 4MJ3A 1NQTA 1XA3A 3M9WA 3O8QB 8GPBA 3JD3A 1TAGA 3EY4A 1T1EA 2P27A 4IWXA 3EUEA 3JARA 3TVDA 3E58A 2VDQB 2JAHA 1QH1B 1SPBS 2A35A 2JGRA 3OSZA 4W5JA 1MB0A 5FV4A 2ZSFA 3VNRA 2AZXA 2O2IA 1FDTA 1H0SA 1P5HA 3QX7A 4WN9A 1AXEA 1R4NA 2I9KA 2QMZA 1XA0A 3JR3A 4JODA 4CF3A 1EVLA 3GHYA 4HZUB 5H4HA 4LXUA 4GI1A 4A5OA 2XTZA 2HMVA 1JZTA 2VBIA 2VK4A 3QSYA 3LRXA 6YASA 1VHLA 3V1MA 4A0SA 1U8XX 3AF3A 3UPUA 1P3JA 3KWFA 3AU9A 3L02A 2XWQA 3GFFA 1VL0A 1KJ8A 1KYTA 2P0YA 1J21A 3REFA 3RAEC 3CEHA 2D06A 4V02A 1JYSA 2NW6A 4DBLE 4AFNA 3SNKA 5LM3A 3IQGX 4Y9RA 2C20A 2QL7A 2WZBA 2I99A 3L2OB 4IKEA 5AI5A 4B4VA 2IOFK 1NOJA 2HDWA 4Z99A 3KSMA 4Z2YA 3CWCA 3RREA 3TR5A 4LGCA 5FL7A 1VCIA 1DEOA 1XQVA 1XNQB 3MMXA 2PU5A 1VCOA 2Q46A 1G42A 3ANMA 2OZPA 1VE3A 4D6YA 4X8HA 1O0SA 1KDTA 1ZIXA 4DLSA 1DAPA 3C7KA 1H65A 1QJCA 4G56A 1T9GR 3CX3A 3V55A 1N7JA 1AX9A 5EIAA 3P1JA 4RF4A 2HSJA 3TQTA 3VZSA 2O7VA 2PUVA 3AFHA 3S1SA 2Z2JA 3D3JA 4YALA 2W2NA 4N18A 4B6RA 3FTCA 1L1EA 3GGDA 2QRMA 4UM5A 2D00A 2J59A 2YCLA 3F5FA 4TL8A 1EQAA 5GWXA 4ZCMA 4MVJH 4TL6A 2D2XA 3BH6A 4QHYA 1R0BA 3V1TC 3VHXB 2L2QA 2PH3A 5A2QA 1QK4A 3HGTA 4LGMA 4DZTA 1BG6A 5BWOA 2JLUA 5AW7A 1IB0A 3WK7A 4PZLA 2CLSA 4G0ZA 3VR2D 2YN4A 4YQFA 3V6LA 2AT1A 1ODTC 1T2DA 2HJ9A 2I8LA 4UHKA 4B0PA 4C4OA 5K4GA 2QUKA 4QM7A 1ZDMA 2FWIA 2OFXA 3K8QA 4R9VA 3HYNA 1LFAA 1L9XA 1MAUA 1SNYA 3KPVA 4I4TA 4XVRA 4U2DA 5KPDA 2AOUB 1YFLA 1LPNA 3ICCA 4GQAA 1UXGA 4WKNA 3RSQA 3V8BA 1RHRA 1U98A 1IY8A 3ITEA 5M3BA 5CNKA 5EGNA 3EGCA 2OHFA 4LPKA 5KTRA 3FAKA 2P68A 4QJIA 4XGNA 3DKPA 3C8MA 5DV9A 4S05A 2ZM5A 3QU2A 1TOAA 1U8UA 2XNSA 1QPBA 2AW5A 4M99A 4RY9A 3ZTTA 4RUKA 5CT8A 4HLCA 1EJBA 1SCJA 1DX6A 3HCWA 2FFAA 4WY2A 2EBFX 1NMZA 4B75A 2B78A 3WMRA 3WAJA 1XZMA 3H3XA 1T2NA 4HN2A 3NJ8A 3Q8KA 3LCJA 3WYNA 1Z4LA 3SSNA 2DBZA 2YXEA 5ALKA 2ZJ4A 2ZVQX 1QTIA 1ZCJA 2QI9F 3PKJA 4MR9B 2A7QA 2YWDA 3EQ8A 3J7AC 4HAXA 3RYHA 5J4KA 2QE7A 3SDSA 3BRSA 6NULA 3GJ8A 2IYOA 4XUEA 3R4CA 1G20A 4UAVA 5EUMA 5FJIA 3NEJA 1LVHA 1W19A 2YJGA 5DIFA 4PLVA 3KQLA 4JVSB 5BVGB 3WYGA 5H5JA 1E7SA 4I55F 5KBYA 2VUTA 2Q5QA 3TCKA 1KMIY 1YE5A 4EG6A 2R6JA 5KJCA 3RODA 4N40A 4GC5A 3CO5A 3VTFA 1PF7E 1RKQA 3ANYB 3DF7A 5C37A 3TUZC 1ABFA 4M9SA 1LLQA 3CNOA 3GUYA 3AFNA 3O47A 4LOHA 5FOTA 1NNUA 1XVTA 2L42A 1WMSA 4R3NA 3ZKWB 1BWRA 1W9HA 2A7XA 4R1LA 4ADSG 4OFBA 2D1QA 2CL0X 2P8SA 3R41A 5KHAA 5LCXA 1WHTA 3X3HA 4B31A 3B5IA 2JEOA 1OU0A 1KU0A 1Y37A 1AMNA 1YJAA 3LNTA 4D3ZA 4WQMA 2RGDA 1EFPA 4IMPA 2GPWA 2ZBEA 1F5NA 2AR9A 2JAXA 1CR1A 3KQOA 3WXBA 4ZKDA 4LCJA 4E31A 1S1CA 2RK3A 3S7ZA 3UMVA 2VP5A 3T3EA 2X0NA 4ZVOA 3ZK9A 5T4FA 1YDHA 1YC5A 2QNRA 1Y6ZA 4EO7A 1UBLS 1RBQA 2ZE6A 2VUIB 4X41A 4FR5A 2CNBA 2RGNA 4YI3A 3TG2A 2GDZA 2GH1A 4OTZA 4YRPA 3FUVA 5KNBH 2VSOA 5E7MA 1KAGA 2E4VA 1C0LA 2C97A 3QEOA 3I2FA 3VMFA 1ESNA 3EEBA 3YASA 1IG0A 1W0CA 5C8DA 3V00A 3WLRA 3GXOA 4EFMA 2FUG1 2E5LB 2ZYIA 3NH6A 3PD7A 5KZMB 1ND6A 2BZ0A 2IIVA 1JKJA 4HCJA 4QHTA 3AF2A 5TV2A 4FFNA 2GD1O 1Z8DA 2BGJA 2P6MA 4DJJA 2RGNC 3IE0A 2QA5A 4Q12A 1IN6A 4K6KA 2VNJA 4KPFC 2YXPX 1IXYA 2GF2A 3NO4A 3ZWNA 1KBOA 2P2YA 1JDSA 1EFVA 1G5QA 2FJ0A 4IW3B 2BSAA 4JA0A 1JEQB 3PQ5A 1A8UA 2ZTLA 2YXLA 2EHJA 3EVEA 3DO5A 4FDUA 3DVRX 5HFNA 3KWMA 2J30A 2PMFA 1V8DA 4X0EA 5ERXA 1THTA 1ML4A 1RHQA 3DH0A 5HKAA 2IYYA 2BCGY 2ZOSA 4HAUA 1QH0A 3OE5A 5H68A 3NV7A 5A3RA 3C1OA 1XZEA 3WK4A 4A03A 5A4FS 3LE8A 4Q7JB 4EJSA 1FJHA 3B1XA 1G5TA 1TKRA 3II6X 1TTPB 4RY2A 2OILA 2HZBA 2TMDA 1TT7A 2CJWB 2WI8A 3UHOA 5KWVA 1H9CA 1Q84A 4TRRA 3RUFA 3BGIA 4Q6BA 2VAPA 3DNFA 3D4IA 3WFZA 2GNAA 2O1EA 3CPHA 4UW9A 3VR4H 1XV5A 4X00A 1RCTE 1EP2B 4N47A 1WMAA 1BCRA 2H2GA 3C2QA 1E9VA 4KODA 4M8SA 3V7NA 3W34A 3I9MA 4X8LA 4DMGA 3P9QA 1GCIA 5ENVA 1WZCA 4PV7A 4F92B 3E1KA 3PITA 3PR1A 5EXSA 3ZHUA 1BAPA 2YHBA 4RMNA 2ZUTA 4BKRA 5J2TA 1PR2A 1HFJA 1P33A 2DJIA 3DVLA 2V6GA 1NJ6A 1I3LA 4DWVA 4ZJZA 3NIBA 1GNTA 3WL7A 2XE8A 3GEMA 3N8IA 3PGKA 4GX1A 5A04A 2K7ZA 1XRLA 3NP9A 2HQSA 1Z28A 2CHFA 2OZKA 3DC7A 3UPTA 3R2JA 2W37A 2CYCA 3QELA 5AW9A 3HO6A 4I66A 3Q41A 2HLDD 4NCXA 5DNCA 1GGNA 3MQFA 4Z86A 1LDMA 2JIDA 3N70A 3GHHA 4MWZA 1RR6A 1ZM3A 3KYDB 4YNBA 5C4MA 5H3HA 5I45A 4MUYA 3I9V6 2C95A 1Z4NA 3CTPA 4B09A 1E1QA 3OC6A 5KNBD 1SEPA 3AR7A 3ZLVA 4CM5A 3P9SA 1N6OA 1T4GA 4EL5A 4B5LA 5DHSA 5I9MA 2X42A 2XUIA 1NVXQ 2I6XA 3LT0A 4MO9A 2R84A 4R83A 2K87A 4ZP1A 4ER7A 3B6KA 1NNSA 4IFEA 3PS9A 4MXDA 3A9SA 4CG2A 2Z09A 1ZNXA 2NXWA 7AT1A 3DLCA 2ZPTX 4QU9A 1SXGA 3KWLA 2MCFA 2DF8A 2OZLB 2CNLA 3SXUA 3FHOA 3MTIA 3WHIA 1EB8A 2II6A 2PXXA 4OLFA 1XZ8A 4DR3B 1LX7A 4TZTA 1I3CA 3IUNA 4QE3A 4OYLA 2EVWX 4UULA 5JZBA 2IYQA 3Q3CA 3F74A 3OJCA 5L3QB 1U90A 3L4EA 4HWTA 3R0JA 2WJVA 1GSIA 1NN5A 1H2ZA 1QWSA 1TQ8A 1ZL0A 2P4SA 3QXGA 1KQGA 4UCXA 4UTOA 1W6RA 5EIBD 2JAOA 2O1SA 3DCNA 3NYQA 4C20A 1RD4A 3K2QA 4AZ3B 1T2AA 3TWOA 2MJLA 1AKTA 2QB5A 3NDIA 4K6OA 3IAM6 3Q87B 4MGZR 2A0XA 1N0IA 1FYXA 2EKLA 2PVSA 2GZ1A 3D4PA 1KSFX 3EJ6A 3K05A 2OWDA 4GR5A 2I2BA 4IUBS 4QJ4A 1FPMA 4E5MA 2OVBA 3KHKA 4DLWA 1YZTA 4DIDA 1IN4A 3E22A 5TPZA 2ZUDA 4ZANA 4J07A 2V7BA 1TF7A 4KOEC 4CKWB 1JE0A 2PZKA 1H2RS 1V5IA 2IZ5A 3COYA 4LRSB 1I80A 3PTZA 1GPUA 1AC5A 5B64A 2ZI4A 2Z3ZA 4JC5A 4Y2TA 4GDFA 1I4DD 5HQ3A 3WOHA 1FYDA 4LOKA 3G02A 2QUJA 1I2BA 3OCZA 1B6GA 1NDHA 3M6MD 5DVZA 1XDGA 2Q5OA 4F6RB 3EZ9A 2YFKA 2JF0A 1AXRA 2XDAA 1KOJA 1CQZA 2O2XA 3RV3A 2A5LA 3LA6A 5JI3E 1VSUA 5DM70 1P45A 1QOQB 2YJZA 1BJKA 4OI2A 3H5NA 1YZHA 4UEJA 2DFDA 4V3BA 2ZTVA 4DJFC 5L4NA 5J63A 3T0FA 5E3HA 3I6QA 1QSGA 1GTG1 1DRWA 2QV7A 3UMRA 6Q21A 1GA6A 2UXDB 5E4JA 5DRTA 1CZKA 4G0QA 1WP9A 4TLAA 5DN9A 3LQQA 4MX8A 5P21A 1Q7RA 3K0AA 1NXOA 2AN3A 2QAIA 3DOJA 1NMSA 4QECA 4IDHA 4RCYA 4UASA 2OYRA 4KUEA 2FTKE 3TQOA 4TMWA 1XTUA 2NNWB 3OJFA 1EM8B 6PFKA 5A4JA 2O8FA 2GX6A 2Y9MB 3G6KA 4J4BA 4RIEA 2HD4A 5BXQC 4Z4CA 4JX8A 1ZHFA 4ZVVA 3VAAA 5LKRA 3F73A 5EXEA 4K2AA 2RC5A 1NHWA 1GUDA 2BKEA 2NGRA 5JSQA 5AK3A 1SC9A 2DLNA 3K9HA 4TMXA 5HJEA 5FBKA 2ZB3A 4G5QA 3GGSA 3HCPA 1EGQA 3N6XA 4GRDA 4KXVA 3UKJA 3WQQA 3H83A 3CSSA 4MR8A 3AXTA 3RHSA 1ULBA 2E55A 5E6RA 1OBCA 2C2WA 5D5HA 3EVDA 5TB5A 3ZZMA 1T4CB 4EB0A 3DGEC 4HLQB 2WHYA 3J7TA 3LPNA 4IMIB 1N34B 1DLJA 2Z9DA 4CTMA 2Q9UA 4RJIA 3FYUA 3JAWB 1EUCB 1F60A 1DOZA 5FWYB 4D9HA 4PCUA 2ODEA 2PNFA 1N5IA 1UXHA 5J9FA 1PWEA 4FXPA 4R84A 1W8DA 4K7JA 5LQDA 3KR0A 5IJ9B 1Z06A 3GAMA 3NEYA 1WAMA 2WP0A 3R5SA 1ENPA 1ID8A 1YCFA 1JJ7A 2G5TA 1B76A 1AS2A 2FUKA 4OQZA 2XXJA 3WRXA 2JIBA 2OCKA 3FYUC 1ZQ1A 4RGQA 1FBNA 2FN3A 3JD2A 4NYMQ 4QUAA 5KNCD 4J0IA 3GLGB 4IJWA 4HOYA 4EYKA 5IXYA 4O4HF 4Q9LA 5HCNA 1WULS 5JS1A 2R6HA 4NBKA 4Q3BA 4FHFA 1FLNA 4RMGA 3DT8A 3RARA 2O5CA 3N7AA 2P9JA 3CF4A 2IPXA 4IVNA 1QU3A 1CUSA 1J0EA 2DBVO 3U16A 1MX9A 4UXIA 4MTLA 4IIVA 3MIZA 3WRXC 2GK3A 3Q3JB 4R8RA 1VE1A 2CJXA 3S2YA 5C52B 3ZHYA 4DZZA 1UMKA 4HB4A 1HUQA 3IVMA 1U2ZA 3RBVA 3AB3A 2XLBA 1VXRA 2WIDA 4GR9A 2BBOA 3A4MA 5EWJA 4XIGS 3UBMA 3ULKA 1K6MA 4MKGA 3EIOA 2PTHA 4JEIA 1Q50A 3H42B 1XALA 2J46A 4REQB 1E1MA 3HCEA 4BKMA 3HV0A 3I9JA 1GXSB 2FRDC 2NUPB 2O3SA 2O8VA 3DFIA 2I80A 3I1IA 1KYVA 3P9XA 1HDOA 3HE3A 5F4ZA 1Y7TA 4W5WA 4ERNA 1FRVA 3LK7A 3ZDEA 1YS6A 3A2MA 3TZEA 1A88A 5C4GB 2BLLA 5EZYA 1T8WA 4G1CA 1VLLA 3H0CA 1L5LA 3H7IA 1Y3FE 721PA 3EGOA 4JJKA 1DLIA 1RVDA 2F4NA 4F8YA 1WZIA 1CU1A 2ZPAA 3AQIA 2CXOA 5KVSA 1N6PA 1S1MA 1VP9A 3U40A 3OEED 3DUWA 3DO8A 1T6XA 2PSJA 3DYBA 4RTMA 3O38A 6REQB 4M7RA 2J6CA 2ZJ6A 4J29A 4R51A 5BUSA 4XYBA 1YL7A 3ENWA 3ONDA 4KV9A 4DQDA 1P1IA 3KNZA 4MQ4A 4JJIA 2V54A 2DHDA 3MIIA 2QT9A 5HQTA 4KPUA 3G23A 1X87A 3TI9A 1CZUA 1G21A 3JQBA 1PX2A 1FP6A 2ZR0A 4GU5A 4ZYZA 2EKZA 4ZDIA 1SY7A 5TR9A 5IKEA 2CFCA 3LBHA 3A3NA 1W88A 3I5AA 1RJGA 4IQ0A 4UQOA 1PDOA 3ORRA 4HATA 4YMUA 3TAHA 5LQNA 4OXNA 2PVPA 3O1JC 1Q0TA 1WCIB 1E3EA 3I12A 3JQBC 1EWYA 2WF6A 5KREA 1RE1A 1AQUA 2ILVA 3M4XA 3FG9A 2ZXEA 1BFDA 2ADMA 4ZI7F 1PV4A 5DNWA 1JZSA 2PGDA 3KBBA 3T3GA 4TZ6A 4HH3C 4UKDA 421PA 4F5DA 3LD9A 3LS2A 1E1CA 2IYUA 2XEXA 1MO5A 4LZNA 1T9HA 2ZR9A 3STWA 3S70A 4DB4A 5IVDA 5I8WA 1DWOA 2I54A 3FCEA 4GVXA 4ZQBA 1WB5A 4OGKA 1M2OB 2O7QA 1OWOA 4KXXA 4DIMA 2INGX 3NETA 5JS2A 2XCLA 3CS3A 4AF8A 1U6KA 5L53A 3OQJA 4H3KB 3IRVA 3OJXA 3HA2A 3RVPA 4TZ0A 1OW3B 5G53C 1QVAA 4UD2A 2A5DA 5HF5A 4D9IA 1YB4A 3HRIA 1OX5A 2ONJA 1EPUA 1JDBB 1YNOA 4UFPA 4R1NA 4HNAB 1EFKA 2RFLA 1J49A 2F67A 5C7YA 2CFTA 3CCFA 1X1QA 4MH0R 3N2YA 3WYFA 4UARA 5A7GA 1T25A 3EEQA 4NCJA 2H2FA 3BIOA 1KF0A 1QYWA 1XYYA 1KDPA 4Q03A 2XUOA 3LFTA 2VZ9A 3Q8XB 2BF7A 4NAUA 1ORVA 1HETA 2F1IA 4E4YA 3U4MA 2GFHA 5ELMA 1DMRA 5CHYA 2P1DA 4NBRA 4BNGA 2CSXA 2LVBA 2GKGA 5KSWB 5JG7A 5AK4A 1ZNZA 3KEFA 3CLVA 3HI6A 3ED5A 2O54A 2O48X 2W93A 2B20A 1K4MA 1MQ9A 2IKQA 1W34A 1WUJS 4HDCA 3A9CA 3K0BA 2NM0A 5E2IA 1QP8A 3WY9A 3KE8A 1AKEA 4DXDA 3D2BA 4RGBA 4B35A 1OASA 4E09A 1GQSA 3MT7A 3X1WA 3U9SA 5GIOE 5BT8A 2ZYSA 3DMHA 4H3HB 2OFWA 2AI2A 2VRWA 2VT6A 2C5SA 1Z0IA 5G4KA 3X0DA 4ARVA 3SQXA 4RQAA 2GF0A 5BP7A 2GTPA 2ZJ7A 1N6HA 3C8HA 1E8NA 3SJBA 2WSSA 2WSMA 3AUUA 4OI1A 1QONA 5ARBA 3B12A 3D7LA 1JSZA 1T6BY 1NVFA 1T3SA 1XIVA 2BHSA 3N3AC 2P4EA 3MELA 3T9AA 4I55B 2NZ8A 3ES9A 1C8VB 2R4TA 2Q1TA 2HMYB 1Y8AA 2YNMA 2HHAA 4JENA 1YZVA 5D5QA 2K4MA 3VPAA 4DLZA 1MZPA 3D0OA 4QVIA 5KSPA 4F4CA 3IA2A 2N3ZA 3WZ2A 3OWHA 1I6KA 3HA5A 4Q9AA 4RACA 3ETJA 5H9VA 3DR3A 1BYIA 3EDCA 3NTVA 1EESA 1QFXA 1KK1A 4QUEA 5C2JB 4HWRA 2OCXA 2AF3C 5L3ZA 3PFFA 2C3UA 3VHLB 2QM0A 1P7PA 4REMA 1HQCA 1E1KA 4LF8B 3FTPA 3WRVA 1X8KA 4X92A 5FTJA 3LUPA 2C4NA 3IALA 5FPTA 2I1VB 5JWOA 4RTNA 4Z8XA 1XYVA 3JYQA 1EWVA 1XEWX 2JANA 4GLJA 3E3LA 3JQ7A 5GOZA 4E30A 3GXBA 1Q74A 4FFVA 1H3FA 13PKA 2V7GA 1ZR4A 1TK3A 4DWWA 1HDXA 1A04A 5EYPA 4PLTA 4Y9UA 5ICEA 3BM5A 2ZYHA 5IHXA 3ADBA 3WWDA 4J9UE 3SHVA 3SC6A 5LDHA 2GCOB 2WJZB 2C0CA 4P8RA 1D4OA 2AJDA 2GRAA 2N1BA 3FM9A 1R1DA 1HG1A 3N5KA 4UVGA 1YQUA 3JVDA 3PQ8A 1IQ0A 3GLVA 1ATZA 2H4WA 3AR8A 2ODQA 1SU8A 1XRNA 2P90A 2QTBA 4JAVC 4MGYR 3ZJ5A 2JGNA 2VJAA 4YAOA 2H18A 2OB1A 4PFQA 4QPJC 4C0BA 1XXHE 3LPAA 3RSOA 1K8ZB 1DKMA 1I5OA 3ZDXB 3GJ7A 3LC1O 1NVWQ 2ZYRA 3EGIA 4S1WA 7MHTA 3ZWCA 1L1FA 1MCZA 1NVVR 3RSLA 1Y8ZA 3BF8A 2QRPA 3TEFA 4M38A 5JE8A 4BNTA 2F48A 3M6WA 3JQFC 2NACA 3S68A 3LT5A 3QE4A 1DIOB 3MINA 5B37A 2DH5A 1E5QA 2FN7A 1FQKA 3HBJA 1CF4A 2RHHA 4CKBB 1Z2OX 4UNPA 5IM4F 2PGXA 2HWWA 2FFQA 3EUWA 3Q7EA 5AK5A 2QR5A 4L95C 4MJ7A 5BR8B 3IMFA 1UF9A 5CDGA 1YCGA 4YV2A 1B0UA 3TNJA 1Y8QA 4CV0A 5EHNA 1S4QA 1CUZA 2YFQA 3DWFA 4LNUB 3NHMA 4N4AA 3O9MA 4GEGA 1T5IA 2DTEA 2P3OA 4HAZA 5JR3A 3CVWA 1ZIDA 1Z2CA 2OXEA 2FF5A 3BD9A 2GCGA 2ZI5A 4L0QA 4LJ4A 4ZAVA 5DN6D 3NONA 3VTZA 3MBKA 4DHEA 1Z25A 1N9ZA 4URFA 4QASA 4WHMA 4YI5A 5SZHB 5JQGF 1RJ9A 4M6WA 2JLBA 3D3WB 2HJVA 1ZCAA 3N76A 4WKOA 3D6MA 3TFQA 4N76A 2Y2UA 3TOVA 1RBZA 2R1TB 4BGDA 2RAUA 3VA7A 1CPYA 3GOQA 2AQIA 3A10A 1HFEL 4PRKA 1T3GA 3M33A 4MI3A 5F1YA 2AZTA 4PN7A 2FB9A 2ZW9A 1I7QB 3EXFA 2BMEA 3V80A 5CLGA 4DMHA 3MGGA 3DHEA 1I0ZA 2A94A 3L8YA 4XWAA 1L7QA 1T3HA 3M6AA 4QODA 1B14A 1J2EA 3GA5A 2ZB4A 4A8JB 3FJOA 3GJ0A 3HP1A 4BDTA 2GN8A 4CKEB 1UH5A 1Z22A 2YHAA 1F12A 2L0XA 1RWWA 1NJSA 5EIOA 2ZUVA 1INLA 2VOJA 4DLAA 3U7FB 4HLNA 3GT4A 1WF6A 1YDEA 3SJ7A 4Z8YA 5FLKA 1IN8A 3THWB 2BUAA 3AR4A 4OLJA 4RM3A 4BEWA 4TV8A 1RMYA 2QJOA 4QC2A 3NVDA 3SXJA 4GS5A 3M4NA 4ATNA 2BTEA 1U28A 2RGBA 3TAUA 4LYHA 1NURA 5IF3A 5JECA 3C14C 5CD9A 1W0JA 3L9WA 1QHIA 1W36C 2DQZA 2LCIA 2YN2A 4O4LB 1Z07A 2E1PA 1J4AA 4BNHA 4P80A 5BQ5A 1CZOA 1T2CA 1M0EA 1ZJ5A 2ZJ5A 1E7RA 3O3MB 3W8RA 2POQX 2OESA 3CISA 5B7GA 1BE0A 2F3QA 1HYHA 4ONEA 1SHJA 1E1DA 4OYRA 4DHWA 1NVBA 4EQ6B 5D3ZA 2KS6A 3FPEA 4PAQA 1UOPA 3HJCA 4N39A 3IELA 3P2OA 3WGGA 4MVJG 2H8GA 1EG2A 4TL9A 2NSDA 1XPJA 2VI5A 2VSYA 4WUVA 3U3JA 3ZGOA 4Y9TA 1CUCA 3KLNA 2KBEA 2FSFA 2E89A 3ZQ4A 1NW9B 2X8JB 5CFPA 1GGMA 1JKIA 2UDPA 1ORTA 3NUZA 1VJTA 5D7NA 2A88A 3W5DA 4W9RA 3HYLA 3FNRA 2JFNA 1UMBA 5JC1A 1KQOA 3NHZA 3DQQA 4OQDA 4Z9XA 4UE6A 3FW1A 1ND5A 2PM8A 3RT9A 2Y05A 2AH5A 2P0EA 3T12A 3VHQA 2IHNA 4TKLA 2DY0A 4KLCA 4UQPA 5EGSA 4TTAA 3PWZA 3T54A 4B6PA 2I78A 4ZV9A 4W9MC 4EF4A 4WBNF 1KYQA 4RHTA 3RS9A 4DR7B 7MDHA 1NV8A 4OHWA 3TRHA 3ZS8A 1PUIA 3FWNA 4AMZA 1O94D 2JBHA 2UVPA 4ETWA 1EWQA 2VHTA 4MA4A 3JVEA 1UXKA 1EDDA 4PNPA 3V8PA 1SXQA 4XW2A 1RSZA 1O3YA 3A0UA 4R1SA 4Q9HA 4FSHA 1Z0ZA 1DIRA 4HUQA 2H0AA 4EJ0A 2R7AA 1RABA 1XZAA 4EI8A 1XEWY 5CDTA 1YK1A 5C34B 2QUAA 4OK3A 1QM5A 5KJFA 5IVHA 5CIYA 1HORA 4P2BA 5EJ9A 1ZO8A 3ZCRA 1EP9A 2IYFA 1NQUA 4N5HX 3J81A 4LJRA 4LKOA 1AB6A 1E9AA 2NU7B 2JH8A 1J2JA 3H2ZA 1XXLA 4M0FA 4PYIA 3N86A 1J6UA 5K8TA 1S9HA 1OI7A 4BB5A 1NF8A 1AUVA 3P0EA 3KKOA 3IQEA 3JQDA 3HN6A 3DZJA 2XMQA 4OLBA 4HDKB 1SA0A 3AEXA 1FTNA 4GMGA 4OHRA 4FU0A 4GKVA 3IEVA 1JIXA 5ICFA 3HJGA 3MYYA 1KBZA 1SELA 2VNSA 3ZCUA 4RYDA 4KTVE 1UZNA 2JD1A 4KXQA 3MWKA 1AXGA 1OYOA 2WW8A 3KJEA 2I0FA 4IXNA 4UBOA 3CH6A 1AKNA 2PLRA 4PYQA 5CT6A 4DBVO 1LPPA 2DMRA 5AUOB 2Q0XA 1TZ2A 4YA6A 2EL9A 1IOZA 1OX6A 1SUPA 3NQ41 2G3YA 2QLTA 1AUQA 4JLAA 1O0BA 4BIMA 4OB8A 2Q3HA 3T5MA 1ENZA 2HXGA 3JRNA 3WMXA 5GVSA 3EXAA 4C7VA 2O2CA 5KYXB 2W8ZA 4MVXA 4P4GA 2H4FA 1F4PA 5A0FA 3U60B 1YUNA 4UHHA 1R10A 4PAOA 2ATIA 1QH8B 3D8NA 1FOEB 3R44A 1MO6A 1KZHA 3ROQA 2XUKA 2AOTB 2ATVA 5AJXA 2OPBA 3R24A 5EWMB 4QPDA 2WV9A 4CJXA 5BN3B 5IT9A 3AHHA 1IY1A 3H11B 4XLZA 3VC1A 2XX3A 3OTOB 1GUBA 4IEIA 4O8ZA 5IN4A 1MW9X 3JSAA 5CT5A 2BFFB 3AM4A 1J2RA 1E2QA 3H04A 3H97A 3WYBA 1WOMA 4ZQGA 5JDCA 5LOVF 3K96A 5I9SA 3I05A 5EAIA 3I62A 5DYNA 4HGQA 3W2HA 3W04A 3W90A 3L4BC 1S2DA 4LTDA 2GFIA 1KEWA 5EVCA 1UXOA 4UJ3A 1PWZA 1M8FA 1P4AA 1UC8A 1EFRA 3DBHA 4EHJA 4F8EA 1VLVA 4BU0A 3LO5A 1L7MA 1YQEA 2C61A 1V6SA 3OPYI 3GDGA 2XKAA 4UPVA 1F14A 2CFIA 2XDQA 1YNSA 3E7PA 1NP3A 2GBLA 1WZNA 4FUTA 4GNRA 2JLXA 1N2SA 3JQCA 5CA0B 4IH1A 2R7NA 4N3CA 1IHYA 3OCUA 1KEVA 2ZXUA 2PX6A 4EX6A 2VT2A 4HYEA 1K97A 3RB8A 3QE2A 3NBFA 2VPZA 5JW6A 1NG9A 3IS3A 2HDOA 3K0HA 1QBKC 4DCOA 3WNBA 2EYUA 2HADA 2R47A 3JU3A 4FCWA 5JJIA 3RSFA 2GM9A 3O8NA 3TTYA 3OG9A 3CT4A 1E6MA 1WW2A 4AP6A 4ZYXA 2WNIA 1RRGA 3E27A 2E5WA 3H84A 2P9YA 2QY9A 3GT7A 4K1XA 4KCGA 5B3KA 2X5NA 5LWHA 1KJIA 3GRCA 1ZJ6A 1KP2A 1Q3KA 2V8BA 1DBSA 1WSAA 3NHRA 3OWXA 4FE4A 4J9VA 4N54A 1DU4A 1KHTA 4DOMA 3P97A 1EG7A 2A9VA 4HDMB 3ZD7A 2Q4EA 3DXXA 1QHGA 4UE3S 1L0BA 3D4NA 1B1CA 1HDZA 1W2HA 3VDRA 1TCBA 3ZGYA 2ZWIA 3U3XA 4N7JA 4OMFG 1HC7A 4FZJA 5I01A 1XF9A 3NALA 5LZ5A 3N6RA 5LU9A 1NMXA 3E18A 4MZDA 3HB0A 1J8FA 2GSDA 2OCBA 2P7IA 4ZEWA 1II0A 1KI1A 2OLEA 2PPLA 3PICA 5TQVA 1PGJA 5JC8A 1R88A 3OQ1A 4JI5B 3RBXA 4RJTA 4L51A 3Q5DA 2B1JA 4NBLA 4MA0A 2HN9A 3GJ5A 3SR4A 1FFXB 3QRWA 1MPTA 4OOEA 2C29D 3SDBA 3P5SA 2VUSA 5K6TA 2FP3A 3BUSA 4ZYWA 4MV9A 3B1WA 4NATA 4RJJA 3REGA 2GILA 4A23A 1X14A 1N2XA 1E7MA 2ZROA 4M9QA 3AL2A 4KGVA 1YRYE 4ROTA 3VU9A 1H1LB 3D6JA 3WL3A 3CZQA 3WQSB 4L7QA 4QJ3A 1R6UA 2Y1XA 1HQKA 3D1JA 4FMDF 5AK6A 4F2DA 1PT6A 1LBEA 2ORED 2A1UA 1KH1A 2C1ZA 3KJIA 1DEAA 5BOSA 5FBHA 2OENG 3CXRA 3QUSA 4ZI7B 1FFDA 1M8KA 1YBAA 1UK8A 1NVEA 1PHRA 1TJ4A 2WF7A 1EAMA 1F51E 3EMVA 1H1TA 3I2YX 4LJ7A 4D4MA 4D9MA 4DRXA 3FHTA 4K9SA 3PFIA 4LA4A 4F1WA 5A2GA 1E2KA 1FS6A 1KORA 1NQWA 3IFSA 1JLSA 3NG1A 4OFWA 4GP9A 4ZVKA 5I9BA 2SCUB 1ZA2A 4RKQA 4Q02A 2E6UX 4JY7A 2IP2A 1IZYA 3LPDA 1POWA 4KGZA 2JGIA 2WA2A 4JQYA 3L7NA 1E92A 3ZW8A 1NI4B 5C1PA 2I33A 1CUGA 4FGJA 4HWGA 3WQHA 1QIGA 3AEUA 3CT6A 2CLMB 5H70A 4BKOA 5A1TA 1HRDA 2WINI 4RHEA 1C1XB 4CIVA 4CR6A 2AEEA 1S4MA 4J0GA 4N7BA 1CKEA 4QRDA 1Q7BA 4YY3B 4KSBA 1FVXA 4BLVA 4QLBA 8OHMA 1JBEA 4K9PA 4OGGA 2Y6VA 3EQZA 1KAQA 1Y8CA 2P7HA 4OYHA 2FLVA 4RZ2A 5F1PA 3UCXA 2G9RA 1K3UB 1SR8A 4NONA 3ZZ1A 4FT2A 3GBVA 2GRJA 4PSVA 3RHZA 4DSUA 3L0CA 1CQPA 1VKOA 1ZOIA 3JAKA 4P7JA 1WUYA 5M2QA 4L50A 3V42A 1BDJA 1NQ5A 1PV2A 1RZVA 4Q37A 4XFKA 4I1SA 2FY8A 3TQQA 3EN0A 4CG1A 3SU8A 1B7GO 2ZUBA 1HDYA 2EW2A 4W82A 2EX0A 1FX0B 2CXSA 3UWMA 4OLAA 4GM4A 2GJ4A 2HCJB 1JQ3A 3F9CA 3PVZA 5B2EA 3U7HB 1RQXA 1U3CA 1GZ5A 2SECE 3BTSA 3FLEA 3Q11A 5DHAA 1QDUA 3MGAA 1T2EA 3ROMA 5GZ6A 3V8RA 4JUDX 5IWCA 4BGEA 4E7PA 1XTRA 3KKKA 3MRXA 1S3GA 5FPKA 5FPHA 1W73A 4JBWA 2JBAA 4CEIA 1WPQA 3AG6A 2GEKA 2R86A 1S01A 3GAZA 2IUEA 3WV4A 3C5CA 4JK3A 1O57A 2AG5A 2FSHA 2I67A 3CEAA 4QXAA 1XTTA 5C80A 1E99A 1ZSYA 4IHAA 4M1WA 4OGWA 4LOLA 3L7IA 2JATA 4Q3DA 5IMBA 2C7VA 1VM6A 1H0KA 1KZ4A 2XB8A 4EY8A 1JEDA 1G21E 1IXKA 2DSTA 5L4LA 2VQFB 5HOEA 3I5MA 1C2YA 3M8KA 2CF5A 5IJZA 4LNHA 1D2AA 2VNHA 5K4AA 3UAZA 2ADFA 4KMOA 1L4GA 4YRSA 3K9GA 3STYA 3GP3A 3VRHA 3Q5GA 1TM2A 2IZOA 4MW9A 4Q9DA 1WZ2A 3I1JA 1C7QA 3ESQA 4I19A 4KOAA 4E2XA 2D6FA 3H87A 1U2PA 1CF2O 3KB6A 4JEHA 3KYIB 3GEEA 3TSZA 1YWGO 3EVFA 3OP4A 1EXVA 2WJWA 2Z2IA 4NI5A 5REQB 3B2NA 2GPAA 3WMEA 2KHZA 1DG1G 3ZWBA 2AV6A 4CUZA 1P9LA 4E15A 1OVGA 3DKVA 2H1SA 5FIUA 1L9KA 3GGJA 2FMUA 3KM0A 4KBGA 1V1MA 2LDXA 4YWHA 1REQA 2QIOA 3AR9A 1XZLA 4EA9A 1D4AA 1OSNA 1YR7A 2FK7A 4RE5A 3EWAA 4LECA 3K4QA 2C7BA 4B6FA 4QZVA 4FGLA 4Q93A 3FYHA 4FQ8A 1HYQA 1A7AA 3ESAA 3I9V1 2VUHB 2XVYA 3A0RB 5A4KA 1CY1A 3NJRA 2QVBA 5AW5A 5JSFA 4JI0B 4HUJA 3RFTA 2F2TA 1U2SA 4Y2JA 2G9VA 2OBMA 3B53X 1X1SA 3PYXA 4BYMA 1Z16A 5CTJA 5L3SB 4KK3A 1SUCA 4YLGA 3PEUA 4J8PA 1DELA 2V03A 1KRHA 1I9GA 1ONBA 1X80B 3KUDA 3QKSB 3EVGA 3BMOA 1WQ3A 2IV7A 3WIVA 4OX9B 3GIWA 1Q1AA 2HBYA 3AWDA 3BTOA 2FPSA 5P8WA 1V25A 4KRGA 3ZE7A 3L1HA 1KJNA 3HSYA 4HTFB 2OHXA 2UZ0A 5TX7A 4IS3A 3W79A 3KUCA 3N07A 2QPLA 2IUFA 5LZ7A 1A1VA 2J45A 3T7TA 3KDSE 3KQKA 4RZUA 4CKWA 1CF9A 4LXXA 1DXQA 3SZUA 4CT0A 3HXTA 4BAUA 4H1TA 4POAA 2H51A 1JHOA 3KTOA 1PVDA 2AG6A 4LXTA 4WKGA 4X97A 5FI5A 4ER5A 4JC8A 1Y9JA 1G98A 3DHVA 3GD5A 4J0FA 3KKZA 1TU3A 3TNLA 3LKDA 2PWYA 4RF2A 1YKFA 3IAM1 3UANA 1YJ5A 3AKZA 1GY8A 3CKYA 3E9MA 4ZYUA 1CUDA 2EKPA 3GZJA 1YJBA 2IU6A 3A1UA 1TL7C 3MQ2A 2F8MA 1VBKA 4JJ7A 4OYYA 4PANA 3E70C 1TEVA 3G2OA 4YIKA 5IKMA 7REQA 3OU6A 4EP1A 1S7CA 1LS6A 1N8NA 1NN1A 1VYUA 1XUOA 2VF2A 3DM5A 1XCBA 2A78A 1QIIA 4G8DA 1ATIA 5EIBC 2E85A 3IV9A 1F48A 2Q62A 1U7PA 3CNBA 4AD8A 4ZJUA 1I7LA 2DCUA 1C4OA 1MB2A 4INPA 3U37A 1FC0A 1EFUA 1Q1GA 2WUFA 2C9OA 2PUHA 5DB4A 3ZXYA 1V47A 1GPLA 5LNK6 3FHLA 3AZPA 3Q3GE 1YJXA 4NHOA 4YFVA 1WQ1R 4PRLA 3EW9A 3OF3A 121PA 4FUQA 4ISCA 1DGQA 4RHFA 1COWA 3DAHA 4GRIA 3T5BA 3KYCA 2GFQA 2J8ZA 1T5TA 1MJFA 4X6YA 1ONSA 1TO1E 1DCTA 4EMUA 4UHDA 3FPAA 3SSAA 5KU7A 1PQUA 2HREA 1U0EA 2HBZA 2IVFA 3ITKA 4TKZA 3GN1A 3IUJA 4XWTA 1Z7WA 4QD3A 4B7ZA 3C5WP 2Q1SA 3QPUA 5G0VA 2VHWA 1OB5A 1GNPA 4FXOA 5DPMA 3TPZA 1MJNA 3G7UA 3X1YA 3ZE9A 2EGHA 4EL0A 5K0CA 1FFHA 3CUWA 5SV2A 2JASA 5IVPA 1AOXA 2PUEA 4B6SA 3B6IA 1YQDA 4JB0A 1YULA 1L5VA 3OJ0A 4O4JF 4IOMA 3PUVA 5FQOA 3ZVKA 1ZMRA 2W11A 3SF0A 1XDWA 1YVEI 2H08A 3K35A 2DBYA 1WWKA 3ZHXA 2E3JA 2FV8A 3DQZA 3LUAA 5BW4A 3F4KA 4AS3A 4MEBA 3DL7A 2B99A 1BJRE 4J1TA 5BPHA 1I0LA 2X3UA 3LKBA 1QHYA 4L16A 4DCJA 2CEKA 1J07A 1VSVA 3B9QA 2J6HA 2J3JA 4FX2A 3L46A 4HRXA 2H31A 1CVIA 2QSYA 5J58A 4D57A 3QEBZ 2XRMA 1VL6A 4PFJA 4TUYF 5AM5A 1NW7A 2WJ4A 3FKSA 3IC5A 5ALUA 1KDOA 3MS4A 4J1TC 1RXCA 4MV4A 1ECCA 4RK4A 5ER6A 3STTA 3L49A 1DFIA 4G26A 1QHHA 3AEQB 5JNWA 5JT1A 1YXMA 3RJMA 2C3PA 3D2CA 4JLWA 4IDQA 1DIGA 5LBUA 2BJVA 1E7QA 4HEHA 1WCXA 3IPCA 1T1SA 2NPFA 3UJHA 4TLLB 1IN7A 1L3CA 1PFWA 4JA2A 4Z9FA 2E4UA 5DYGA 5CJ2A 5K8IA 3ZDDA 1SK9A 4G4JA 3DE7X 1AT1A 5K0NA 1CZNA 4HXYA 1SBHA 5KNCA 5E3JA 1QCYA 3W77A 2BISA 1PW5A 2VDOB 3OQHA 3PUXA 3O8OA 4FYHA 3HEBA 4ZO8A 2C88A 1QG6A 4WBNB 1FDWA 3H6KA 4P31A 4YMTA 2OORA 3AUSA 5ADVA 3VSDA 1S2MA 4MKFA 4EG7A 3AVQA 3AKDA 1PFVA 4A5SA 2W6QA 1QZXA 4NJOA 2DYKA 4YBZA 4GLOA 4HDNB 3TTXA 1I4LD 5EN4A 3U4AA 5L7WA 1RJWA 3NOQA 2IUTA 1UFOA 2XWPA 4O8CA 5GP1A 4BNLA 4J4HA 3V4OA 1XTPA 2X0DA 1CNMA 1XVVA 3WISA 3M5DA 1UK7A 3L4KA 4XYLA 5BSEA 1C4KA 4WASA 4QDUA 4UAGA 4ZRNA 3LYHA 1JB9A 2P4UA 3BTUA 3L0BA 5JTUA 4L4SA 3S28A 2VAWA 4EELA 1YZKA 1ZBQA 4IJMA 3U7QA 2QNBA 1IH8A 4YRNA 4YCNA 2FOXA 4JBGA 1GPDG 4WLNA 1QKJA 4RPCA 2O5VA 3FFBA 5LJIA 3BK1A 1IZ0A 3L84A 1RQRA 1B8NA 5AFSA 4L76A 4RHUA 4XDYA 3NAGA 1H5QA 1Z8HA 1YZFA 3LGXA 3UAVA 4GSYA 4IFIA 4ETIA 3OEEA 5JEEA 4EI2A 1SQ5A 2VS1A 3S3TA 3B2QA 4WFIA 1IRXA 3ESCA 4ALKA 4O2AF 3H4TA 2QG6A 3HDVA 3SBDA 2V9PA 5K3AA 3UIEA 3SZRA 3QPWA 4EGSA 1EDEA 4YJ3A 1U0BB 2JGJA 4DV7B 3OUZA 3Q9LA 3MPOA 3A2KA 2RHWA 3R20A 3NHJA 1XPRA 3P0IA 3VV2A 3DL2A 1CFJA 3CPEA 4X71A 1YIAA 2NPOA 1MH1A 3FMFA 5FCDA 1LJ8A 3ILSA 4UOQA 3WKCA 2J3HA 3HCFA 1YCDA 2QAGA 5TQ0B 4C29A 4C30A 1CS0B 2JHGA 4L22A 1LI4A 2CWDA 3M9XA 4I1YA 4KPYA 2VAMA 5FLYA 1ZS9A 4M9XA 4EVQA 3FWZA 5LOVB 1M5RA 5AESA 4OQ4A 1RRVA 5J43A 2Q8NA 1KKUA 1NYRA 2I3DA 3U4GA 5DIZA 3ZJUA 7GPBA 4ISBA 2I22A 4C0JA 2QAGC 4MQBA 4EHLA 2C58A 1C80A 2OHIA 1UJNA 3UW3A 3SCZA 4LF4B 5LA6B 4R8MA 1S96A 1M2VB 3IAXA 3LXMA 1W5AA 4I08A 3RTAA 3WQRA 4A2WA 4F5YA 4EPXA 4QGAA 1WE2A 4NMXB 2I4MA 3GELA 4PAGA 4NNPA 1C0IA 2VXCA 2XYRA 3PG5A 1XJWA 1JT9A 4YK7A 3VJKA 1G8YA 1QDEA 3OPYA 1WBJB 3EG9B 3ESRA 4B47A 3EISA 3REOA 1V7CA 2F8TA 3PK0A 4H1HA 2ZE8A 3EXG2 4ZVPA 2F1HA 4LZWA 5EJEA 1C30A 1D4FA 5D01A 5HF9A 1B8OA 1JRLA 3LT4A 4P4TA 4JMLA 1N3YA 4KBYA 4MVWA 4MQEB 4RWEA 4MS4A 4CDGA 3DF9A 3HKDB 3TGPA 4MDYA 2GA9A 2BRUC 1UBGA 2R9VA 2WY2D 3RTBA 5IC6A 3AY0A 3K6SA 3VV3A 5FKJA 1J8MF 1I3KA 4ZMRA 5KEIA 2ZZNA 1XRRA 1PKEA 1U2EA 1T9DA 3JV7A 2X2FA 3CRMA 1FXUA 2WIBA 3WKDA 3KOZA 1Z0AA 3AVPA 3N05A 2PMWB 3C3XA 4PU0A 3MJDA 3TM5A 5AVRA 4P0PB 3F7MA 3CNHA 3CX7A 3ZD6A 3WBBA 1QRRA 4ZGBA 4ZRDA 1PNOA 3ZQKA 4O1IA 3VPGA 4BWGA 4QYTA 4ZVLA 3EH2A 3COWA 2Q45A 3SNHA 2PUJA 1FNCA 2FWBA 5ESWA 1ABEA 1D2MA 5DNUA 2REQA 1Y7HA 4OJNA 1I24A 2UU9B 4ZIRA 5H59A 1OIXA 2HTFA 2N9UA 2OC4A 4UM8B 1GTVA 3FNFA 4EY3A 2XKBA 3SJCA 2BFWA 4YRKA 1T5OA 1C2TA 4P33A 3DL4A 5AVYA 4NKRA 3EG5A 4JJAA 1C7IA 4RJKA 3IEMA 2XVZA 4AU1A 3UT5A 3HG7A 2XLCA 3HJHA 2Z3VA 3IIEA 2YWRA 1UOQA 4XJXA 3T1OA 3QMPA 2BVNA 4HLDA 4YASA 3CKLA 3PNLA 4FMDB 1PJAA 2PR7A 4GBGA 3S2ZA 5K3CA 1D2RA 4LF9B 5HK8A 2FSGA 3GGPA 3WIDA 3BE4A 1ZNYA 3AJAA 2XNCA 3AETB 4MZXA 4YQYA 5G41A 5J59A 4QNRA 5E6UA 1BHQ1 1U0TA 2XVAA 4LY6A 4R2XA 3RYFB 1I1HA 2BI7A 4MRNA 1ST2A 5CDFA 2CBGA 1E5XA 3ZXXA 2QRVB 5B4VA 4US2R 4GE0A 3LUHA 3IB3A 1TFUA 3D6NB 2NVUB 4IUDS 1A5ZA 3GEHA 5B7NA 3TIGA 5CCDA 4DLRA 1TM1E 2H7CA 1BXRA 1TPZA 2I2AA 3VJLA 5LQAA 3WFIA 3C3PA 3UG7A 1MKYA 3DA8A 5FR2A 1KEEB 3EQ7A 2VK2A 4DW8A 2NVOA 4Z9YA 5TQJA 1DX4A 4IHQA 1B74A 3MQ4A 5BSHA 5AWFC 4W5TA 4BLUA 1XROA 2IYLD 2YIJA 4F11A 2XQKA 2R7KA 2DBRA 1IZZA 3H5IA 3LYLA 4RQTA 2C9ZA 3AERA 3O2QB 4O29A 1C3OA 2V58A 3V7UA 3L04A 4RZHA 5I4KA 4KE7A 4Q00A 4DMUB 4BB9A 2Q9AA 1E8DA 3A25A 1H0RA 2Q0SA 3QI2A 2K5UA 4FILA 4GFDA 4FNAA 4CMIA 1IFXA 2SICE 1IHOA 3F5SA 5FOSA 2P9HA 4NCIA 1LWOA 5HUJA 1FZTA 4NMWA 3BL8A 2JJ1D 1QR2A 5DKFA 1EP1B 1D03A 1ZH0A 5EXTA 3TMYA 3ZWMA 2WTUA 2V1UA 1JU9A 2ACWA 2EV9A 1E5LA 1OGIA 2P2DA 2QRNA 2XD4A 3F1LA 3P9NA 5FOXA 3M3DA 5D6OA 1YOVA 4BZQA 2SKDA 5KQMA 1FYVA 3WNCA 1FFEA 3PXDA 3QQPA 2C0QA 2A33A 4DBZA 2BGNA 2XHZA 4NV3A 2C2KA 4ZQCB 2ABWA 3UXYA 2R7MA 4CLRB 1E3JA 4QUJA 4LFAB 1V95A 3WBFA 2HT1A 4LXIA 4QUIA 4I2VA 2Z1DA 1QHEA 4F4FA 1ORDA 2LWIA 3PQCA 5AW6A 2CT8A 3PFHA 4H59A 4N5DA 2CDNA 1ZGBA 1XL1A 1M2FA 1JG2A 1MIOA 1W44A 1D2HA 2AKYA 4WK0B 1TQ6A 1NKSA 5CFOA 2QVGA 3EZ6A 3ZDZB 4MP3A 1EE1A 4G3XA 1PVOA 4OY3A 5T4EA 3T5GA 3D7KA 4E3WA 4Q0MA 2RCNA 2PO7A 3GLHB 3L77A 3OPNA 3PFWO 4P83A 5T8KA 3RC3A 4ZHQA 1KAEA 4JLBA 3D7MA 1ACJA 4AJ4A 4B6EA 4DIBA 5CG1A 1R9NA 1Y6GA 2X3FA 2J3MA 3EBLA 3E5NA 1A72A 1CNFA 3QJGA 4L4YA 4CR8A 4JC4A 1EZ1A 3NBAA 1IOLA 1N1MA 4ZRMA 5CB4F 5JDIA 5DBOA 4EHAA 1XTZA 5EJ6A 4WLVA 5G2OA 4GKAA 3K0EA 1GTRA 3GOHA 5T8KC 3GEPA 3U81A 2FNAA 2X8WA 5DI3A 5EKUA 3PXEA 4J91A 2O3JA 2XCUA 4RC9A 1RC0A 2ZJAA 3MCUA 1C4WA 4DZRA 4PN3A 1A1SA 1MHPA 3HXPA 1QGAA 2FZKA 3E9RA 5H7XA 3DSRA 1XMJA 3HZZA 3ZXIA 4O08A 4QSMA 3WA6A 1G5RA 1SQ6A 5DTQA 1W76A 2Y1FA 4CN9A 4ZTUB 1L8AA 3K94A 2W8BB 3O31A 4KH1A 4F7DA 5JSZB 1BHSA 4ALNA 4AXBA 5KYUB 4TTQA 2RG7A 5I7UA 1FXWA 2DC1A 2H16A 2JI7A 3BILA 3G2PA 3EIUA 4KNWA 4FKBA 4ML3A 4M83A 5DOVA 4WN3A 3R7SA 4A7PA 1LLCA 5AKLA 4H7IA 4AJJA 4R9NA 3WGKA 1YVPA 4DB2A 3A6FA 3MRVA 3INTA 4KDFA 5F1OA 2JG3A 5JARA 3OE4A 1FFSA 1U04A 2QS9A 3AF4A 4FIDA 1QZTA 4IJ6A 4D2IA 1Z56C 3R3WA 4KIUA 3LIIA 4S3MA 4WH0A 1HYBA 5B1DA 8ATCA 2NO9A 4OL9A 3AFIA 3OM1A 4NFLA 3A36A 4OXKA 1WX1A 4KAFA 3GEBA 1XCLA 3LSYA 3IJPA 4I4TF 4KDEA 3E7WA 5IJAA 4EUSA 5CG2A 4LFBB 4GXTA 1THZA 2LPMA 3EMDA 4OSPA 3BWMA 1XVAA 3LQKA 1OLUA 1UMDB 1QGUA 2XCIA 3EGEA 1E1NA 2DH6A 4LZPA 4WV3A 2FUEA 3QKRB 2W00A 1EEHA 3K5PA 3ORSA 4WXYB 1KDVA 2Z5LA 4AUEA 1TYEB 1J20A 1M1YE 1D1TA 1VGRA 4Q7MB 5EHZA 2EFJA 4W5NA 1U3UA 3UXHA 2YV5A 5KVCA 3HKCB 1ZK1A 5CK5A 4L5CA 2EZ4A 4RKYA 1W5EA 4KLAA 1GQOA 2XZPA 3H9JA 5B1IA 3X1DA 4DLNA 2FPWA 1AQ6A 3M2PA 4PIVA 2GPNA 2YL2A 3WK8A 5KQLA 4LW8A 4L4XA 3O3NB 5T6BA 1V8PA 1KXZA 1Q7CA 1URPA 3TX2A 1Q6YA 1NVTA 2YMMA 3TLMA 3V6MA 5LBIA 1MVOA 5LU8A 2W9XA 1O94A 2D7JA 1OYVA 2PLWA 1KHHA 2REXB 5DX1A 2EP8A 2B36A 4HYQA 1PS9A 1WW8A 2VJYA 5C5DA 5K0SA 1W9MA 2TSYB 1M34A 3RSGA 3DD5A 4HX2A 1HI9A 3WHKA 3BK2A 3IAHA 1V3QE 2YWBA 3A14A 1NTOA 3ASVA 5DMXA 2GM4A 4R2MA 2WFLA 1PS8A 4IFBA 4TWAA 4NOJA 1UAGA 1GGHA 4RPHA 1X7WA 3I04A 3C24A 1WKVA 1Q0HA 2AZ4A 1O94C 4YQEA 2HCTA 5F1KA 2X5OA 3H4MA 4CI0B 3JASA 2PSEA 1JPVA 1MA3A 1UPUA 1W5TA 2GZ2A 2H2WA 2O50A 3G13A 3H8VA 4B8WA 1BMDA 5FOQA 1JL3A 3DMTC 4B3HA 4F6CA 1FFBA 4AX8A 1P39A 3O7MA 3GJ4A 2YWFA 1VB5A 3O03A 1NNEA 3ER8A 1S02A 1KVRA 1B42A 4O4JB 5T3YA 9LDBA 3GLSA 4IY1A 5CLLA 5JCOA 3MCTA 2XOKD 4H7FA 3FPLA 1LBIA 1QK5A 5ALSA 1MF7A 3HI4A 3KTDA 4I8IA 1M0SA 2IEIA 1RPZA 1QVRA 2F62A 3DCIA 2EG5A 1JUDA 3VI4B 3UJ8A 4MI9A 1QYDA 3LWNA 2NU6A 1PS0A 4D7AA 2UUPA 4HI0E 4E5KA 3NBKA 1U3FA 4A4DA 4OP1A 4AK9A 4NE9A 1R2QA 2ZB7A 3IURA 1YFKA 3LZDA 4C7KA 5JCOC 5C51B 1G38A 3PE6A 3BCUA 4G37A 1XZGA 2JJQA 2ZIXA 3M83A 4QPPA 4KPEC 5CR9A 4IJ5A 4UM9D 2GBPA 2W6JA 4F3TA 4MVYA 1X38A 4ZZ2A 1E66A 3TX6A 3UV6A 1VP3A 2ZYVX 2IH5A 5CYFA 3N8GA 5ALDA 1O5IA 1CETA 4FNGA 2BMFA 4IOJA 2H8KA 4R2KA 1KOLA 1GTL1 4WZ6A 4LWPA 3WLQA 8ABPA 1KE2A 2HJSA 3ESYA 3BC1A 3B6EA 1ZBDA 1GPYA 3WLJA 4G0MA 4JU9A 4BX3A 1BS1A 3RQIA 5B58C 3BMCB 2CXPA 3HJTA 2J0UB 4ID9A 3OIYA 3NXKA 2NAPA 3AUFA 4KR0A 3ZJYA 1I3OA 3K0CA 3U4CA 3DW3X 4HEJA 1YB6A 4BO5A 4Y2SA 1VFPA 5E9AA 1I4OA 4F0JA 4JCOA 5F76A 4YRGA 3QVJA 4MMXB 4MUHA 2ZIVB 4PHGA 1Y89A 5BORA 1GAXA 1GRNA 3S7TA 3HVHA 4OB6A 4NQRA 2V8OA 4DR5B 3K0CC 2FEKA 3HB5X 1NSFA 4ICIA 3O8BA 4OKSA 4Z0HO 3VGPA 2MSEB 1D6NA 4GXRA 3QEKA 4HLUA 1BOOA 3T3IA 3QKIA 4V0LA 1WXQA 3UQZA 4POOA 3E2MA 4ZEOA 4ZI2A 2W2LD 3IUPA 1L1RA 3DE2X 3EF3A 1THMA 3HDYA 3K09A 4K3VA 2BHRA 3TDMA 2YY5A 3FETA 4RHYA 2QKYA 1Z82A 2HU7A 4MDHA 4PFSA 1H2FA 5J2TF 4NARA 3VBCA 3R5FA 1UXIA 3WKAA 4A2PA 3NGLA 4KI0A 1PT8A 1PG0A 2OV4A 3ETHA 4LKRA 3GMDA 2E82A 4WT7A 3RFFA 1ZC4A 2QN7A 1E18A 1E1YA 3K09C 3UHPA 1QG2A 4IQFA 1TRKA 2GM5A 4KFTA 2LRHA 4YCAA 2IUUA 2QTRA 3RR2A 3I04M 4OA5A 3LFHA 1U7HA 4G5FA 4HDOB 3WYDA 2YRFA 4O2AB 4CR7A 4ERXA 5CB8A 4KFCA 1T4BA 4NEQA 4WWHA 3U9LA 4BMVA 3AKYA 1L5OA 1OLXA 4EW3A 3K5HA 1JEJA 1DC8A 1MNQA 1FU7A 1WTCA 3CW2A 3ICWA 5FHQA 4RY8A 2P78A 1TT5B 1V1RB 2C4TA 2A4KA 2O2SA 2Z08A 4FOTA 2FW0A 1EI9A 2O2GA 2FX2A 2ZRBA 4X6LA 3ZE1B 3I3SR 3FWYA 2XZDA 4NBTA 3ZU4A 1EJ0A 2I4NA 4M76B 3SOZA 4KNYA 1P77A 1F4LA 1HE8B 1QWOA 3VVCA 3Q10A 5MFPA 4MULA 4X54A 1BVYF 2B98A 2NG1A 1IMJA 1E89A 2CMFA 3L79A 3SXPA 4M1TA 3HXKA 4OO3A 1S8NA 3EIFA 4QQ8A 5C8YF 3FB1A 1PDWA 2ZUCA 5KTSA 3OU2A 1M6HA 4XUCA 5BN1A 3N74A 4ENSA 1C7EA 2AFIE 2POCA 3JQGA 3UC5A 4LJSA 2BFDB 2GAOA 1NLMA 3HCDA 2VJOA 1CUAA 4HFJA 4OHBA 4OV6B 4W5HA 4ABTA 5CVCA 3SIWA 3EIXA 2VDWB 5DYWA 4CHGA 1I0IA 2FPKA 5YASA 4D44A 4DWJA 4YJGA 3EIQA 1DQRA 3LX8A 3UOWA 3I8SA 4J1QA 4M55A 3ZR4B 4BLSA 5CK4A 3T5TA 1XI2A 1G8AA 4AMUA 4YMHA 2O1XA 3AOGA 3LHDA 4LBZA 4N03A 2X3YA 1H9AA 1I30A 3RVLA 3G0IA 3T7IA 3JCZA 1G7SA 1X74A 3HKBA 2PX2A 4KLZA 4G1UC 4LSWA 4YUZA 5IMSA 3JQ8A 4X66B 1ORWA 4P3KA 4JL8A 3GFVA 1KZ7B 2BFCB 1P1BA 2D5BA 4FWBA 4ZCLA 4G09A 4HVAA 5COBA 1I3NA 2FPLA 4C6TA 1XKLA 1K8XB 4KFSA 1CYDA 3QWBA 5CH3A 3M9LA 4DIOA 1XVIA 4NZOA 1VECA 1Z5GA 2Y0DA 3WDMA 2PO5A 2DPYA 3IE2A 4F04A 1J42A 2IX9A 4RW0A 3L8GA 1IE3A 2VG8A 4YDSA 2Y1CA 2HPVA 2B30A 1V3UA 4X6UA 2VHJA 1C0PA 4J43A 3VU0A 2H1VA 2AC2A 4KDCA 2ERXA 1VOTA 2ZLBA 1OLSA 3SQWA 4Q3KA 4X94A 1WF3A 3VAYA 4D97A 5BN5A 2WFZA 3V4RA 1GA4A 5AVKA 4DDHA 1TRHA 4CCYA 1GQRA 1PZXA 2X77A 4YCLA 5CLHA 2ZJYA 3SC2A 1L4KA 3KSUA 2ST1A 4C87A 4P0TA 2P8JA 4BJ1A 1NVVQ 4RVNA 4W1PA 1OXXK 2OTCA 1R00A 4HDRA 3ANTA 5DTJA 5BYBA 1FUIA 1L1QA 2R3SA 1DEHA 3P2EA 3PJFA 4WIAA 5CXQA 2IHYA 3VO8A 2DR2A 4NYJR 2AK2A 1Y34E 4RVUA 1KJZA 4M0EA 4LQCA 5LMUB 3DD1A 3KJNA 4GX5A 1X19A 1PJ4A 2BR5A 5A4DA 3IOMA 1A8IA 2PL1A 4AJOA 5JAMA 1V39A 3WYCA 3N2GA 4OHVA 3ZV3A 1TJYA 1HNNA 4KACA 4MICA 4RA6A 2J33A 1WBDA 3EXG1 4DDTA 3CLHA 2RKOA 1YTUA 3D64A 1XKXA 2R6ZA 4G0XA 4HGRA 3G7SA 4EG1A 2IS2A 3ASYA 2P6PA 4M53A 3Q3EA 1EYZA 2BGLA 3KHUA 2OAQ1 2ZYWX 1C9DB 1SULA 3JWIA 4XEUA 5DNEA 1DADA 1KEUA 3ABRB 1FF9A 2IHKA 1EXMA 3GYBA 3O4RA 4G81A 4HAOA 1Z4OA 4JITA 1U0OC 3L8EA 3GQVA 3DUFA 2D1SA 3OCYA 4JI1B 2ATEA 4DA8A 3JR7A 4ITRC 2GLTA 3OEYA 4RK5A 3OX2A 4A3SA 5ITZA 2ZJBA 2VCHA 1Y4AE 1Z4PX 5FBWB 5JSUA 4FOPA 2R48A 5E95A 3NT2A 4P0QB 3QPCA 1V5GA 3F6SA 4YPOA 4JN6B 4WI1A 4QTTB 1NJ8A 3OCWA 4N7RA 3EIHA 1IN5A 3QFRA 2QTVB 2B92A 1H8HD 4L9WA 4B34A 3SZMA 2OCYC 3UH0A 4C5CA 4Z4GA 1AVTA 1O95C 1OZAA 2V5AA 2FPPB 4ZV4A 5H0IA 1CRQA 1DTWA 2XQGA 6GPBA 4AN1A 3BWXA 3QA3E 4GPTA 2WVGA 1L8XA 1I94B 3CWZA 2BUCA 5A5VA 1BX1A 2RI6A 2FPOA 1VJGA 2I87A 2QJFA 2ZR8A 4EAAA 2IDZA 4CFZA 4N0EA 2JD2A 1CSEE 2WT4A 3MN1A 1IXRC 3L1VA 4BZPA 1U5BA 1HLGA 5JZOA 1GZUA 2SKEA 3ISTA 5HJ5A 4Y6SA 2NSJA 2VQ6A 3FVVA 5K1ZA 1ZD8A 2DU8A 1E2GA 2R97A 3AP3A 2D5IA 3OLWA 4IXTA 1DZ3A 2APJA 2H1CA 1T0PA 2DFLA 2R2AA 2XMCA 3G85A 5E7IA 2CCGA 2IH2A 4TTIA 1FU8A 2NPIA 1PKXA 3NV9A 5EQJB 3Q1KA 4R8SA 4RZSA 5FBRB 3JARB 4ZYLA 5EZYF 3ZDQA 1R6TA 3HEAA 3QZUA 1E8MA 1SIBE 2XKJE 3E9QA 4O63O 4U6QA 5EHIA 2AVDA 2CMDA 4PHHA 4DMLA 1NMEA 1VG8A 3O8CA 1N3LA 3G89A 4ABYA 2RAPA 3D2AA 4WN9B 2Q5IA 3DZGA 1R4NB 1OR8A 4RWZA 4E5VA 2H7YA 6ADHA 4K0KB 4JASB 1E3TA 3MT8A 4NU8X 2XF2A 3HL0A 4FFWA 3HA3A 3ROKA 2WDZA 4PEVA 2IP1A 1NXSA 3C3KA 1B8PA 1K8QA 3IBSA 4N48A 4LZAA 3X2SA 5DYTA 2CMGA 3L82B 4TT3D 5LNK1 1UP4A 2P3SA 3IHKA 5I7OA 3OQMA 2CV0A 4C7OA 2OMEA 3T4XA 3W6NA 2NZ2A 2QI9C 4G07A 2R85A 3ONWA 1Y1RA 5CEJA 2G07A 2H6EA 3HVIA 4UTXA 1YHZA 3VPHA 3PQ2A 3HSSA 3PVCA 1ZC3A 3RV4A 1J5EB 2ZVPX 4DDVA 3ASZA 3IAS6 4BJHB 4DCMA 4II7A 1KMCA 3C85A 3EFOA 2GYVA 1EX1A 2WYOA 5DE3A 5TJ9A 4ZVQA 5AW1A 5THXA 4B48A 1R3UA 3AHCA 1K4YA 4TM7A 3SBEA 2NTVA 1MTOA 4YHBA 1BS9A 5LYYA 2XCOA 4EY5A 3QIVA 4LXYA 1Q2UA 3ZWQA 3OA0A 1P4RA 5KHLB 3FOEC 3USCS 1DQZA 3S44A 4B45A 4ZKEA 1IC6A 1P75A 2CHGA 3CGGA 5KVVA 1O8CA 2GZRA 3HUUA 3UMBA 2IYNA 4DRZA 5JTTA 1OH8A 2BM9A 4MB2A 4W63A 3F3MA 3IUYA 5EIFA 1RIIA 2HGSA 2YWGA 3M4ZA 4XPIA 4URYR 4D9GA 1NUSA 1TZKA 2Z6QA 2CDAA 4QBFA 3L0SA 5FFMA 4QRHA 5HKKA 1UPBA 1DBQA 5EEHA 2BD0A 5HK9A 1A4XA 1LTQA 4PAMA 3PNYA 4X1YA 1WW3A 1Z7BA 2MYTA 2QXTA 2A1TS 4CF5A 1U5AA 2ESRA 3TTSA 5KYGA 3PPXA 1JR3A 2DG2A 2ODWA 3QVTA 3ELDA 1W48A 4X64B 3N53A 4DG9A 1R50A 3NHKA 3JZAA 1IATA 4KVFA 2I7TA 2OL4A 4FM9A 4DQXA 1Z12A 4KQ6A 3FMIA 2HJGA 3TL6A 4UEKA 3WYEA 5F3RA 3M81A 3MT0A 4XGKA 4J6FA 5THQA 1XPOA 1RWOA 2PQ0A 4JR1A 3G8AA 4JQSA 1ZN2A 2AMLA 4XGIA 3UV7A 4H27A 3PE4A 3EOBI 2J9FA 1CK4A 3GVPA 4JLNA 2M6LA 4C0XA 2RC6A 2QN3A 4A0HA 1GGFA 3ABQB 1GUZA 4UOZA 3RJZA 1KGDA 2EW8A 5JNRA 3HU2A 5DWQA 3N0XA 4MYDA 2ZRAA 1EJ6A 1WXXA 4S2UA 2HRZA 2GESA 2YVUA 3CUEF 3IEPA 3K7EA 1TC1A 2P6NA 2PSFA 4OSOA 4TM8A 1EE2A 4GOMD 5KI6A 2J5KA 2WD7A 3DVAA 4GLLA 4RD6A 5IWAB 3KXKA 4FOOA 1SVUA 4LTNA 4N3BA 3RYHB 3OZRA 2GHTA 1IBKB 4R7GA 1RWNA 3V4FA 3WMGA 5HR5A 1G20B 4DAOA 2B7BA 2IXFA 3SX2A 3DPUA 3ZCQA 3SN6A 4K8RB 3PNKA 5KNDA 1SXPA 4XDGA 3MPUA 5AM0A 4ZQFA 1KDRA 1QIEA 1UP6A 3T7DA 1YJ8A 4ZC1A 2Z5VA 1JFTA 3RS0A 5AVUA 1SKBA 4KJZA 1M67A 3Q2KA 2VDLB 3SP1A 1LJUA 2X5XA 3R3ZA 3HJUA 2QGNA 1AGYA 3KT8A 1G6KA 2H1FA 3PD0A 1WHTB 3HL4A 4XLLA 3O93A 2EU8A 3C4VA 4DJ5X 3CH7A 2QX4A 3CJQA 2NUBA 1R8YA 2CUTA 4NZ9A 1PRYA 2A0WA 1EFPB 2JZNA 4TLEA 5GM1A 2C2ZA 2HK8A 5BQPA 3S55A 3FZGA 4XRGA 5KX5A 5HNKA 3H5TA 2XWBF 1KK3A 1RKXA 2EF1A 5DXFA 1GPKA 2I7CA 2J4CA 3I4FA 3AI1A 3KOMA 3Q9NA 1G16A 1E3LA 3QNWA 3VH2A 4DA6A 2VTBA 3Q3VA 5KOJA 4M46A 1R0WA 2SKCA 3QOWA 1GAWA 3R8CA 1DDOA 2O8NA 2Q4RA 2WF5A 2H2HA 2ZSBA 2WNHA 1G3QA 3G9ZA 3Q0EA 4CL3A 3NHFA 4YVFA 5K6RA 1J25A 3OZXA 2E87A 2V4UA 4FJ2A 5JV5A 2PL9A 3K9FC 2R6R1 3MBIA 2RH9B 2JL1A 3IPXA 1XSEA 3F46A 4JI2B 2HSDA 4CIYA 4Q3EA 4YJFA 2QTNA 3D5EA 5G02A 3OM8A 1J56A 1JKJB 2Z9BA 3UO8B 4AULA 1EUDA 2Y93A 3FMPB 3GRYA 3BD8A 4XDZA 4JYZA 1HXHA 1DKNA 2ZQZA 3B7GA 1N92A 3ZTWA 3UGQA 5BW6B 3ETDA 3UJBA 2ZATA 2GZSA 1OWLA 1Z2DA 3GCGA 3QU7A 3ZYZA 3KELA 2HIGA 1ZU5A 4LK3A 3TLEA 1V4NA 1TECE 2A9OA 2XMRA 3HFJA 5KTNA 3UT6A 1EFVB 3AR5A 1WZUA 2H4JA 3DZHA 3QLJA 3WGMA 4GW3A 4EGAA 3SGLA 3SIPA 2WAXA 5HBGA 2X8AA 4Q66C 1DWUA 2PV0A 4ZVMA 3H1BA 2DSNA 3DAOA 4G1FA 3Q12A 5IASA 2NZWA 1GAJA 5HYVA 1OBHA 1M9NA 3HCBA 3ZGNA 3HVJA 2C4VA 3ZGLA 2RDMA 4GZ6A 1FDOA 1JA0A 2ZJ3A 4UHFA 4FPXA 1MX1A 5BXYA 4HNRA 5BV8A 2AUMA 4EJSB 2HMUA 1CFZA 5AI6A 5JNTA 3HYCA 2B4YA 4HJRA 3K2BA 1JG1A 2LCFA 2XA9A 2ZI6A 2ZS7A 3FPSA 3CQ9A 3IQZA 3QPDA 3MUNA 2BFEA 4NZMA 2EWVA 2GEUA 1OXBB 1PSZA 1KVUA 4JIMA 2WJPA 3GVIA 2NO5A 2IW3A 4NMHA 1G5HA 1E2HA 1JEYA 1BCRB 3QW4B 4G9GA 2LTAA 4G8BA 3VDXA 3KOOA 3ETLA 3JYHA 4HNHA 4D5GA 5TPWB 1Q44A 3KQSA 4PSUA 3OJWA 4Y1EA 1OH7A 2WLSA 4BO8A 2JHCA 3GPCA 4JOCA 4TSFD 5CX1A 4QU8A 1E62A 2FA9A 1SAYA 3I2HA 3PDWA 4XARA 2BFMA 5JATA 5J2TB 1EK2A 2H59A 3ZWPA 1N6IA 4BCBA 1NKVA 3EB9A 1G18A 4BV8A 3CLUD 4EJMA 4BXOB 3EVAA 3QNMA 5EFZA 3D0KA 2B4QA 2EBHX 4EI7A 3NBZC 4KXFB 3OZCA 4CF7A 4G0UA 4ODIA 3MFYA 3QELB 2QSUA 4IIBA 4M0KA 3A6PC 1ILWA 1PFKA 2OO7A 3BJZA 4MEJA 4A36A 4GL4A 3GEIA 1L7PA 2JFPA 4EDFA 1J0XO 1YD7A 2FZGA 2FK8A 2WABA 3AGQA 2BMVA 5LLSA 4EKDA 5KAMA 4HMOA 4BMDA 1U5CA 4RF5A 4CQMD 2D1YA 2F3TA 3LLMA 1Z62A 4W1SA 4IG4A 3D3KA 2GEDA 1QC5A 4NZNA 2EQAA 1K86A 2D4AA 3ROZA 2AZMA 2BLNA 3UMSA 3VNUA 2PBFA 1CVLA 3AHDA 4WOPA 4NU5A 3LY7A 5E3IA 5TGTA 2GPTA 4JKOA 2FPGA 1WXGA 5JPIA 3SQLA 2FRXA 3CNEA 3GU3A 1N1DA 3ZWAA 5FUWA 5DEOA 4QARA 4WK6A 3VPBA 4UCFA 1UJ2A 1VJDA 3R9KA 3CZPA 4BQRA 3ORFA 2Y99A 3P4XA 4Q3NA 3CBGA 3NEPX 4PHTA 4Q9NA 1W29A 4KKXB 3GP5A 3SXUB 3BE5A 3DDOA 2EJBA 3IP6A 2WB4A 1N25A 1QIDA 3EW7A 4OAPA 1IQPA 1ZK0A 1BMQA 2YINC 4QWWA 1W4RA 1Z73A 3F2VA 4XDHA 2HW8A 2Z8YA 4BX2A 4FFSA 2FG6C 1CW2B 2P9QA 3B1ZA 3E9CA 3IP9A 4GXQA 4KXLA 1LVUA 1UKZA 3ORQA 4MW0A 4HGYA 4R8LA 3ROXA 2B4TO 4LXHA 3U3DA 1NXTA 1QB7A 1Y6FA 3WX0A 3DP9A 3COZA 4TS9A 5E4TA 4ND6A 3M1AA 1Z2AA 2Q1UA 2JFFA 2XMDA 3DBLA 3N0WA 3RGWS 4FZRA 3ZVLA 4F3YA 2ZRLA 1T9CA 5K20A 2WF8A 5I3CA 2A9KA 4RK6A 1DFHA 4O4HA 2XGMA 4HSGA 3CRNA 3TD2A 3TUJC 5GTDA 1Z7EA 1J97A 2B9EA 3E22B 3NI2A 3R3UA 4NEHB 2JCVA 3PUZA 1UT6A 2YVAA 3S1AA 2NYUA 1F2VA 1EEXB 5LR6A 2H7VA 2VP9A 4QYWA 2JHAA 3D8SA 5I8ZA 4HH1A 1D07A 4QREA 2QRZA 5DXJA 1XK7A 3RF6A 5HQ3B 2DQYA 1WO8A 4AF7A 3GFRA 2VAXA 4KMMA 4N0QA 4OU5A 3COJA 1HG0A 3FE2A 4BFYA 2BKUA 3WMFA 1FP2A 2QW0X 1UM9A 2H48A 2ZKLA 3GF4A 2FEWB 1SCBA 3DE4X 5T7BA 3HRKA 2KLHA 3KVNA 2XDYA 3FKJA 3PHBE 1CR0A 1VPDA 3LL4A 1OFIA 3N8HA 2EDAA 1KP9A 2TYSB 5ANRB 4JEUA 1OBFO 1IZ8A 3PDJA 4PYKA 3VHRA 4MGHA 1AMUA 2VJBA 5ER9A 3GAAA 1JX6A 3ZNQA 1BA2A 3OF5A 4H6XA 1TMOA 4AMYA 3NASA 2O1WA 4CCWA 3K0AB 3EVTA 3ZBTA 1LC0A 1M2WA 2L18A 1A2OA 1F8FA 2YX1A 3VUEA 1X1DA 1NRWA 2ZRHA 3KVRA 3BERA 3DWGA 3LOPA 3WP1B 4OH1A 4XX1A 4BJ6A 3PHJA 4A0QA 4Z9AA 5ICSA 5B55A 3PPYA 3P4UA 1VFNA 3AF1A 3FR8A 2J08A 4AWXA 1ULTA 2HYDA 3A3KA 4O59O 4U6NA 4II3A 4GOND 1U7TA 2KPOA 3FY4A 3WMWA 3DE1X 3NKVA 4IDOA 4HWSA 3WWEA 4ZMBA 4EJ2A 3RC1A 3V4PB 3O90A 4Z7NB 3ZLJA 3GROA 5BWCA 4L57A 5KTMA 3SY8A 1E9RA 1T8YA 2R8EA 3M6LA 4N7MA 1W59A 2G04A 4DCVA 4DUGA 4ALIA 2V65A 5GPBA 2H1OA 1RZRD 3C48A 2AFVA 1OF1A 1E79D 3B60A 3OCCA 5I6DA 2H5JA 2JFYA 1DC6A 2KBFA 4DEVA 3CN7A 4MR8B 3R76A 2PZMA 2PGIA 5E6RB 2AEMA 5FNVF 3WLKX 1JLMA 1THGA 2QUZA 3ACCA 3PPVA 2B94A 3L7CA 1SZDA 3ZDYB 3ETNA 2ETVA 3FYUB 3HYSA 4QUGA 1BVHA 3CVOA 4AJ2A 3DTVB 3PLRA 4N3AA 5AUNB 1EMDA 1CE8A 2OQIA 4LFCB 4BATA 4EFKA 2OBNA 2TMGA 4IJQA 3QGMA 4J3JA 4DJEC 3W5IA 5KOIA 2A84A 3W6OA 2QXYA 1Y42X 4YO8A 1HZJA 1UANA 3I0NA 3WGJA 4FQ7A 4JYCA 5IF9A 3KQQA 4BRUA 3ACDA 4H17A 1CUUA 2RGRA 2Q27A 4DIFA 1KVQA 4PYOA 5TVKA 1BXKA 1YB7A 3HDQA 3V2IA 3ZNNA 1PT5A 1XN4A 2QR2A 3JPWA 1HO3A 3M5PA 2HFJA 3IPYA 4IX1A 3I01A 4KR2A 4RFVA 1F6DA 2AS0A 2DKNA 2Z8YM 3IQXA 3PBKA 5HTKA 4RETA 4Q4JA 1K5DA 3JQ9C 2G63A 5K8CA 2J5XA 2NV0A 4KU4A 3E05A 5K01A 4ZI3A 3H6HA 4DN6A 3DP7A 4WJZA 3LBFA 1X7XA 4LBYA 1GEEA 4XD7D 5L6LB 2R8OA 3ZE2B 4KWHA 4RENA 3BWYA 1KKMA 3ICEA 2BE9A 4LHYA 4A8PA 1GUFA 3DFMA 5EWJB 2ECKA 3AW8A 1TW3A 4ZN6A 5FWDA 5C53B 4B33A 3LW8A 2Q5FA 5F2NA 1F3LA 2VPIA 4G5OA 3THYA 3J81k 1ULSA 2EKQA 1Z5WA 3PJEA 4C88A 1PJSA 3WWZA 1NBWB 1MH9A 5AJUA 4D82A 3QFFA 4F9FA 1S3SA 2Z1MA 3IRUA 2X6QA 1IYZA 2WVAA 3C98A 1TA4A 2O2DA 3T3HA 5EZYB 3GEGA 1VI6A 3M2TA 1LDBA 4NE2A 4AURA 3K72B 1QFMA 1Z74A 1ZICA 3Q6IA 4EUNA 2W0SA 4PC3A 2F55A 4P53A 3ZG6A 4DVJA 4OX9Y 4TWZA 5JZVA 1YFZA 1ZGCA 2CK3A 4OUDA 3TKLA 5CJPA 1E6KA 3P2IA 3QM1A 2KW5A 3MOIA 2WF9A 3DEZA 4IKOA 1LTKA 2XWJI 4OUKX 2R25B 3E53A 4G1VA 1BCSA 3RK4A 5AM3A 1U99A 1II8A 2IKSA 5JH7A 1QJ4A 4KPUB 2OBYA 1G21B 4DBLC 1E6WA 1I5EA 1E3IA 1XDSA 2WSLA 3PVSA