1VPEA

Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
398
structure length
398
Chain Sequence
b'EKMTIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKIDLAKELVEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAAVNKFGLEDKFSHVSTGGGASLEFLEGKELPGIASMRIKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOGLYCERATE KINASE
molecule tags Transferase
source organism Thermotoga maritima
publication title Closed structure of phosphoglycerate kinase from Thermotoga maritima reveals the catalytic mechanism and determinants of thermal stability.
pubmed doi rcsb
total genus 148
structure length 398
sequence length 398
ec nomenclature ec 2.7.2.3: Phosphoglycerate kinase.
pdb deposition date 1997-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00162 PGK Phosphoglycerate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vpeA01
3.40.50.1260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vpeA02
2IE8A 16PKA 1HDIA 3OZ7A 1PHPA 1VPEA 4EHJA 2YBEA 1FW8A 4AXXA 4O33A 2X15A 1ZMRA 2X13A 3PGKA 3ZLBA 2P9TA 1KF0A 3Q3VA 4NG4A 13PKA 1V6SA 4DG5A 1VJCA 3C3AA 3C3CA 3ZOZA 1VJDA 2XE7A 1QPGA 2PAAA 2ZGVA 3UWDA 1LTKA 2WZCA 5BT8A 2XE6A 4FEYA 2X14A 3OZAA 3C39A 2XE8A 2WZBA 2WZDA 3C3BA 4O3FA 2Y3IA 2P9QA 2CUNA
chains in the Genus database with same CATH superfamily
3BORA 3DBHA 4AVYA 721PA 3VVBA 3D3JA 2G25A 1XAHA 3DAPA 3BDAA 2ZSDA 1XTQA 2H1VA 1Z4PX 3DP7A 3QLTA 4OMFG 4RGBA 4BEVA 4HXGA 4PCUA 1FC0A 1OH5A 3U7QB 5A2QA 3STHA 2E1PA 4WUVA 5BYKA 4KFTA 4IY1A 4W1RA 5E3IA 1P7CA 3IKVA 3FGZA 4MW9A 1YR2A 3T7SA 5TS2A 1OZHA 3WRXC 1CF4A 4UTNA 3I6QA 3D8HA 4ZDIA 1QOZA 2XUKA 3GA5A 3B9QA 3T5TA 3PXCX 5G0WA 1YI1A 3DM5A 1XQVA 1JLLB 1RPAA 4PR3A 1MAHA 4O2BA 1TFRA 1ZCBA 1WR8A 1Z2EA 1JWLA 2ZT8A 4XCXA 3Q0IA 1X7WA 1SZDA 2PX5A 1D1QA 3KZKA 4B34A 5ADWA 5FV4A 1THZA 3I0MA 2DQZA 5SZIA 4WY2A 1AQLA 2FZVA 3IUPA 3OPYI 4L15A 4ROTA 4C0JA 2SICE 2QJTA 3N8DA 2GNOA 1NF9A 1WPXA 2OGTA 3KU1A 1YJAA 3FAKA 3I3OA 3EDCA 3OEWA 2X6QA 4FC6A 4N5HX 1HFJA 4LBYA 4G01B 4K6KA 3R5KA 1E2LA 3UTCA 3T9DA 3NAMA 3WMRA 1EFDN 1Y1TA 5KPJA 1DZIA 1QGED 1Y0BA 1DRWA 1NUQA 2FMXA 1HTBA 4KQ6A 1PR4A 4XM1A 3FWPA 3I62A 3ERCA 1GJRA 2EZTA 3C5WP 1YJ5A 3FVWA 3GBSA 5TGDA 4C05A 2P6MA 4CTKA 1BOFA 5LSAA 2D74A 2R751 2PBFA 4OI0A 1JA0A 3D9QX 4GOND 2IF2A 3PXXA 3B1VA 3UFXB 1JQJC 3P0EA 1SQ5A 3HO8A 5BN3B 5BWNA 1OIVA 2DQKA 1SCUA 5KOHA 1RWBA 1YIDA 5G02A 1D4OA 4D3DA 1JFLA 3BK7A 3DFIA 1QK3A 3B5EA 4A2CA 1Q7BA 4JSYA 1F3LA 1Q92A 1S9DA 3WSTA 4Z49A 4KE6A 4XQEA 4EG7A 1G6OA 3K8YA 4BFUA 1U1CA 1EP9A 1E7YA 4PE5B 1JEYA 1GTMA 3KB6A 3VBCA 2VP3A 3K1AA 4MJLA 3U7HB 2WHXA 3WK6A 2GHQA 1LXCA 2XCIA 3AUFA 3HE3A 4HUJA 4F2PA 5JOQA 3OLCX 4TKZA 1FTGA 3QXSA 1R5OA 3ESAA 3LCMA 2J59A 2P3OA 3QHQA 1RMQA 4MVJA 4DREA 5K6TA 3RRXA 2NIPA 4N41A 3N2EA 4F6LA 3ZTYA 5LA6F 4HB0A 5DW0A 3QSGA 4PX3A 5DPMA 2FN4A 2Q2NA 1MGPA 4QTUB 2WP8J 4PVDA 4N6OA 3KR0A 1Y42X 3OO1A 3TL2A 5LN1A 3ZWMA 1T4CB 4F6RB 2F55A 3C8UA 1QR6A 4RF3A 3QV2A 2J4DA 2HEGA 2EFDB 2ZIZA 1GRQA 4K46A 3VTAA 1JDNA 2RAPA 2ZSEA 5AVKA 3VHXA 5TEWA 4O29A 1FPMA 2PFKA 1H6CA 2H59A 2IYNA 1JQEA 3C48A 2H52A 2CW5A 1FNBA 1VBNA 2CF5A 5DTEA 1D2CA 1UJ2A 1NLZA 4NBUA 4UMFA 4C21A 3QBVA 4PNZA 5HF8A 3LFUA 3GLSA 1FUKA 3BXEA 4MKHA 4RVHA 2G1JA 3VAYA 4DC9A 3B6KA 3RBAA 2GN6A 4EFKA 4XKJA 1KA9H 4HQRA 3RKSA 3N70A 1JR4A 1OXUA 2VZ0A 4P4LA 4TZTA 3IAHA 4EY7A 4E51A 5BV1A 5KIAA 1MB4A 1QWSA 1HWYA 3GP8A 2OLEA 5CM9C 2B6NA 4G24A 4AI6A 3KXLA 4MP8A 2X2FA 3V80A 4MIEA 5BSGA 1CUHA 3FYDA 5TMDA 3EVGA 3BXPA 1DC3A 2E4UA 4C0WA 4PG6A 3BWXA 4FFSA 4H7FA 4WXMA 2BMAA 1ORTA 2IXBA 4NHOA 4JYAB 1L7VC 4G56A 1Z39A 1N2SA 3VR0A 3HXKA 4P5EA 2J48A 1QH1B 2LCFA 3E05A 3WXMA 1IE3A 3R3UA 5M5BA 1CF9A 4O8CA 2MINA 2PT7A 2EFGA 3CUUA 4LXQA 2UXDB 3ZD6A 1HE3A 3X1ZA 1KY2A 2G08A 2CWWA 1U8XX 3UJCA 5D01A 2MU1A 3TG2A 3DE6X 2XCRB 3PXEA 3NAQA 3UB2A 4WJZA 1LNQA 3EMBA 3OKAA 4YFVA 3ZDQA 5A3RA 4KXQA 3WLMA 5ALOA 2CZCA 5F77A 1N6PA 4DM3A 3CRZA 5B30A 2FW6A 3WISA 2AI1A 2QT9A 4P1ZA 3BDIA 4X3OA 4FJ2A 1O5OA 2BFOA 3G3EA 2QN9A 3VM6A 4BJ5A 4XVCA 3PPWA 4YIHA 1CTQA 5JC1A 3ORFA 1C9NA 4I9FA 5FWDA 3SR4A 2Y2VA 3K9FC 1T13A 2QLNA 1EWVA 4JHLA 1H2ZA 1RAFA 3RASA 5JSZA 4KB5A 1RBMA 1GQQA 2QX6A 3ENQA 3QFRA 4AY2A 4RHCA 3QEOA 3UZUA 1QTNA 1XJ5A 4JUIA 5AM5A 3THSA 1ISHA 1EK0A 3UAGA 1Z4QA 5AM0A 4LWZA 3LW7A 2B34A 4ZYWA 3HM2A 3UO8B 5DM2A 3E3NA 4DB2A 2Y4NA 4GRDA 1UKEA 4D8VA 2CYAA 1O97C 2HO5A 3K0BA 2OMKA 3NPAA 3QE0A 4TL9A 4BGVA 4HNVA 2AFHA 5BRJA 5KOJA 3RNLA 1YCDA 5CT9A 1K7FB 1NNSA 1G6KA 3OWXA 3MA0A 2I4OA 1NA5A 3VR3D 1C3EA 1W88A 4KCGA 4OCZA 1U2PA 2WWXA 3EDOA 3BHJA 2XRFA 4W7SA 4DZTA 5KYKA 1V9LA 4L8YA 1Y9EA 3FW1A 1GKYA 3KLNA 5K3SA 1TZKA 3GJ4A 3NJ8A 3H4MA 3AEQA 2GS9A 3AEKB 5H82A 3H13A 1XQ1A 1SPBS 5IJZA 3EGXB 4QQFA 3W8RA 5CBPB 4FHEA 2IZ5A 5JTTA 3I01A 2O3QA 4EW6A 4R01A 4K9LA 2IOYA 2QRVA 1Z5WA 3PWSA 3FZEA 2QLBA 2W2MA 5AXBA 1E7WA 3WIOA 5I7HA 1JQ5A 3GN1A 4HY3A 4MLPA 4NCAA 4U2KA 1T43A 3P94A 3WLKX 2D5IA 2FMIA 1KDOA 4LZAA 4LJ5A 2OM6A 3Q7EA 3AU9A 4MB2A 1CQJB 4O3FA 4V24A 2M98A 1QYRA 1XRRA 1GQFA 4IDEA 4F5EA 4ZVMA 3N5KA 2G82A 3IIEA 5AW2A 2H2HA 2VIIA 4BE7B 2CJPA 2NSLA 5F51A 5HF6A 5JTUA 4JJ7A 3FFXA 3PR3A 4QFCA 4U6NA 1CZOA 2Q0QA 4IUDS 1QH0A 3QJ5A 1F0PA 4Q4AB 4MW6A 3T06B 3U60B 1UMCA 4YBRA 2O8EA 2F7SA 2AQHA 2WT4A 2V7TA 4B0OA 2P6RA 2JGDA 2Q3HA 3G8BA 5FAXA 4K9NA 4R2XA 1Y1PA 4HXEB 4P3NA 1QHGA 3UNXA 1Y8RB 4FD2A 3RSFA 4R1PA 1SVUA 1EXMA 4JVMA 2ORYA 4UUQA 4PX2A 1R5NA 4PPFA 2N1MA 3ZE6A 1JHOA 1T8YA 1NY5A 2YBDA 2WTMA 1FTNA 2ESRA 4V03A 1N2BA 3DKVA 3PHCA 4JI2B 5HRCA 4WJKB 3F6RA 5LDGA 5J5VA 3DTVD 1N92A 1GNQA 3ADDA 4QIHA 5J2TA 5A3SA 3JZDA 1HOXA 1MC8A 2C82A 5CLQA 4EX6A 1R6BX 3PIIA 4N5IX 2C20A 4UAGA 2PWPA 2L17A 4ER6A 3OTGA 3G0IA 2EC5A 2D5BA 3H2KA 1BNCA 3HR4A 1C7RA 1FFCA 4ZT5A 4QUAA 3UT5A 2SKEA 2G06A 5A5DA 1UWCA 5A7GA 5CH3A 5F7OA 3R3WA 4Z0HO 4KSBA 1TU3A 1ZM4A 2FWAA 1WUYA 2VK4A 4F72A 1N5DA 3HUDA 4NMHA 4DSNA 2JEYA 3O4RA 4LY6A 5TT0A 4D8WA 2TS1A 4GMXA 4W9NA 5FL7A 1AS3A 2HWYA 4R0VA 4UPDA 3VPFA 4URYR 3MQ2A 3RDPA 4QDJA 1E2UA 1MF7A 4L0CA 5J4HA 1NMZA 3OJOA 2B0JA 5DNYB 2ZIEA 4FSDA 3S4YA 5IVHA 2PXCA 4ALKA 1JUDA 4B85A 4CN9A 3EA4A 1D2MA 1PV1A 3G5MA 5LC1A 5I48A 3KKQA 2Q07A 4EHKA 2KJQA 4OV6B 4O4LA 2XF2A 3RC3A 4GLBA 2V97A 2JHAA 2HCFA 2B1GA 2WLSA 3QPAA 3AR8A 1XNJA 3W78A 1YV9A 4OXYA 4LHVA 4B9EA 4J7UA 4P3PA 3FPLA 3UW1A 3AF1A 4B9AA 5DYIA 3H9JA 1MT3A 1JP7A 1OSNA 3PQ5A 3RCBA 3HKCA 1F0KA 4PSDA 2GB4A 2EVWX 1TYBE 4NEGA 5AJZA 3L0DA 3NTRA 1EEXB 3P9ZA 5CDFA 1GG8A 1NDQA 1RTKA 2YWHA 4YXWA 5SY6A 3S1SA 2GEBA 4AKEA 3T95A 4F2WA 2ZRMA 2OA0A 4W9RA 5FO1A 2H1LA 3VV3A 4N8EA 4Z53A 3L0CA 4N9QA 3LMKA 4RKWA 3T3IA 1SELA 3IKJA 3BKXA 1YA8A 1KP3A 3OUZA 4WCDA 3I09A 4X60A 2WJ4A 4CODB 1M0EA 1CUXA 3CFYA 1XBTA 2GFQA 3INGA 3T3PB 2Z5LA 4A92A 2BGKA 2O5VA 4TTPA 5DJ5A 1KDTA 3ZNNA 4N7BA 1VG9B 4F3KA 3P2OA 3QWBA 3SZRA 2CFCA 4GQAA 3X3HA 3O1HB 4F3TA 1N2ZA 4HN2A 2COUA 5EIHA 3BDVA 4ND7A 4QUHA 1YZUA 5HP4A 5ETJA 1JLRA 1XMJA 5KX5F 3SICE 3H1BA 3OT1A 1M2HA 1YQEA 2PUWA 2R4UA 3N6VA 1MJ5A 4RZXA 3V9PA 3QVVA 3RYCB 1ZPDA 4B3MB 3PC4A 3L7JA 3U3DA 2DKNA 1XZNA 3K0AA 3HTXA 4X54A 4ZMRA 5CT5A 4RPLA 4EL5A 4E3ZA 2AF3C 4UHEA 1O0SA 1OOEA 2GK3A 2V6JA 3NT4A 3QE3A 3TVYA 4CR8A 4EVSA 1J0BA 4PEVA 4XAQA 2A9VA 2QD2A 3LBNA 1C7QA 2CF6A 5IK2A 2RGNC 2Y0CA 2VJKA 1QWOA 1MVOA 3NHYA 4LGCA 2XUAA 1DKMA 3OHPA 5F1OA 4CKCA 1X15A 2FW9A 3CZAA 5FWYA 2QRKA 1FCJA 2N42A 2FX2A 3BMNA 3RFFA 3X1JA 4RHTA 3RSGA 4ZAGA 4NYJR 4QBKA 3VU3A 1OWNA 4NBVA 2F4NA 4BGEA 5LQKA 1RQXA 3TZLA 3CCCA 3A70A 3C5VA 3DCYA 3DXYA 3OQIA 3DDOA 3C3MA 4U3JB 3WS7A 2H3EA 4L4XA 3B1ZA 5F76A 3U62A 4BVAA 2I4LA 4DWOA 1X2BA 2BW0A 2RGEA 3EDRA 3MMXA 1LZKA 2VTVA 1EWQA 2O0KA 3DPUA 5BMVF 3OU7A 1YVPA 1L7NA 4KBGA 4OLFA 2VATA 3UAWA 5KJ1A 4AZ0A 2ZCJA 4KE9A 3GW8A 4E5PA 1QAQA 5I8PA 1JG4A 2OP1A 1OV4A 1DXOA 1BE8A 1U7OA 2R62A 3GLIA 2IUTA 1CQPA 4X8MA 3ILYA 2C2WA 1GA4A 3G17A 1LQ2A 5CVUA 5FO0A 2W2PA 1AKMA 5FI3A 4MYHA 4L8FA 5CRIA 3X2EA 1FTWA 5JCJA 2PKQP 1DBRA 2QV0A 2BE9A 2JLYA 1NYQA 3E18A 1TW2A 1JKIA 2R9VA 1QIMA 1NVWQ 2VYNA 3GZNB 1ZC4A 3HJCA 3O5AA 2GARA 1I7SB 4DT1B 5H83A 2ABWA 1ZEMA 5DHFA 1A2BA 2BP7A 3G49A 1DC4A 4HNGA 4E6PA 2O7SA 3FGNA 1BWQA 2IXDA 4UQLA 3ZCTA 4DCUA 3ZCRA 4EJFA 4O2BB 5IN5A 3ULKA 1U9IA 2RHLA 5KTOA 4QRHA 4RY2A 2BH2A 4UPVA 1IY9A 1ZMOA 2CN1A 2LUOA 3AY0A 1SKQA 2ODAA 3LYAA 4ANFA 4JXKA 5EGSA 1FYFA 1NPYA 2Z58A 1UMKA 2ASEA 4RA9B 3VHLB 3EB9A 1O3YA 3ZHUA 2XCOA 3A4TA 1Q44A 5EMMA 3UT0A 3WLJA 3GFBA 1Y3IA 1XDUA 4WGGA 1UBOS 2VRWA 1OZAA 4YC7A 5GY7A 3EA0A 2XLCA 2FPWA 3ROTA 2GO1A 5BWMA 1Y1KE 2QVLA 4TLAA 2GBLA 4WKBA 5ALTA 5C4GB 1J2YA 1FRVA 1R15A 1W76A 3ADKA 2WWIA 1U28C 3OA2A 4FQ7A 2X9NA 2C3OA 1Y3AA 1VGVA 5IABA 4X1OA 3H6HA 1H2HA 1PG5A 5ALRA 5FBRB 2NZVG 3OY7A 4L6AA 2P2CA 4LWOA 2C98A 3M6LA 2C61A 1HG0A 4C2BA 3R09A 2DPYA 1FVXA 4EMSA 4LMBA 4YXWD 3MM4A 4NZYA 4W5OA 4C4PA 1JF8A 2EZ9A 2FMHA 3CWZA 1MMFB 1I4WA 1UWLA 2H2AA 4FK8A 4HRYA 3DJYA 4FR0A 2Q6LA 2V7XA 4N5DA 3ZK8A 4MQUA 1V47A 3VGPA 4ZYTA 5AFSA 4LF5B 2HMVA 3HWWA 4L08A 5EXTA 3W79A 4C01A 1R9JA 1YB1A 4XDZA 3WJ1A 4ZANA 4X44A 4LF7B 1CRQA 5TMEA 4R9RA 3BREA 3AP3A 4GGOA 4JQCA 4DBLE 5CEJA 1KVRA 3N3AC 1PR9A 1KNQA 1U2GA 2FQWA 2R6AA 2RK3A 2ZFUA 3JTMA 3WQBA 1KI9A 3RRFA 1S8OA 4FCTA 4RV4A 2UZ4A 1L5ZA 5LPNA 2ZJFA 4K6OA 4U7FA 3ASZA 2OC9A 5EE9A 1E92A 3IQWA 3DE4X 5GM2A 2G88A 1CQZA 5AJVB 2XVAA 5FR2A 2ZIAA 4UASA 3EPKA 3OFNA 2CHGA 3DBLA 4BNZA 4ZVQA 1F7VA 4FS3A 2QF7A 2Q6OA 3ZIAD 5EC8A 1XR3A 2ZIVB 3RYFA 4I50B 1XVTA 3FN4A 4NZZA 3ZI4A 4GGMX 2HC9A 4EG3A 2X7HA 3BE6A 3FTNA 5BOSA 1T24A 4MVJF 4F3CA 2Q8QA 1TM1E 3WRYC 1HI9A 4QDOA 1V2HE 4QATA 1IPHA 5G4LA 1ZGJA 3WP0A 4R2KA 5KWIA 1P60A 4K05A 1YRYE 3MAJA 5DHAA 5JEEA 5BSEA 4KQHA 1A71A 3NTUA 3H0EA 3G5LA 3LP8A 4LE1A 3H5IA 2JIRA 3TDKA 1ZONA 4FFLA 5CX4A 2OV1A 4EGQA 2JKZA 2PGXA 1ZUD1 3WAJA 4TXLA 4R2HA 1ID8A 4ZVNA 2FGKA 4LN1A 2B8NA 2XQGA 2JK0A 3W6NA 3LK6A 2E85A 3CKMA 1YQGA 3DOJA 1PR0A 3W9BA 4DABA 1E4EA 1IU9A 1SG0A 4HDSA 4ILKA 4I5FA 1AQUA 3G9ZA 2E4YA 4M89A 2XRYA 1NUSA 1X42A 2I6GA 3NOQA 3OHSX 2A58A 3QVUA 4FN4A 4OXRA 1PYGA 2Y6VA 1YAJA 1OU4A 4AG5A 2ODPA 4BMVA 3AFNA 4F56A 5F2EA 4AF8A 3JW8A 4MMYB 4ZQGA 3DPIA 1NULA 4NG4A 5EJMA 1RHKA 2K6GA 2IOHA 1GTG1 4CL3A 2A0KA 2ONKA 1KYTA 1XWWA 3TCKA 1E5XA 3FSEA 1AY0A 4HFRA 4PQRA 1YHYA 5JE8A 3QP9A 3G7NA 3DLTA 4MUHA 3COYA 1PVOA 3NTVA 4RPIA 3BAFA 4Y2PA 1KJ9A 2C3MA 4X61A 1C1XA 3OSZA 5FYDA 4B2IA 2CL6X 1Q77A 4XQCA 5KBYA 1WDTA 3M6UA 5AKGA 4Z4IA 5DM4A 2R1UA 1OPXA 4Z4EA 2REXB 2E0IA 3UOAB 1GHTA 2HX1A 3FTPA 2ZBQA 1EJ2A 3PCXA 2NO6A 1T9GS 4L4SA 5B5SA 4TL8A 4R31A 2Q49A 1GGMA 1HFWA 1GUYA 4LYAA 1QOQB 1ZNZA 3ONWA 5B58C 4CMAA 3RW9A 2P65A 1DRJA 2AJDA 3NDJA 2JJ2A 1LEHA 1P0FA 2I65A 1BE6A 2BEJA 3E3OA 3C8MA 4OXIA 4BVJA 4F8EA 4MWEA 4XVUA 5CFMA 1YL5A 5M2QA 2C9BA 3OETA 5K5EA 1ZVKA 2I80A 4IOLA 2O2ZA 4B4VA 1YZVA 1F14A 3IV7A 1LDNA 1P91A 3IVMA 4WAUA 3NBZC 3EFHA 4DFDA 3TUZC 4JDPA 3L0IB 5KOYA 1ZW1A 4UXHA 4MQBA 3EG5A 3M3DA 8AT1A 5F98A 4P9NA 5IX8A 4KOAA 1EVEA 3HB7A 4ETIA 1K5DA 2JFVA 3CF4A 4RY8A 4M9CA 3QEAZ 4Q1FA 1LDYA 3ROXA 4P0QB 3GNTA 4YJHA 1USIA 1G59A 5KMGA 1ETHA 5IDVA 1WQ1R 3FWHA 2C7QA 2QTLA 4FLFA 2IODA 2Q1YA 2WJWA 5C1BA 2JD1A 2WILA 3BF8A 5C1DA 5IEJA 3U1VA 1EZZA 1K7YA 3LT2A 4KXVA 4LW8A 2AN4A 2FLVA 1KO8A 2WT9A 2HPZA 1MLDA 1PFWA 4WHMA 3X1KA 2JLWA 5JWOA 1BMFA 3MCWA 2HKIA 2YXNA 3HCDA 2TMKA 1JFFB 3H11B 3SHFA 1PJTA 1GT91 4NZ9A 3TZQA 1SKYB 1XAGA 4H15A 4BNGA 5IYZB 3GWZA 2J67A 1RCFA 1GM5A 2BBOA 4TMXA 5FA6A 3S2GA 4A6EA 3N8IA 5KNBD 2DE0X 1O58A 1UJ5A 4UTRA 2C2YA 3SIXA 3RUPA 3FHJA 3L04A 3TIFA 4I1RA 1XDZA 4ZV7A 3GFFA 2H29A 2X15A 3EZXA 3S3TA 4G84A 1LNSA 4MW4A 4DCPA 4LCBA 3KLMX 1TM3E 3ROKA 4EA6A 1QLWA 1JEQB 2VH1A 3RK1A 3U4AA 3GFOA 1W73A 2B8JA 1IB6A 2DM6A 3AETA 4C5AA 1ZGZA 1ADCA 4ZWNA 4IUYA 1M2NA 1LGYA 2JRCA 5CA0A 1V41E 4UFNA 2HCBA 4N7RA 4PY2A 1V9CA 1CR0A 1WCIB 2P5TB 2AL7A 3VVCA 2ZRGA 4YCAA 2ZYGA 5I7AA 1UADA 1D09A 2FEWB 2LRHA 4DMGA 2V8OA 3DLPX 1E9SA 1WDMA 2WUGA 1KK0A 2VDOB 1YDMA 3KTOA 2AFHB 2EDCA 1GL9B 4GP7A 4BE4A 3D8BA 5COQA 4OXQA 3UJBA 3ABOB 5CB4B 1KJQA 5E0KB 2ZRJA 2MOKA 5JW6A 4LRUA 1SD2A 5I5EA 1JFFA 3WLLA 2ZYHA 2I62A 2X0FA 2WMOB 4HDQB 3PNKA 1L4KA 1LX6A 2PSDA 1IM8A 2P8JA 1WPGA 4B8ZA 2R6FA 2AWNA 4MPDA 3G7SA 2X8JA 2HJSA 3T9AA 3THOA 2FK7A 4LE2A 2XSZA 3K1ZA 2YC4C 4PR0A 4QXQA 2HSZA 1X1CA 1Q7RA 2BZ0A 4AYWA 1C1XB 5E1BA 2WD9A 7REQA 1VKJA 3WDMA 4OG2A 3TZHA 3PQDA 3V1MA 4MW0A 5EQFA 2Q3DA 1SXHA 4HWRA 3GIWA 4B4UA 3B12A 4BO3A 1H85A 1Q1ZA 3OZBA 4ZIRB 1LBSA 2C42A 2GXAA 2PMWB 1MORA 4JQZA 3T4EA 3T4XA 4XZ3A 2VJYA 2D1QA 3EN0A 2R44A 4DPMA 1UXHA 4ZPXA 5ADHA 5FBZA 1OFTA 2J32A 1E3MA 4EKNB 3AJDA 3N2KA 3GD7A 4R1MA 4RV9A 2YVLA 1VLLA 3CHYA 5HOEA 1DWOA 2CMDA 3SOZA 1AHHA 1L1RA 3WB2A 1SQSA 1GTRA 1I1QB 1XZKA 3SKXA 2G07A 4FR2A 4ID9A 4D9NA 5AESA 1E7SA 1YA4A 2GRJA 2PD3A 1QG2A 3ES9A 3T9BA 3D64A 1WW8A 1NC3A 1SG6A 2C5EA 4M0LA 5C7IO 4TKMA 4M86A 3FDIA 1PJRA 2YJ4A 2JDIA 5G53C 2KLHA 4NMMA 2P1DA 1M1NA 2EATA 3FYHA 3HN7A 3KYCB 4WKPA 4EI7A 2Z8YM 3SF8B 3WKCA 3GEBA 5LMZA 1E60A 1Z6XA 4XPIB 1NXOA 5LQJA 1K7SN 1CY7A 3L5KA 4M6WA 5KUTA 4PLYA 5A1JA 4QM6A 4A82A 2WTXA 3VKHA 5DKFA 3FMPB 3RUIA 2SHKA 2NV6A 3GA0A 2B0CA 1ZIDA 1N3LA 2ODQA 2C96A 2MHCA 1X77A 1M7BA 2QZPA 1E9VA 1ZZEA 1LFAA 3C3BA 1DEAA 3IMEA 5G1PA 5C51B 1J1UA 2QIPA 5BN5B 2FNAA 2AK2A 2SKDA 4X20B 1BO6A 2B9VA 4OFWA 5DYTA 4HTFB 1Y1SA 4E14A 3PNYA 4HI0E 1KEUA 2CK3A 2ZYUX 3ZU4A 1VRWA 1NZJA 2VP2A 3I5YA 4DA0A 2VYVA 3JVVA 4R9VA 1Q7EA 2JVIA 3ORSA 3E82A 4C7OA 2D2XA 4ER5A 4UD6A 3R9IA 4ZHQB 3HO1A 4HX2A 2XNKA 3BB3A 4G0NA 1R0CA 1QF6A 3DT8A 1RYMA 4QEDA 1AV6A 3U4MA 5I9BA 3Q8WA 2VHYA 4IJUA 1JEDA 5IAKA 1IZYA 3EVCA 4X1IA 3ME5A 1NXSA 1X6VA 5JY1A 2ZM5A 2OOSA 3KQNA 3E6AA 4W5NA 3PNSA 3EXEB 4I4NA 3A1CA 3NHFA 1ACMA 3DZDA 3LCVB 1KYXA 3DMGA 4O4LF 4C7XA 1D6NA 5L6MB 1BVUA 1GG5A 3ESQA 5SZHB 1MG0A 2FTKE 2CVOA 4RYDA 3L02A 4TTQA 1JEOA 4RQAA 4J16C 1TMKA 3NASA 2WDPA 2EU8A 2OBMA 2YC2C 3I8OA 5JD4A 4GZ6A 4ZJYA 2CL5A 1MRNA 1P1FA 1QFSA 2GAAA 2WD8A 1Q6ZA 3VO9A 5EZ5A 3RAEC 1DAKA 4LFAB 5K3BA 2PCLA 3GRFA 5DSTA 3WDKA 1P3Y1 3RSQA 3SBXA 3VKGA 2BMDA 1HTWA 2WU1A 2X0KA 4DCNA 2Q2OA 3B1WA 1EVKA 2JCSA 2R00C 1M0WA 2Y1XA 3BSWA 3QVLA 1U7TA 3JSAA 4RD6A 1NMEA 1MABB 5D6NA 1AB6A 4X20A 1GPWB 3F8TA 5G1OA 4ZZIA 5KKNB 1E2IA 3V8MA 4CQMA 4RK6A 1R50A 2A30A 3C6XA 3OVMA 3RGGA 1CUFA 1ZW6A 2YFHA 1C41A 4DCCA 5HOQA 2BHSA 3HJAA 5KWJA 1U90A 3MGKA 1P4AA 2VHZA 4JU9A 1KJNA 3UK0A 8GPBA 4A36A 1GPNA 3BZWA 3PEUA 2JFXA 1CJKC 1DCMA 3KC2A 5L3QA 3R7LA 1P9OA 3RF6A 3T5DA 4IHJF 4LXGA 4RZ2A 3AK4A 4Q9JA 2X7JA 1J00A 3T1QA 4URWR 3ODPA 3PCTA 4P7JA 4PQYA 1VLQA 3SMVA 3U7IA 2GTIA 2R65A 3IOCA 4F38A 4IEEA 3K0AB 4BXOA 3DH0A 1TIKA 3A04A 3PGXA 2P9BA 4PRYA 3F6EX 3WG9A 4NECA 4BVFA 4ZQFA 4HWSA 5IZCC 1B0PA 2IP4A 4EIWA 2I3GA 3ODGA 4IXTA 1D5CA 3E3MA 5HIJA 3H97A 2Y05A 5K3OA 2PPVA 5EIFA 2W90A 1KZ1A 3KCQA 3RHZA 4B82A 3DC7A 1XMOB 1HDZA 1RAIA 4FOOA 5K8LA 3QI2A 1VM6A 5JJIA 2PX8A 3AERA 4G1MB 1QFMA 4BU0A 2OXIA 4ARAA 1ZD2P 4BV2A 4CF4A 2AC4A 5GPBA 2ZSIA 5T7BA 4JXXA 3MMPA 4ZHQF 4F4HA 3LY5A 4ZC8A 2A6PA 2H1HA 2YIJA 5PGMA 1C9KA 3B52X 4ZVRA 4O2AB 1Q0RA 1U3VA 3IURA 2HCJB 3P2IA 4AJIA 5LP6F 2MDTA 4UU7A 3CMCO 1VFNA 5F7JA 4AJ4A 3WA7A 1KE1A 5KTMA 2V5AA 1GU1A 2XTNA 10MHA 1ULHA 4X41A 5M29A 4IAOA 1Q11A 4QVIA 4PVCA 1VSTA 1AQYA 1V0JA 2BFBB 3EASA 1LPOA 1E79A 2VT3A 3NB0A 4ONEA 4J0CA 4QEZA 6AT1A 2PZFA 3KBBA 3HY3A 5K0ZA 3A37A 1NFFA 1ZISA 3MVEA 3UIEA 1TYZA 3PE3A 5TGZA 1GNVA 1ZX1A 1G8GA 2F3SA 4ZN6A 1KO4A 2H2GA 3I1JA 4UUOA 1HSOA 1SHLA 2B4RO 2ECOA 1UXJA 2Z2ZA 3PUXA 3JTEA 1M34E 2EEZA 2OBXA 4INAA 4F5YA 5C7YA 1A4IA 2H0QA 1W49A 4J1TC 5CYPA 2XQIA 2IYUA 2Y1GA 4JI8B 5ALVA 4F04A 3CNHA 2CXTA 3CVUA 3DAFA 3VHRA 2FOIA 3H3JA 4W6QA 3X0DA 3G0HA 4JI5B 4EHNA 4EG6A 1AMUA 2W6CX 1CUYA 1TKRA 2GWHA 1JSCA 2XXJA 3R24A 2Y66A 4LHYA 3IQZA 3B51X 1A96A 2IHUA 4AYXA 2ZBEA 4RHYA 2M6KA 1FSGA 4WLNA 2Z2JA 3U7JA 1SVIA 1PZHA 2CDAA 2H1RA 1PHPA 2OK8A 4I5DA 4J9UE 4PYQA 4I19A 4ND6A 4QNRA 2ZOSA 3DAGA 5FB3A 1Z9BA 2P5YA 4FQ8A 2HF7A 1QYIA 2ZTLA 3KO8A 4LS3A 2BGLA 4YJ3B 3V32A 2IF0A 4EUSA 2RIPA 2WG0A 1J2EA 3GHYA 3CC8A 3DE1X 5D00A 4CMKA 3T1TA 1QK4A 1V6CA 2P1ZA 2NO4A 2IH2A 1HL7A 2IEGA 1P7VA 4O2LA 5DB4A 2CXOA 2XJ4A 3EF3A 2FW1A 3HYRA 4WKCA 2ID9A 2O8BA 4GPTA 1DKNA 1M66A 1LS6A 1JG2A 1LD3A 1X1TA 2GZSA 4S0ZA 1DQNA 3V48A 1NBHA 1UXIA 2FYTA 3VDRA 4QPPA 2IKSA 3E9MA 3ED1A 3NC0C 3U40A 3GPIA 1BSVA 3ZJUA 1ZLYA 3BERA 2EBUA 3ICWA 4FCWA 1B23P 4IXMA 2F90A 3R3HA 4HDRB 4DVJA 3LQ1A 4TWAA 4CYMA 3JQAB 3ZZNA 1G7SA 4EI2A 2C1ZA 2B25A 2YFYA 5E8RA 4ARVA 5C2JB 5CFRA 4D0SA 2AYXA 3MUOA 2AWOA 5MN5A 1GSAA 3HBLA 1IY0A 2XA9A 2XZOA 5AKKA 2VJLA 1R6UA 4TTAA 3TRKA 1BDIA 1UBKS 1DO0A 4DDKA 2FSGA 4DBLC 5HVNA 4L1KA 2OY0A 3D8UA 1K4KA 1ZGCA 3KWFA 3BTOA 4OJNA 3TUJC 4EB6B 4WOKA 4CW7A 2IV3A 1IVYA 4YPOA 4CKBA 1ZUNA 5JXGA 4K9DA 1OXVA 3QY9A 2R3SA 4FVTA 4LQDA 5GM1A 4C0KA 1Y8ZA 4IIUA 2HMAA 1Z5UA 1R5JA 2BE7A 2ZYDA 1A7KA 4RF2A 1PJLA 4QPDA 2ZXEA 3IHTA 3QNUA 4KO8A 1KJ8A 5A6SB 3SNHA 1C3VA 3OUUA 1XRJA 3HB5X 3IIMA 2EL7A 3LC1O 1KF0A 4J0KA 1KBQA 5ECYA 1P1RA 2XYRA 4GBJA 1W2HA 2JHCA 1A97A 3T6KA 1C9DB 2R48A 3OIDA 4A23A 2WFLA 4X62B 1EFRA 4JL5A 4QU0A 5FUXA 4AN0A 2Y9PB 1J24A 2HCTA 3NUGA 1XOIA 2HO4A 1X1DA 2NVBA 3JQ8B 3ZCSA 4TRJA 2GCOB 1TCBA 4Y0VA 3ZGXA 3M1AA 4F8YA 3H4VA 1OLOA 4WCFC 4B8YA 3G1UA 1P39A 2WWRA 2QQGA 2O4CA 2V96A 1E77A 4C87A 5HCIA 1YH3A 3NWEA 1L8XA 2GF0A 5IDXA 1Q74A 5EJFA 4GO1A 1VE6A 3C8ZA 4O33A 4F86A 3FCYA 1U8CB 2ZJ7A 1UK7A 1DIAA 3RGWS 2AIRA 2VUIB 3BEDA 3F7NA 3L07A 4QYWA 4YDRA 4BVKA 3QBEA 5JH7F 3N53A 5IU6A 5ALMA 4MUXA 3SJCA 4G0ZA 3PA6A 5DN6D 1R8SA 1E9AA 3EXFB 3IOYA 2OD9A 4G8BA 3ENKA 4PYLA 4MS3B 1RI3A 4XGQA 3D2BA 3GNQA 2DB3A 1EP1B 2ATIA 2GZDA 4DHEA 4QGSA 2O8CB 4AG3A 3LO5A 3WK4A 3I2KA 3LBHA 4HDKA 3S99A 1Z06A 5LLTA 2MSKA 5LQSA 4KODA 2KB0A 2EWWA 2UYYA 4MLZA 3NXSA 4NBTA 4BPBA 1RKUA 1DDIA 3I45A 4FSXA 4KIJA 3X1DA 4YUZA 2D4AA 4DMRA 1M83A 3DL2A 4L28A 1SN7A 1JE1A 4XDYA 3LXUX 4ZKEA 3ZDRA 5KOJB 1C8KA 1N1MA 2XUHA 1QE0A 4L51A 1T4BA 1PJ2A 4HGZA 5LU8A 1E66A 1UFKA 2FQ1A 4IH4A 1AGNA 1T6YA 4RGVA 1EUDB 3G89A 1Z6QA 3PBKA 4MYDA 5JAMA 1UJBA 1NNEA 4M9RA 4JBGA 3F73A 4DLTA 3ZV4A 2ANBA 4QZVA 3HHPA 4WZ6A 4ZQCB 4G8DA 2P9YA 4AKSA 2FR0A 1P2FA 3H18A 1VL6A 3GH1A 1P62B 1TUBB 1DC7A 1PL0A 1UEXC 4KO1S 4JQOA 4ZEXA 4BNJA 2CSXA 3UOWA 1JEEA 2WJAA 1GKLA 1FU8A 3R3VA 4QDUA 4YACA 4Z9FA 3LHSA 2V6FA 3I9FA 3NEJA 3AM1A 1MOZA 1OLSA 4YJDA 2GVNA 2HV8A 1XRLA 4AJHA 4C07A 5EMKA 5EA2A 2JK1A 2A5JA 2GD6A 3BA6A 3DKPA 2JAQA 4RKYA 4Y2RA 5TLSA 3DDCA 3ABIA 5ADUS 1KGDA 4UU0A 4MDEA 3W9UA 1PL8A 5ITWA 3VTZA 2BFNA 1BQEA 2DWOA 2XKJE 4KJZA 2W6ID 4DQ0A 3AVTA 1U2QA 4XTCS 1ESMA 1RD4A 4QQKA 3LBAA 1K6MA 2RBKA 3H5VA 1JH9A 1HXHA 3DHEA 2AJ8A 1UKBA 1NJSA 1DB3A 1AK1A 1OT3A 1MN6A 1U9IC 3QBJA 4P4NA 4FMPA 5IC4A 1PP4A 3H8SA 2V9PA 1REQA 1YI8A 2P9FA 3WV5A 4KDRA 5B57C 3PSHA 4HBGA 2IC5A 1GNRA 2A0UA 5C35A 2VUHB 3T52A 3CLUC 4F8JA 1VG0B 4MCJA 3GELA 3N6XA 5IDYA 4ISBA 1D4AA 5J23A 3CSUA 1UBSB 1WXFA 1DUSA 1ZUNB 4WEQA 5ESDA 4C78A 3LXRA 1HX7A 4QLAA 1W9HA 1YUMA 1GUBA 3ISJA 2IV7A 3CKKA 3L92A 2AVDA 1SK8A 1TECE 4DSZA 4HAVA 3RWOA 3YASA 3M6XA 1PNOA 2I2WA 4OQ4A 2ZAIA 3KYJB 1L7AA 3SYLA 4DF3A 4F1KA 3LL7A 1ZKDA 2BTQA 2FMKA 5B3JC 2ZPAA 5L9AA 1TJPB 2HA4A 3B5IA 4YJ2F 1VHDA 3F4LA 3R5TA 3TXXA 4BN5A 5LLDA 1QHIA 4PZYA 5BRAA 5EWJA 5THQA 2YRFA 4MUNA 3CN9A 1QOPB 2B21A 1RJFA 4X7MA 1Z6YA 4B09A 4C2TA 1E99A 2ADOA 2GN9A 2YMQA 4DBZA 3IEXA 2R7LA 3Q7QA 1B43A 1IHPA 4KLZA 5F12A 4C20A 2DG2A 1P3JA 1ORHA 5B53A 1OFGA 3VZCA 1VLJA 3K1TA 3ZIUA 1TTTA 5T4FA 1NPTO 5C34B 3ZQ4A 1OHHD 1P9NA 4H4CA 1T8SA 2JGJA 2ZANA 1JKXA 1U9CA 3U3ZA 4M7RA 4C4AA 5T57A 2D3TA 4HUQA 4EYQA 1KVSA 2LPMA 4NZMA 5AJXA 2ZTMA 4UQPA 3V2IA 3L7CA 5KEIA 2XCSB 1XVVA 5CDFE 2PZJA 2JAXA 4B17A 3ZXSA 4IJ5A 4BPRA 1R4AA 2D0OB 5AJUA 3FPJA 1FP6A 3A9WA 4B7AA 4MPPA 3GRPA 3HNOA 3A06A 1JHUA 1OUMA 4EO7A 2N46A 3OCYA 3F2IA 4IBOA 3H2JA 3D02A 1BN6A 1ZJYA 1WMAA 3PGA1 4KKXB 2GF9A 2XWPA 1ORRA 2CJWB 3I5MA 3IP5A 2ZSBA 4TSKA 1UXGA 2CK3D 1T9AA 3ANSA 3LPLA 5JLJA 1PWXA 1ND6A 3ZE8A 5ENZA 2CC2A 3ANYB 3N0XA 1DNPA 1M74A 1ZVQA 4HFNA 4D99A 5A3QA 4ZO9A 5HJ7A 5JQGA 4L4ZA 4C5BA 4H4EA 5DVZA 4M0FA 4WFJA 5IVPA 3H1PA 3TS1A 5F9FA 1V3UA 4ENWA 1YC2A 5G4KB 1TE2A 1XVAA 4Q9DA 2DZDA 1O95A 3HXMA 3FJ1A 3CKYA 1E59A 3EBLA 1U5AA 2ZKLA 3ILVA 2PJRA 4DIUA 3GV0A 2J5XA 1TUBA 4JYZA 2I87A 2WHEA 2IHKA 3EGDA 5AK6A 2ZPTX 3SP1A 4HDMB 4ZCIA 1MFZA 1RAHA 1OWPA 2R5WA 1IOLA 3P9IA 1ZRHA 2RJOA 2G80A 3L7OA 3CSSA 4LXTA 3QYFA 3EF0A 1QMGA 1V16B 4G63A 1EI9A 4WLUA 3HPRA 2JDID 2YINC 1QIHA 3W05A 2O48X 4DC1A 2G1PA 2XXBA 2ISCA 3DDNA 2VJMA 1YE8A 1J0CA 3KP1A 3RFCA 1FFEA 2WTEA 3LX8A 4HBZA 4EB6A 1JYEA 3CR7A 3HJRA 1USWA 2FV8A 4Z2YA 4AQYB 3CU5A 2FR8A 1D1SA 3KUXA 3F49S 4MV1A 4M7WA 1K63A 3UV7A 3TR0A 1E89A 2GDJA 1B8OA 4O2RA 1L5QA 4KNVA 2CEAA 5DLQC 4F85A 1I3LA 2VOEA 3BVPA 1E4YA 1N8KA 2Z9CA 1W44A 4J2TA 3L8FA 4L4RA 4QOEA 3DD5A 2AFIB 1XD2A 2PJZA 4B31A 4RJTA 4A2QA 1W88B 2QY6A 2WAMA 4EVRA 2Y1WA 1V39A 2JFBA 3RSOA 2AXNA 3O0DA 5DISB 3PJGA 4BQEA 3E9ZA 3ZZTA 1PKXA 4GM0A 3U9LA 4PLTA 3B6MA 3HH8A 3C85A 1HE5A 1SXPA 5HZGA 3M89A 3D3QA 4I14A 3JZIA 2GERA 3FOWA 1E9CA 3VDQA 4FJ0A 1CJUC 1QIFA 3CA8A 4C3ZA 4XQGA 4FHGA 3VVMA 3AY7A 1JLHA 4DOMA 2DUJA 5F52A 4CIYA 2R6JA 1NOKA 1TUEA 1L4EA 3A6DA 4ZQEA 2JF0A 1B1AA 4CV1A 4CQLA 2R85A 3E0QA 3SM3A 3SXPA 1UBMS 4UNRA 5K0NA 5JYCA 2I2CA 1RRGA 1TYCA 2JJ1D 4Q4AA 4XDGA 1N5JA 2NZUG 2O6LA 1BWPA 2XNHA 4Y0NA 5DLDA 5BQOA 6Q21A 1HNWB 1SMKA 4IF4A 1MB9A 5ER9A 1MX5A 1H8HA 1W4RA 3LUGA 2GKSA 1KH1A 1E32A 3QIVA 4KO2S 1SUCA 4J0FA 5B7NA 2Z6UA 2W22A 3TTWA 4J94A 3ETDA 3DL4A 3SYNA 2VQSA 5CG1A 4WI1A 1N2XA 3TLKA 2AJTA 3E70C 1EUDA 3H2IA 2GLUA 2JD2A 3EISA 1ZWKA 2YQZA 4ZOEA 3L7MA 2XT9A 1F51E 4K0KB 4V0KA 4OD0A 1B4DA 3DB1A 3D0KA 2CE7A 4QFMA 3P2YA 3K0FB 3IAAA 2PFSA 4QL3A 2WC1A 3KETA 3TW8B 5T4EA 4P82A 3KJQA 2Q1WA 1U3CA 3OZFA 1RWQA 4GP9A 2XUQA 1QQ5A 2XV1A 2D2EA 4J0JA 3RTGA 1X9GA 5KQSA 2C2BA 2WSBA 2RJNA 2C4NA 4U7WA 3HNPA 3RJ5A 3HFJA 2QPTA 1JJVA 3N3BC 4LXIA 1TTPB 3TRIA 3KT8A 2QMHA 2AMJA 5CTAA 3KQMA 4B3CA 4C04A 1PEKE 4MVJD 4ISCA 1V4VA 1KR2A 3FM9A 2J9XB 1A5SB 1WW2A 4GSLA 3K1YA 3ND6A 2RGBA 3DAOA 5GV8A 1Y80A 1ZHHA 4Y2VA 1C30A 1OWMA 1XD8A 3HACA 2ZVJA 4UULA 3UJ8A 1FFYA 1FP1D 5CB4A 2FWIA 4P92A 3OX1A 1IXRC 2C3YA 4L9RA 3A1VA 5IMSA 1JWBB 5K99A 3COWA 1AC5A 3KQOA 4UEWA 1NRWA 1SXGA 2IOFK 4P33A 3RR2A 3VC2A 1Z5GA 1YBVA 2VHEA 3L2OB 3NKVA 1P3DA 3JQRA 1R88A 2DUNA 1KIFA 1M10A 4R40A 3KYDA 1THTA 4JT2A 3SS9X 4BNNA 2BMJA 4PC2A 1L8AA 1DEOA 3K32A 4WN3A 3HL0A 4OEHA 2HYIC 4OLAA 1AURA 2CHFA 1AD2A 2VQ6A 4HDNB 3USES 3ZBTA 1JR3D 2EKBA 3NEPX 4RIHA 3TBHA 2V98A 3UUWA 4LJ6A 4XIFA 2GM5A 1E2QA 3P2MA 1Z18A 3BGWA 4TLEA 3PEYA 2VEDA 5L53A 1IAQA 2YWJA 1T5DX 1XRSB 3RBVA 1V5FA 1CQJA 2PAAA 3CT4A 4KNWA 1N1GA 3AY3A 3STYA 5TR9A 1YE3A 3BHMA 2AOTA 1B15A 3BCHA 3WA6A 1C1HA 1JMVA 2Z8YA 3FDZA 2B1RA 1C0IA 4BQQA 2CHEA 4BWVA 1T2FA 4RSGA 3GUHA 1QUEA 5KJFA 5DX8A 4MQMA 2VSNA 5BSWA 1C30B 1US8B 3A2KA 5K2MA 5SZKB 3RB8A 3U3KA 4C7BA 1YJXA 2WMDA 3AEYA 5F33A 4EW1A 1A9XB 5BNWA 1HY3A 3GLTA 3GJYA 3P2EA 1IN6A 1AUQA 2ORED 2IU4A 4M8NE 4NJOA 3TTUA 1GRVA 3DFKA 3F3MA 2V0NA 3NM6B 5DH9A 2HL6A 3A05A 3KJIA 3KPUA 2BONA 5AUNB 5J40A 2WQ6A 1RQLA 1DGQA 3KYCA 1G7CA 1MHTA 1EK6A 4ARIA 2WT8A 3J81A 3GUZA 3LKVA 3WGVA 4R6WA 2AR7A 2HMUA 2OQIA 2XT0A 3MRSA 1K6XA 3DEHA 3MTBA 3WTCA 4MHOA 3G8DA 4WH0A 1QO0D 5AHKA 1NV9A 4KQEA 4I9GA 4Q7MB 4KQ1A 5DYNA 3DD1A 1MRZA 3FSJX 4FR5A 2WFLB 4V0LA 2X6TA 4QICA 1FIUA 4K9SA 4ZCTA 1RE1A 4E1BA 1SOMA 1BHSA 2FWNA 4FYJA 4WNIA 4CTMA 2BFDA 1B6GA 1M1YE 3AC0A 4X0EA 1IJBA 1RW4A 4Y2JA 1Z2NX 5EMNA 1X7XA 1OZ0A 4PAWA 4G07A 2ZJOA 3K0FA 1RWWA 2C31A 2WYWA 2HJVA 4TUYF 2B69A 4O0LA 1XPJA 2BBSA 1MZPA 2VTEA 2EWMA 4RMHA 1ZBDA 1FLNA 4G23A 4LQCA 4AZ0B 1AXRA 4ZTBA 4EJ0A 1MQ9A 3ZWAA 3TCXB 1PGNA 3I76A 2OBBA 1JZQA 2ATEA 3IAS1 1JV2B 1VE3A 1ISJA 2VHVA 3HYNA 4YJGA 1TA0A 1NLUA 1V95A 2J9RA 5FBWB 2WEKA 4EAQA 5D85A 2OCGA 4BO0A 5JCZA 1ZK1A 3LUKA 1GNTA 4AAYA 3PDJA 4DL9A 4E5KA 3KT3A 2QUKA 2ZQZA 4NV1A 1V43A 3DLCA 4R41A 4HQNA 5EE1A 4D9FA 2Y6UA 5DM60 3K5WA 4B8WA 2D7DA 1Y5IA 2NQ8A 3TD2A 4Z7NB 1XF9A 1E58A 1FDRA 1YVRA 4A03A 4OJMX 3EJWA 4I8XA 5IVDA 1Z8FA 4JELA 4NFHA 5KSPA 1ZK2A 3KFXA 1IJEA 1SJ9A 3E7WA 1A88A 1BHQ1 2ZQ5A 1YZTA 2B1JA 2ZPUA 3GGCA 1F60A 2GPSA 3ETLA 4PO1A 4UVGA 2WJZB 4UNPA 4Y6QA 3OX4A 5BN4A 4ICIA 5EXSA 5B1YA 4QG3A 3FOEC 4TROA 2Q4EA 2TMGA 2ZS9A 2VNSA 4TS9A 4NFSA 4EJMA 3C4QA 5ALHA 4UBNA 2AA3A 3IP1A 5D87A 3OI7A 1I1HA 5JY6A 2V58A 4X91A 1MH1A 2BISA 2EBHX 4I1OA 2F8LA 4R16A 3VU9A 1GSIA 4HD8A 3P9QA 3Q12A 5F1KA 1FFGA 4CEHB 2BGRA 1WCV1 2X4GA 4Q4LA 1K4YA 1ODFA 4DM7A 3NDBB 2HQOA 3AZQA 3IAXA 1VPDA 2PKCA 3VZQA 3CVVA 1A8UA 5K0BA 3T5CA 4N40A 2ZBVA 1OC4A 1PT5A 2VEOA 3BWVA 3MTAA 2BTOA 1YDGA 2FZCA 3BK1A 3C0KA 1INLA 2IVZA 3GFPA 4M1OA 2I22A 2VBGA 1YU9A 4C9BA 4PS1A 2WAOA 3HN2A 4QXOA 4L85A 4HLQB 3SLKA 2PX3A 1ODLA 2V3WA 3IPAA 2JG3A 1MTZA 3GY0A 1EE2A 1AKUA 2A9PA 2HGSA 4RZHA 3VC1A 3CBGA 1I4TD 4HATA 1HPLA 3U13A 3A9CA 3F97A 3NDIA 2YYYA 2BKEA 4HDCA 5ALSA 3SD7A 5IKXA 4DR2B 5CB0A 1OX4B 1J06A 1TMGE 5L95A 2IK8A 1GIAA 2PUHA 4O2AA 1JILA 5DO9A 3QXXA 3X44A 4IP0A 4DLVA 1QO0A 2YOHA 4UCQA 4BO6A 3UYKA 5TC4A 3TIGA 5T4HA 1WMDA 2WSIA 3KKOA 3O8OA 3TSYA 1FJ2A 2UV8A 4FGKA 4BTEA 3IUYA 4JOQA 2IU0A 3UTDA 4LJRA 1NI5A 5ABPA 1P5JA 3CN7A 3E3LA 1WCWA 3I1FA 1XI2A 4TYWA 2VA9A 1ZQ9A 2G17A 3ET5A 1VBFA 5AD1A 2SKCA 1FB5A 3L7AA 4CM9D 4PFSA 4X1YB 2DR0A 1ZH8A 1RABA 4ZQIA 3KEOA 4QHSA 4BJ3A 3K4PA 1QE3A 2ODBA 1NQOA 3IUEA 3PQEA 2ODEA 1DUIA 3PTZA 3QH4A 2AKEA 3WBJA 3LWNA 3M9XA 5DHSA 3ANLA 3FUCA 2I6UA 2MYUA 3JWPA 3CURA 2NQTA 4F2DA 1AHNA 4P5PA 2JJYA 4LZZA 4UTOA 3F98A 1NVXQ 4KYIB 3IHKA 3TLZA 4GOMD 1E1KA 1ADFA 2GNAA 1Y6RA 1E1YA 3ZOKA 3HN6A 5HQTA 1ODCA 4BX2A 2P4SA 4YJ2A 4H17A 1NPDA 3GMTA 1FX0B 1NMXA 4RH1A 1YF3A 4WESB 1PCXA 2YNMA 1QYCA 3ZLUA 1XCMA 4X7PA 5IG2A 1TQ2A 1GQRA 2CDNA 2YR0A 3D1JA 4I55F 1E4EB 1V1RA 1ISGA 1SXJE 4TKUA 1T3LA 1VL2A 4YFYA 1KI3A 1IZ7A 1Y82A 2GETA 4JYCA 5EJGA 3JVIA 1VSUA 3O3NB 4EMTA 1X7WB 1FYVA 1MC4A 2QUHA 4O0MA 1IQPA 1N3IA 5IASA 1BDHA 1ABFA 3FY4A 3U4DA 4G0UA 4PGGA 4AC9A 2COKA 3DAHA 3WE7A 4EG4A 1UT8A 1C8BA 3KUUA 3HCPA 4YV0A 2H06A 1TVMA 1T3SA 2YWRA 3DL0A 1HNZB 4ZU1X 4DRXB 4X1YA 3RS9A 1QGUA 1UXOA 1CJMA 1CJCA 3K9BA 1C3OB 2R8RA 2Z08A 4RORA 4UHKA 3AINA 4KE7A 4XW2A 2DCMA 1EFHA 4H7PA 1B74A 2I2DA 2X2EA 2PWYA 3GDWA 3H4TA 1HGXA 1G17A 1M2FA 2XYGA 4JVSB 5C0OE 3W4KA 2X2OA 3ZQJA 4KDCA 4DA7A 4FB5A 2YL2A 3EFBA 3IIKA 5GIOE 4IFIA 4JASB 5AI5A 1V3VA 1H5QA 3VHQA 1IBRA 1MDBA 2OAP1 4GR4A 4BGUA 2EV9A 3PIDA 3U09A 1L5RA 2AOTB 1CUJA 1JVNA 3EAFA 2C2ZA 5E4YA 1XD9A 2Z2IA 4LYYA 1EHCA 3RC8A 1KEZA 1LTHR 4TYYA 2Y77A 5KQLA 1G66A 1W46A 4UPEA 2JEZA 3PF8A 3DZCA 3FFBA 4XVHA 4QKQA 3PNPA 3ENVA 1V16A 4FFNA 5J59A 4EGAA 2QM3A 3PUVA 2W83A 2XNSA 5IJAA 4BNDA 1IN8A 3AUKA 2Q2WA 3ABSB 4CLRA 1MV5A 4C6TA 5ISMA 1SWVA 2JGRA 3IO5A 1V4BA 3Q9NA 1ISPA 3GWGA 4AZTA 1O89A 5JMOA 2WKRA 5COAA 4M46A 2I4IA 4MVJE 3FCAA 1UC8A 4IRXA 1I14A 5EUCA 3KQTA 2PBRA 1JHPA 1ZSYA 1S1CA 1W2GA 4GVXA 3WMXA 3LT1A 1VJ5A 1VQ1A 4FDUA 2XB9A 4H0FA 3EIEA 1G8YA 1ID1A 3H1FA 1EFKA 4EJ6A 1XPRA 3R5JA 4MHSA 4J4HA 5KHLB 3OSUA 1EM8B 4R1SA 2BKXA 5IC5A 3SHTA 4DCGA 4EL0A 3K70D 4LJYA 1E63A 2QTHA 1RQRA 2HQSA 3DONA 1WDKA 3ZXXA 5HKKD 1SZPA 2GGSA 1BHO1 1G55A 3ZVNA 5LMCA 1X9HA 2BM0A 3DVLA 2OD7A 3QEMB 9ATCA 3F5QA 5FUMA 1CG6A 2ADMA 1CW2B 2IUEA 2OV2A 3U3JA 2NYUA 1E1QA 1RM0A 2E21A 2CXNA 4HQFA 2QTRA 4ZGBA 1OAOA 1Z83A 5LDDC 1PWZA 4BZPA 1ZVVA 4B71A 4X6UA 3OTIA 4OQLA 1IXSB 5HCNA 5T64A 1NVTA 4FCCA 1Z68A 2FDCA 3QLVA 1QKKA 1VE9A 4P86A 2WU3A 3NBXX 4RLSA 4M88A 4RS3A 2VDQB 3QJGA 4KMSA 1W85B 1GNSA 4PYKA 3BIFA 2R7NA 3E81A 3H9BA 4LVCA 5JC8A 3DBRA 1YZLA 1GYRA 5CB4F 1R4NB 3AJEA 1HDOA 4RTSA 2HWKA 4D1YA 3O8QB 1SK9A 4NCBA 1NZDA 1E2FA 4P35A 4IM7A 2XB8A 5JMWA 1YGPA 4BQOA 2QSYA 2VK8A 1T5OA 1YUBA 2VPPA 1R3DA 4Y7CA 1YS7A 2C2KA 5DGXA 4LNUB 5LXTF 2J0EA 1M6NA 4P53A 4QVGA 1Z0AA 3CF0A 3BIXA 2YZ7A 4FIDA 3DTTA 1F8XA 5TDHA 5EIEA 1A5AB 4Y2HA 2ZJZA 3V8RA 5BVGA 2K2WA 3COZA 3RKRA 1HQYE 3FLAA 3QKRA 3AUTA 5AO9A 4KWIA 5J63A 3TRHA 1D07A 3B20A 4MV5A 4Z0NA 1BN7A 4XYBA 5EJ4A 3OURA 3P5BA 1JVSA 3OFSA 2C84A 2XWSA 5DM70 2ZBUA 1A7AA 2JCVA 1RJDA 2W43A 2FRVA 1GZ6A 2C2HA 2QUIA 2GNPA 3SKYA 4F7WA 3ZW7A 2CXUA 5E4TA 3D1LA 1DMSA 2Q3CA 4E7OA 4C7JA 4EHIA 5CVCA 4EVIA 4QE3A 1LDEA 4BB9A 3DR3A 5AKEA 1MQ8B 2PUBA 2P3QA 2D8AA 3CF2A 1UKZA 4GMKA 3WLTA 3EGOA 3AJ8A 2J3EA 2D5CA 3L8YA 1XNRB 2WFMA 5FPTA 4JBIA 5JD3A 2RHDA 4JL6A 5BY2A 1ANKA 3W5UA 4FZ5A 2QVXX 4HF7A 2HB6A 4XUGB 4B3DA 1L4HA 1J0DA 1GZDA 4KWCA 4OXNA 1YIAA 2CXSA 2OHFA 2W9XA 2F8TA 1JHXA 1YQUA 2GO7A 1Q17A 4OHUA 4CDGA 4LZPA 4KOEC 2X19A 4DUPA 5JVDA 1N2JA 2QNRA 4LZJA 2RHCA 3KKNA 4RA6A 4BVHA 3IO3A 3H65A 4EQ6A 1P9RA 3AEKA 1RRCA 1LCIA 4WFIA 3KQVA 3RC1A 3PX7A 4HH3C 1JQAA 1Z33A 1CETA 3QM1A 1H6AA 3EQ8A 3EXHA 3IB3A 3BRWA 3IDQA 4Q21A 1I32A 2H4WA 4O5AA 5D84A 3HGTA 5IUJC 5GQSA 4PZEA 3ER9A 3PJEA 4D9MA 4KUGA 3VU8A 1AOXA 4YROA 2O5RA 4UHFA 5JS6A 2QI9F 4BEJA 1O96A 2X9QA 4LXXA 1HFKA 2IHBA 3O2NA 5FKJA 4ZZ1A 3SQXA 5FJIA 4Z54A 2IA5A 4BL5A 2QI9C 4DTCA 3DZ8A 4ARUA 4CRWB 1KI8A 1CB7A 2OYSA 2BF4A 4XGNA 2OCXA 2VDWA 1XELA 5GJWC 5L45A 3WLAA 2X3YA 3ZXUB 3FWNA 4DJJA 1U9JA 3GEIA 2WMNB 4X92A 5BMVB 1CVRA 5IVKA 2ZE8A 4UUNA 5C5DA 4AKIA 4KV7A 3BG5A 2CLSA 4KXMA 3IBTA 5TJ9A 1CHDA 4NKRA 4EGJA 2IBSA 4G0QA 3SX2A 1EGVB 2WUWE 4LX0A 1A9XA 2OBNA 1CY2A 4XIGS 5FLKA 3RANA 2WKPA 1T9DA 3DZKA 5HKKA 1ZICA 1NWHA 1OTHA 4PTLA 3SYRA 3TOVA 2AV6A 3AILA 3UMVA 1BFKA 2PV7A 3MS2A 1QKJA 1G2QA 5HGJA 2P3LA 5B6PA 1VHLA 1ZKMA 5HMMA 4FFMA 5A9SB 1O54A 1VIYA 3UJDA 1G64A 1ZSVA 3UH1A 2R68A 3AI7A 3MCAA 2MIIA 1W6RA 4FONA 4GMFA 5ARBA 1TZCA 5IJWA 3CVWA 2VBFA 5JAOA 4D4KA 4RBNA 4YAJA 5BYBA 5JO9A 4BDTA 4RKQA 3TE7A 4FX2A 3FYTA 3SJBA 3UT5B 1D4FA 1JQ3A 2AW3A 3EVTA 3P19A 4H1VA 4JR1A 4OFXA 2KQUA 5JEDA 2DUMA 5JHHB 4TYMA 1T4CA 3X1MA 4BLRA 1S7GA 3NHLA 4RHUA 2C0QA 4LNUA 1C9YA 1QONA 1XZQA 5HSGA 3QX7A 5EJEA 2FEXA 2VL7A 1XMIA 4IHQA 4OVKA 1HDRA 5J2UA 1GZHB 1KQGA 1KEEA 2ECFA 3AIMA 2QRNA 4CGYA 1HEUA 1QHXA 4F3NA 1T5HX 1X7XB 1TO6A 3MAAC 2Q5CA 3DKIA 3O9MA 1Y4SA 3G82C 4CM5A 4JXJA 3H42B 1NQVA 4MGYR 2W2XA 1OY1A 4WACA 4HUTA 1HKHA 5EHIA 3PJRA 1V8PA 3EVNA 3NCTA 3OPVA 3SXJA 3AW8A 3HBMA 2FN7A 2P68A 2XE6A 4PG4A 1PZFA 5LMNB 3MFQA 2C2XA 3BSFA 4M0EA 1VA5A 3CEPB 3EIOA 2B37A 2VQ3A 3H75A 3QUQA 2GESA 3IP3A 4G5OA 1PJ4A 4I46A 4L2IB 1MBZA 1TEHA 1UFVA 3B3GA 4EPRA 3IQXA 2PUTA 4JZKA 4DCSA 3FFTA 2Z4RA 2QVGA 3T15A 1XP8A 4M6WB 2FE1A 3CPJB 2HOQA 3IVRA 5KREA 4JLUA 4KQJA 4PGAA 3DM9B 2PUEA 4RGYA 4WNAB 1QIJA 1DLJA 4JY7A 2QTFA 2O8BB 3GRRA 2Y1CA 3R40A 3FB4A 3PJFA 4GG1A 5DNEA 5I4CA 1Z34A 1BXRA 3OH8A 4MAAA 3RTEA 4PN7A 4JI3B 3OQOA 1GPLA 3RJZA 1ZXLA 1EGHA 1JZSA 1ND5A 1NX9A 1QCYA 2DPLA 2PGLA 1RKQA 2W48A 3B7GA 4N18A 1V3TA 2OZPA 4L9SA 4FC7A 2BFDB 4I1UA 3WL3A 4AWXA 1Z6AA 3IH5A 4M87A 4D98A 1S96A 3COJA 1YOBA 3H2GA 4ER7A 1C3JA 4RMJA 2GFHA 1R3UA 1DBPA 2N0SA 2XVXA 1A95A 1IRXA 4HJRA 1XTKA 3B2NA 3LQQA 5EYPA 3G2LA 1TUIA 2XIQA 1P1BA 1BROA 1RXUA 4I6JA 5K3EA 2VLBA 2PH7A 4TXJA 4NU0A 4RESA 3KJZA 1P4GA 3GEGA 3M3PA 5JZVA 2OL4A 4EW2A 3IRUA 3Q0EA 2WD7A 5ALFA 5C46F 2BOVA 4AJ1A 3EW7A 4YCLA 2K4MA 1CEYA 4DLZA 4UAUA 1TPYA 3ETHA 4PW0A 2P5SA 3FFAA 4Q9HA 2VDWB 4GF5A 2COEA 5CH8A 1L3BA 2BBTA 5TPZD 5EZSA 3H3XA 5FPPA 1AZTA 1VIMA 2NSJA 3GGSA 4QYSA 5FTKA 2K2QB 4TSFA 2XTAA 2VDKB 1SIBE 2HRQA 4UTXA 1BTOA 4A3SA 3OPYA 4RD2A 2F2TA 1NLYA 3EHDA 2PS0A 3K8ZA 4Z2AA 4Q4HB 5AM1A 1FJGB 1QIIA 3TM4A 4NMXB 3B89A 4F92B 3PUYA 3AM5A 4I5IA 4ER0A 3LW8A 1OV6A 1T5LA 3SR0A 5JR3A 3A0RB 1ZRSA 2GUGA 3U7GA 1UOPA 1L1FA 2J08A 1R64A 5HIAA 5I9MA 1QX3A 1TRKA 2IGTA 5LWHA 3B48A 2OCBA 3H6KA 3H9CA 1KI2A 1DOAA 3OE4A 1GFZA 3OLYA 1PR1A 5BW8A 1XVUA 4H4DA 2AX3A 3VU9B 4MWCA 3I04A 3G0OA 2OFWA 2WINI 4LCJA 3DTYA 4DQKA 4WIAA 5BR1A 4IIHA 4TLDA 2FZ5A 4HNAB 4C76A 1NW3A 5JV5A 2YRWA 3QPWA 3AETB 3U4IA 4ZVLA 1GQOA 2OHVA 5B58T 1ZR2A 4MR9A 3R9WA 9LDBA 1YS4A 2P2SA 3HY6A 2QX8A 3ZWDA 2O2EA 4J49A 5JSQA 3EX7C 4ARSA 4ZQBA 3T3GA 2EGGA 3RO7A 4E4YA 2I6TA 5BSKA 4B5LA 1A9OA 3NUZA 1LK7A 3DXFA 3A32A 1NG1A 2O14A 4YRMA 4JGBA 4J3NA 1XWIA 3IVCA 2PZAA 3BC1A 1FNMA 4RHEA 3WB0A 3EQ2A 2XVZA 2Q1UA 1U9YA 1EVLA 2B36A 5GOZA 5HYVA 5KINB 4KAAA 4M1WA 2PJUA 2FW8A 2PSSA 4TKUB 2QUBA 5ALWA 3VR6H 4O4JB 4A0SA 5C5CA 1SBIA 2HHCA 4F2GA 1E2DA 3ACDA 2VUUA 2L82A 4ZAFA 5KQMA 3IAFA 3UM9A 1OBFO 1LW7A 2CBGA 2YHAA 2BSXA 4Q48A 2XXAB 3I2HA 1GCAA 2OBFA 1EZ4A 2BJHA 2IOQA 2BH9A 3N0RA 4LGVA 4BLSA 5IAAA 4ZTZB 3RG8A 1HO3A 1IXYA 2QRQA 5CT4A 3O1JC 3KBOA 4LYFA 1E6EA 4DLKA 4C4YA 4N48A 3FSGD 1CWUA 5A6SA 2WYVA 1I36A 1JZTA 3EMVA 4JEUA 1POWA 4I50A 2W0SA 2P9HA 5FJJA 1RYDA 4B3SB 4EGSA 5GADl 3WLIA 1LJ8A 4K86A 4N49A 4YRSA 3DHYA 1OXSC 1M6HA 2C4TA 2YV1A 4IQGA 2D06A 3JASB 2H3HA 3I0ZA 3IEVA 1WF3A 2BCEA 4IIGA 2Q6KA 4R71A 1RQ7A 1WB6A 1NNUA 3CRQA 2GQ0A 3FYCA 3G8CA 3VHXB 3DBOB 4NBWA 2AUNA 2CNBA 2PX2A 1WEKA 3INYA 3MSXA 2VI5A 4KAJA 4KIFA 3HFSA 4OQQA 2AZXA 1US8A 4UQOA 3L43A 3FCSB 1CEEA 3EA5A 3R7NA 4AJ9A 2RE8A 2HJRA 2V7WA 3MQFA 3EZNA 3OE1A 5GONB 3TBFA 2H1SA 1KY4A 1YRWA 3EAQA 1TO2E 1GGNA 3GD5A 1HYBA 5T41A 3OIWA 1JEJA 2GD0A 4P4GA 1CP2A 5KVVA 1IXZA 5AW4A 4Q82A 1U7WA 4IGFA 1AO3A 3C6QA 1DBVO 4IVRA 4MGEA 1VLZA 3DEFA 1OA1A 4IIVA 3SYKA 4AF6A 4BOYA 2VZEA 2OCAA 3TRDA 3UAOA 2NVOA 5JS8A 4LECA 4Z4GA 4DNOA 1W0KD 2DVMA 3VZSA 3ZY6A 4MGZR 3D8TA 3OQPA 1D6JA 4KG7A 4MUFA 1SU6A 1YMUA 2ZWVA 3AGPA 1RWVA 4URFA 4Y2QA 4BMPB 3K20A 3QVTA 1G21B 3QW2A 1RVDA 1I13A 1N33B 2AQ8A 1BGXT 2F43A 3WLQA 1HK7A 2RHRA 4K9RA 4X1KB 3PWTA 3ZDYB 3UG7A 3O73A 1CJTC 4P7GA 4Y0AA 5ARDA 1NVMB 2Y3IA 3X2SA 3CH4B 2XNCA 3NFYA 3WGKA 5BV7A 1N2CA 3E5RA 2CBXA 2CBZA 5KYYB 3MGCA 1A77A 1GQ2A 1JS1X 4QRDA 1RKXA 4ZYYA 4WSOA 1Z75A 221PA 1JTFA 3MJFA 2KLBA 2FPMA 1DDOA 1BQ3A 4MVJP 3RABA 1E0DA 1GKKA 1M5RA 1OI2A 4PFQA 2IX9A 1WVIA 1IN5A 3RBXA 4L02A 1E8DA 3OG9A 5CVJA 1PLLA 3PNMA 1V8OA 1Q1AA 2FSSA 4OGLA 1JKJB 1NRXA 4A8JA 2NU7B 2OCIA 1RWXA 2O50A 3NXKA 1MNQA 2W98A 3MCZA 1DRKA 5FT9A 1QXSA 3GGDA 3TNJA 5J2TB 2H5EA 5DXFA 4TWBA 5F64A 2DOKA 1KERA 1U0OC 3CMMA 3NKLA 4RJKA 4QEKA 5CNJA 3RREA 1B3RA 2IYVA 3GGJA 2X5KO 2YVQA 2BY4A 1A3CA 4ZODA 3V4ZA 3V7YA 1X38A 1I9GA 1W1WA 4JA0A 4KVFA 1TO1E 4RPHA 1G4UR 3CNOA 3FNFA 4F0JA 1LF5A 4TMKA 2CXXA 5AVSA 4DE5A 1N32B 3RFXA 4RPGA 4DCMA 2Z4TA 3IUQA 3PXDA 4TLLB 2NZXA 3CZ4A 3ENZA 5G0VA 4B6SA 4QOGA 1BW9B 5G4KA 4KBYA 4ZAWA 4CF7A 1QO9A 3AEQB 3LT0A 4IIFA 1GVNB 2AC7A 5DHTA 3ETCA 5JBNA 1XROA 4DEYA 2FFRA 2C2OA 4CM3A 4YUVA 2IDJA 3QXHA 1PFYA 2NTNA 5AW0A 5IJ9B 2B7CA 2YJ6A 2PA0A 3A1UA 4L74A 5CCDA 3VZPA 4F4FA 2OHHA 3MUEA 1Z2PX 4A16A 3J81k 1UBRS 3CNEA 4KE8A 5CAEA 3F4BA 4LV6A 5JAIA 1QMPA 3I6MA 4JJKA 1X2EA 3G2IA 5JQGF 4NQZA 2XOXA 5CLHA 2AX4A 3CJQA 4YPVA 1Q3KA 1P1KA 2W6OA 1JHDA 1R4ZA 3ER6A 3MILA 4X85A 2CEKA 4RK1A 5U1PA 3KJNA 4MV0A 1BMTA 2XQVA 2QP4A 1E1LA 4PO8A 3IBCA 1KFJB 3WGIA 1VPVA 2AG5A 2X9GA 1K8RA 2I5PO 2V7VA 3P71T 3CJRA 1F8UA 3NJ4A 4ND5A 1K88A 2P4HX 2BKLA 4S0XA 1ULZA 4BNVA 1VIVA 2JASA 3D7RA 4JDUA 4NJEB 2R1VB 3CKLA 1LW6E 4PLWA 4AZWA 1JG6A 5CCXA 1GAEO 2H7XA 2O7NA 4TXNA 3U17A 1BJRE 2J45A 3NT5A 2EFJA 2Y8EA 3PNBA 3VPAA 1NLFA 1JFSA 1NE7A 4P54A 1HC7A 1B0ZA 2EHDA 1ZM7A 2Q4RA 2QNBA 1LBTA 4INPA 4RXTA 3C3PA 4XGIA 4LJ7A 5CJJA 2CJXA 3AH8A 4QDZA 1ICEA 1T0HB 1RLMA 1CZNA 3CNQS 4XE5A 5JAZA 1UM9A 3F3YA 4PHHA 5LLSA 1IUOA 2JARA 4CDRA 4DLUA 4FB4A 1S4MA 3LZDA 421PA 1I2DA 2R2GA 1YONA 4JT9A 3REFA 3HJGA 4HDNA 2X0IA 1XTSA 3GPDG 1TEVA 4M36A 4MXDA 4Z8XA 1A9ZA 3Q8KA 2CDBA 4MKFA 4OSEA 2GJSA 4ESVA 1QP0A 4ZAXA 3A6PC 1RU3A 1N1DA 1ZGGA 1CUSA 1ZSNA 4PAGA 4Q3CA 3REQB 4B6FA 3WMEA 4R7TA 2RKWA 5FTLA 2OILA 4KXFB 1Z47A 4MNTA 4PRZA 3T41A 2BLNA 5DCUA 3LFHA 3O91A 4CZ2A 3Q8XB 1XDSA 2JAHA 1XL0A 1XKTA 3SOPA 2BM8A 4IIJB 4L72A 4ZU6X 1JIUA 1KZ6A 4RFLA 4KMOA 4CLXA 2G72A 2OM2A 3EPPA 3PLRA 2X4IA 1PK8A 4LZOA 3SPXA 1NIJA 4QASA 5DI9A 3RAJA 1MOQA 1Z0UA 1HUQA 2AQKA 8MHTA 4E33A 1EWRA 3EGDB 4HPJB 3ZYCA 5CA1F 5IPFA 2NZJA 3DW3X 4F4IA 4RAOA 3UB3A 1Z29A 3DE0X 2CMKA 4B7XA 4AMVA 5IRCD 2HJHA 5CLIA 3TSWA 4D0NA 4ER3A 4F1JA 1JNYA 1I01A 2RHWA 2JCYA 1SNYA 1VL8A 3A0UA 4M49A 5DF1A 4B3IA 4D9KA 3BWYA 1GTVA 4YALA 3I9LA 5GZ3A 3BZBA 2PSFA 4MCIA 2V7PA 2R11A 2IHYA 2YVAA 1C1YA 5IFKA 4HXYA 1V1JA 4I9UA 4EARA 3U4HA 2HRDA 2Q45A 1QH9A 1VKOA 3JYQA 3QLUA 3DKKA 4NYJQ 5C7OO 3ZVKA 3EXIB 4FFOA 4CUZA 4DKJA 3BIJA 1ECFA 1IY1A 3KQLA 1KVTA 4LF6B 2I3ZA 2P9TA 3F6CA 1WOYA 1KZYC 3REQA 5AVOA 2HMYB 1NTRA 2LXNA 3DHVA 4UZEA 5G41A 2JFNA 4CU5A 1NBIA 2BZSA 2M9MA 4MYTA 3RVJA 4COOA 4CN8A 3A31A 2IUSA 2Q5JA 1HLFA 2VHUA 4G5FA 5DDIP 3S2SA 1G20A 4REMA 3SXUB 1FSZA 1I9CA 1M2OB 2YV5A 3HJFA 5CU7A 1T1SA 3FNRA 2GMWA 1E7QA 1N7GA 3CISA 4JJGA 3SAJA 5DHRA 2JGDB 1T5BA 3UT6A 1DARA 4DKXA 4FGUA 3NHSA 4JLMA 2FG7C 1ABEA 4LC1A 5DFAA 3U48A 1PR5A 4HLUA 5AJYA 4JLWA 1V37A 1TJYA 2DFVA 4NSNA 3OC6A 4LBZA 3P45A 3QTLA 4EFMA 4RACA 4OKNA 1FZTA 2JLRA 1Q16A 3C6ZA 3I9V6 4LBVA 3P97A 2C7VA 3LHKA 2QL7A 5DGCA 1ENOA 1J70A 1FBNA 1YJCA 3LGSA 3UHOA 4M0MA 1X7ZA 4L50A 3DLHA 1U1GA 1WU8A 2R6R1 3EWIA 1RCTE 2MYPA 2QY9A 1MZVA 4Q4JB 5AVRA 3CVXA 1DRUA 1ODTC 2OZKA 1ZC3A 2ZSAA 3VR2A 4CKCB 1NI3A 2QN6A 2A9QA 1EGQA 2WFAA 3JQ9A 3QF7A 4IKOA 1XRQA 4DMMA 5BVHA 3UK2A 2R1VA 1BMFD 5ES4B 3DCIA 5IKEA 4MJXA 1XEWY 3QG5A 1JQLB 2O2YA 4R8LA 2WM9B 4S1OA 1R00A 4NS4A 2C88A 3TZ6A 4E15A 4LJ4A 4OI2A 4HVAA 5JQGB 2IIVA 3KZCA 3GLGB 4G4SO 1QHFA 1KP9A 3RH0A 4YRBA 2QQ0A 4BNUA 3HSSA 4D46A 4ARZA 1O95C 3JQBC 4KR9A 3ZTTA 3HJTA 1O87A 4MUKA 2DBVO 3U81A 2X23A 2R66A 4MI6A 3N0VA 1JJIA 5L8VA 2WHRA 3QK7A 5DIZA 2ZB4A 5DLEA 3DHNA 1Q0QA 5EYPB 4TN5A 4ITUA 1XTRA 5DM0A 4QJBA 5C1IA 5DSZA 3JWJA 4WZBE 1MW9X 3FMVA 1Y6ZA 3WKDA 1XNQB 5H4HA 2ZE5A 3IDAA 4PIMA 3L46A 4G1CA 4M1KA 1CY6A 3BMOB 1CZLA 5L51A 3QE2A 1VP3A 3BHNA 3K16A 1NQUA 1Z0KA 3UMYA 1VZ3A 1ZIXA 1Z5ZA 4ZZ2A 5DWDA 4ZEWA 4DSOA 4ENVA 3DV0A 5EIXA 3PDWA 1P75A 4MVJI 4JL8A 4GXNA 1DBQA 1SKYE 2YV3A 2D8MA 3BN3A 1SULA 2G5CA 4P6VF 1K6JA 1Z8NA 4K9OA 3RRYA 5F7XA 3NHPA 1IL0A 2HDOA 5A06A 4BNHA 3T1YB 3CNLA 4UATA 4B7CA 2F3TA 1CRLA 5BVHB 1LY1A 4FU0A 2A1TS 4PLCA 3TXAA 5LQRA 1QRUA 1PZNA 2CFTA 3IAS6 3KLOA 4Q34A 3D4OA 1NN0A 1CQXA 4M1EA 4YP6A 2AE1A 3GGPA 1PWHA 2B3TA 3H5WA 3T7CA 3VH2A 1B93A 3CLHA 4MI9A 4I5GA 3KR9A 3SY8A 3DUFB 4B6JA 2W4QA 5AUQA 3LLCA 3T0IA 3ZKWA 3M6IA 3GAZA 5K8TA 5HUQA 2J5RA 4BEBA 4UBKA 1SCDA 3K8OE 4WA8A 2ODTX 1P4HA 4AM8A 1NRJB 3A2NA 5K20A 4MLDA 2QLTA 3HEMA 1DUVG 3TQFA 3HLYA 4CT4B 3AJRA 3H7IA 4OLJA 2E7ZA 4F7DA 3FNBA 4FFPA 2QTZA 1ZN9A 4WY5A 2I2XB 1A8SA 3F8SA 4YRTA 1CDOA 4UE2A 3PT5A 1DWUA 5DTIA 2HCRA 1J9ZA 3LK7A 2FMUA 4KVZA 4F06A 3K4HA 4WDRA 5JSHA 4M21A 1SCIA 3Q5DA 1FFXB 3MT0A 4IHJA 4PSKA 2ZWMA 1V8DA 2Q99A 4MJ3A 4NU6A 2PQMA 2WYUA 2R6ZA 2JIMA 3MSCA 2YVUA 1OXKB 2YVKA 2YWFA 1I10A 4A6PA 2X5NA 5FADA 3R75A 3C5HA 4EDHA 3GGGA 1TM4E 2IFTA 1F8YA 1W1UA 2JGAA 3THXB 1N0UA 3OZTA 4RDIA 3SSNA 2WOJA 4P7BA 2C57A 2CNLA 2JLQA 3A6LA 3JZAA 1K5GA 2P41A 4R81A 1L2TA 2WZBA 3NR2A 4R1OA 4D74A 5KTTA 1KP2A 2GXSA 1XEWX 2QP3A 2GYVA 3GCXA 3EGWA 3K94A 4QM7A 1UFQA 3PF9A 4UDOA 5C7LO 2CXPA 4CM4B 4QO7A 4I1VA 2IHZA 4M1MA 1VSVA 1UDXA 3HV2A 4LGYA 2NSDA 1MAWA 1YMVA 3JYOA 4E32A 2JKYA 1GN8A 1DCKA 2JIZD 3FRJA 1MH9A 3VISA 1MIHA 4BFVA 1F5SA 2JNWA 4H6WA 2BTQB 4OQEA 5HDQA 4GVPA 3WNZA 4EZIA 3C3CA 3IODA 3FNHA 5EOVA 1B1CA 4RPJA 1SKMA 2E4XA 1XV5A 3GLIE 3G1TA 1P2UA 1GU0A 3IALA 1CJVC 1KMNA 2OFOA 1EA7A 4HAZA 4NC9A 4O2AF 1BJKA 2ORVA 3R3SA 4XD7A 3VRHA 2NP7A 4ARZB 4XYEA 4IH1A 1S6YA 2UYHA 3BXHA 1X3SA 2XAUA 1BE1A 3UGQA 3EZLA 1RZRD 1ESZA 3IXLA 4CMIA 1QANA 4OHXA 4BKOA 3JRNA 4N03A 2FWMX 1SQGA 2GFIA 3DLIA 3Q3IA 2KWIA 2GCPA 2WE7A 3UXMA 2MMGA 2O7QA 4NRDA 4GXTA 2G70A 3DVAA 4PG5A 5D2CA 3OFKA 3TQCA 5IHPA 2AC2A 3IX7A 4ZD6A 2RK6A 2XPCA 2R4QA 3OCVA 5IP5A 2ZRHA 3UAXA 2EEPA 2ZJ6A 4G3XA 3RUAA 3ZKAA 2Q6IA 4P4SA 4I4IA 4YREA 1N6OA 1QNFA 4HH4A 3SF8A 2G04A 3PUHA 5JNUA 1ILEA 1J2RA 3QXGA 4OY3A 1FMLA 3VYRB 1QG0A 5CK4A 4CU2A 3TFQA 1Y8AA 3L7IA 2D5AA 3KQHA 4MV9A 1CYDA 4G36A 2AYZA 4UAJA 1L7OA 2MSEB 4RE5A 1EJBA 1CRPA 1L7RA 4G86A 3A25A 4UJ5A 2CJYA 4PGMA 4DS3A 2NU6A 1E4OA 1O77A 2PH1A 1ORWA 3WGNA 2W2TA 1TGYA 3S44A 3MINA 4OSOA 3TL6A 5ALQA 2GAIA 1SUEA 5JNLA 1M1YA 3UH0A 4JX9A 4KFRA 4NAVA 3SXUA 3WGYA 4GI7A 2Q5QA 3MGAA 2Y1FA 3EW9A 1X70A 5TY0A 4BATA 2H1FA 2HHHB 5AK4A 1E3TA 4CG2A 3HLKA 4C7OB 4NPAA 1QRAA 2A3RA 3ADOA 1NVDA 1H9AA 4UOQA 4EFNA 2J4CA 1U04A 4FYYA 5JFOA 2YTZA 5LQDA 1UC5B 1E18A 1R7RA 5FPYA 3RYTC 1SVKA 1KDVA 4BMNA 4X63A 4IEFB 4Y6RA 2V6GA 3AV3A 2YY6A 1V3QE 1AA9A 4OMCA 3RYIA 4XUEA 1MHPA 2QVBA 1KO7A 3LS2A 2KSQA 4ZVKA 2EBFX 2YN2A 2EWVA 2FP3A 2BFFA 2E1RA 3CYFA 3O8BA 5ALPA 5FCDA 4KK4A 3N2IA 3VKVA 1YASA 3TZEA 2YHIB 1VJDA 3HRHA 1V1MA 2WB2A 4WERA 3KOWA 1MNAA 2AEJA 1PDOA 1BMDA 3TR6A 5DBGA 1T2DA 2FGJA 4Q7LA 5I9SA 4D4IA 3UENA 4LRYA 4PINA 1OC2A 4AQ7A 2R6CA 1H1DA 2NYVA 3EZ6A 3HDJA 121PA 1LRJA 1VTKA 2BMFA 2VP0A 3C4VA 1CK4A 1LLUA 2H1WA 1TDJA 2RHBA 1UPFA 2YX1A 3NWJA 3O26A 4WOBA 3GR6A 4J7XA 6ABPA 4MWGA 1QV6A 1RKVA 3M6WA 3HKDB 1KTVA 1PBTA 3CEHA 3FGOA 3PQFA 1ADYA 4FMCF 1FDSA 3W04A 2I4RA 4F93B 1QGYA 1TF2A 1UC9A 2LKCA 1P72A 2I67A 4BCBA 3MT8A 4LVNA 1NVGA 4OBXA 2NUTA 3BYZA 4FFWA 4LHZA 2J1LA 3QSYA 3WAGA 4YAUA 2M6RA 1IJFA 1W36B 4DTIA 1DHRA 1DFIA 2AUTA 2DFDA 3G79A 4XB2A 3F7TA 1DC5A 1XFAA 3H2ZA 3M4JA 4J03A 4RDHA 3OZUA 3ZY5A 1GV0A 3UXYA 2OESA 3ANXA 1IK6A 4LV5B 1HLPA 2NUPA 3C6KA 3ENNA 3K5HA 3L41A 2PX4A 3D7NA 3FKJA 3FJYA 4LKRA 1KI1A 1MP0A 5BPHA 1LV8A 2QG6A 2PH3A 3QF4B 2HT6A 3G5AA 2DBQA 3G9QA 3I58A 3Q87B 1T0UA 3WL5A 2ZUEA 2J6CA 2G71A 1JE0A 2QBYA 1KYWA 1RADA 2P67A 3ONEA 4JUDX 4P81A 5TRTA 4LNAA 1C8LA 3L0BA 1U0NA 3ZGNA 2DLNA 2XYHA 2X1HA 4KXNA 4QBHA 3VVLA 5DWQA 1XZGA 3W7VA 4N8SA 5B3KA 1SC4A 3ZWNA 1OAOC 1SOAA