1VPEA

Crystallographic analysis of phosphoglycerate kinase from the hyperthermophilic bacterium thermotoga maritima
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
398
structure length
398
Chain Sequence
b'EKMTIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGETKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKIDLAKELVEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAAVNKFGLEDKFSHVSTGGGASLEFLEGKELPGIASMRIKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOGLYCERATE KINASE
publication title Closed structure of phosphoglycerate kinase from Thermotoga maritima reveals the catalytic mechanism and determinants of thermal stability.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 148
structure length 398
sequence length 398
ec nomenclature ec 2.7.2.3: Phosphoglycerate kinase.
pdb deposition date 1997-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00162 PGK Phosphoglycerate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vpeA01
3.40.50.1260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vpeA02
1FW8A 2YBEA 2ZGVA 3PGKA 1HDIA 1ZMRA 2XE7A 5BT8A 2X14A 16PKA 1PHPA 3ZOZA 3Q3VA 2P9QA 3ZLBA 2WZDA 4NG4A 2WZBA 1LTKA 2P9TA 4EHJA 13PKA 2X15A 3C39A 3OZ7A 2X13A 4O3FA 2WZCA 1QPGA 3UWDA 4O33A 2XE6A 2CUNA 4DG5A 1KF0A 1VJDA 2XE8A 3C3CA 4AXXA 1V6SA 1VPEA 3OZAA 2IE8A 2Y3IA 3C3AA 4FEYA 2PAAA 3C3BA 1VJCA
chains in the Genus database with same CATH superfamily
2W2KA 2OO5C 4ZRNA 2FSIA 1L5LA 5DLPA 1XAJA 4HWSA 1WXXA 1L4EA 5LCXA 4EF4A 3OCZA 1X1TA 1U4NA 3DVAB 1ZI9A 1W93A 3GT7A 4RVOA 1FP7A 2VT6A 5J2TF 3C48A 3KPJA 1O57A 3BPSA 5EHGA 4M98A 1BHO1 3NW9A 3O8OA 3CGGA 2FPXA 3WOHA 5HQ3B 5K8LA 1G63A 4US2R 4XLTA 3FPJA 2GF2A 4IVPA 2HKIA 1CVIA 3FTNA 1CG6A 4PG8A 3Q8KA 2WR8A 3LFTA 1T1JA 4QUGA 1N4AA 5GGYA 1P74A 2H9YA 2PEYA 2VJMA 2CJXA 3FTCA 5JCOA 2BISA 4BO8A 5JZSA 1RJWA 4OIMA 5SYNA 4W5TA 2Z04A 1BA3A 2FRDA 2QIOA 4JLKA 5LZ7A 2O2EA 4BNKA 4DEVA 1AS3A 4P5DA 2YIVX 1MQ8B 4X6UA 1IBKB 2B99A 3L3BA 4WA8A 2WP0A 4UNNA 3OU6A 1T5BA 2VYCA 2ZJOA 4QGAA 2I4OA 2Z8ZA 3UOGA 2C83A 2M2IA 3KYBA 1N2SA 3T7JA 1X15A 2HY7A 2QQGA 3NPMA 3MJ4A 2Q3DA 2WIDA 3QKTA 2W42A 1HEUA 1DKRA 1DOAA 2GR9A 3QHPA 3VU9A 2SCUA 4E3WA 1XF1A 4F8EA 4DV5B 4OJKA 3D7RA 1AKEA 2VCHA 4K9DA 4WADA 2X1VA 3SR3A 2Y1FA 2ZUTA 3UB4A 3MJTA 3L46A 3P32A 1Z68A 3NKFA 4P1ZA 1AZSC 2UZIR 3PGXA 4KOAA 4MR8A 1BJRE 4DLLA 4C3OB 1M7BA 2LDXA 5FUWA 4DWWA 1EXVA 1QG4A 5JZOA 3HVRA 5KOHA 1PWYE 1K63A 1P9RA 2FUEA 3BJIC 3IE2A 3BGWA 2RGCA 3RJ5A 5C8YF 1PT8A 5BV7A 1XOIA 3E7WA 4RC9A 3CLSD 2PTGA 2J5BA 3V1KA 1DX4A 4ZVMA 5CFLA 4DIUA 1RFLA 1VMDA 2QQ5A 1BQ4A 2X5OA 5CU7A 3DBRA 3PPXA 5AJWA 3OUUA 3WTCA 2E85A 1IB6A 2IP2A 3FUXA 3LJKA 3RI3A 2D5AA 2R44A 4B5KA 1N2ZA 4XVCA 4RTJA 1TZBA 1UBNA 3W77A 3CVUA 3IJEB 4QBKA 4YJ2B 1F2DA 2PX4A 5B12A 3WL7A 1G2OA 4Q24A 2D1SA 4AKIA 1U2QA 2EKPA 1XQWA 1FE8A 3AM3A 2JCBA 2PQ6A 4LJKA 3A9WA 5CT9A 3L0ZA 3UIEA 3SR0A 2JLAA 2P2CA 3WOVA 1DC3A 1NP7A 1DKLA 4Q6BA 5EZQA 3ES9A 2I4IA 5JU6A 1X3SA 4ZOLA 3MTIA 1Y3FE 2J0SA 3G6KA 2A58A 3LHIA 2Q2VA 4GYJA 3EZFA 4ZOEA 3O92A 1OLUB 1ZMOA 2KW5A 2AUNA 4MUHA 4QKQA 3FCXA 1B23P 1Z3CA 3PC8C 4EMBA 3FB1A 3PRYA 2O5RA 4HH0A 3Q7QA 1QNLA 2GZMA 1E4EB 2EFHB 5C1IA 3MJCA 2XA2A 2C0PA 4GVLA 1OWMA 1BS1A 4R1TA 1MORA 1Z5NA 2Y6UA 4HWGA 4UDYX 4RAOA 1WPQA 1SIWA 1I6WA 4XGQA 1ZK1A 2AOVA 4R81A 5H68A 3AF2A 1KC1A 3UYKA 3AIIA 1EEHA 1ZJ6A 2WKQA 2YMMA 2PPVA 5DF1A 3LNTA 1PD1A 1NKVA 5B7PA 3M5PA 1VMEA 1XCLA 1IHDA 4BFUA 3KPUA 4XYGA 4DQLA 2I99A 1P60A 2VL7A 2W2NA 2QNIA 3E9ZA 3H5TA 1TPZA 4RA9B 2WF5A 2QM7A 4HB4A 5F64A 3UMJA 4P7JA 1LQUA 3D6TB 1NNUA 2OV4A 2MWMA 5FQNA 1EAMA 5ITVA 1F2TB 1NTOA 1SCBA 4S1TA 5EXPA 5T8KA 4C21A 4E2XA 1NL3A 3GUZA 3LDAA 1VZ2A 1Q1GA 3D3WA 4UBMA 5FBRB 5L3SA 4G4JA 1M9NA 4X6YA 1GZ4A 1EK6A 2FG7C 3KU1A 1UT6A 4Y6QA 3TW8A 3WX0A 1W8IA 1VRCA 3EFEA 4OX9Y 2Z2XA 5KBYA 4L3VA 4RX1A 4ZICA 1F2VA 3T5GA 3AINA 3K20A 4GMXA 4MI1A 1D04A 4BGEA 2WP8J 3MERA 4UZSA 3LI2A 2PSSA 3AG5A 5DN6A 1YUBA 3CCFA 4OPMA 2R86A 2HLDD 2WYUA 2XLBA 4A7PA 2HIHA 1JAHA 2M6SA 5EC8A 4HWOA 2IEIA 1X7YB 2AX3A 5B7QA 3REFA 2XD4A 3I04M 1CJCA 4MW1A 4UAVA 3Q7PA 2ADMA 1J5PA 4YCBA 5DU2A 3K9GA 2LIVA 3GGOA 3NP9A 4YQZA 2XGGA 1YB7A 3L4BA 1PNQA 3RANA 1YFZA 1Z07A 1E94E 3L7OA 2BZGA 1SHKA 4RF4A 3ROKA 1BMTA 5FUMA 4FNMA 5F1PA 3TXXA 1FSSA 1QH0A 2FEAA 3RRMA 5CK5A 3TL3A 2UVPB 4CMGA 3O7WA 4AX4A 4IXTA 5HF5A 3U40A 1IXYA 1N0HA 5EJMA 3T5DA 2EFCB 3NDJA 4M1KA 4V0QA 1IULA 3A3YA 1PL7A 1U2EA 4JBHA 4WD3A 2HCBA 4MICA 2D13A 3GEPA 1C3VA 4IH4A 1V37A 3VZSA 3D3KA 1SU7A 4A6XA 3HN6A 4DLWA 1LA2A 1U8CB 3I61A 4JA0A 1M2VA 1Y7TA 1N5KA 2OY0A 1V96A 4IRMA 2IKSA 3JSXA 4G23A 4K6OA 5ENZA 3SE7A 1E3WB 2B5WA 3CRQA 2Z4TA 2I8CA 1PKXA 4G84A 4IJQA 5SY9A 3UZUA 4A2QA 1YBFA 4LWPA 4HEHA 1HK7A 4CZ2A 3OJWA 2V7QA 1QCZA 2NU9A 1XD8A 4ZYVA 3B5JA 2QTZA 1OT3A 4HAZA 3ECAA 1ZW6A 1QHGA 4XASA 1WMSA 3TZ6A 4L5IA 4EB6B 1RZVA 3ZZ1A 1DBRA 1R5OA 3FMFA 1OD6A 4YJFA 5T3UA 4ZJYA 4MR9B 3Q87B 4H4EA 4LQDA 4W1RA 3UHFA 3WQHA 1FRQA 4HN9A 2HRZA 1YJXA 2G71A 4HDNB 2PUHA 3M3DA 5JY1A 3K2EA 4BVBA 1OFGA 1QRAA 3RW9A 3WJ2A 2Y1EA 4L4UA 1W1UA 4IXMA 2HC9A 1JPVA 3L93A 3QA9A 3KOZA 1N5MA 4MLCA 4TV9F 3NGLA 3ZWDA 1APBA 1T10A 4CIAA 1INLA 3RRNA 1IXKA 4AY4A 3RSCA 1FSZA 2ODBA 2PVPA 5DPMA 1BJTA 5CVJA 3SHOA 3EZYA 1WW8A 4WOBA 2C4NA 2ZAGA 4ND2A 3AZPA 4DQUA 1CUHA 4RVCA 4BWFB 5CX1B 4P84A 3BT7A 2PZJA 1D1PA 4E70A 3ZK7A 3EGDB 4MS3B 4QG3A 2VHTA 5B7GA 5FTWA 3W9YA 1E9FA 3MGBA 4ALJA 1QYCA 4RVHA 4JLBA 2ZIFA 3NYWA 4R2JA 3VKWA 4YRKA 4ZV4A 2H1OA 1E2BA 5A3RA 2IW1A 2WIBA 1E69A 2GXSA 3GLTA 3HZRA 1PL0A 5FBKA 2VJLA 2Y0EA 3V2UA 4UFPA 1XEXA 3PFKA 1OFUX 4WUTA 2JHPA 4ALKA 4R1UA 5FF9A 2NUBA 1SU4A 1ZQ1A 2VIIA 2X6QA 3UJHA 4A2PA 1YASA 2ZJ7A 1X1CA 1OJLA 3H75A 3V2IA 5IKMA 1UPXA 4EB8A 4EA6A 5AOAA 3V1LA 4FFOA 4R1OA 3TZBA 4EG1A 5BUSA 1XLWA 4WXRA 1HL3A 3QKRB 2IYNA 4Q05A 3EUAA 4QU8A 4QUJA 4TMFA 2NSDA 1W30A 1Z0JA 1JHMA 2XT6A 3OQVA 2ANBA 2YVAA 5DO9A 1TM1E 1SA0B 4G09A 1D2RA 1GG9A 1PR5A 3ZZTA 3D8RA 3MSCA 4MW9A 4G8CA 2Y9MB 2B1JA 1YB4A 2AOTB 3GRPA 3VSAA 2ZRBA 5JW6A 4K8RB 1HLPA 1B6SA 1JKJA 3JAWA 4Q7KA 1DAKA 2GO7A 1C0LA 1MENA 3IP1A 4KQHA 5LQSA 3X1ZA 3N05A 5ESDA 4BP9A 4LDZA 4G0VA 1TK3A 1Z62A 3N2ZB 3OX1A 3DUFA 4HR7A 3I0NA 2IYFA 3DPIA 4IPTA 1WB6A 2WHYA 4MVJH 1WBJB 5EWMA 1OBCA 1L4KA 4HLQB 3PU6A 4TUYA 3ZY6A 3EUFA 1YE5A 1ZCFA 3E4DA 4FBLA 1PR9A 4AJHA 1YR1A 1HTWA 5K8CA 1SKAA 4OH1A 2CJFA 2HMWA 1RWKA 3TRDA 2ZDGA 1F12A 1Q20A 1QHSA 2G8NA 3GVIA 2CL0X 3OURA 4U3JB 3RC8A 5EWLA 3ZYZA 4HKTA 2OGWA 1FFBA 2O59A 4US0R 2VHVA 2BTEA 1EFUA 2XSZD 4RH0A 2CYAA 1CV2A 3VKFA 3F98A 1P4JA 3OCXA 1E6CA 1A9XA 4GPIB 2GAFA 4YCJA 5KOIA 1CC1S 3OPYB 4DMUB 4FOSA 5CFZA 5ED0A 4MITA 3HJBA 1ZD2P 2WZQA 2ERYA 2QZSA 2GEBA 4PTYA 5I7SA 1I10A 2DGDA 1XT6A 4HQLA 2ALJA 4C30A 4B6RA 1H5QA 5CA1B 3OZTA 2QTNA 4YCSA 2R8XA 3FJ1A 5CXUA 3DFKA 2B7LA 4M8NE 1W88A 2YYSA 1CLUA 2R751 3I83A 1UJ6A 5AIBA 3AR5A 3KQWA 1GRCA 3HR7A 3D2AA 1T8YA 3TIIA 3ZS9A 1ABEA 2XTZA 4E46A 2QSUA 1OWOA 4QYIB 1DWQA 2VSXA 1R9JA 3D5EA 3LS2A 5DNAA 2ZRHA 2CLEB 1ZS9A 3RC2A 2J46A 3PJGA 4HBZA 2X5XA 3W8NA 4N3AA 1NT2A 2FJPA 3NT2A 3NT5A 5ALSA 3ZLBA 1Y3DE 4KXLA 3S1SA 1KMNA 4ILEA 4LY3A 4CV1A 1SUDA 1UM8A 2JGIA 4TXNA 2Q9CA 1SM4A 2KB0A 2WJ3A 3IAAA 3MS4A 4NBNA 4PV7A 4P5EA 2FFRA 2JRCA 3WNQA 1OIWA 1N7GA 5ICSA 5IMSA 1SWWA 4N03A 4OXXA 2AEMA 3VAYA 3VI3B 1Z6YA 2Y99A 2P67A 3BWDD 3EQ7A 2QORA 2RHBA 1W0KD 4FMCF 3R3XA 3K53A 4UTOA 1Y9AA 3VOBA 4EVIA 5KKNB 2NP6A 4OJYA 3PDHA 4MNTA 4Q3KA 2CLFB 4MGHA 2AYYA 3VC7A 4RY9A 3WWEA 2OQRA 4JC0A 3PUIA 2R1VA 4PZDA 3S5JA 3COJA 1USGA 2AEJA 4YR9A 1DWUA 4DV2B 2Y05A 2JKYA 1JJ7A 2VQSA 1YL7A 1Z0UA 2PXCA 3NGMA 4GRAA 3WB2A 1I0ZA 1IDN1 4FZ3A 2RAUA 5F3DA 5LYJA 5U4QA 2QVCA 3ISVA 1G3RA 3HCWA 2OOSA 5FDFA 1EJ2A 5DDIP 4CYMA 3FF1A 2O0HA 1PR1A 3VH4A 2P3OA 2ZT7A 5E3JA 3BWYA 4DE5A 4LJ5A 1VJ5A 2QWXA 1FZTA 3K71B 3C7AA 1M6EX 1U7XA 1H4SA 4KO8A 3D8UA 3MA0A 5JAQA 3I6BA 2G08A 4OQPA 3SYTA 2VF8A 1QRTA 3A4TA 3K8ZA 2C2MA 3CZPA 1FFAA 1YDGA 2EJUA 2IQ5A 1E2HA 1S9DA 1O5IA 3LFHA 4C0JA 1ZICA 1J8YF 4FD3A 1ZI8A 3THRA 3K0EA 2BEKA 1RPJA 3DVRX 2QF7A 3BAZA 3HCEA 4KO1S 2YASA 1QS0B 4Y6RA 2PXXA 2VPWA 3BH7A 5KU1A 1J8VA 1XFDA 3L7YA 1P3DA 2K6GA 2V03A 1REQA 3GPCA 4UAUA 4ZZ0A 3K09C 4OUDB 4QATA 2W4QA 3RRYA 3OD5A 5LQUA 3GMSA 3KYCB 3SSAA 4BDSA 2C77A 5JC8A 3G5LA 4EB3A 5JAHA 2C4TA 2DC1A 1PLLA 4EM6A 5EXSA 2WV9A 1RLTA 3I6ZA 3O8QA 2VJQA 4R68A 3C41J 2PMKA 2ZIEA 3AEYA 1Y81A 1UFVA 5GTDA 1UFOA 4XCQA 2EARA 3UN1A 4U5QA 1NJ5A 1R4ZA 3UHAA 1QIGA 4ZVOA 1IHOA 4FILA 4GSYA 4LF4B 4IMJB 3G0CA 1QJCA 3CUTA 4IV8A 2RMKA 1BNCA 2COUA 2ENWA 2NXJA 4KXUA 3INRA 3ZS8A 4CI9A 2AEEA 1F9EA 4FMPA 3L8CA 3NHJA 2GBGA 2Q0SA 2GJ4A 1ESNA 1O94A 4LX0A 3OC0A 3K96A 3DQZA 4KYTA 4MV4A 1B4DA 2JLBA 2Q4TA 4OA5A 3TIVA 5LMNB 1U0JA 1TUBB 1P17A 4RV4A 5CEEA 3F7MA 4G2NA 3ZV5A 5LQCA 1LI5A 1EUCA 5LB2A 4EY6A 4A0QA 1Z5ZA 4PR3A 4MAFA 1X42A 4MDYA 2YVKA 2B9EA 2ON6A 1R6BX 3HP4A 2ZWIA 2J0QA 2O8FA 5KNLA 5M3BA 4R1QA 5DW3A 3HJAA 4WXMA 3SZMA 3E9CA 5E1DA 1YDWA 2EBFX 3CU5A 5C31A 2BR3A 3Q7SA 1DIGA 3PFWO 4CJXA 3GAMA 5F7ZA 3WR5A 4KUEA 3ROTA 4J1SA 3VKHA 2BHRA 1BHQ1 2ZUVA 1RVDA 2SKDA 5LN1A 1C9JA 3K4QA 3PXGA 3BXFA 3DUWA 3G0IA 2BR5A 3U2QA 4BVEA 1KI6B 2CLDX 4JNCA 5GJCA 1WDTA 1P2VA 1X3LA 1OYYA 1QO0D 2FY8A 2J0UA 4MPRA 3LXRA 3PNMA 3K9HA 1TW3A 4OHZA 2ODQA 2EW1A 4GRDA 4G1CA 3TCXB 5BNZA 3KJEA 3DT8A 4JGIA 4E5SA 4MWEA 4BVLA 1QGDA 3P9SA 4RD1A 2D0IA 2FNAA 5H4HA 4WJLA 5LP1A 4GH5A 4U7TB 2VPQA 4AROA 5BVHA 4NEQA 4BFLA 1RM4A 5K4GA 1T4CB 3LPMA 3QUSA 4W9MC 1ZRHA 2C7GA 4YACA 2WNHA 5KVQA 2C42A 2POCA 3EQ6A 1VA5A 1YULA 5C8YB 3ZJTA 1MVNA 1N9KA 3KM0A 1H69A 2WWVD 2JB9A 1SOAA 1NF9A 4UXHA 3T7RA 2RC5A 4UUNA 3X1DA 3HC7A 1FQOA 1RC1A 1VECA 3KYDB 4GL4A 4RFLA 4KQEA 3WK8A 1WXHA 2J6BA 2WVGA 3D7SA 3MW8A 4IIBA 4RS3A 2BR4A 5F5XA 3DXXA 1L7PA 3ND7A 3I5YA 4NKRA 4EL0A 1GFZA 5LMCA 2JG3A 3EVDA 3AG6A 1VSVA 4BX3A 3T5CA 3B38A 1I4WA 5IPFA 1QR6A 3CLVA 3GRFA 1C7FA 2Y1OA 4MW0A 4N6NA 4QLOA 4X97A 3ZX5A 3ESQA 3O1IC 4H1UA 2I66A 5KYWB 4L1KA 5YASA 1RLMA 4QDZA 5C81A 1VYHA 5CB8A 2V0CA 1JR4A 4YREA 2ETVA 1SVSA 3TCKA 3ANLA 3X1MA 5CYOA 4FFBB 3QFRA 1C14A 4PN7A 3TZLA 1IZ9A 1E9VA 1T4BA 2JIQA 3HKBA 4ZVKA 4Q9AA 3WICA 3EF1A 2PVCA 1U9IC 1NW6A 2Z2ZA 2P7IA 5B4TA 2DTEA 5EVJA 5CVTA 1T9DA 3VDXA 4R1SA 1Q1NA 1BIFA 3K31A 1J6UA 1AQJA 1SPBS 3GOQA 4M87A 2H2AA 1U80A 4FYKA 2UUAB 5CYFA 5E3IA 2I7DA 3RS2A 1MGPA 4BNUA 1CW2B 3Q7RA 2ZS7A 2QTLA 1AY0A 2F43B 4O4LB 2XUFA 3TB6A 3U62A 4EGCB 1O97D 1K6EA 4QTXA 3RRBA 3WLEA 2AK3A 2HLPA 4FDAA 1KHHA 3CX6A 5NULA 1CU1A 3JZAA 3QWIA 4HGRA 3E3LA 3GA0A 2IV7A 3NPAA 4DM4A 3BBLA 4P4UA 2R6GA 3CEMA 2QYSA 3HEMA 2WC1A 4JENA 2PLNA 2CC2A 3DZIA 2ZUUA 4F6CA 3O9MA 1Z2PX 3LIIA 1DTSA 1QFYA 1LQ2A 4RE5A 2O0JA 4U02A 4B81A 1C1HA 2VCYA 1W75A 2QY6A 5HE8A 2Z1MA 3EZGA 2NU8A 4TS9A 4TQGA 1T5LA 1XEAA 4PWYA 3LG2A 3W3AD 3B3JA 2A0UA 2PANA 3LA8A 5BRAA 5C35A 5CEJA 2IVZA 3QMPA 1GQFA 2W43A 2PUVA 3GRVA 1VGVA 3WYEA 5LDDC 3GLIA 3JV7A 1GTVA 1YRYE 4J1QA 4TXJA 5CLHA 2G0AA 4FYWA 1Y63A 3P2EA 2F8SA 4XEHA 1TZKA 2PMDA 2OVBA 3IALA 2GH1A 3LSTA 1KE2A 4GZ6A 3WKBA 4AXBA 3E3AA 2W48A 4CKEB 5ISMA 2FZLA 1SXJE 2AYXA 1Y8QB 1K7SN 4Y6LA 4E09A 2WWRA 1H6CA 2PT5A 2RHHA 3EEQA 1VMAA 3FFXA 4ZT2A 5ELLA 3VR2A 4D2IA 4IMIB 1B73A 3WYGA 2W6ZA 4MW5A 1NE7A 2ZBUA 5JCZA 1ACLA 2QRMA 2PZGA 2UYGA 4HWRA 4I4CA 5BSUA 4D92A 4C5CA 4N18A 1A2QA 1JHZA 5IP5A 3QH4A 4WCDA 4MULA 4Z3DA 4XIYA 3HJCA 2E18A 3K1YA 3KSBC 2XYHA 2R8BA 1W5SA 5ALYA 3L7KA 2DR2A 4RXMA 3ER6A 3FSGA 5FL7D 2GDJA 3JZMA 5A4IS 2YXEA 2FWJA 4P80A 4RAQA 4LF5B 1KJWA 5JYEA 4KQ2A 3H8VA 3PRHA 4FYJA 3B6MA 4FYMA 5AWFC 3VZCA 1N3LA 2Q3MA 4BYMA 5FTNA 5AKXA 3DLBA 4BQSA 4DAEA 5T6MA 3PFFA 4X1KA 4YWHA 2PH5A 1V6CA 3I5UA 1CY8A 3IQZA 3ZIDA 4A16A 1SZDA 3KHSA 3V6MA 1LBQA 1S4QA 4WL0A 3AU8A 4J0JA 3E7DA 1FVHA 1UPBA 4LZZA 3PTAA 2J6CA 1U0EA 2PBFA 4A27A 4B47A 5D51S 4MVJG 1XGKA 3DMRA 5AOCA 1J0XO 2DFTA 2OFOA 3SYMA 4BNDB 1YI8A 2CDCA 2R97A 4Q1DA 1EXNA 2CD7A 2CVOA 4REOA 4YVFA 3WSTA 3ANYB 4KNVA 4EO9A 1BFUA 1JSRA 1K8ZB 3F4LA 4JT4A 2BP7B 1IC6A 3WLAA 4CM8B 4RE6A 5I9MA 2AQIA 4DY6A 2BGUA 5ALOA 1VE3A 5EERA 5CW2A 4GWLA 3IKVA 3VR5D 2H5JA 4JOQA 1RBQA 4ABTA 2YMQA 3L0IB 1M1NA 2DHCA 1L3CA 4L73A 1ZN2A 4L85A 4BQEA 4F7WA 1PYGA 5HJ2A 4AG6A 1UP7A 1FTSA 2JIZA 3AR6A 3I1FA 4C14A 1DKMA 2H3HA 1YAHA 2BLNA 1D4AA 2W6ID 1AB5A 4MX8A 4OMDA 1VLQA 1G7TA 1O5TA 1TF7A 4AURA 3AUXA 2YV5A 4MPTA 2WY2D 4ZDIA 4IGFA 3FNIA 1QIFA 4Q4JA 5A6SA 3GRRA 1GGKA 3JATA 2XA1A 1MIOB 3S1LA 1VSBA 3QTBA 1PFUA 4PTZA 4NXMB 4IDHA 2V1XA 4TKLA 1JNYA 4V0KA 5K0LA 1WB9A 1YBMA 2WF7A 4K9OA 3IOYA 3S2GA 3ITKA 3NYQA 2VRCD 4H15A 1IBSA 4J76A 4Q1FA 3S55A 1S6YA 2LXNA 4IIJF 2BYTA 3B85A 4RVDA 4MUMA 4RLHA 5KI6A 1R2QA 1QIIA 4B45A 2HI0A 3L06A 4KO3S 4RHCA 5JV5A 2L19A 3O82A 3M1AA 1ZOPA 3MQ4A 4FB4A 4IFBA 4YP1A 4WV3A 2QPAA 1YE3A 2I0FA 4GLFA 1R6VA 3AHDA 2OV2A 2YIMA 1QXSA 1LPSA 3AR3A 2AC4A 2BHTA 5E2IA 3T1QA 3W8DA 5AW4A 3EH2A 1U3DA 3LWNA 1R0SA 4PNHA 3MD0A 1RRVA 1G20E 1AO3A 1JIIA 1FFGA 1H42A 2CNWD 1V1MB 4JUIA 1USWA 1FYXA 2BEUA 2GXQA 1PJZA 4JA2A 4F4FA 8AT1A 4P0PB 4G97A 3LT1A 4QT4A 2VHWA 3MWKA 3A6GA 1GYPA 1ZH8A 1FNBA 2CKMA 2PKQP 4JKOA 4ME6A 4QE3A 2P2GA 1NT4A 1V5WA 3NT4A 3TRFA 3KT3A 1I13A 2R7MA 5TQ2B 2H08A 2ZRNA 5J1TB 2WBLC 3THYA 2PXHA 2CUNA 3QUCA 4KR6A 2MINB 1NSTA 4JK3A 1DL5A 1G21E 1P6XA 3IOCA 3JRNA 3U1TA 3M2PA 2IZ5A 2QXTA 3R5HA 1Z6QA 2VK2A 4KXVA 3UQZA 2VQDA 4X71A 3VJKA 5DNUA 1XN4A 4HNAB 2RHGB 5AW9A 1LI4A 4DEYA 4B3RB 1YR7A 2FW9A 3NWJA 2BH2A 4ZARA 3OX4A 1ZU4A 3W6PA 1UFRA 3X1KA 1PV1A 3C3XA 1CB0A 2Z2IA 4RDXA 1XPUA 3DOFA 3RRZA 4OP1A 3A2KA 3WWOA 1P9OA 3I73A 2PH3A 1UPUA 2DLDA 1Z7WA 3BH0A 2L0XA 1NN0A 3TDNA 2KM1A 3CUKA 1PLKA 3SYNA 3Q8MA 1LDEA 3GB9A 4I19A 3NFYA 4DGSA 3GRAA 3SC2B 1RYNA 1K3FA 3JZDA 3VV2A 4ZAYA 2P4SA 3OH8A 3A9CA 5JFGA 3UCEA 2QMEA 4LFBB 1XD2A 2I3AA 4PHTA 1IOZA 2BMVA 1WCWA 3GP5A 4TZ0A 1K2WA 3PPVA 3M1YA 1TKBA 1A95A 1ODKA 2EKZA 3HFJA 4UE3S 1BRMA 1CUSA 3ZHYA 4FWTA 4RSGA 1RM5A 1CUZA 2QBYA 1TL7C 4HC4A 1UT8A 3WGTA 5EKXA 4XIJA 3QF4B 2WJHA 5CK4A 2IXDA 4ML3A 1C30B 3AF5A 4FW9A 3KWLA 1IBMB 3K1ZA 1QV6A 4HFNA 5JNSA 3GJQA 3ITNA 2XUZA 4TKZA 4BKOA 1ZCBA 4NBLA 1URPA 3F3KA 4MTCA 2OCAA 2W83A 2XCIA 1ECGA 3IIMA 5IN5A 2Q1UA 3IT0A 3BOSA 2ONYA 1FMTA 5HKLA 3WP1B 2DTXA 1FOEB 4L95C 2ZCJA 1RKBA 2FRXA 2YH2A 3E5RA 1FX1A 1QIJA 2PEZA 1XMPA 1BHJA 3K0FA 1OQAA 2VNHA 4D3XA 4UOZA 1V25A 1ZZGA 1H5NA 5EGSA 4DXAA 5DVZA 5LOVB 1YV9A 3OKPA 2H2WA 3QPAA 3O0DA 2H92A 2H11A 4TRNA 3BK7A 3EC1A 2HT1A 2CMDA 3EMKA 4O2LA 2N3ZA 3IUMA 1X7HA 3MTJA 2YWGA 2OXIA 3TLEA 4BNYA 3QWHA 3Q8WA 2V6JA 3C3EA 4G0OA 4IKPA 1ZJ5A 1XA3A 1NN5A 4G81A 3VU0A 4OBEA 3DBHB 5C8XA 3HBJA 4KBYA 1THTA 1B0UA 1QF9A 3EVTA 4YROA 1TM5E 1ZHHA 3W7BA 5IH7A 5JJBA 3H2IA 3QU4A 1Y4ZA 3BHNA 3M6IA 2FFAA 4PZAA 1IZ7A 4XUCA 9MHTA 4WDRA 2HF2A 3I12A 2E4YA 1FXWF 4M0PA 4B7UA 2XBMA 4E11A 1ISMA 3CMMA 3E05A 5DX8A 5FOXA 1F1BA 5AI9A 4Z7QB 1XTIA 4O4JA 3K2QA 1PSDA 3R3VA 2OCYC 5TJHA 1Q3HA 3E7XA 4W82A 1ILWA 1KAGA 5DH9A 3K0KA 3FUTA 2GUWA 1SD2A 4JOCA 1C50A 2PJZA 3WGOA 2AOUB 2J5XA 2Q1SA 3FRJA 3I9OA 1QGUB 3GJ4A 2A0KA 3OQ6A 4Q47A 3AC0A 1XDWA 2FR8A 2C7PA 3FYUB 4WW0A 1JTVA 2XUAA 4H77A 1CDOA 1WOYA 4ZZ2A 3BTUA 1M0WA 1Z3IX 2HF9A 2QUZA 3U4MA 1GCOA 1M8GA 3LLMA 3M70A 4K6GA 2LVBA 4BP1A 1I0IA 4C4ZA 5LR6A 3OETA 2QAGC 4MUXA 3GIDA 1H6BA 4HDMA 4R8VA 4OLFA 2A5YB 3VPDA 2X8AA 1VBFA 4PYRA 1RWBA 2D3WA 2WHEA 4CLXA 1LTQA 4WY2A 4W5RA 3REQA 3TEJA 3DZHA 3ICPA 1QVWA 4S12A 5C7IO 4W1SA 4WKGA 3BWMA 1L0BA 3UC5A 3QSYA 1Q7CA 4F3NA 4QTTB 4DR6B 3OFSA 3SMVA 2WIAA 3TQHA 4CKXA 3QVWA 1N6HA 2P1ZA 1A8SA 1PKEA 3IUBA 5AVJA 4OJNA 5JLAA 1W87A 1T3TA 4MCJA 1B74A 3R5FA 3A6PC 3ENQA 3B3GA 1EX6A 3S2YA 4LJLA 4RTNA 3DD5A 3FE2A 1BXGA 2CXTA 4JJ6A 4Z4HA 2NYUA 1OLXB 1NRWA 4HRXA 3E1GA 4FUQA 4MRPA 1CY7A 3R8FA 2NP7A 1T6ZA 1J2EA 1P4RA 4O2AF 3CLRC 3AT1A 1BH6A 4TKVA 4RV5A 1GFSA 2AF3C 1I7PA 1ANKA 2XUOA 4ILKA 3HXQA 1GCGA 1V41E 1WUKS 1KS2A 4MVCA 2WEKA 1DMSA 4RL6A 3OF5A 5IVDA 1O6ZA 2UKDA 2ZYUX 2YKGA 3DS8A 4GOXA 2IEZA 3BKXA 4S1NA 2GEFA 1IY1A 2PV0A 4HEA1 3TBKA 3EXIA 4CKBA 1QOZA 2QW0X 4D97A 4RVSA 1R9MA 1U2GC 8OHMA 2O2JA 4U00A 1XZNA 1JSLA 5C8DA 1PFVA 2I2BA 2B8WA 4LHSA 1W36C 5LQRA 5ECGC 5L6LB 4QJ5A 1UBOS 1X19A 1NRJB 1PFYA 1L5KA 3FCAA 3PFNA 4C2UA 1W8DA 3VHXB 5A6SB 3K5IA 4TKMA 1THMA 2JGLA 2NN3C 3IEXA 3CIOA 4FGWA 2R6CA 4U7FA 3ADBA 2CN1A 4XIGS 4EG3A 1Z45A 1T2AA 4KK3A 1XG5A 4BJ6A 5DV9A 1ESMA 3RV3A 1PUIA 4AJPA 3G0BA 5K01A 1QK3A 3IUNA 4IDNA 5EPUA 1JIXA 1G8KA 4EB0A 3QE9Y 2Q9UA 2MMCA 4C7OB 3JQPA 1XZQA 3ZWVA 2H2FA 4UNSA 1J20A 4HRVA 1T1SA 2G9RA 3WGJA 2HYDA 3CWQA 5TLSA 4G1EB 4NESA 4WNYA 3STYA 1GPMA 1RI3A 4LTNA 2FJUA 3C3PA 4R7GA 3OQ1A 5AI6A 4BNVA 1XRMA 3TW0A 1XHEA 3EISA 5C1OA 4E94A 1ORTA 1E63A 2PLRA 4LSMA 1HE5A 1KMCA 3RWOA 1P81A 3FWZA 3R7WB 2CDAA 4ZCMA 4YCLA 1JKIA 1U5AA 1ZM7A 1SELA 3CH7A 3FPGA 1MGOA 4JJKA 2C4UA 4ZI5A 3PF9A 3RUCA 1Z34A 3QX3A 3ONVA 4PG7A 1LC0A 2ILVA 2EU8A 2Y71A 4S24A 4CETA 2NZWA 2Z9DA 3Q6NA 4G85A 1W5BA 4MVXA 4XQ0A 4WEQA 5CXSA 2XMCA 4BAGA 4FFLA 4LVOA 2AWOA 1IZ0A 1HDIA 4FE3A 3HUFA 3GNTA 3M2TA 3PDUA 2ATEA 1I4OA 2GB4A 4GR4A 2VH1A 3RRJA 4ZGBA 3A6HA 5FD8A 2BKAA 1DAIA 4WMLA 4AMGA 2ORED 2BHSA 3Q10A 2D6FA 3EIOA 3ZV3A 5BWCA 1IM5A 3IAM1 1JR3A 2IPXA 1BQ3A 5HNKA 4EW1A 1IM2A 1K66A 3RGGA 4PC6A 2X0DA 2BVNA 4Z7NB 4FKBA 4ROTA 4QXAA 4JXXA 4L4YA 1GDTA 1SXHA 3UXMA 3LO5A 3WK4A 1EFRA 3HY4A 3GELA 1TADA 4JITA 4MB6A 2CXOA 3IKLA 1EA5A 1KY3A 1NA5A 1W5EA 2IUSA 2Z56A 2K2QB 3GFGA 2QJTA 2EP5A 3OD1A 5FI0B 2AJ8A 3SXPA 3V34A 1KEEA 3H5RA 4B3GA 1TLTA 3C6XA 4TS4A 4BX9A 1ORRA 3WDKA 3CM0A 4FPXA 5EMKA 3N2LA 4TYNA 1UBJS 3OY2A 5AKYA 2WWWA 4O4IF 2WIFA 4LJRA 1QV9A 5BV2P 4FR5A 5C0OE 1VMKA 3GROA 3GFBA 2R5NA 4YCCA 2GS9A 3PD1A 2X8BA 5AI0A 3S4YA 2JJMA 1N8SA 4ERXA 3DKKA 3IJ5A 1FK8A 1Z16A 3D3NA 2WWHA 4UOQA 1A9SA 4CR7A 3FPKA 1R16A 2VT2A 1L8XA 1JPNA 3ZE6A 2AV6A 3U17A 4B9EA 5IU6A 4OHCA 4H7HA 3P1JA 4KMOA 1EWTA 1UM9A 2ZI9A 4LEIA 1NXVA 4KRXA 1W1WA 3IHWA 1WB4A 2HXYA 4RQAA 1Y37A 1V9LA 2GLTA 4X1YA 4JLJA 4KO2S 1G3MA 4A0GA 1U3UA 1LGYA 3D2CA 3NP7A 1K4KA 3DR5A 1K97A 3OOSA 4H59A 1DWPA 5J9FA 5A5EA 2EX4A 5E6UB 1S8FA 2A35A 4Y9SA 3V1YA 1VYUA 3PYLA 3VR5H 5LZ4A 1KAOA 1TJPB 5ADUS 3CG4A 1QYXA 2B8JA 4ZIRB 1UP4A 4GECA 1GYQA 3O7MA 4QDTA 1K7YA 3CBGA 1DNPA 2XDWA 4Y1EA 3NMUF 1MW9X 1NMYA 4C0XA 3K6SA 1I7SB 3BF8A 1U94A 4DQVA 2QZZA 4PXYA 1GUYA 1UCFA 4XDYA 3GCGA 2DKFA 2PU7A 3A06A 1FYEA 1ENYA 4ZQEA 4C7KA 3IQDB 3OZVA 4JBNA 3FVQA 2JD1A 1YHZA 1LDBA 4NBSA 5DRTA 4ZCLA 2DJ5A 3RVNA 3X3HA 4DAOA 1SBYA 5K0BA 2VPZA 3B82A 1XMQB 1TYEB 5CNMA 5A05A 3PIRA 4OXQA 1FBNA 3E35A 3A1SA 1EBBA 4J16C 1YOVB 1DCFA 4MYTA 5DK4A 2AE2A 4RJ2A 5DTMA 7REQA 1FXUA 1KWGA 4Z9FA 1T8WA 2A1TS 5TVKA 3BA6A 4G4SO 5HKKA 1XZJA 5IJ0A 1IEQA 1UK9A 3I6MA 3K2BA 4IHAA 4H4CA 5E4JA 3DDCA 2O7NA 4HFRA 5J2UF 4IZHA 4KE7A 4EENA 5JHHB 1NBME 2WFLB 2FN8A 4K9NA 1T1EA 4DB2A 3P8ZA 3U6BA 3BFVA 5LZ9A 3QOXA 3ZE7A 1RM0A 2OBYA 4XIIA 4J0IA 3ERCA 1A7UA 4EEXA 2JAHA 3CW8X 3SNKA 1H2YA 2AL7A 3H11B 4HYEA 1IUKA 1OFHA 1SVWA 2IYVA 2RHLA 2A9OA 3FSEA 4JT9A 4RH3A 4DQXA 1LB1B 2ZRJA 1WUJS 1YZLA 3ORQA 3EFOB 1V43A 1PJCA 2QSJA 2XOEA 1AD2A 4XWWA 1HA3A 2O0KA 1O4WA 2K7ZA 3HO8A 2XMQA 3USZA 3N7AA 1KETA 4B40A 4KQXA 3R7FA 1RAIA 3HCDA 5JQGF 3S2SA 2BSXA 4INPA 4GZLA 3ICQB 4QXQA 2RGEA 4IDQA 4LMBA 1Z63A 2NVBA 1P1FA 3TRJA 4A8JA 4R8MA 1LLQA 3VMFA 3QX7A 4B73A 3Q5GA 2WU4A 4MEAA 1ZJYA 2MYPA 1OPRA 2Q3LA 3SQWA 2APJA 3ETHA 4AUEA 3Q8LA 1J97A 1O8CA 2WAMA 1BWPA 3R41A 3R9XA 3M4XA 4I1SA 1MZVA 1Y5RA 1LX6A 2PX3A 3KXIA 2I2DA 3FTPA 5JSZB 1IZ8A 3DXYA 3SZLA 4OHOA 2YFHA 2AJBA 2FQYA 2IU6A 4IJVA 3VDMA 4D4HA 3BUSA 1LRJA 4UDXX 1Z9BA 3BX1A 4WBNA 2XV1A 1T9HA 2O5VA 3KT8A 3NNDA 3C98A 4KPUA 1A96A 2P8JA 4OHFA 1VE6A 4YRJA 3FNEA 4L0CA 2JLWA 5JLJA 3AX6A 2DHQA 4I5DA 3ZEIA 1GCIA 4R2HA 4FLMA 4DVGA 1FDVA 2CCKA 1F1JA 3ZWQA 5DWQA 3MXTA 4JD5A 1NVUQ 5JJIA 2RH8A 2X42A 5A03A 3I64A 4KWHA 4BNGA 4IIJB 3EA4A 1XVIA 3OVMA 4RENA 5GONB 3VH3A 4HNSA 4AJ9A 2WHPA 3M8KA 1Z0KA 3OECA 4RTOA 1KF0A 1U9ZA 3A7DA 5J23A 3NBAA 1TYBE 2WWYA 1LEHA 1G64A 1Z73A 4AJ1A 3RS7A 4RUKA 3NCTA 3WHKA 1N9GB 5K0SA 1BVHA 1GITA 4GSLA 1Z35A 1BE8A 5G0UA 3BG5A 1HDYA 1OXUA 2PZEA 2FMUA 5FKJA 4TN1A 3MFYA 5M5BA 1UMBB 4URUR 1DUSA 3IE0A 3MTGA 2D7JA 3OLCX 1AKTA 2G5TA 4Z0TA 2XNKA 2AUTA 2C3MA 2V8OA 1EQUA 3LL4A 1QLWA 3AVOA 5L8VA 1SKYB 3N1UA 3P26A 5ALJA 3WXBA 1B8OA 4V3BA 4QU9A 1XMIA 1LF0A 1OTHA 3GGPA 4WEOA 5H1YA 2PS1A 3RSLA 1CUBA 3RIHA 3LVQE 1R0CA 3Q7EA 2EHDA 5A4FS 1CEEA 4Q1EA 2OYSA 2ZRAA 1A9TA 4DV1B 2AZMA 3FMPB 2ZUDA 3FWKA 4P4GA 2FF5A 3RTDA 2PSHA 2XTJA 3NBUA 1ZC4A 2C4HA 1CJTC 5E7IA 2QVLA 2ATIA 5I7OA 4FR0A 1YCDA 4F9GA 1KFCB 2Q6TA 3G9TA 4O2BF 5FNVF 5ALTA 4LJ6A 5HCUA 5ILGA 3CN7A 1PZEA 4QVGA 4F2DA 4V2IA 1RMTA 3MCTA 5CA0F 4MVJE 2QDXA 3KSZO 2IOHA 2C95A 4TX1A 2JJ1D 3EDCA 2A9QA 3EHEA 2X0FA 3WHLA 4CM9A 4YUYA 1U2DC 4I1YA 4KFUA 1U5CA 1QE3A 1P29A 1X80A 2O3SA 3EGCA 1E5QA 4Q1VA 2G40A 3RFUA 3WLJA 4KIUA 1YZ3A 2CD9A 2Q2OA 1KH1A 1HTBA 3FAZA 1ZVVA 3RASA 3AOGA 4AL4A 1E9AA 2P9CA 4BO3A 2I33A 3LY8A 1G19A 1G5IA 2KYRA 1VMIA 2ZTUA 3IEIA 2CEAA 4A0FA 2P4UA 2GYUA 1MO5A 4YJHA 3T95A 3V4ZA 4ARCA 3JQFC 3QMWA 4S1OA 4BFWA 2JH3A 4POOA 1G8MA 2Q07A 4KTVE 2JBAB 3OBBA 3QEOA 1JAXA 1BGWA 2EWWA 2IPMA 2XB4A 4L50A 4LTMA 4OXRA 3PT5A 1DLIA 2EF1A 5C8ZA 4MDEA 2QP9X 5JYBA 3CSUA 2FPPB 1U90A 4RTRA 2H1FA 1KRXA 2QTRA 4M7OA 3ZKAA 1EQAA 4IO1A 5IUJC 1ULAA 1R0YA 1HE3A 1R6UA 1TM4E 2Q21A 1XVVA 3FROA 1CP2A 1XI2A 2QUJA 1ESDA 2X0RA 1ONSA 4GQIA 4JODA 5FAXA 3VNRA 3COVA 3HUDA 1AN9A 1XKXA 3QLVC 4YRTA 5DCYA 4L08A 2IOFA 4OI4A 1G7CA 3TKAA 4MRSA 1T8RA 4QVKA 4WZZA 3WGUA 4LF8B 5G4LA 3RM3A 1Y1KE 3U13A 2TMDA 3EZXA 5EQTA 1YZFA 1Q0TA 4G0WA 3N2EA 2FXVA 5KSWB 3UMMA 3L41A 5CLIA 2O4CA 4BLVA 2IH2A 4IX1A 2HRDA 3O2NA 1LDGA 4LE1A 1Z39A 1ZN8A 1MT0A 2BAGA 4AKHA 5FPPA 3BGDA 2BFPA 2ONZA 1MJNA 3D0QA 3PQ3A 4OHYA 1NZFA 2FQQA 4YMUA 3A2NA 4G5RA 4G89A 1FLAA 3SG0A 4EPVA 5KDOA 4LXTA 1Z7GA 4K86A 1XCBA 3SLKA 3F3YA 1DJMA 2V8BA 4R9SA 1XRLA 3D4NA 2EKBA 4ZCPA 4D5EA 1LK5A 1TCAA 3MGGA 5EP2A 3UUEA 5JXIA 2VTKA 2ZTVA 2FPGA 3UF0A 4I14A 2B20A 2QQFA 4HGZA 1Z13A 1ONNA 1G5PA 1XMOB 2ZRGA 1JG6A 2MTBA 3OIWA 2XCQA 2A3NA 3IMFA 3DZFA 1QFMA 3Q2IA 1BO6A 2WJYA 2HV8A 2R7LA 3CX7A 3OEWA 3LRPA 4HNRA 1IJEA 1K5GA 2HMAA 2NX2A 4REQB 2R00A 4RGQA 5EOVA 5SZJA 3RVLA 2AN3A 3QOWA 3UO8B 4AS3A 2Q1WA 3L7AA 3W4IA 1ODTC 2HF7A 3ZDEA 3PKIA 1I24A 2HLNA 3KAJA 1SK9A 1DHRA 2IUUA 1T35A 5B3LA 2O7RA 2RC6A 4ND1A 1WP4A 1H85A 4DBLE 4E6PA 1L9KA 5HK8A 3LPLA 1GPDG 3A1NA 3G7NA 3SYLA 3UAGA 3ZK9A 4DTCA 3CCCA 2FZVA 4S0ZA 2JJ2A 2W2MA 4UHHA 4BLQA 1Q7EA 1R6XA 4D7AA 5IDXA 3QBTA 3JAMA 3MT9A 1XE3A 4MUIA 2VUHB 821PA 4K6HA 3ZDXB 1Q57A 3V00A 4UREA 4DCOA 1JQKA 3ZVMA 4N7MA 5KNBA 5CVEA 3RSGA 421PA 1VXOA 2W22A 3NATA 2CFTA 2HJ9A 3WQRA 2CLSA 3UVEA 1AHIA 1WSBA 4QL3A 5IYZF 1EWQA 1GPLA 3A1UA 3EA0A 4ZCIA 1BW9A 4U2KA 4DJDC 5KZMB 1E3DA 4IIXA 3ORSA 2EJTA 4FCVA 3AHGA 1W25A 4LVUA 3JZIA 3VHLB 2IH5A 1MPXA 4N6OA 1XCJA 4KFRA 4YJKA 1EGMB 4Z99A 3FLEA 1A77A 1H9CA 1QJ4A 4HDQB 4HWPA 2NUPA 1EH5A 4IH1A 2PKYX 2PGAA 2YFKA 1K6IA 4YAGA 5JXWA 5KYUA 1NIPA 5J4KA 3ABIA 4X7BA 1W59A 2VEOA 1EEXB 3QUQA 4OQ4A 3SDBA 4BVGA 4EG5A 1PS8A 5KQRA 1VI5A 1VA4A 1I33A 1Q2UA 3DT9A 1VLJA 3S99A 1ACJA 3SIPA 2QAJA 1JX6A 1J23A 2LW7A 5IK2D 1GSIA 3KS9A 1W7AA 5A0VA 3QXSA 3VNBA 1KSJA 3L8MA 2GESA 4TYMA 1RT9A 1I3CA 5CVCA 1WEKA 2WWGA 2NLOA 4NE2A 2QKYA 4JYMA 2D2EA 3ASUA 4H0CA 3LAWA 2QN6A 1KTVA 3CY6A 2XUQA 3RBVA 2A33A 1ZH0A 2QM0A 2ZPAA 4IJMA 4JN6B 1RWMA 2CLIB 2LCIA 1UBFA 3GCDA 4CODB 2WG2A 1U98A 5D1NA 5EIWA 2BM9A 3H6HA 4INZA 2PCLA 2XQFA 3PEFA 4FHCA 3TQCA 1ICIA 2VP2A 4MGKR 1LQTA 4I5EA 3CRNA 3EXEB 1Z7BA 3IS3A 4IDDA 2CDRA 4H16A 2XDQA 4K6MA 4XLLA 2IU0A 3T9EA 2B6HA 2NYRA 5GJBA 4WERA 2DWPA 2VDMB 4UVEA 1A2BA 4IGKA 4CV3A 4DMGA 4LYJA 5CMLA 1C2YA 3DF7A 5DBGA 1PK9A 1OI7A 3L8GA 3V2HA 1GY8A 5EQJB 1R4NB 1ECPA 5EYPA 1EFVB 2NV0A 3P4UA 5DW0A 1ZUNA 1CJKC 1OX6A 3GRCA 4YLEA 5E1BA 3MMZA 3DT6A 4K2HA 1HOXA 4Z1MD 1U3WA 2OHXA 1U3GA 3JCZA 2OM2A 2WWIA 3NIBA 4FCTA 4RD0A 5HJ5A 1L5HB 3GDFA 4GUAA 2OZLA 3B1WA 4J7CA 4CM3A 4K1XA 5IJ9B 1GG2A 2W8ZA 2XCOA 2VJCA 1NYTA 4FB5A 3PHIA 1UZAA 1Y34E 2XEXA 2D5CA 4ZANA 2VP3A 4C9BA 3CH6A 1NXQA 3C8HA 3CONA 4ONEA 4XWKA 4M1OA 3RFCA 3IMEA 1LF5A 2LIPA 2Z6VA 3DOHA 1K08A 3FHOA 4GOOD 4KBFA 1JQLB 3GH1A 3IQGX 4XTRA 2DUNA 4Y2XA 3TVTA 5C7LO 4HAUA 4TN5A 1S3GA 3AL0C 1AKMA 1H94A 1JSCA 1E7MA 4FZVA 4PY2A 1OXVA 3RVSA 3FCYA 1Y0BA 1QG0A 2R2GA 2OC9A 3L7BA 4LYFA 3KKKA 2XHEA 4HYTA 4JI3B 3WVNA 4AMYA 4DDUA 5AJZA 4GNRA 4DNOA 3RS0A 3HJFA 4B09A 2YQ5A 4O4IB 4MRMB 2VSNA 5JZMA 2RE8A 1D5WA 2PKWA 1ZH4A 3CW2A 5EJ5A 4YO8A 1NW5A 2HA4A 2H85A 4MH0R 1V47A 3LT5A 2VPPA 2W9XA 3O73A 1CFZA 2OO7A 5H70A 1M2NA 5F2OA 3W1WA 2Z6QA 2XNDA 1PZNA 1TMOA 3LX4A 5SYMA 2FZEA 2J31A 2OMEA 4MW7A 2FFBA 4TSFA 4ODIA 2ZITA 4DRYA 1H2RS 1N2JA 2EEZA 3RDPA 4UTVA 1NU8A 3QPDA 3FOZA 3HKCA 4ZAFA 4JI6B 3EJWA 2JIRA 3UJNA 4PQEA 2YUTA 3HP7A 1UC8A 5CFRA 2IPAB 5DI3A 3IBGA 4R05A 1EVIA 3NHUA 3D5TA 4JLSA 4ZEVA 1FMFA 2VF7A 4LNUB 1Z17A 4DOMA 1C4OA 4MZXA 2FDRA 5BW6B 4KV9A 5E0KB 4DT1B 1AF4A 3FXAA 5IXJA 4OKNA 3TR6A 3FD8A 5HRCA 1OR8A 3IT1A 1MO3A 1FB5A 3FHJA 1GUFA 4OOEA 3B52X 1LFAA 2FTKE 2JGDB 2PFGA 3LA6A 1LX7A 1PVOA 2VJNA 5ARBA 2PM8A 2GARA 2YW2A 1GQRA 3H8SA 4OQZA 3TTVA 1XA4A 3F74A 2IWHA 1R18A 4OGFA 1E2JA 4KQGA 5DBHX 1XN1A 2C2HA 4R3UC 4Q6WA 4LGCA 1O58A 3EE6A 1X7XB 4JJAA 1ENPA 4Q9DA 1SUIA 2EZ8A 3KPYA 1BAPA 2YJ3A 5T57A 4I7EA 1P0MA 2P79A 4JB3A 5A3VA 1L1FA 1UWCA 1P9LA 2OT3B 3BC1A 5L3ZA 3JWGA 4A26A 2DKOA 4RIGA 3UWPA 4TMVA 5JH7F 2AHRA 4RY2A 4JT8A 4HQ6A 2W00A 3KL2A 2YC2C 3MWEB 4BNWA 5IM4F 1YI0A 4TROA 3EOZA 4FS8A 4E13A 3EA5A 1P1CA 3ISJA 2JAPA 3UG7A 2CJYA 3UWDA 5F51A 3TE6A 2XOKD 2WQ6A 1AHNA 2Q6IA 2EG5A 1SH7A 3O03A 3RUFA 1PFWA 4ZT6A 5DE3A 2BEJA 1TZCA 3VPSA 4DUGD 4QXOA 1X1QA 2ECQA 2X1MA 5JUWA 2FYTA 3FCUB 1NC1A 4HRAA 1BYUA 2VP5A 3OUTA 3F46A 5SYAA 1DQZA 4M1ZA 1JG1A 2W6QA 1TPYA 3AUSA 3IBSA 1RLUA 4J0FA 1KQ3A 4OAQA 3QPUA 1S9HA 4DJTA 1THZA 3A10A 5IKPA 1N5IA 1SZJG 1UZNA 4QICA 4HDSB 4URVR 5FPHA 1JQDA 3L40A 3WRYC 4OH7A 5SZHB 3RARA 4KN5A 4RPKA 1O95C 2GBCA 1CZLA 1NX9A 3L8ZA 4GW3A 4JDUA 4U2BA 3NVAA 1U3TA 3OE1A 4R0VA 1VPDA 3CNQS 2R79A 1GA4A 1XKLA 1E1MA 1E6KA 2QAGB 3OTGA 4P4NA 1A9YA 5ADVA 2C2ZA 1EBFA 4Y7CA 4HZGA 2VJYA 2CBZA 5AVWA 4BMXA 5AVQA 2O8CA 4HGYA 4J0EA 1DZ3A 1CIVA 3JQCA 3M6FA 3ZHBA 4DTIA 5JQGB 1L8AA 2XB9A 4NU5A 4WKNA 2O1XA 1Y6JA 5I5EA 4I5IA 2HTFA 2PBLA 1PV2A 2IF0A 1BHSA 2CHEA 1ZIPA 3BCUA 2EIHA 3EIXA 3EVCA 4UDNA 4KMMA 3DOOA 3ZWXA 3VDRA 4AS2A 2JRLA 1WZ2A 5ALKA 1CDEA 3G23A 4U2CA 2FEOA 4ZKDA 1QVZA 4UASA 1E3EA 3KQKA 2ZWAA 4GKBA 1AUXA 1SOWA 2C2GA 3I2FA 4HH1A 5IC5A 1SUWA 2HSJA 2R5FA 3K0CC 3CHYA 4C0BA 4UEOA 2VI5A 4ITVA 1QVVA 2D0PB 5FWYB 3LLVA 3NV7A 2NAFA 1Y80A 3P9RA 1I7DA 2QTVB 4GDFA 4IYJA 1WUHS 4KHPB 1QQ5A 2RB4A 2ZS8A 4IDGA 3BMNB 2Z1NA 4H3SA 2VTDA 1V7ZA 4O2RA 4ENVA 4X84A 2CXUA 1P61B 4NJEA 1HNZB 2X22A 2IYZA 1US8B 5EKDA 3FNQA 1OZHA 2CWWA 1OAKA 4WN9A 2NZVG 1W96A 2VDVE 1GZ5A 1TYAE 2XWSA 4ZO8A 3NH6A 4KI0A 1EFTA 3C3JA 1D4OA 5ALFA 2C3YA 1W9HA 2CFSA 4NFYA 5FT9A 2B1RA 3ZGYA 1T3ZA 3N87A 1W49A 4OJQA 3AERB 1SQ5A 4DIFA 1GG5A 1NDQA 4M1MA 3P52A 3DE4X 4OKIA 1M2WA 4FDVA 4BLPA 2Q6LA 4E03A 2WJ6A 3ECSA 5CNKA 1D2CA 3MCWA 4G8JA 3IB3A 1L1QA 4JQOA 4JP3A 1MIHA 3M9WA 3OQIA 3L8FA 1DC6A 3BMXA 3T3OA 5ETJA 1JLKA 1GCAA 5FHRA 1I1NA 3UB2A 5JAUA 2PAAA 2FEXA 3CFYA 1PW5A 3UAOA 1P5JA 4NDNE 4RCVA 1J1UA 1AXEA 1H5UA 1R6TA 6REQA 4TT3D 1M0SA 3H5OA 5CVUA 4DIOA 1E7QA 3IDAA 4EY4A 3M6AA 3NM6B 3HXKA 4BWVA 4ZN6A 4CTKA 2PY6A 3PLAE 2PUDA 1RYZA 2DP4E 3GL9A 3HLTA 2BMDA 2OGTA 1GQSA 1NI3A 2Z9CA 1JG3A 3N8KA 4NNOA 1PEDA 3C6BA 3CLKA 4OYRA 4TWRA 4B4UA 4IS2A 2DFPA 2P2ZA 1XLTA 1ZGBA 1G21A 2ROQA 1F8UA 2OZEA 4G0YA 5C7YA 4X62B 2Z9BA 4US1R 1QKJA 2G9VA 2OPBA 5FFFA 4D4KA 1Q1ZA 4R1NA 1EUDB 2GZ1A 4A15A 1V3UA 1RNLA 2FE4A 3FWYA 1I3NA 1BDBA 4D9FA 1L7MA 2VNSA 2VSOA 5IUKC 3O2QB 3HEBA 2YL2A 5CVDA 3ZJYA 1J09A 3DZ8A 3A3NA 3IRUA 4URHA 1RCFA 3L4EA 5DP2A 5FOQA 5L6MB 1Q84A 4DRZA 2J3JA 4BB6A 4UHKA 2B4RO 1BXKA 1HE2A 1RIFA 4DMRA 3O2JA 1DFGA 2FDXA 1D5CA 3JARB 1FTQA 1M2GA 4HNVA 2WD7A 4PR0A 4B71A 3QXCA 4QGSA 4WOKA 2R8YA 3BRCA 2XNCA 3LW8A 3DTVA 4GP6A 2YHUA 4EVQA 1DAOA 1YMQA 5FLXA 4ZOAA 5F7OA 2HBQA 1PJBA 1YJCA 2YVQA 2M6LA 3LO8A 1N2CA 1W0JD 1B6RA 1IN6A 3K6RA 1UXKA 2BJWA 4WI1A 4EOGA 3A2MA 4WLVA 2Z2YA 4U4AA 3GUVA 1KP3A 3C3AA 4KQIA 2CKDA 3ASYA 3OZXA 3PR2B 3BE5A 4C6SA 1NUPA 2C1XA 2O9JA 2Q3BA 4IXWA 4ZJPA 4EKGA 4CKZA 5J43A 3IR5A 4MIYA 4I8DA 3WLLA 5BUQA 3NDBB 3K9LA 1GIAA 4Z8XA 3N6RA 1KDRA 3L0CA 1VPLA 2WM3A 3UG6A 2NQ8A 1U1CA 2H7VA 2W11A 3QEJA 4Z9AA 3AKEA 3T4XA 5KTMA 4S0XA 1VLVA 3GXBA 1QPGA 2OECA 2YFQA 2N75A 2BRUC 4FDTA 4KLAA 4EYSA 5IN4A 2RARA 3K3PA 1FX0A 1PGPA 3LGSA 3P0RA 2C5SA 4QXMA 4RKEA 2JJYA 2Y1XA 3TD6A 3RADC 1RWWA 3HR4A 1QHYA 3HS3A 3OCJA 3R5KA 1UBEA 4YC7A 3JU3A 1R64A 2H3EA 3OEHD 1G291 3DZDA 4RGYA 3ZXSA 4B5LA 1TQ8A 1XL1A 5FA5A 3LQRA 5KDLA 3ABQB 1X9GA 4E5VA 4YXWA 3OIFA 3THXA 4D6YA 5KYGA 3H7AA 2F64A 5IAOA 3HXMA 2BGMA 1IAVA 2I6FA 3GGCA 4V1CI 2F3RA 2GTIA 3B1VA 3VA7A 4O3FA 3ZXYA 4YIKA 1JDNA 3MUOA 3HYRA 4WX2B 4YCNA 3K92A 1LZLA 4NZZA 1QQTA 4RK5A 2PX2A 3QE0A 4D9MA 4DDVA 3VNVA 2AG8A 4QNNA 4Z4IA 2FZ5A 4E6EA 1VCIA 2QV0A 5JAOA 3BFJA 1VFNA 5ANRB 3ZHTA 4MUAA 4H35A 5AKKA 4AY2A 1VC2A 5LWHA 1YT5A 5LBUA 4MKHA 5F1OA 2H1SA 2QTAA 3HCFA 2X86A 1N57A 1QGYA 3NAQA 2B4AA 3FOEC 5BXQC 3KDPA 4FP9A 2AE1A 4EW2A 4XW2A 4B7XA 5I7FA 2LZ0A 4OYLA 3R7BA 3TQFA 4OVKA 4F85A 2DQKA 3N2NA 3OFJA 4ITRC 2ZI7A 3MJSA 4QUEA 5DNDA 4EI8A 1I5EA 2QZJA 3P2IA 4BV8A 1HI9A 3GWGA 4MR7B 3VO1A 1Q1BA 1KIMA 2X2FA 3AMVA 3PEVA 3G8AA 4YT4A 3V4PB 5IZCC 5LVAA 1G4UR 2A30A 4HEA6 1GZ3A 4Q03A 5PNTA 2O1SA 3AESA 3RE1A 4DA7A 5IABA 1XYYA 2C78A 3ABZA 2ZPTX 2IEYA 4M60A 2ZUCA 2WU8A 3C24A 4ZREA 4OU5A 3S7ZA 5B3JC 5DNYB 2PT6A 1UDBA 1M2HA 4F0JA 3M81A 3CJTA 3COWA 1OOEA 2PPLA 1F6DA 4LJ9A 5FIUA 1JIKA 4GD3Q 4IILA 5C3MA 3ETCA 4CQNA 2Q4BA 3DLAA 3A11A 3UMRA 4AICA 2R1UA 1GL7A 2RFLA 1KR2A 3RROA 1RYHA 2CHGA 1EGQA 1H8EA 1E2MA 1DT3A 2FR1A 4CLEA 4QBFA 2PA3A 3E5HA 4KU4A 1F7VA 2GCOA 3RVMA 2BFEB 1NVWQ 1NRIA 4MIEA 1WSDA 3KALA 1VP3A 2V6GA 2YUIA 1YB6A 2O48X 4D8VA 1OB2A 4MQFB 4X3PA 4C3VA 3GFPA 4ISBA 1OX5A 2VBFA 4DCPA 3DVLA 4ALLA 1U1GA 1ZY2A 4BP8A 3S8EA 4I55B 1E2LA 5H59A 1TD1A 4I1UA 1EWYA 1T1IA 3BS4A 4FU0A 1BVUA 1GKYA 2XIJA 5DI9A 1QYVA 2YVLA 3LL7A 2F3UA 2RBEA 4RNDB 4UZFA 4B43A 1SC6A 1ISJA 5NLLA 2JLRA 5HDQA 1C1DA 4CM6A 3SHWA 2FMXA 4GQBA 3VSBA 1ZAKA 1OH5A 1W29A 4O1IA 3PNOA 4Q93A 1TU4A 4TWAA 3RS8A 4MIOA 1O9GA 1KO8A 2REOA 5B53A 3UENA 5K99A 1C3LA 1NW8A 1PDVA 2IT1A 5GGXA 2FZ4A 4LS3A 5F5NA 3ZNQA 1FC0A 4BFCA 3LUJA 5HUJA 3X2SA 5JT1A 5C52B 4S05A 4DLUA 4QWWA 2Q1XA 5CPFA 1L5OA 3IVMA 4BMNA 2JEYA 1TXGA 1Z37A 2OXEA 3EF3A 3O3OB 4C43A 2F8TA 4LHEA 2QR2A 4CEHA 4QQRA 4UBJA 2EGGA 4OHXA 4TGLA 4WKPA 3RT7A 1XXHB 2Q8PA 4FWBA 3SNHA 1KU0A 3AONB 5ALGA 3UAZA 3WYNA 3IAM6 3IP7A 5BVGA 1HM5A 5JCOC 4CV0A 1GUAA 2IWRA 3P97A 2ZJAA 2PBZA 3CO5A 1SG0A 1AXGA 3ICOA 4N0EA 4ZMSA 2CE2X 3IUPA 2WICA 2OE2A 4WFJA 1JLLA 3TH5A 3VYSB 3BWXA 1AQUA 3AZOA 2Y2UA 4HB0A 4C4TA 4RK6A 3G9QA 3IPXA 3I9V1 3NHKA 2G1AA 4K8OA 3F5DA 5KX5F 4L8FA 2IHKA 2FSFA 1MJFA 3AVXA 1P9NA 2HPVA 1G6KA 2OO3A 3QELB 5F2NA 1XJCA 4GPBA 1XPRA 5E6RB 4J4TA 3KQNA 4MA0A 3B3AA 2BEWB 4ZYXA 1UK7A 4JVMA 2X4IA 3LUGA 4X1OA 4TL7A 2ORVA 3VDQA 2C2BA 1E5DA 3FLMA 1O96B 4Y0VA 1S1MA 3RU9A 4R84A 2NW6A 1UPTA 2BMFA 2GHIA 1KNQA 1K0UA 3I45A 5F21A 4DVJA 4ALMA 2FPIB 3O91A 1G3UA 2PUEA 4MB2A 1L7QA 1GSOA 4NBKA 4RZQA 3RG2A 2HGZA 1DC7A 1SCKA 2AK2A 4F3KA 2AG1A 4Y7DA 1SOVA 3NVMB 1CY1A 3OOWA 4O6VA 4OK3A 2PMCA 4MYDA 1E3QA 1RS0A 3QENA 1NV8A 2HFKA 4ZMRA 2VDOB 3AW9A 1V1RA 2XNHA 4GEGA 1J0CA 5B1DA 1ZD3A 2AFRA 4NH0A 2ZWPA 4IYRA 1UPFA 1JKMA 3GD5A 1ZRSA 1JEOA 3F7TA 1VJRA 4BU0A 1QTNA 5LWQA 3LZCA 3KR9A 4PEVA 3ETEA 3ICWA 3OHMA 3GUUA 1E9EA 2RGNA 1P7WA 2H1LA 2WZDA 3DDHA 3I4FA 1Y1QA 1I5OA 2FFHA 5IARA 3YASA 1KO5A 1RRKA 1Q7TA 1S0UA 1PGNA 2CF5A 3GRYA 3IURA 2OG2A 4G25A 1GQYA 3MLEA 3OAAA 4JDPA 4TT8A 4HQOA 2N46A 1OC2A 3GD7A 5I5GA 2GN0A 1VCHA 2FAXA 4K9QA 3QEMB 5K45A 3HFRA 5DM70 1SUCA 3BBPA 1GPKA 2VNIA 3Q3IA 7ABPA 4BB5A 2VXYA 2VVTA 1TU3A 4BKPA 5I8WA 5H4GA 5IKXA 1U63A 2Y1DA 4EHKA 1W52X 2QM8A 2YN2A 1USVA 3ODGA 3G1UA 5GMOA 1JEYB 3T7EA 3I6QA 1FDRA 4BP3A 2YHIB 5F35A 2QZPA 4DMHA 2BGRA 1M6YA 4JYPA 2D1QA 4GL2A 3G2MA 2IIQA 3MILA 2E1PA 2J9FB 3ASZA 4CU2A 4D0RA 3HU2A 2XR1A 3VR6H 5KTPA 1NURA 4MHTA 3F6YA 4DJ5X 2FU5C 4B3HA 2XCSB 1TI7A 1N8TA 1COZA 3AV3A 1SC4A 3EODA 1E59A 2C99A 3LE8A 1J39A 4PIPA 3U3MA 4AIIA 1ISHA 1JF8A 4JS0A 5BN1A 1HRDA 5BWLA 5EI5A 4UQLA 1ZXXA 3CKMA 4EKIA 1KC3A 1COWD 3FG9A 1Y6FA 2GETA 2R8RA 3IHLA 2P62A 5F2KA 2PZ8A 3TZQA 3W7VA 3F3SA 3PB3A 3RT1A 2Q5EA 2VTBB 3H9GA 1U1IA 4MW6A 1GPUA 1R88A 5EIFA 1XVUA 1Y8CA 2XMDA 2YWJA 3W3ZB 4BECA 3MAJA 1SVNA 2A9VA 2Y67A 5FBVB 4MOWA 5AOVA 4WUVA 3FCSB 2OSBA 3L5OA 4MV9A 3S2ZA 2R25B 5COAA 2CLOB 5B1EA 5IDQA 1MZPA 3QJ5A 1BE6A 1WEHA 2VJAA 3PXXA 5IJZA 1O9HA 2X8JB 2NTEA 3HB7A 4O4HA 2O19A 1R6AA 2EX1A 1B8VA 3QPVA 1BFKA 1P4SA 3PNVA 1HDCA 4ZXFA 4MVJP 1E8NA 4F1JA 4BNHA 1F5SA 1H93A 2VNAA 1OMOA 3HCPA 4OSPA 2XZPA 4DRXA 3VFDA 5BRJA 1OWLA 1T91A 1W2WB 4KVGA 2Q4OA 3GT3A 1DEAA 2ZBRA 2G7ZA 1AKVA 2E21A 2GRAA 3I2HA 1OB5A 1XVAA 4QA9A 3G2JA 5IC4A 4Y67A 4PRYA 1UXOA 2CUTA 3U7QB 1EX9A 4ZI7B 3ESYA 3IJPA 3O1HB 1EM8A 3BRWA 4IDCA 3T61A 5BR8B 1OX4B 5EVCA 1C1XB 2XQVA 2YIDA 4MWSA 4KO4S 4GGMX 1EP2B 3M7IA 4R41A 5KWIA 1BXRA 4HY3A 1W5AA 4M46A 3C6ZA 2VQ6A 4A8PA 3KJGA 4J2HA 5B5SA 3AFIA 2ECPA 3SKVA 3P94A 3R3ZA 4EECA 5M7EA 2GVNA 4AN4A 3JQBA 1P77A 5K0ZA 1SHUX 4LMRA 1ZK2A 2HU7A 4Q21A 4DMFA 2Q4EA 4EG0A 4CXMA 4NXNB 4UNIA 5DWVA 3CYFA 5FFMA 3TXYA 2NO1A 3WWPA 2UVQA 4RSRA 1YRLA 3F9RA 1ENZA 2WD9A 4Q1BA 3AO0B 3TVDA 2ZQYA 2R85A 2IS6A 5ARCA 2I87A 4FFWA 4J91A 2ZI3A 1ZSVA 4LN1A 3CJRA 3ESCA 1B42A 1WCXA 3P9KA 3L6BA 2VUTA 1NATA 3D54D 3DE6X 3DMGA 2DWQA 4I4TB 5AUOB 1G59A 3E3OA 1I4DD 3G17A 4BVAA 2VHZA 2HMVA 3KZOA 3MMSA 3PVSA 5EXTA 4DUZB 3OJXA 4OB6A 3EAQA 1XB2A 3GAFA 3UAVA 2ZDQA 1NMXA 5BMVA 5JALA 2FK8A 3H6GA 2CJPA 5A4KA 2RHOA 3WKEA 1KOLA 4AZ0B 1HEYA 1S7GA 3I8OA 2WAAA 4ZAWA 5E6SB 2QM3A 4PPGA 3RBZA 3RODA 5I51A 3M1IA 1CY2A 2XYPA 2HXGA 3DZCA 4M3NA 5MFPA 2QG4A 2YY7A 4CUJA 3GT0A 2GERA 4BBPA 2C5LA 4HN2A 3N2KA 2DUUA 1PBNA 4M9QA 1TDJA 1TJ5A 2C5AA 1O0CA 2XXAA 2C88A 4X6LA 3IVCA 4MKZA 4CUZA 3HHEA 1NZDA 1E7RA 4Q7EA 1L4NA 1A4UA 3GJZA 1YVEI 1Z88A 3KKOA 3HDQA 3ZJUA 1L5WA 3CVOA 1F51E 1YR3A 2YXBA 3QF7A 4DFDA 3OX3A 1O95D 1ZONA 2QVZX 2QTGA 2FEKA 2H0QA 2GPTA 3KE9A 1FNNA 5D3MA 5T4EA 3AUJB 5DISB 1J2UA 1NVVR 3F96A 1JEQA 2BM1A 2EIXA 1II9A 1N8KA 2X15A 2X76A 5F2EA 5FPSA 4ESVA 5BSHA 1KMQA 1Q83A 5HF8A 5JNLA 2AEFA 4YGYA 1A88A 2Z8YA 1JSXA 4EITA 5JSYA 4CLRB 3QQ5A 3BJRA 4KXXA 3RQSA 1PQ4A 4FHDA 2CXHA 3DKPA 4RMNA 4PQGA 1YBAA 1NM5C 4RF5A 3IKTA 3SOZA 1CUGA 3GHHA 5B6JA 5CBPA 1MFZA 1FDOA 5HOQA 4JSRA 1QRSA 3BMQB 3DO5A 1VJTA 2OCDA 4PXAA 2EFYA 3MSXA 3PTZA 4U2DA 5A1TA 1YO6A 3NH9A 2V7UA 1Y1SA 2Y3IA 3MN1A 4PZ0A 2DERA 4YJ3F 4I4LA 3AVQA 2Q3CA 1U99A 1ZBQA 3OEED 2GHRA 4B4OA 1X1RA 2ZSIA 5JNVA 4DMMA 2WYVA 3GYBA 3EOBI 4CM7A 4DM3A 3G49A 2B98A 4R8KA 1EZ4A 3UW3A 1AU9A 4CMIA 2DSNA 2ZIAA 3GLUA 5K3FA 4C6RA 1ZL0A 3QEKA 3I1YA 2CK3D 4A6PA 1AQIA 3TNJA 2OHIA 2ZANA 3V8VA 5CIQA 2OHVA 5HBGA 2A5JA 1O6FA 3DDZX 1EM6A 3RBXA 2JGKA 4Y3UA 4BFTA 5I45A 2G07A 5JROA 4KFTA 2A6PA 1E96A 4QSHA 4PAGA 4RKFA 4KWIA 3K9BA 4QREA 2QJWA 3TLJA 3B13B 1WSAA 3PC2A 4XR4A 3N3BC 2RK6A 5KYXB 3M5CA 5K0FA 3ANTA 3NANA 5CX4A 1EP9A 4OLJA 3C97A 3WBJA 1EJ0A 4AU1A 1T5OA 4AF7A 4DV7B 2VBGA 1RHJA 3HXTA 5EP4A 3T7KA 3U56A 1A1VA 3TQSA 1YR2A 1SKQA 1K98A 2TMGA 3K0HA 3O4VA 3JQAB 3VOSA 1UOPA 2P5UA 1RBZA 1GL6A 4Z86A 3GMDA 5GOZA 3T7AA 4AM8A 5BSVA 5HZKA 3U9SA 3OWHA 1VE1A 1VPTA 3IV9A 4JUCA 1P3Y1 2J9GA 1UXHA 3H18A 3VC2A 1S89A 2EZ9A 2Z4RA 4UKDA 3GEGA 4N12A 3VPGA 5JOQA 4NYIQ 1JMVA 3F7OA 1ZCAA 3GLRA 4XD7A 5I7VA 1XXLA 1X2EA 1Z6PA 1TQ4A 2B6NA 3IAHA 2R1TB 3LY7A 1DPGA 2ZIGA 2VUSA 2Z1DA 4GG1A 5AKHA 3UJ3X 1I4LD 1OFVA 2B1QA 3DE3X 4BO4A 4I6GA 3MHPA 1QUFA 4J0GA 2QVGA 3I1JA 1KDVA 1RJEA 2WJJA 1U7PA 4KV7A 4PBTA 3SXUB 1SULA 2IX3A 2GCGA 4KTTE 5JXHA 3JX9A 4KGVA 2B94A 1M8JA 1MABB 2AZ4A 1CB7A 1N0VC 2V4UA 3AFNA 4HL6A 4QYTA 4TMWA 5EEGA 1M67A 3OESA 5H3CA 1FYVA 1Q95A 3HCNA 5HM8A 3RS9A 2M32A 2ZXUA 3MGCA 4CQMD 5IVKA 4OCZA 1MO6A 3HHPA 4ND7A 3W8EA 2JFHA 1M73E 2VZ0A 1U8UA 1E7YA 1H2XA 4DLPA 2NVOA 4X3OA 1U28C 1NE2A 5LDGA 3VPHA 5DXFA 1EAYA 1JQ3A 1NR7A 4CIVA 4WLEA 4E5DA 4R16A 1N8NA 4EA7A 3LHKA 1WLYA 4R5MA 3GLKA 4F2PA 3CINA 3UAYA 1L4LA 1XZMA 1E4YA 3DAFA 3PEEA 5HQTA 2MSCB 4XJSA 4K2AA 1JN0A 5KNDD 4KKXB 4KDFA 4NJMB 4AAYA 2H65A 3KLOA 4NC9A 4CEIA 3E9QA 4BAZA 3WL6A 5JNUA 4P7KA 1E3WA 3DOJA 1Q17A 1SQGA 3JQRA 1AA6A 2A9RA 3FTEA 1Y8AA 4II2A 4P98A 3KX2A 4I9UA 1J42A 2JZNA 4RFSA 5KMGB 1NYRA 1TUEA 3E8MA 5HFJA 4CLOA 2ZJZA 5FCDA 5L45A 3T4PA 1M1ZA 2V6FA 3MJFA 1WLSA 2ZWVA 5HOEA 3UK6A 4ZZ3A 2YOFA 2UZ0A 1NQWA 2WJVA 2J7PA 2QEQA 3IJRA 3TLKA 1KO1A 2EQ5A 2OD7A 4KR2A 3PQ4A 1H9BA 2OBFA 4FUTA 5LA6B 3UOWA 2G63A 2Q3JA 4W5HA 1MNQA 4ER3A 1PHRA 2NSJA 3JWPA 2G80A 4GBMA 1M1YB 4LZWA 4FW8A 1RC0A 3D2BA 1U7OA 1MMFB 2WTEA 3OE7D 5A9SA 1JECA 1AGYA 3KETA 5FA8A 4RTKA 4V38A 5KCMA 5KYYA 4V0NA 5IAGA 3PZRA 1WNTA 3NWBA 3QVMA 3AUUA 2NWQA 3DMNA 4RJIA 3PC7A 3AHCA 5CUQA 1FUUA 4B82A 1SC3A 1C80A 2PMEA 1Z8HA 4DV4B 1T0UA 1KGSA 2QXUA 2ZI6A 4NP6A 5HRUA 1KQPA 3KAQA 4IR7A 2Z4SA 1S2NA 4J0CA 2ZZKA 5CH3A 1JR2A 2HDNB 1RJDA 5K1ZA 1QO9A 2BGNA 4Q9HA 2CLMB 3CEPB 1NUAA 4F4HA 3IC5A 1YQUA 5ELMA 1TEZA 1KZGB 2OCIA 1FYFA 3R0JA 4L4RA 5FXMA 3NAGA 4CMHA 2XADA 4P7FA 3OT1A 4Q9LA 4LSWA 4J6EA 4LBZA 4XQGA 4BBAA 3GDWA 3A4LA 2IYRA 2FHSA 4YX9A 1KDOA 4H6WA 1XRRA 3JVDA 3PICA 3BL8A 3CIFA 3BGOS 3GARA 5LZ2A 2I2FA 3TXAA 4LCBA 4EGJA 2CV2A 3U9TA 1H2WA 3B20A 3BK1A 3JYHA 5KHAA 4M86A 3OIYA 5A4AA 2IDJA 3ROMA 2V0GA 1JHOA 3QVSA 5KPJA 3DQPA 1HUQA 1AGXA 1L7XA 3JASA 5CPBA 4FMBB 2Q2WA 2Z8YM 4F5ZA 1VLLA 5BUCA 1R37A 2VYND 3DMTA 3N0RA 3ACCA 3KVRA 1ZVJA 3DE0X 4PC7A 4RZ3A 2ANCA 1WZUA 1SKYE 3VZDA 3ZOZA 1TVCA 3GNLA 2QT0A 2IU4A 2AW5A 3ZLTA 2X4DA 2YN0A 3BQNB 3G1TA 1F6BA 4JBGA 1SA0A 5ALPA 4TTVA 4FFRA 4Z4CA 1I01A 5ENDA 3O8RA 1A50B 1VBKA 1X7DA 3R0XA 1UKCA 3C5VA 3SFZA 3TUZC 2VP6A 3GQBA 3H2GA 2WSSA 4PCVA 4HZUA 1VJDA 3URKA 3QLUC 1PT7A 3CZ4A 3HYCA 2IA5A 3NHBA 4PYMA 2FOXA 4EA8A 2JVIA 2LCFA 4EFDA 4WCFA 5JSKA 4G0ZA 1M34A 2O6LA 3BXZA 3IBFA 3CG0A 4BKRA 2B2XA 1R0ZA 2JI7A 1JLHA 1XTBA 2Z98A 3O84A 1RPNA 4JLUA 4XGKA 1MG5A 5JZ9A 3U7FB 3ZUGA 1NW7A 1BGVA 3RYIA 4D9KA 2H59A 1KQFA 4Z4FA 4AG3A 3CE6A 4CGYA 4HAVA 2BTQB 3TVYA 1QZXA 3I6IA 4HPJB 5C1BA 3M4NA 1KZ4A 2KS6A 3JYQA 4NI5A 4ZOBA 3NUGA 4OL0A 2HQBA 2Y92A 3EZ2A 3TOCA 3V8RA 2IYTA 2PZMA 5A7FA 3IQIX 4HDRB 1Z0DA 4KE9A 4G24A 4W5OA 1T1RA 3GJRA 2YC4C 1PWXA 3T35A 3VAZA 4KDCA 4CQLA 3ELBA 1TA9A 2E2WA 1N6KA 1YR9A 3LU1A 1J2YA 1LNSA 1PTJA 4FQ8A 2IY9A 3CVWA 3PPYA 1EFHA 2F9LA 4IHJF 2JD2A 4EJSC 2AG0A 1DEKA 4WKCA 3USCS 4BVHA 4LJSA 2FK7A 4QO8A 1WU7A 2OFPA 5P21A 3LYLA 3R7SA 2Q27A 1NQUA 1HYHA 2GBIA 3CLTD 4CFZA 5AFSA 4LRSB 1J0DA 2I91A 1MEOA 4MPPA 5CA1A 1DO2A 4PO9A 4G2TA 4GOMD 4AG5A 1I2MA 5EFZA 3U3JA 3E7FA 3DM9B 4KAFA 1TX4B 4FGKA 1VLMA 3S0JA 4R31A 4UU7A 1YA8A 4FX2A 2YJ4A 4QYIA 2Q99A 2JAWA 3INGA 4LA4A 5FUQA 1LJUA 3CNNA 4PZYA 4LCEA 3IDFA 4Y1GA 2ZYWX 4B87A 1LH0A 1X7ZB 2VT3A 4JZYA 1AC5A 1LVGA 2QQEA 1ZJWA 1ZD4A 2AN4A 1LVHA 8ADHA 3S27A 2OILA 4CQMB 1HQDA 4KXWA 3GW8A 5C4GB 1TEVA 2I54A 5B4UA 2O8DB 2VYQA 1SBNE 2R84A 4OGLA 3U4GA 2DR3A 2IDKA 5FOSA 4YV2A 4CKCB 4F6RA 3DD1A 4ISCA 1NQOA 2RKWA 1WR8A 3ANMA 1FTNA 4HCJA 4PONA 4DCCA 2ZUEA 2IY7A 4P53A 5B6PA 4LMAA 4PAMA 2HH9A 4A36A 2IHTA 4GZMA 3WK7A 2GNAA 2EZTA 3DFUA 2GCIA 5LLDA 2R8ZA 2E4UA 1OLOA 4JQCA 1NHWA 4DARA 4YJGA 5AQ1A 1P7ZA 4YMSA 1QFJA 2JHCA 4Y30A 2JLSA 1GA6A 2YR0A 2IPOA 3TPFA 1H8HA 2EW8A 2QGZA 1CKEA 1D03A 4KPGA 5DNEA 1JMKC 2OK7A 3U39A 4D26A 1NXTA 1YB2A 3RKRA 2A7QA 5F9HA 1NVTA 3DAYA 4Y2PA 4B17A 3CNEA 3UGQA 2BJVA 3F8WA 4X20A 2RBGA 3UPUA 4IUYA 1XNJA 1USUA 3EGXB 4IDPA 1ZDMA 4J3NA 4ZVVA 2OOKA 5C9ZA 5JMOA 1EU1A 4UCWA 4WZAB 3WFIA 3R5TA 4WK0B 4YRSA 5I3CA 4M0KA 2XTAA 3OZ7A 5FOUA 4UQOA 2NVUA 4FINA 1OV4A 1ZGJA 4LECA 4QJBA 1XUOA 2SBTA 4E5MA 4F12A 4WKOA 3JWJA 1GXSB 5ALEA 1QPZA 3TLXA 3B9RA 2PKRA 3ZDDA 2XCUA 4NSNA 5JVDF 4BE7B 4DIBA 1X0VA 5KQMA 4YRRA 3UCFA 4LFAB 3GLGA 4AN1A 1DBSA 3C1AA 3KQQA 2W90A 4II3A 3VMMA 5G4KA 1RKXA 2OBNA 2IE8A 2PNJA 3JPWA 4LYGA 2P9BA 3DEZA 1J33A 2FWRA 2BY4A 2GJ8A 3CPJB 4L16A 3SI7A 5IBCA 1FVOA 4C5BA 4E3ZA 3HO1A 3VHRA 2P6PA 2OB2A 3IIEA 3MYRA 2G4LA 3DEAA 2WV7A 1Y1TA 2VJBA 3BIOA 5MN5A 1LV7A 4CL8A 3ZR4B 2J5QA 3G5TA 2QENA 4EGAA 1OWPA 3TB4A 3GRKA 1CYEA 2FZGA 3CLHA 4CKWA 4WIAA 2ASVA 4QTZA 4F6LA 3PI6A 5LXTB 5JTUA 5LP6B 2TS1A 2ZYHA 3A9TA 4RCYA 2OHOA 5L7TA 2NUAB 3UANA 1IPHA 2OTCA 3GC6A 3MUFA 1WCYA 3AF3A 4YI5A 4DZRA 2XB8A 1PBTA 5J2TA 4RGBA 4AJIA 4M99A 1Z6GA 5FWAA 3RLIA 1VP9A 2GO1A 2ZJ2A 1V5GA 3AOEC 4FE7A 3KSAC 1TUBA 1MOSA 1HBJA 4AP5A 4FEGA 2AH5A 1IIRA 3BD8A 3I0MA 3PA8A 3S81A 4IIFA 2VCEA 4TV8F 1R9NA 2BI8A 1HDZA 5BYBA 4JIMA 1KJZA 5THXA 3ZV7A 2I6XA 2QJOA 4O59O 4IXDA 5JD6A 1G1MA 1KQNA 3MWDB 4EYKA 7MDHA 2EQAA 2PZFA 3QXJA 4I4NA 5AM4A 4GI5A 2N0SA 4LZNA 4G0XA 3HRHA 4ZAVA 4AY6A 2QGFA 4H7PA 4MVYA 4IS3A 3UHOA 1FYWA 3PUZA 3TLYA 4D80A 3BF7A 2IXGA 3CB4A 3R40A 4WLOA 4AJ4A 1GTRA 5FOWA 4KFCA 1F4VA 1CR4A 1Q77A 1EK1A 1W85B 3DDSA 3I92A 1ADFA 2BL4A 5DM1A 1GKIA 2WWFA 1T3LA 3Q5EA 3QYJA 5BN3B 1G9XA 1JFTA 4HMOA 5CT4A 1VGQA 4MYCA 2QSZA 3N5KA 3KQVA 4RS4A 4X8OA 5DN6D 1TA4A 1QX3A 3DWGA 1UINA 3IV7A 4PG6A 1UXJA 3LH5A 4QYMA 4YP9A 4F5EA 4F5DA 4FDMA 4XRGA 2PJDA 4YJDA 5G3YA 4ARBA 1J5EB 2B83A 4QPZA 2HU5A 3JTEA 1IN7A 1FQJA 2VUUA 2YZKA 3AI3A 3CUUA 3KKMA 3PIIA 4LOHA 5EKSA 3TZHA 4E0BA 5KSYA 5C8YA 4B4KA 5FWXA 1VJGA 3A6EA 3WK9A 3ZBQA 4W4TA 1XJ0A 3CJQA 1OLSB 2QL6A 2QTCA 3GGGA 3JD4A 3UNXA 3W2HA 4YMGA 2AXNA