1VQ5I

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vq5I00
1QA6A 3I56I 1VQNI 2ZJPF 3DLLF 1S72I 3G4SI 5GAEJ 3CMAI 3CF5F 1FOXA 3CC2I 2JQ7A 3G71I 1YIJI 2OTJI 5GAGJ 1VQ7I 3CCEI 1VQPI 3PIOF 3CCSI 3CD6I 5DM7F 3G6EI 1VQ5I 1FOWA 1Y39A 5GADJ 2K3FA 5DM6F 3CCLI 3CCMI 1VQMI 1YITI 4IOCF 1YJWI 3CC4I 2H8WA 1HC8A 2QA4I 2OTLI 1YI2I 3CJTB 5JVGF 1VQ9I 2E34A 1VQLI 1VQ8I 1FOYA 3PIPF 3CCVI 4IOAF 1VQ6I 1YHQI 1VQKI 2FOWA 2NXNB 5GAHJ 3CC7I 2E36A 1ACIA 4V19K 1YJ9I 2QEXI 3CCQI 1YJNI 1VQOI 2E35A 4IO9F 3CCJI 3CMEI 3I55I 3CCRI 1MMSA 3CCUI 3J7YJ 4UY8I 2ZJRF 1VQ4I 2ZJQF 3J7ZI
chains in the Genus database with same CATH superfamily
3QYEA 1R9TJ 3ECOA 3HOXJ 2Q2EB 4FT8A 2BGCA 3SQNA 5IY5H 2AQEA 3IP4B 1SVOA 4XRSA 3AAFA 4EM2A 2ID6A 2OAZA 4OAZA 1Q1VA 5D4SA 5JHFA 1W0TA 1FSEA 3M1EA 2JA8J 5CVIA 3BJAA 5CKTA 4NBQA 1ZN2A 2N8GA 4JK1X 4UB8C 2EA2A 3GFMA 1JGGA 2DMNA 1WJDA 5FRNA 2HXOA 2M9HA 2VJ5A 2ZMEC 1BI2A 2NVQJ 3GCMA 1F36A 3LA2A 4PSWA 4BE2A 3K4LA 4FQGA 1LPQA 2CV0A 2V9PA 2FE3A 3FM5A 4ZH4F 1NHAA 1T95A 4A3FJ 1YTYA 1RI7A 3IHUA 1PYVA 4CXFA 2QQBA 3DLAA 4HNVA 2PFBA 2Z2SB 4H4KC 4AM3A 2R7TA 5D5UB 2VONA 5E1ZB 2DT7B 4CDGA 1B8IB 3ZMUA 5J8FA 3IL2A 4RB1A 4F93B 2VASA 3LSMA 3I9V2 2TCTA 3R61A 2PBIA 2EV6A 3K4BA 4BJTA 2I8DA 2WC2A 2HVRA 5C4XJ 4ASNA 3OS2A 3T5XA 3HJEA 1MGTA 1X58A 1S9HA 5HS7A 2LC2A 1B9MA 2VKEA 1O4XA 4PSXA 2IS2A 2R3SA 5FKNA 4EMSA 1LQ1A 2UXXA 4D1QA 3DKYA 3OYEA 1HCRA 2R7UA 4XIDA 4EV0A 1B9NA 4YRVA 5BQTA 2CGPA 4K2EA 1BW6A 2IEKA 3L1PA 1MNEA 4QWQA 4QPQA 5H2FC 2KIUA 4IQ4A 1ETOA 3DPTA 4N9HA 3CCQI 2R7FA 3CUQC 3RZDJ 1TW2A 1HW5A 3D1NI 1T2KA 1Y8QB 2ZO4A 5J40A 4DZPA 5IPAA 2JA5J 2Y31A 1ZG1A 4KITB 1LNWA 4MLOA 1SAXA 1O57A 1KA8A 5DEQA 5L3DA 5JLWA 4FETA 4NC6A 3W6KB 4M3FA 1MKMA 1K6OA 3GTGJ 1ZRCA 2BY1A 3VSKA 1S5LC 2Y0SA 4PUSA 2Y0MA 1BC8C 2RDPA 4DNCA 2DA7A 1FTZA 1SANA 1IUYA 1HDDC 5FD5A 2O0YA 1T6SA 1UZCA 4HQMA 4XRMA 2HYGD 1OCOH 2HDWA 5JFRA 2XAGA 1D5YA 1H0MA 2DLLA 2L01A 1DU0A 1O7FA 4JX4A 4BY7J 2KKOA 1BW5A 1FWZA 4ESFA 4I02A 3S32A 3D5SC 1X3ZB 2RAEA 1VFCA 2BE5F 5C3EJ 2X6OA 1X4OA 2IS1A 3S16J 4Y7NJ 4ZDLA 2FMYA 3K10A 2BW3A 1D5VA 1ZR4A 2JA6J 1EV7A 2FJ1A 2LNBA 2X51A 3H5NA 1SFEA 4S04A 3LSPA 3B02A 3DTIA 2PX9A 2F6CA 2EBIA 2AS5F 1VQ5I 2X1DA 3LSJA 4CCJA 5D5VB 4L0ZB 2VPLA 5DD8A 2DXIA 4EEFG 3PUBA 1YO5C 2VOOA 3ZOBA 2RN7A 1HKQA 2ZJ2A 3JTGA 1H9GA 1GV2A 3V8LA 1X1CA 3RPQA 4LIUA 3DP7A 3Q0UA 1VQMI 2M0MA 2YSRA 3OYIA 1ZH5A 2ADUA 5C44J 1G59A 2VPRA 3MVPA 4RAZA 2B7EA 4HDVA 3F21A 4IF4A 1TTYA 4AIJA 1Y1WJ 4Z2YA 1IN8A 2QUFA 3AFHA 1IXSB 5J6XA 4XRFA 3J81K 4E7ZA 2QSFX 4LGWA 4HDUA 3W6VA 2D1HA 4XSXF 3E97A 2B0LA 2IS4A 3PIPF 4D5FA 2A6TA 1YFHA 3WE2A 1YHQI 1R71A 5ILVA 3HOSA 4PK4A 3IWZA 5EG0A 3K1PA 3RQ4A 4AYBA 1XC5A 3CP2A 2NVYJ 2ZXWH 2E5ZA 3RKXA 3LSIA 3OYNA 3QOEA 1Z21A 2CQQA 1UB9A 1YJNI 1XTAA 3IC7A 4RAYA 3OYHA 5JR3A 2COMA 3CP8A 3TBIA 2L54A 1T0FC 3F8CA 3FXLA 1S29A 1Z6TA 3P5JA 2XF6A 3S3MA 3ZQGA 1YW9A 2Z5UA 1IW7F 1BN5A 2VODA 2ZBKA 2Z16A 4W97A 2GXBA 4PCQA 3GFIA 1EH7A 3UNGC 1B6AA 2L7FP 3DBRB 1MDMA 3MMYB 2R7OA 1QA6A 1QVTA 1XSVA 1D0ZA 2O61A 9ANTA 2JVHA 2EZIA 1S6LA 2FX0A 3ZCOA 3S8PA 4LD5A 2DYRH 5F04A 4KUMA 1LB2A 2L5QA 1EJ9A 3Q9SA 5KAIC 2O7OA 1MMDA 4HAMA 2WWYA 2V79A 4EJOA 3L7WA 1HQCA 4GXOA 2IBDA 2BW3B 4YFKF 1APLC 2LSOA 5LEKA 4HF1A 2EZKA 2L4AA 4Q48A 2LKXA 2DA2A 3HXLA 3H92A 3DPUA 3CUQB 5DTDA 2P5LC 5FKKA 3MKYB 2XGCA 1W5TA 1TT5B 3HRMA 1JKRC 4O6JA 5J4YA 3PO3J 2VLAA 1OR7A 4IHTA 3FF5A 1L0OC 4BKXA 4B4CA 1I1GA 4PJ0C 1FX7A 5DCMA 2V9KA 4IX7A 1XB4A 2K86A 4Y52J 3OIPA 4WF2A 5EDNA 1FOWA 4CA0A 3BP8A 3ABLH 2M87A 2K3FA 4QSHA 5DM6F 3F72A 3HSEA 2DAOA 2PEXA 1ZK8A 3WHCA 2QGUA 4LLGF 2LLKA 1VTNC 1AHDP 4RB2C 2WAQN 5J47A 3U21A 3HC7A 1D1AA 3TO9A 3HOUJ 1FT9A 3ONQA 4A3MJ 2HGCA 1WCMJ 4CICA 5EG0B 4CZZA 2ZXJA 2F5VA 1S3JA 1FLIA 3I59A 3GTMJ 2Y30A 5LEJA 4PJMA 2K4BA 5KVRA 1XMKA 3C7JA 1VI0A 2A5YB 2K3PA 4HA8A 1U2WA 4IJAA 2C6YA 3M8JA 5JVTA 2HTJA 2I5UA 3O8HA 1R1UA 2ECBA 3F6VA 1QZZA 3PO2J 2KHMA 4PFPA 3WGIA 3H3ZA 1X4PA 1ETXA 2LBFB 4WK8F 1KU2A 1A6QA 1Z9CA 3GBGA 1R4NB 3IUOA 5J1YA 4C2TA 1VZ0A 3C2GA 3K0LA 2XSJC 1OKRA 1YX5A 1LJ9A 1D8JA 1XGMA 2QBYA 5ICEA 1MH3A 3TW6A 3GTJJ 4N9IA 4DYCA 4G94A 2G7UA 2J5OA 4HV5A 3QPHA 5HDNA 3VODA 3MKZA 1VQ4I 1JUSA 2FRHA 4GFBA 2XIGA 3O6BB 5IT9K 2M5WA 3VYTB 4OIOF 2CYYA 4I7HA 2XAFA 1XMXA 3ABTA 3ZQLA 4KISA 5FKOA 4IRIA 4MFEA 1MSFC 4QIWN 4A6DA 2KFDA 5FFZA 1QNTA 2XUBA 5LGTA 1DP3A 2D2WA 2CV1A 5FLXK 3RKWA 2M7BA 2EB7A 3BR5A 3F9KA 5IOYA 4CYCA 2MGQA 2A07F 2XB5A 2RQPA 5ERIA 3ZN1A 4OIQF 2OBPA 3I64A 3WGGA 1TWHJ 1F43A 5E8IA 2P8TA 3HUGB 2R0QC 2P7CB 5E8GA 1AKHB 2UZKA 2M4GA 2LKPA 4HSTA 5GAGJ 2LP0A 3JR9A 4IPAA 1I1SA 3IV5A 3BR2A 3RI4A 1E0EA 3BR1A 3CTAA 3G6EI 1TBXA 3PNVA 2K9MA 3VFZA 3TDUC 2HU9A 4MQ9F 4BE0A 1JKQC 5HS9A 5HLGA 2XB0X 4HNUA 1YRNB 4XOTA 4LK0F 4LLNA 2ACJA 2QM3A 3TP0A 3ZQHA 4PDKA 4RGXA 4ZYEA 2EFWA 2DFHA 3GVAA 3T8TA 2UWMA 1WJAA 4MEXF 3OYLA 2DA4A 1YX3A 3FXJA 4CCNA 5EGOA 1G3TA 3TOAA 1S8NA 2HOTA 4BQOA 2LF7A 3G1OA 1B72A 4HPQA 3FM3A 1IG7A 3MN2A 2FF4A 2RREA 1TC3C 1VQ6I 2R7ZJ 5K7FA 2DMUA 1HSTA 4TV7A 4KMFA 3H5RA 2QBYB 1KYWA 2ZNZA 5CQEA 1ETYA 3PJRA 2VQLA 1MJ9A 2LRDA 5IP9J 1R5GA 5HVQC 2BHZA 3C2HA 4DIQA 3L2RA 1K61A 1OYWA 3CJRB 1D0XA 2CQKA 5K5RA 1RPWA 4LG3A 4PZJA 3BT9A 3K2AA 2F5FA 4F92B 3LNQA 3CLOA 5KAFC 2M0CA 1UCRA 3S2DJ 1UJ8A 2WA0A 4KT6A 1RETA 1F9NA 4KFCA 1WJBA 4DBQA 4PGHA 2A6EF 2ESHA 3PQKA 1USTA 3BG5A 2LH9A 1ZRFA 3KYDB 1BOBA 1DQUA 3FWEA 4CYCB 3IAS2 1MW7A 5FJ8J 5E79C 4LG0A 5CVJA 1Z3XA 2E2HJ 2UV1A 3IAM2 4BXUA 2A61A 4E4HA 2O3FA 5CQGA 2ZSIB 2HQ5A 2M3AA 2G7HA 2WBMA 2XAQA 5L3FA 3BWGA 4WXHA 4D7NA 4L9TA 3BCAA 4F7ZA 3WTZA 1JKOC 4H0EA 2KZGA 3L00A 1I3QJ 1WVRA 4M6VA 2X6WA 4LB6B 2E7WA 1U3EM 4L5JA 2X4HA 3OL4A 2JPCA 1HBXG 3QPSA 2BXZA 3SDBA 4KNYA 4BQQA 2HQAA 4FASD 1Z6RA 2XHKA 3QU3A 3SZTA 3GX4X 4UUTA 3GTQJ 3ERMA 1GXQA 3VOEA 2OU2A 1DPRA 3J7AY 1IDYA 4JBAA 3CCSI 1IN5A 1MMGA 2FD5A 2XPVA 4WX9A 2QF7A 2A69F 1A35A 5J3LA 5M3FJ 4V2FA 2HQRA 3LWFA 2HVQA 1W7PB 2VL8A 1E3PA 2DQLA 3HZJA 4XLNF 1REPC 2OZUA 1ZLKA 2P7VB 4BBSJ 1B72B 4RM3A 2DA5A 4M6XA 5E17F 2L7ZA 3LOCA 3VPRA 5HODA 3KP7A 4FE4A 2Y0SN 1ZGWA 2Z99A 1PUFB 1Z7UA 2DODA 4KDPA 2ZFUA 1OCZH 3A0HC 3PUFA 1EKEA 3L9FA 3F23A 1O7LA 2EFPA 3LSHA 1GV5A 3RPUD 3OYBA 2EQRA 3BROA 4MHGA 2A68F 2CW0F 4NHJA 1MBFA 1ODDA 3F6OA 4EM0B 2NRAC 4Q47A 4GDFA 1X19A 4AC0A 2V6EA 2MBFA 3CC7I 4HLYA 1XDSA 3T8RA 3S1QJ 2GOMA 1WHUA 3OYJA 4KMUX 3L2UA 1R23A 2QKLB 4M71A 1FMVA 3W6JB 3J80Z 1SD5A 4XL9A 3MAJA 4CUGA 3KYLA 3FBNB 5FB2A 1BI1A 4E7JA 4ESBA 3QRFF 4RLQA 1TT0A 1X1AA 5L3GA 4AVZA 2ME0A 3GLXA 2ZJRF 4V2GA 1ZREA 1QHGA 3HEFA 2QKMB 4Z6YA 5J4VA 4BACA 3H35A 4J00A 4BJ6C 4XKVA 1GT0C 3BG3A 1DGRM 3CLQA 2H94A 3S3OA 1FJLA 2E71A 2Y69H 2JUCA 1KU7A 3ZN0A 4CYDA 3KEQA 3G4SI 2MLKA 3RDIA 2MH9A 1LEAA 3QAHA 4NC7A 4C30A 2ZSHB 2R7DA 1FY7A 4KICA 4A3GJ 2IT0A 1ZGAA 3N4MA 3K9TA 3L09A 1MNDA 3F8BA 5H6QA 2GWRA 5CVUA 1U5TA 2CWEA 4MFDA 4RS8A 1ONVA 4GO1A 3I0TA 3H9QA 2H27A 2VN2A 1MMNA 1Y8RB 3Q9VA 3FMRA 3G71I 3WTSC 3S14J 1ULYA 2DJIA 1VQPI 1NK3P 1QVUA 1IRZA 2IRFG 1SFUA 3PFIA 2IPQX 1KQ0A 1UHWA 4G12A 4ANJA 1X2NA 3MD2A 5A2QZ 2DDAA 4XLFA 1HDPA 2LY1A 1FMWA 2M34A 2VC0A 3LL7A 3RTRA 4QLCU 2OQGA 1I39A 1ZYRF 2IA1A 4Y15A 3ABUA 3ZMZA 2Z3YA 3HTUA 2KIMA 4PFOA 1IDZA 4IOCF 4YIIA 1Z1DA 3GEZA 4NC8A 3R6SA 2IA2A 1SFOJ 1BC7C 2H8WA 2XV4S 3ULQB 2WAFA 3SJMA 2GXAA 2H09A 5JVGF 4Y33A 1JJ8C 1X2MA 1RKWA 1T38A 3DFGA 3FHZA 3JSPA 4KN4X 5FO5A 1MZBA 2VQGA 3F3XA 4IOAF 2W4SA 2KIQA 4Q4ZF 3VYSB 2L4MA 3OYCA 2MC3A 2RC4A 3G3ZA 1FBSA 2P5VA 2FBIA 2ICWG 2NXNB 3I58A 3KZYA 3M07A 1H88C 2QSGX 3SEZA 3HYIA 3JRDA 2HTSA 4AU7A 5FKLA 1Z91A 1RKTA 2BBYA 2DOAA 4ZTFA 1B59A 2HYJA 3VWBA 4ZJZA 2ELKA 1R1VA 3SDGA 1LUJB 3H9JA 2M7AA 2ZXIA 3A2KA 3L2QA 2LG4A 3FXKA 2L3DA 3P9IA 3FKJA 3EUKL 4FHTA 2MA3A 4CZCA 4R8HA 1ENHA 1J2XA 3GWZA 3O8GA 5DCFA 1GDTA 4M3DA 2JK3A 2GIZA 3GZNB 3A4CA 2HXIA 2JA7J 3HSRA 1HOMA 3QYBA 3NWSA 2NYXA 1RZ4A 2GXGA 4RMNA 4Q5SF 1V54H 3K1MA 2XGDA 3FXMA 3HBLA 1U5TB 4P5OA 3GXOA 3GTLJ 3DWLE 3CDLA 4F91B 3OIQA 2NOJB 2E1NA 3PNYA 4ZYHA 5K7ZA 2R7SA 4JX6A 1YG2A 2V1DA 1BBYA 3HOVJ 3F8NA 3NEUA 4HLXA 3LQQA 4BXFA 2VOPA 3VB2A 1T8IA 2CS3A 3QPTA 3K70C 4J19A 2LREA 3W2VA 2JN6A 3NWTA 4M73A 3CC2I 1J0RA 3WTTC 1LFUP 2X9DA 4YIRX 2R93J 2Z9OA 1G3SA 1PUEE 4G6TB 1WSUA 2HI3A 3BG6A 2VBXA 5FLVA 2FQ4A 3ZQQA 1ZELA 2OC6A 2ISYA 3H0DA 3E6CC 1BIBA 3K6GA 5CVRA 4HF2A 1IN6A 1TWGJ 3R0AA 1FP1D 4CCOA 2XGXA 5J1UA 1I27A 1YE9A 2M30A 2HR3A 3V4GA 3TP3A 1N77A 3U9GA 1IV6A 1U8RA 4G7HF 4CH7A 1XCBA 2ZXHA 3OOUA 5M5YJ 1WJ5A 1W1WE 2JWTA 1PP7U 2NAZA 3KP2A 3RSNA 2NS7A 1XX5A 1D1CA 1K4TA 2P6SA 3ZMVA 5E3MA 2AXLA 4A5MA 2HNHA 1H8AC 2VE8A 2V6CA 3MCZA 3ZGKA 4RM2A 3DQVC 1WJFA 3WTXC 5E3LA 1QHHD 2FUG2 5E1XA 2CW8A 4DGWB 2FA5A 4IHXA 3AG3H 3Q0VA 3JRFA 4DYRA 1UG2A 2PG4A 2X1CA 5K1YA 4EGYA 2P5KA 3UR3C 2DA6A 2DQRA 2H6BA 4G8XA 5L3CA 2CG4A 1R5ID 2LFBA 3HIFA 3OYAA 2UXNA 2TRTA 2OCCH 4EVIA 1KGSA 2VJJA 2A3SA 4RBOA 3E7LA 2BHYA 2QLZA 4YFNF 2F5EA 3IRQA 4CCLA 2A5WA 3S2HJ 2E35A 5D6FA 1K78A 4OMYA 4ENJA 1HF0A 2DO7A 2NNYA 2KLOA 2IA0A 2VKDA 3I55I 2R5ZA 1Z05A 2GZWA 3HKZA 3DBHB 2Y9YA 4C3HJ 3BPXA 1UHMA 2DK8A 1OR7C 1UELB 1X3UA 1MJBA 2NS0A 4UB6C 4AUXA 1P7IA 2V1XA 2HOAA 1BOAA 3S1RJ 3JSOA 2H1KA 2FEZA 1RIOH 1N78A 3SHFA 3W2AA 5LD2C 3IRRA 1X3WB 1NH3A 4HNTA 2L2OA 3BCBA 4BDZA 3TL4X 2HKXA 3RJPA 2KP6A 5BPDA 3NAUA 4F3QA 3HPHA 5E3NA 4ZYAA 2XAJA 3FXQA 1BR2A 2RNJA 1UHSA 1JUMA 1VNDA 1X1DA 2JQ7A 1EF4A 2YU9J 4DQ2A 5IT3A 1GXPA 4N4NB 5F64A 3P7NA 4G9YA 1DP7P 4QTRA 3X2QH 2GQQA 4LOCA 3BC8A 3OYMA 1EH6A 2WB1N 4G6QA 5EEAA 4A3DJ 4KIBA 4M3BA 4U0VA 3HG9A 4E7SA 4B3AA 3HOYJ 4EATA 4N4OB 2XRNA 3BQYA 5D5WB 1IF1A 1B1BA 3IWFA 1YJWI 3BG9A 2CUFA 1JJ6C 4LITA 2ZB9A 4AVPA 1K83J 2PMHA 3GLLA 1XG1A 1RR7A 1OLTA 2W7NA 4HG2A 4BHBA 4BAYA 2W84A 1U78A 1PP8F 5CVVA 5DD4A 2RGVA 2PI0A 3RYPA 2UUZA 4YELA 1K78B 3IH2A 1R6RA 4UNOA 3WE3A 2R7RA 2O9LA 1W7PD 1W4MA 3NRVA 2VB6A 3I71A 3JRGA 3UKGA 2R5ZB 2EV0A 4GYGA 2K9NA 2D45A 5FRMA 1MBKA 5E1WA 5HDKA 1XCVA 3HRTA 3BLYA 3HGGA 3F8MA 3A02A 1VQOI 2KISA 4E7LA 3E5QA 4ETSA 1WJCA 3BR6A 4MQVA 1GHCA 4KIGA 3R60A 2EH3A 5LHIA 1OYYA 2D5VA 3KEYA 3N05A 3LFUA 1WZ2A 1L3LA 3CQZJ 5EZHA 3S17J 3WU2C 3SZGA 2IXSA 4GYIA 1IRFA 4C2UA 2YR2A 2M8EA 3TDZC 3E5XA 1P4XA 1X1BA 1NG6A 3LA3A 1SFXA 1MDMB 4W1UA 2CUJA 1S72I 1K6YA 3BPVA 4XN0A 3GYHX 2VXZA 4BDYA 2HDDA 5EEGA 1FZPB 4XNFA 3QP5A 3HTSB 4O5VA 2XASA 3HPGA 1RUOA 1P6RA 3ABMH 4JP0A 2DFEA 1SMYF 3I54A 1MJAA 1YOVB 5GTIC 5M3MJ 3CF5F 5HNFA 1IC8A 2G0EA 1SFKA 2BY0A 2R7XA 1I50J 4DJAA 2XKPA 3DXJF 3AG1H 2V4JC 3EUHA 3M1CA 1P92A 3KZIC 1RRJA 4CGZA 2DDBA 1IXCA 5K5QA 2DFIA 4U0WA 3CCEI 3TEDA 4BQNA 2XF5A 1ZTRA 5D4RA 5B1BH 3U2RA 1OISA 3OL3A 1ETQA 4ZC3A 2CMPA 4OIRF 2FMLA 2QYOA 5EEHA 3K1NA 4HX8A 3NQOA 5DCMB 4L9VA 1YYVA 4L18B 2ZC2A 2F4IA 2CFOA 2DMTA 2YX7A 4RB0A 5IYCJ 1ZHFA 1XGSA 3ABKH 1W36C 2VJ4A 2H1LA 5LFAA 2P0WA 2WY7Q 2JA2A 3COAC 1V5GA 4BBRJ 3OSGA 2IS6A 5FKMA 1OCPA 4A3IJ 2Y75A 5L3EA 4MNUA 2CUZA 4IQJA 2YX4A 4MTDA 2KMUA 3DCFA 3KX2A 1IJWC 2JRTA 3P9CA 2LVSA 2XPUA 4B1RA 2IGMA 3F0CA 1MBGA 1ZLJA 2JUGA 3QQAA 3E1SA 4UXNA 3JAMK 2DPUA 3I59B 3MZ8A 4M74A 1XN7A 4KA4A 3FXOA 3EUAA 3GO5A 3FDYA 2F48A 1ZR2A 1ACIA 3DF8A 3HL2A 4UVAA 4YIFA 1YJ9I 3GFLA 4LMYA 4DW6A 5B66C 4R79A 1FIPA 1FC3A 4Y13A 3G73A 3CDIA 5DUKA 3M8EA 3QU6A 1J59A 2PMZA 3CUOA 3FX3A 1DGWY 2K4JA 4C9YA 3W3CA 4HX4A 3TMOA 4X0GA 3TW7A 2BXYA 4XLCA 1FNNA 1Y0UA 1F4KA 1T98A 1P7JA 4M9ZA 1ETKA 3FISA 5A2QK 4A3CJ 3CCYA 2NVXJ 1A31A 1R58A 2JPBA 2ZJQF 4RB3C 1LVAA 1M1EB 1BR1A 2FSWA 3JRAA 3EETA 4A2UA 2PJRA 2VQHA 2IAIA 2ZJPF 3GTKJ 5LRSA 1QO0D 4B09A 2F4OB 3R4KA 2L9NA 1TNSA 4XLAA 1A6IA 3K4CA 3MWMA 4RAFA 4QPOA 4UV9A 1JUPA 2VT2A 4ITVA 4UVBA 1MD0A 3BR0A 1D8KA 1FSHA 5F08A 4RA2A 3CJQB 3LSTA 4II3A 4E7IA 3HM5A 2CRGA 3M9AA 2DPDA 3L2WA 4NUBA 2O8XA 2DOFA 3DEWA 1YIJI 4XKCA 2GBYA 5KK1A 5ILUA 1LVKA 4KYWA 3CJNA 2HWVA 3AL0C 1XPXA 4BEHA 3ZQIA 4IRHA 5ICFA 1GVJA 2IW5A 3FXRA 1JHHA 4B44A 2DI3A 4UHTA 3U1KA 2L02A 1XMAA 3LAJA 2F5CA 2EINH 2LYCA 4M6YA 3BTLA 3FKIJ 4NDLA 3D5RC 4FX0A 4NQWA 2QSHX 2G9WA 2W1OA 2MABA 3OMYA 2OUMA 2JVGA 5LHHA 2FBKA 1SC7A 4RLFA 4XSZF 1O3SA 1DDNA 1IUFA 5LGNA 3HRUA 4L0YB 4ZZLA 1FP2A 1EH8A 1TL8A 3E0JB 1NK2P 2OTLI 5F27A 4HOBA 3T1BA 2CU7A 4G7OF 1T56A 3F8FA 1U0JA 3C3WA 3BZ6A 5H6RA 3KETA 2WAQA 3HHHA 3O3KA 1KZHA 3REOA 2JZYA 2V26A 2KPMA 3ZPLA 3S15J 1IZ1A 4BHPA 4YEJA 3BZCA 1WFXA 3TGNA 5EGOB 2WV1A 1LE8A 4JQFA 4WCGA 3B6CA 1JE8A 3ZXSA 3GTOJ 1MSEC 2ISZA 2Y9ZA 3AKZA 2O6GE 2JT1A 5BOXA 2OV7A 4UVCA 3RIRA 1IRXA 4HBLA 1R22A 4FE7A 4J01A 4I99C 5IYDJ 1Z0XA 1QZYA 3MKLA 1U5TC 2Q2EA 3A03A 2P6TA 1BA5A 2Z1DA 2MW8A 2DTZA 2DU9A 4UY8I 5HS8A 5GP9A 4I09A 3MFKA 1V3FA 4JX5A 5B3SH 1H9TA 3DTKA 3M3YJ 1KQ8A 3QODA 2GIVA 3WTVC 4BL0B 2BVMA 3S93A 1IAWA 3ZP5A 1MIJA 2QCOA 1R5HA 1R7JA 5KHDA 2KL4A 3R0JA 2E2IJ 4II2A 1XSXA 4XRSG 2Y48A 5BMZA 1OPCA 3QPLA 5GAEJ 4I6ZA 4UUVA 2DN0A 4LG0B 4IHWA 3SEQA 3WODF 3V7RA 4BEHB 1UFMA 5IT9Z 2GAUA 3LAPA 3KFWX 1J09A 3GZ6A 1EA3A 3OV8A 3BZKA 1JT6A 2ZFWA 4ZYGA 2MYSA 2WADA 2VQCA 2HS5A 3FK6A 2OTJI 4R1HA 1VQ7I 2DT5A 1A04A 2E60A 5TJJA 3OWTA 3PM1A 1LDKB 4RDUA 1P2FA 1ZARA 5FLXZ 3OSFA 1G8XA 4B8XA 2CH0A 3DEEA 4CSWA 2PN6A 1B8IA 4BQAA 1JI8A 2FOKA 2GOXB 2HYFA 2K7LA 3WG7H 2VT3A 4F55A 3CCLI 3BDDA 4EGZA 2Q1ZB 4XLEA 1QBJA 5DS9A 1O3TA 1HW2A 3TOBA 2CW7A 4C3IJ 2LTPA 2L0KA 2W82A 2KIFA 3E6MA 5JHUA 3V8JA 2KRFA 3T0YA 2R5YA 4IEJA 4C2MJ 1HC8A 2LD5A 3BTJA 5DV5A 4AYBN 3M4OJ 1FBUA 1ZG3A 2DMPA 1LE8B 5IOZA 4OOIA 3JCUC 4ZDPA 4IXAA 2F4MB 2P4WA 1AWCA 3BTCA 3W2WA 5D6EA 2E34A 2TDXA 2V9VA 3V8KA 1RR8C 5F0HA 1D0YA 3C1DA 2ESNA 2X6XA 1J9IA 3LFKA 1TNTA 3FHNA 3SZPA 3BOQA 2EIMH 4BYYA 2VBYA 3CMYA 1ZQ3P 2BOLA 1J75A 2MLGA 5AIPA 3E6DA 4XORA 2VKVA 5GAHJ 3AL0B 1R36A 3KYCB 5D5XB 1D3YA 4LLLA 1FEXA 3U1DA 3FMQA 1TQMA 3GTPJ 3A1YA 1IN4A 4U87A 3WU0A 1Y6IA 4LFUA 1SD7A 3VDXA 1MBJA 3ASOH 3ZQ7A 2K9LA 5KNLA 3E6BA 1QRYA 2DMQA 4AIKA 2NVTJ 4IVNA 3K4KA 1RUNA 1P4AA 3VEPA 3K70D 2ZCWA 3AG4H 5K7HA 5M5WJ 3SYTA 3J7YJ 3L2VA 5C4JJ 2Z33A 2ZKZA 2E19A 4AIDA 1Y56A 2OA4A 5HLTA 3KEOA 5JI6A 3I56I 3L2CA 4EJVA 1P4WA 4HEA2 4KIFA 4HRIA 3OYFA 1E3OC 2E7XA 1PDNC 5AIQA 2DW4A 4MIMA 4EJTA 1G2HA 4B43A 4WWCA 3SFZA 4BGDA 1SAUA 3RPUA 3FZVA 1TP4A 4IHSA 1TZLA 2CQXA 3GUDA 3ZR8X 2HOEA 2COBA 2M8GX 2LY9A 2NVUB 1N75A 3N97A 2YPRA 2BY2A 2MG4A 2HOSA 3KP4A 5B1AH 1CQTA 5J1RA 3EYIA 2A05A 3OYGA 2M45A 1XGNA 5F1JA 1JKPC 4D9JA 3J7AO 4XICA 1HXDA 4OINF 1I6HJ 3PIOF 4BU2A 2R7WA 3OOPA 2LOOA 3EDPA 3DU6A 1MNMC 3WHBA 4HV6A 1SVLA 5D8LB 3TQNA 2R5YB 4C3JJ 4U0YA 1S7AA 3JRHA 5DDGA 1FYLA 1UMQA 2HFHA 2HZDA 2B63J 4G6DA 2RVCA 3IH3A 5ILSA 4ABZA 1ZKGA 4U88A 5LLQA 3JRBA 5FFXA 1D1BA 2HKOA 4LIVA 2LKSA 5JLXA 1FYKA 2GA2A 2BZTA 5HLHA 1G6NA 5GPCA 4OMZA 5F1RA 4I0AA 2EILH 3GFJA 2VKHA 3GZ5A 3NARA 4KJZA 5CPRB 1YQAA 2ZMEA 3BR3A 3DV8A 5IP6A 5F0FA 4A3LJ 1VQ9I 2VUMJ 2FQ3A 5ICGA 5CJ9A 5HDGA 4WXDA 2X6YA 3I4NJ 1QQIA 3F22A 2Q8KA 2VC1A 3K4NA 3JREA 2YUSA 2IGKA 1VQKI 2ETHA 3HHGA 2FOWA 3RKYA 2E36A 1A5JA 1ETWA 3H3UA 1UG0A 2QQ9A 5E18F 3VYUB 3CO7C 3WTWC 1U9OA 1LDDA 5DUIA 1DU6A 2DT6A 2KQRA 2RNGA 3QWLA 3JRCA 5FD6A 4PJLA 4LK1F 2R7VA 1K79A 2HZTA 2CO5A 3EPZA 5BNGA 2JRMA 1LFBA 2X48A 3OR2C 3ERED 2CV2A 1A36A 4CCMA 1BM9A 1RC9A 5H20A 1G3YA 3JW4A 3CCJI 1KYZA 3MZYA 2H8RA 5LRRA 2H6CA 3DBLB 2BY3A 3B6AA 3KE2A 4MGRA 1GUUA 2XVCA 1I5ZA 1ETVA 3M8FA 4MTEA 3I4MJ 1MMAA 1U8BA 2EFQA 2IVMA 4RGUA 1ZG5A 1OCRH 1ITYA 1X1PA 1YLFA 2L7MP 1YW7A 1P9QC 1R00A 2AXTC 2LY2A 3KP5A 2V1NA 3CUQA 2JMWA 2O03A 1R1TA 2QVOA 3SFIA 2VIXA 3WTUC 1FOKA 4XMYA 3CO6C 2LR8A 2B9SA 5IP7J 1XS9A 1LEBA 2JJ7A 3KP3A 1XGOA 2VJIA 4M72A 2PJPA 1ZRDA 1O3RA 2HPIA 3Q5FA 4A3KJ 1W5SA 2L9RA 1SEUA 4XKWA 3IH4A 5BS6A 3E5UA 1IGNA 4E7HA 4ENNA 2O8KA 2FNPA 3OY9A 3BQZA 2CUEA 3AG2H 2JSPA 3BG7A 5FROA 2EIKH 4IRGA 4BJ5C 1MBHA 1WRJA 3Q0WA 2ZMEB 2FBHA 1WH7A 4A3JJ 1QPMA 1U9NA 2PMZN 1XDUA 4JOMA 3A0BC 4GGGA 5F0CA 4EJWA 4D7MA 3LSKA 3CC4I 2JSCA 2XAUA 1KONA 2QA4I 4I01A 2R92J 2XRLA 4HYEA 4FTHA 3S1MJ 2WV0A 1I6XA 3MKWB 1BL0A 5L3BA 3ISPA 3KZZA 3MZHA 2EZLA 2LBFA 1VQ8I 3SXYA 1BIAA 1FOYA 3RZOJ 4RGSA 2I10A 2IGNA 4N0BA 5ICCA 1TQIA 3WU1B 3S3NA 4PJJA 2OZ6A 2JTVA 1V5FA 1FTTA 1TQPA 2QENA 1ORKA 2X85A 3ZMSA 1QGPA 1RESA 4D5CA 4P9UA 4S05A 3MEXA 3MQ0A 2HPMA 4IL6C 1AA7A 4CO8A 4YFXF 4CHUA 1Z3YA 2RKHA 3FBIB 4AWXB 5D8KB 3FXUA 3HDDA 1WQ2A 1Y1VJ 1AOYA 1BI0A 1OMIA 4XKBA 2XAHA 2KJBA 4HZFA 2Y2ZA 3VYRB 3KP6A 4RGRA 1H89C 1JHFA 3HGYA 3CCUI 4A3BJ 4P55A 2W25A 2ZNYA 3HOTA 1F1ZA 4A93J 3EUHC 2OF7A 2L7KA 1Z77A 3H1CA 3GW2A 3QYFA 2D1VA 5TISC 4ENMA 4NB5A 2K5CA 3VSLA 3M7GA 1VQNI 3KLOA 4BHCA 1TWCJ 1PJRA 1R4MB 2LF8A 1ERDA 2AQFA 2QQ8A 2RV8A 2XDVA 4MEYF 3HRSA 1RNLA 2L9SA 3HUGA 1FYMA 1MH4A 1T0FA 4DZJA 1CF7A 3CMAI 1AKHA 3ELKA 5CYVA 4IHVA 1QZEA 3B73A 3JTHA 2BVLA 5F6FA 4HF0A 1LFPA 1V55H 2QWWA 1YW8A 1AU7A 1FPQA 5AONA 2R4GA 3CESA 4S0HB 5BPIA 1IN7A 5EZGA 1W36D 2K27A 3K69A 4M3EA 3DKXA 3A01A 4WXCA 1YRNA 1HKSA 1C0WA 2EA4A 5EF6A 3LMMA 3S2WA 2W24A 2CQNA 1HKTA 4ESJA 2BYVE 3D0SA 1YIOA 2WTEA 3DU5A 2STTA 1WI3A 3E3VA 2E1MC 2KDOA 2RQQA 3EQLF 5GPAA 3FMSA 4XR6A 5B5EC 1SVMA 2MSYA 2EK5A 4UUSA 1BJZA 1HW1A 3KPHA 4RAGA 5DYMA 1YI2I 1E17A 1G4DA 3CJTB 2E2JJ 2EFOA 3DKWA 4E70A 3DTEA 4AD9A 1HSJA 1U6GA 4L5EA 4LB5A 3J80K 4LJZF 4GCVA 5LGUA 1V5EA 4XK4A 3RKQA 2ELHA 4Y4RA 5EYRA 3DPLC 2VXDA 2DK5A 4P1WA 2V7FA 2L9VA 1Y0NA 1SMTA 2GA1A 3LA7A 4XOPA 1PVEA 4AIHA 1V4RA 1WJEA 3G2BA 3I53A 3IKTA 4I76A 4ENKA 1WGXA 4BY1J 4BXXJ 5LHGA 2DJNA 1E2XA 1WKMA 1POGA 4M3GA 4A3EJ 1YS6A 1USSA 2BV6A 3V7SA 5EJCA 4CCKA 1E3HA 3C18A 3WTYC 3ML6A 4EM1A 4HX7A 2P81A 4IO9F 4DOZA 2ID3A 1ON2A 4OU0A 3CMEI 4L9NA 1ZAOA 3CDHA 3CCRI 2YS9A 2M4KA 4P9FA 3JRIA 2DYSH 2PQ8A 5IYBJ 2DA1A 3K4JA 4L5IA 1IV8A 2VBWA 2OCEA 3WG9A 1FBQA 1CF7B 4EJUA 1JGSA 4E7KA 4XLPF 1I3AA 3J81Z 3S1NJ 2CQ7A 2NNNA 1TWAJ 1J5YA 4XONA 1XD7A 3OYDA 2VE9A 2M1BA 4XQFA 2XC7A 3A01B 2DTRA 1TWFJ 3ROUA 5E20A 2E1OA 1W5CC 2IGOA 1FOXA 2BEOA 2MD5A 2HEOA 2FNAA 2LK2A 4NNJA 1BI3A 3OS0A 3ECHA 3V42A 2EWNA 2XROA 2ECCA 3O2PE 1K4SA 5HLIA 1XSDA 4BH9A 5TRDA 3HOWJ 1W7PA 2LMDA 2YU3A 2NOGA 3IKVA 4I98B 4M9XA 1T39A 2AHQA 3P9KA 3RYRA 3CD6I 5DM7F 5K5OA 4ZZDA 2VBZA 2XKOA 3ZQFA 2MC4A 2OD5A 2XF7A 4BE1A 4G7ZF 4UUSB 1Y39A 2EPFA 5GADJ 4FX4A 2GLOA 4P96A 5FGMA 1PUFA 2A6HF 2HQNA 3BJ6A 3LSGA 4U7DA 2NS8A 3PNTA 4ZDOA 3CCMI 1YITI 1BJAA 4PJNA 4A12A 2W48A 4X6AJ 1OYIA 3BY6A 2EJRA 3PL8A 3KCCA 5LBQA 1WH5A 2WB1A 4XM3A 4F52A 3EYYA 1GVDA 3ZRGA 2KRHA 3CMMA 1N25A 3G1MA 2PLYA 3H9GA 2IJLA 2DCEA 4YG2F 1IRGA 2WAEA 3I4PA 2E1CA 5KCMA 3CCVI 5TGTA 1TLHB 4I0BA 4A0XA 2F2EA 2XPWA 4OWRB 3FIWA 1OJLA 3WGHA 3TO7A 2O5RA 4HSRA 1OCTC 1J7KA 3LQRA 4XBFA 3ZMTA 3D5LA 2F5DA 3K4MA 1ON1A 2DA3A 2VI6A 4L9JA 4V19K 2R7QA 3BJOA 2QZ8A 2K9QA 3G1LA 2QEXI 2CSOA 1YS7A 3K2ZA 6PAXA 1SD4A 3RCOA 4GRIA 1QU3A 3H0GJ 4ON0A 2DOEA 2KDZA 1G3WA 2FU4A 2E1MB 3HOZJ 5GTHC 2K02A 2EZHA 2MFZA 3TO6A 5HOOA 4HW0A 4ZTJA 1BR4A 1K7AA 1F5TA 4DBRA 3DEUA 4HQEA 2M2EA 4A5NA 1WPKA 2PMUA 2X1EA 4MO7A 3J7ZI 4A69C 1IXRC 3TKYA 1LKXA 2EIJH 3H36A 2XGEA 2V1UA 1KU3A 2HVSA 3KIOA 2K40A 3DLLF 1FIAA 3H3VK 1DPUA 5HNHA 1KU9A 3GMEA 3OIOA 1WWXA 2W57A 2X0LA 2Q0OA 3ZQCA 2PJRB 3GF2A 1QPIA 2CFXA 2OPTA 4U7BA 1VF9A 3K7AJ 2E5NA 2W85A 4BNCA 3BTIA 2ELJA 4IHYA 4A6EA 1OFCX 2J5PA 4OIPF 2CJJA 3HB9A 3ASNH 4FISA 3CZ6A 1STZA 1B4AA 4X1EA 4JYKA 4KT5C 4FCYA 3Q3SA 4Y17A 3OYKA 3PSFA 2LDUA 3LSRA 2MD0A 2OQRA 3CF2A 4M9SA 1DUXC 1HA8A 1Z7LA 2K85A 1SD6A 4OAYA 5FLMJ 2KJCA 1GLNA 4DYQA 1LDJA 2ME6A 2IP2A 1WI9A 5J8CA 2K9SA 3ESWB 2EV5A 1JXSA 2MH2A 1UAAA 1OQYA 3PSIA 3QOPA 4D0PA 1OCCH 1HLVA 1MBEA 4B47A 3I5UA 5CLSA 1CGPA 4NQWB 1T08B 2KRCA 3OR1C 3PQJA 2STWA 2XSDC 5ED4A 2OJED 4ZYDA 1VQLI 2DBBA 1JTYA 1S7OA 1JTXA 4BUPA 3ZMDA 4E6KG 4IKFA 1Z67A 1NG7A 2QQAA 1T33A 1TW3A 3C2BA 3H5AA 4PGGA 1W0UA 2AO9A 2WY8Q 3QP6A 2HDCA 4BS9A 3FK7A 2FXAA 3OS1A 3HSFA 1S7EA 2KT0A 4A0ZA 5E3OA 4XN3A 5M5XJ 4B48A 1JT0A 3HKZN 1R49A 3V7CA 4I2OA 4A0YA 2GM4A 4XLHA 4B3XA 2W00A 4UV8A 4EQQA 1KQ9A 3JAMZ 2KZVA 3KLNA 4KN7X 4IZZA 1NTCA 3RQIA 1IO2A 4O3MA 1MMSA 1O3QA 2EFNA 2DFFA 1ZGJA 4Y3OA 1Q1HA 3I3LA 3PFYA
chains in the Genus database with same CATH topology
1QA6A 3I56I 1VQNI 2ZJPF 3DLLF 1S72I 3G4SI 5GAEJ 3CMAI 3CF5F 1FOXA 3CC2I 2JQ7A 3G71I 1YIJI 2OTJI 5GAGJ 1VQ7I 3CCEI 1VQPI 3PIOF 3CCSI 3CD6I 5DM7F 3G6EI 1VQ5I 1FOWA 1Y39A 5GADJ 2K3FA 5DM6F 3CCLI 3CCMI 1VQMI 1YITI 4IOCF 1YJWI 3CC4I 2H8WA 1HC8A 2QA4I 2OTLI 1YI2I 3CJTB 5JVGF 1VQ9I 2E34A 1VQLI 1VQ8I 1FOYA 3PIPF 3CCVI 4IOAF 1VQ6I 1YHQI 1VQKI 2FOWA 2NXNB 5GAHJ 3CC7I 2E36A 1ACIA 4V19K 1YJ9I 2QEXI 3CCQI 1YJNI 1VQOI 2E35A 4IO9F 3CCJI 3CMEI 3I55I 3CCRI 1MMSA 3CCUI 3J7YJ 4UY8I 2ZJRF 1VQ4I 2ZJQF 3J7ZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QA6 A;  3I56 I;  1VQN I;  2ZJP F;  3DLL F;  1S72 I;  3G4S I;  5GAE J;  3CMA I;  3CF5 F;  1FOX A;  3CC2 I;  2JQ7 A;  3G71 I;  1YIJ I;  2OTJ I;  5GAG J;  1VQ7 I;  3CCE I;  1VQP I;  3PIO F;  3CCS I;  3CD6 I;  5DM7 F;  3G6E I;  1VQ5 I;  1FOW A;  1Y39 A;  5GAD J;  2K3F A;  5DM6 F;  3CCL I;  3CCM I;  1VQM I;  1YIT I;  4IOC F;  1YJW I;  3CC4 I;  2H8W A;  1HC8 A;  2QA4 I;  2OTL I;  1YI2 I;  3CJT B;  5JVG F;  1VQ9 I;  2E34 A;  1VQL I;  1VQ8 I;  1FOY A;  3PIP F;  3CCV I;  4IOA F;  1VQ6 I;  1YHQ I;  1VQK I;  2FOW A;  2NXN B;  5GAH J;  3CC7 I;  2E36 A;  1ACI A;  4V19 K;  1YJ9 I;  2QEX I;  3CCQ I;  1YJN I;  1VQO I;  2E35 A;  4IO9 F;  3CCJ I;  3CME I;  3I55 I;  3CCR I;  1MMS A;  3CCU I;  3J7Y J;  4UY8 I;  2ZJR F;  1VQ4 I;  2ZJQ F;  3J7Z I; 
#chains in the Genus database with same CATH topology
 3QYE A;  1R9T J;  3ECO A;  3HOX J;  2Q2E B;  4FT8 A;  2BGC A;  3SQN A;  5IY5 H;  2AQE A;  3IP4 B;  1SVO A;  4XRS A;  3AAF A;  4EM2 A;  2ID6 A;  2OAZ A;  4OAZ A;  1Q1V A;  5D4S A;  5JHF A;  1W0T A;  1FSE A;  3M1E A;  2JA8 J;  5CVI A;  3BJA A;  5CKT A;  4NBQ A;  1ZN2 A;  2N8G A;  4JK1 X;  4UB8 C;  2EA2 A;  3GFM A;  1JGG A;  2DMN A;  1WJD A;  5FRN A;  2HXO A;  2M9H A;  2VJ5 A;  2ZME C;  1BI2 A;  2NVQ J;  3GCM A;  1F36 A;  3LA2 A;  4PSW A;  4BE2 A;  3K4L A;  4FQG A;  1LPQ A;  2CV0 A;  2V9P A;  2FE3 A;  3FM5 A;  4ZH4 F;  1NHA A;  1T95 A;  4A3F J;  1YTY A;  1RI7 A;  3IHU A;  1PYV A;  4CXF A;  2QQB A;  3DLA A;  4HNV A;  2PFB A;  2Z2S B;  4H4K C;  4AM3 A;  2R7T A;  5D5U B;  2VON A;  5E1Z B;  2DT7 B;  4CDG A;  1B8I B;  3ZMU A;  5J8F A;  3IL2 A;  4RB1 A;  4F93 B;  2VAS A;  3LSM A;  3I9V 2;  2TCT A;  3R61 A;  2PBI A;  2EV6 A;  3K4B A;  4BJT A;  2I8D A;  2WC2 A;  2HVR A;  5C4X J;  4ASN A;  3OS2 A;  3T5X A;  3HJE A;  1MGT A;  1X58 A;  1S9H A;  5HS7 A;  2LC2 A;  1B9M A;  2VKE A;  1O4X A;  4PSX A;  2IS2 A;  2R3S A;  5FKN A;  4EMS A;  1LQ1 A;  2UXX A;  4D1Q A;  3DKY A;  3OYE A;  1HCR A;  2R7U A;  4XID A;  4EV0 A;  1B9N A;  4YRV A;  5BQT A;  2CGP A;  4K2E A;  1BW6 A;  2IEK A;  3L1P A;  1MNE A;  4QWQ A;  4QPQ A;  5H2F C;  2KIU A;  4IQ4 A;  1ETO A;  3DPT A;  4N9H A;  3CCQ I;  2R7F A;  3CUQ C;  3RZD J;  1TW2 A;  1HW5 A;  3D1N I;  1T2K A;  1Y8Q B;  2ZO4 A;  5J40 A;  4DZP A;  5IPA A;  2JA5 J;  2Y31 A;  1ZG1 A;  4KIT B;  1LNW A;  4MLO A;  1SAX A;  1O57 A;  1KA8 A;  5DEQ A;  5L3D A;  5JLW A;  4FET A;  4NC6 A;  3W6K B;  4M3F A;  1MKM A;  1K6O A;  3GTG J;  1ZRC A;  2BY1 A;  3VSK A;  1S5L C;  2Y0S A;  4PUS A;  2Y0M A;  1BC8 C;  2RDP A;  4DNC A;  2DA7 A;  1FTZ A;  1SAN A;  1IUY A;  1HDD C;  5FD5 A;  2O0Y A;  1T6S A;  1UZC A;  4HQM A;  4XRM A;  2HYG D;  1OCO H;  2HDW A;  5JFR A;  2XAG A;  1D5Y A;  1H0M A;  2DLL A;  2L01 A;  1DU0 A;  1O7F A;  4JX4 A;  4BY7 J;  2KKO A;  1BW5 A;  1FWZ A;  4ESF A;  4I02 A;  3S32 A;  3D5S C;  1X3Z B;  2RAE A;  1VFC A;  2BE5 F;  5C3E J;  2X6O A;  1X4O A;  2IS1 A;  3S16 J;  4Y7N J;  4ZDL A;  2FMY A;  3K10 A;  2BW3 A;  1D5V A;  1ZR4 A;  2JA6 J;  1EV7 A;  2FJ1 A;  2LNB A;  2X51 A;  3H5N A;  1SFE A;  4S04 A;  3LSP A;  3B02 A;  3DTI A;  2PX9 A;  2F6C A;  2EBI A;  2AS5 F;  1VQ5 I;  2X1D A;  3LSJ A;  4CCJ A;  5D5V B;  4L0Z B;  2VPL A;  5DD8 A;  2DXI A;  4EEF G;  3PUB A;  1YO5 C;  2VOO A;  3ZOB A;  2RN7 A;  1HKQ A;  2ZJ2 A;  3JTG A;  1H9G A;  1GV2 A;  3V8L A;  1X1C A;  3RPQ A;  4LIU A;  3DP7 A;  3Q0U A;  1VQM I;  2M0M A;  2YSR A;  3OYI A;  1ZH5 A;  2ADU A;  5C44 J;  1G59 A;  2VPR A;  3MVP A;  4RAZ A;  2B7E A;  4HDV A;  3F21 A;  4IF4 A;  1TTY A;  4AIJ A;  1Y1W J;  4Z2Y A;  1IN8 A;  2QUF A;  3AFH A;  1IXS B;  5J6X A;  4XRF A;  3J81 K;  4E7Z A;  2QSF X;  4LGW A;  4HDU A;  3W6V A;  2D1H A;  4XSX F;  3E97 A;  2B0L A;  2IS4 A;  3PIP F;  4D5F A;  2A6T A;  1YFH A;  3WE2 A;  1YHQ I;  1R71 A;  5ILV A;  3HOS A;  4PK4 A;  3IWZ A;  5EG0 A;  3K1P A;  3RQ4 A;  4AYB A;  1XC5 A;  3CP2 A;  2NVY J;  2ZXW H;  2E5Z A;  3RKX A;  3LSI A;  3OYN A;  3QOE A;  1Z21 A;  2CQQ A;  1UB9 A;  1YJN I;  1XTA A;  3IC7 A;  4RAY A;  3OYH A;  5JR3 A;  2COM A;  3CP8 A;  3TBI A;  2L54 A;  1T0F C;  3F8C A;  3FXL A;  1S29 A;  1Z6T A;  3P5J A;  2XF6 A;  3S3M A;  3ZQG A;  1YW9 A;  2Z5U A;  1IW7 F;  1BN5 A;  2VOD A;  2ZBK A;  2Z16 A;  4W97 A;  2GXB A;  4PCQ A;  3GFI A;  1EH7 A;  3UNG C;  1B6A A;  2L7F P;  3DBR B;  1MDM A;  3MMY B;  2R7O A;  1QA6 A;  1QVT A;  1XSV A;  1D0Z A;  2O61 A;  9ANT A;  2JVH A;  2EZI A;  1S6L A;  2FX0 A;  3ZCO A;  3S8P A;  4LD5 A;  2DYR H;  5F04 A;  4KUM A;  1LB2 A;  2L5Q A;  1EJ9 A;  3Q9S A;  5KAI C;  2O7O A;  1MMD A;  4HAM A;  2WWY A;  2V79 A;  4EJO A;  3L7W A;  1HQC A;  4GXO A;  2IBD A;  2BW3 B;  4YFK F;  1APL C;  2LSO A;  5LEK A;  4HF1 A;  2EZK A;  2L4A A;  4Q48 A;  2LKX A;  2DA2 A;  3HXL A;  3H92 A;  3DPU A;  3CUQ B;  5DTD A;  2P5L C;  5FKK A;  3MKY B;  2XGC A;  1W5T A;  1TT5 B;  3HRM A;  1JKR C;  4O6J A;  5J4Y A;  3PO3 J;  2VLA A;  1OR7 A;  4IHT A;  3FF5 A;  1L0O C;  4BKX A;  4B4C A;  1I1G A;  4PJ0 C;  1FX7 A;  5DCM A;  2V9K A;  4IX7 A;  1XB4 A;  2K86 A;  4Y52 J;  3OIP A;  4WF2 A;  5EDN A;  1FOW A;  4CA0 A;  3BP8 A;  3ABL H;  2M87 A;  2K3F A;  4QSH A;  5DM6 F;  3F72 A;  3HSE A;  2DAO A;  2PEX A;  1ZK8 A;  3WHC A;  2QGU A;  4LLG F;  2LLK A;  1VTN C;  1AHD P;  4RB2 C;  2WAQ N;  5J47 A;  3U21 A;  3HC7 A;  1D1A A;  3TO9 A;  3HOU J;  1FT9 A;  3ONQ A;  4A3M J;  2HGC A;  1WCM J;  4CIC A;  5EG0 B;  4CZZ A;  2ZXJ A;  2F5V A;  1S3J A;  1FLI A;  3I59 A;  3GTM J;  2Y30 A;  5LEJ A;  4PJM A;  2K4B A;  5KVR A;  1XMK A;  3C7J A;  1VI0 A;  2A5Y B;  2K3P A;  4HA8 A;  1U2W A;  4IJA A;  2C6Y A;  3M8J A;  5JVT A;  2HTJ A;  2I5U A;  3O8H A;  1R1U A;  2ECB A;  3F6V A;  1QZZ A;  3PO2 J;  2KHM A;  4PFP A;  3WGI A;  3H3Z A;  1X4P A;  1ETX A;  2LBF B;  4WK8 F;  1KU2 A;  1A6Q A;  1Z9C A;  3GBG A;  1R4N B;  3IUO A;  5J1Y A;  4C2T A;  1VZ0 A;  3C2G A;  3K0L A;  2XSJ C;  1OKR A;  1YX5 A;  1LJ9 A;  1D8J A;  1XGM A;  2QBY A;  5ICE A;  1MH3 A;  3TW6 A;  3GTJ J;  4N9I A;  4DYC A;  4G94 A;  2G7U A;  2J5O A;  4HV5 A;  3QPH A;  5HDN A;  3VOD A;  3MKZ A;  1VQ4 I;  1JUS A;  2FRH A;  4GFB A;  2XIG A;  3O6B B;  5IT9 K;  2M5W A;  3VYT B;  4OIO F;  2CYY A;  4I7H A;  2XAF A;  1XMX A;  3ABT A;  3ZQL A;  4KIS A;  5FKO A;  4IRI A;  4MFE A;  1MSF C;  4QIW N;  4A6D A;  2KFD A;  5FFZ A;  1QNT A;  2XUB A;  5LGT A;  1DP3 A;  2D2W A;  2CV1 A;  5FLX K;  3RKW A;  2M7B A;  2EB7 A;  3BR5 A;  3F9K A;  5IOY A;  4CYC A;  2MGQ A;  2A07 F;  2XB5 A;  2RQP A;  5ERI A;  3ZN1 A;  4OIQ F;  2OBP A;  3I64 A;  3WGG A;  1TWH J;  1F43 A;  5E8I A;  2P8T A;  3HUG B;  2R0Q C;  2P7C B;  5E8G A;  1AKH B;  2UZK A;  2M4G A;  2LKP A;  4HST A;  5GAG J;  2LP0 A;  3JR9 A;  4IPA A;  1I1S A;  3IV5 A;  3BR2 A;  3RI4 A;  1E0E A;  3BR1 A;  3CTA A;  3G6E I;  1TBX A;  3PNV A;  2K9M A;  3VFZ A;  3TDU C;  2HU9 A;  4MQ9 F;  4BE0 A;  1JKQ C;  5HS9 A;  5HLG A;  2XB0 X;  4HNU A;  1YRN B;  4XOT A;  4LK0 F;  4LLN A;  2ACJ A;  2QM3 A;  3TP0 A;  3ZQH A;  4PDK A;  4RGX A;  4ZYE A;  2EFW A;  2DFH A;  3GVA A;  3T8T A;  2UWM A;  1WJA A;  4MEX F;  3OYL A;  2DA4 A;  1YX3 A;  3FXJ A;  4CCN A;  5EGO A;  1G3T A;  3TOA A;  1S8N A;  2HOT A;  4BQO A;  2LF7 A;  3G1O A;  1B72 A;  4HPQ A;  3FM3 A;  1IG7 A;  3MN2 A;  2FF4 A;  2RRE A;  1TC3 C;  1VQ6 I;  2R7Z J;  5K7F A;  2DMU A;  1HST A;  4TV7 A;  4KMF A;  3H5R A;  2QBY B;  1KYW A;  2ZNZ A;  5CQE A;  1ETY A;  3PJR A;  2VQL A;  1MJ9 A;  2LRD A;  5IP9 J;  1R5G A;  5HVQ C;  2BHZ A;  3C2H A;  4DIQ A;  3L2R A;  1K61 A;  1OYW A;  3CJR B;  1D0X A;  2CQK A;  5K5R A;  1RPW A;  4LG3 A;  4PZJ A;  3BT9 A;  3K2A A;  2F5F A;  4F92 B;  3LNQ A;  3CLO A;  5KAF C;  2M0C A;  1UCR A;  3S2D J;  1UJ8 A;  2WA0 A;  4KT6 A;  1RET A;  1F9N A;  4KFC A;  1WJB A;  4DBQ A;  4PGH A;  2A6E F;  2ESH A;  3PQK A;  1UST A;  3BG5 A;  2LH9 A;  1ZRF A;  3KYD B;  1BOB A;  1DQU A;  3FWE A;  4CYC B;  3IAS 2;  1MW7 A;  5FJ8 J;  5E79 C;  4LG0 A;  5CVJ A;  1Z3X A;  2E2H J;  2UV1 A;  3IAM 2;  4BXU A;  2A61 A;  4E4H A;  2O3F A;  5CQG A;  2ZSI B;  2HQ5 A;  2M3A A;  2G7H A;  2WBM A;  2XAQ A;  5L3F A;  3BWG A;  4WXH A;  4D7N A;  4L9T A;  3BCA A;  4F7Z A;  3WTZ A;  1JKO C;  4H0E A;  2KZG A;  3L00 A;  1I3Q J;  1WVR A;  4M6V A;  2X6W A;  4LB6 B;  2E7W A;  1U3E M;  4L5J A;  2X4H A;  3OL4 A;  2JPC A;  1HBX G;  3QPS A;  2BXZ A;  3SDB A;  4KNY A;  4BQQ A;  2HQA A;  4FAS D;  1Z6R A;  2XHK A;  3QU3 A;  3SZT A;  3GX4 X;  4UUT A;  3GTQ J;  3ERM A;  1GXQ A;  3VOE A;  2OU2 A;  1DPR A;  3J7A Y;  1IDY A;  4JBA A;  3CCS I;  1IN5 A;  1MMG A;  2FD5 A;  2XPV A;  4WX9 A;  2QF7 A;  2A69 F;  1A35 A;  5J3L A;  5M3F J;  4V2F A;  2HQR A;  3LWF A;  2HVQ A;  1W7P B;  2VL8 A;  1E3P A;  2DQL A;  3HZJ A;  4XLN F;  1REP C;  2OZU A;  1ZLK A;  2P7V B;  4BBS J;  1B72 B;  4RM3 A;  2DA5 A;  4M6X A;  5E17 F;  2L7Z A;  3LOC A;  3VPR A;  5HOD A;  3KP7 A;  4FE4 A;  2Y0S N;  1ZGW A;  2Z99 A;  1PUF B;  1Z7U A;  2DOD A;  4KDP A;  2ZFU A;  1OCZ H;  3A0H C;  3PUF A;  1EKE A;  3L9F A;  3F23 A;  1O7L A;  2EFP A;  3LSH A;  1GV5 A;  3RPU D;  3OYB A;  2EQR A;  3BRO A;  4MHG A;  2A68 F;  2CW0 F;  4NHJ A;  1MBF A;  1ODD A;  3F6O A;  4EM0 B;  2NRA C;  4Q47 A;  4GDF A;  1X19 A;  4AC0 A;  2V6E A;  2MBF A;  3CC7 I;  4HLY A;  1XDS A;  3T8R A;  3S1Q J;  2GOM A;  1WHU A;  3OYJ A;  4KMU X;  3L2U A;  1R23 A;  2QKL B;  4M71 A;  1FMV A;  3W6J B;  3J80 Z;  1SD5 A;  4XL9 A;  3MAJ A;  4CUG A;  3KYL A;  3FBN B;  5FB2 A;  1BI1 A;  4E7J A;  4ESB A;  3QRF F;  4RLQ A;  1TT0 A;  1X1A A;  5L3G A;  4AVZ A;  2ME0 A;  3GLX A;  2ZJR F;  4V2G A;  1ZRE A;  1QHG A;  3HEF A;  2QKM B;  4Z6Y A;  5J4V A;  4BAC A;  3H35 A;  4J00 A;  4BJ6 C;  4XKV A;  1GT0 C;  3BG3 A;  1DGR M;  3CLQ A;  2H94 A;  3S3O A;  1FJL A;  2E71 A;  2Y69 H;  2JUC A;  1KU7 A;  3ZN0 A;  4CYD A;  3KEQ A;  3G4S I;  2MLK A;  3RDI A;  2MH9 A;  1LEA A;  3QAH A;  4NC7 A;  4C30 A;  2ZSH B;  2R7D A;  1FY7 A;  4KIC A;  4A3G J;  2IT0 A;  1ZGA A;  3N4M A;  3K9T A;  3L09 A;  1MND A;  3F8B A;  5H6Q A;  2GWR A;  5CVU A;  1U5T A;  2CWE A;  4MFD A;  4RS8 A;  1ONV A;  4GO1 A;  3I0T A;  3H9Q A;  2H27 A;  2VN2 A;  1MMN A;  1Y8R B;  3Q9V A;  3FMR A;  3G71 I;  3WTS C;  3S14 J;  1ULY A;  2DJI A;  1VQP I;  1NK3 P;  1QVU A;  1IRZ A;  2IRF G;  1SFU A;  3PFI A;  2IPQ X;  1KQ0 A;  1UHW A;  4G12 A;  4ANJ A;  1X2N A;  3MD2 A;  5A2Q Z;  2DDA A;  4XLF A;  1HDP A;  2LY1 A;  1FMW A;  2M34 A;  2VC0 A;  3LL7 A;  3RTR A;  4QLC U;  2OQG A;  1I39 A;  1ZYR F;  2IA1 A;  4Y15 A;  3ABU A;  3ZMZ A;  2Z3Y A;  3HTU A;  2KIM A;  4PFO A;  1IDZ A;  4IOC F;  4YII A;  1Z1D A;  3GEZ A;  4NC8 A;  3R6S A;  2IA2 A;  1SFO J;  1BC7 C;  2H8W A;  2XV4 S;  3ULQ B;  2WAF A;  3SJM A;  2GXA A;  2H09 A;  5JVG F;  4Y33 A;  1JJ8 C;  1X2M A;  1RKW A;  1T38 A;  3DFG A;  3FHZ A;  3JSP A;  4KN4 X;  5FO5 A;  1MZB A;  2VQG A;  3F3X A;  4IOA F;  2W4S A;  2KIQ A;  4Q4Z F;  3VYS B;  2L4M A;  3OYC A;  2MC3 A;  2RC4 A;  3G3Z A;  1FBS A;  2P5V A;  2FBI A;  2ICW G;  2NXN B;  3I58 A;  3KZY A;  3M07 A;  1H88 C;  2QSG X;  3SEZ A;  3HYI A;  3JRD A;  2HTS A;  4AU7 A;  5FKL A;  1Z91 A;  1RKT A;  2BBY A;  2DOA A;  4ZTF A;  1B59 A;  2HYJ A;  3VWB A;  4ZJZ A;  2ELK A;  1R1V A;  3SDG A;  1LUJ B;  3H9J A;  2M7A A;  2ZXI A;  3A2K A;  3L2Q A;  2LG4 A;  3FXK A;  2L3D A;  3P9I A;  3FKJ A;  3EUK L;  4FHT A;  2MA3 A;  4CZC A;  4R8H A;  1ENH A;  1J2X A;  3GWZ A;  3O8G A;  5DCF A;  1GDT A;  4M3D A;  2JK3 A;  2GIZ A;  3GZN B;  3A4C A;  2HXI A;  2JA7 J;  3HSR A;  1HOM A;  3QYB A;  3NWS A;  2NYX A;  1RZ4 A;  2GXG A;  4RMN A;  4Q5S F;  1V54 H;  3K1M A;  2XGD A;  3FXM A;  3HBL A;  1U5T B;  4P5O A;  3GXO A;  3GTL J;  3DWL E;  3CDL A;  4F91 B;  3OIQ A;  2NOJ B;  2E1N A;  3PNY A;  4ZYH A;  5K7Z A;  2R7S A;  4JX6 A;  1YG2 A;  2V1D A;  1BBY A;  3HOV J;  3F8N A;  3NEU A;  4HLX A;  3LQQ A;  4BXF A;  2VOP A;  3VB2 A;  1T8I A;  2CS3 A;  3QPT A;  3K70 C;  4J19 A;  2LRE A;  3W2V A;  2JN6 A;  3NWT A;  4M73 A;  3CC2 I;  1J0R A;  3WTT C;  1LFU P;  2X9D A;  4YIR X;  2R93 J;  2Z9O A;  1G3S A;  1PUE E;  4G6T B;  1WSU A;  2HI3 A;  3BG6 A;  2VBX A;  5FLV A;  2FQ4 A;  3ZQQ A;  1ZEL A;  2OC6 A;  2ISY A;  3H0D A;  3E6C C;  1BIB A;  3K6G A;  5CVR A;  4HF2 A;  1IN6 A;  1TWG J;  3R0A A;  1FP1 D;  4CCO A;  2XGX A;  5J1U A;  1I27 A;  1YE9 A;  2M30 A;  2HR3 A;  3V4G A;  3TP3 A;  1N77 A;  3U9G A;  1IV6 A;  1U8R A;  4G7H F;  4CH7 A;  1XCB A;  2ZXH A;  3OOU A;  5M5Y J;  1WJ5 A;  1W1W E;  2JWT A;  1PP7 U;  2NAZ A;  3KP2 A;  3RSN A;  2NS7 A;  1XX5 A;  1D1C A;  1K4T A;  2P6S A;  3ZMV A;  5E3M A;  2AXL A;  4A5M A;  2HNH A;  1H8A C;  2VE8 A;  2V6C A;  3MCZ A;  3ZGK A;  4RM2 A;  3DQV C;  1WJF A;  3WTX C;  5E3L A;  1QHH D;  2FUG 2;  5E1X A;  2CW8 A;  4DGW B;  2FA5 A;  4IHX A;  3AG3 H;  3Q0V A;  3JRF A;  4DYR A;  1UG2 A;  2PG4 A;  2X1C A;  5K1Y A;  4EGY A;  2P5K A;  3UR3 C;  2DA6 A;  2DQR A;  2H6B A;  4G8X A;  5L3C A;  2CG4 A;  1R5I D;  2LFB A;  3HIF A;  3OYA A;  2UXN A;  2TRT A;  2OCC H;  4EVI A;  1KGS A;  2VJJ A;  2A3S A;  4RBO A;  3E7L A;  2BHY A;  2QLZ A;  4YFN F;  2F5E A;  3IRQ A;  4CCL A;  2A5W A;  3S2H J;  2E35 A;  5D6F A;  1K78 A;  4OMY A;  4ENJ A;  1HF0 A;  2DO7 A;  2NNY A;  2KLO A;  2IA0 A;  2VKD A;  3I55 I;  2R5Z A;  1Z05 A;  2GZW A;  3HKZ A;  3DBH B;  2Y9Y A;  4C3H J;  3BPX A;  1UHM A;  2DK8 A;  1OR7 C;  1UEL B;  1X3U A;  1MJB A;  2NS0 A;  4UB6 C;  4AUX A;  1P7I A;  2V1X A;  2HOA A;  1BOA A;  3S1R J;  3JSO A;  2H1K A;  2FEZ A;  1RIO H;  1N78 A;  3SHF A;  3W2A A;  5LD2 C;  3IRR A;  1X3W B;  1NH3 A;  4HNT A;  2L2O A;  3BCB A;  4BDZ A;  3TL4 X;  2HKX A;  3RJP A;  2KP6 A;  5BPD A;  3NAU A;  4F3Q A;  3HPH A;  5E3N A;  4ZYA A;  2XAJ A;  3FXQ A;  1BR2 A;  2RNJ A;  1UHS A;  1JUM A;  1VND A;  1X1D A;  2JQ7 A;  1EF4 A;  2YU9 J;  4DQ2 A;  5IT3 A;  1GXP A;  4N4N B;  5F64 A;  3P7N A;  4G9Y A;  1DP7 P;  4QTR A;  3X2Q H;  2GQQ A;  4LOC A;  3BC8 A;  3OYM A;  1EH6 A;  2WB1 N;  4G6Q A;  5EEA A;  4A3D J;  4KIB A;  4M3B A;  4U0V A;  3HG9 A;  4E7S A;  4B3A A;  3HOY J;  4EAT A;  4N4O B;  2XRN A;  3BQY A;  5D5W B;  1IF1 A;  1B1B A;  3IWF A;  1YJW I;  3BG9 A;  2CUF A;  1JJ6 C;  4LIT A;  2ZB9 A;  4AVP A;  1K83 J;  2PMH A;  3GLL A;  1XG1 A;  1RR7 A;  1OLT A;  2W7N A;  4HG2 A;  4BHB A;  4BAY A;  2W84 A;  1U78 A;  1PP8 F;  5CVV A;  5DD4 A;  2RGV A;  2PI0 A;  3RYP A;  2UUZ A;  4YEL A;  1K78 B;  3IH2 A;  1R6R A;  4UNO A;  3WE3 A;  2R7R A;  2O9L A;  1W7P D;  1W4M A;  3NRV A;  2VB6 A;  3I71 A;  3JRG A;  3UKG A;  2R5Z B;  2EV0 A;  4GYG A;  2K9N A;  2D45 A;  5FRM A;  1MBK A;  5E1W A;  5HDK A;  1XCV A;  3HRT A;  3BLY A;  3HGG A;  3F8M A;  3A02 A;  1VQO I;  2KIS A;  4E7L A;  3E5Q A;  4ETS A;  1WJC A;  3BR6 A;  4MQV A;  1GHC A;  4KIG A;  3R60 A;  2EH3 A;  5LHI A;  1OYY A;  2D5V A;  3KEY A;  3N05 A;  3LFU A;  1WZ2 A;  1L3L A;  3CQZ J;  5EZH A;  3S17 J;  3WU2 C;  3SZG A;  2IXS A;  4GYI A;  1IRF A;  4C2U A;  2YR2 A;  2M8E A;  3TDZ C;  3E5X A;  1P4X A;  1X1B A;  1NG6 A;  3LA3 A;  1SFX A;  1MDM B;  4W1U A;  2CUJ A;  1S72 I;  1K6Y A;  3BPV A;  4XN0 A;  3GYH X;  2VXZ A;  4BDY A;  2HDD A;  5EEG A;  1FZP B;  4XNF A;  3QP5 A;  3HTS B;  4O5V A;  2XAS A;  3HPG A;  1RUO A;  1P6R A;  3ABM H;  4JP0 A;  2DFE A;  1SMY F;  3I54 A;  1MJA A;  1YOV B;  5GTI C;  5M3M J;  3CF5 F;  5HNF A;  1IC8 A;  2G0E A;  1SFK A;  2BY0 A;  2R7X A;  1I50 J;  4DJA A;  2XKP A;  3DXJ F;  3AG1 H;  2V4J C;  3EUH A;  3M1C A;  1P92 A;  3KZI C;  1RRJ A;  4CGZ A;  2DDB A;  1IXC A;  5K5Q A;  2DFI A;  4U0W A;  3CCE I;  3TED A;  4BQN A;  2XF5 A;  1ZTR A;  5D4R A;  5B1B H;  3U2R A;  1OIS A;  3OL3 A;  1ETQ A;  4ZC3 A;  2CMP A;  4OIR F;  2FML A;  2QYO A;  5EEH A;  3K1N A;  4HX8 A;  3NQO A;  5DCM B;  4L9V A;  1YYV A;  4L18 B;  2ZC2 A;  2F4I A;  2CFO A;  2DMT A;  2YX7 A;  4RB0 A;  5IYC J;  1ZHF A;  1XGS A;  3ABK H;  1W36 C;  2VJ4 A;  2H1L A;  5LFA A;  2P0W A;  2WY7 Q;  2JA2 A;  3COA C;  1V5G A;  4BBR J;  3OSG A;  2IS6 A;  5FKM A;  1OCP A;  4A3I J;  2Y75 A;  5L3E A;  4MNU A;  2CUZ A;  4IQJ A;  2YX4 A;  4MTD A;  2KMU A;  3DCF A;  3KX2 A;  1IJW C;  2JRT A;  3P9C A;  2LVS A;  2XPU A;  4B1R A;  2IGM A;  3F0C A;  1MBG A;  1ZLJ A;  2JUG A;  3QQA A;  3E1S A;  4UXN A;  3JAM K;  2DPU A;  3I59 B;  3MZ8 A;  4M74 A;  1XN7 A;  4KA4 A;  3FXO A;  3EUA A;  3GO5 A;  3FDY A;  2F48 A;  1ZR2 A;  1ACI A;  3DF8 A;  3HL2 A;  4UVA A;  4YIF A;  1YJ9 I;  3GFL A;  4LMY A;  4DW6 A;  5B66 C;  4R79 A;  1FIP A;  1FC3 A;  4Y13 A;  3G73 A;  3CDI A;  5DUK A;  3M8E A;  3QU6 A;  1J59 A;  2PMZ A;  3CUO A;  3FX3 A;  1DGW Y;  2K4J A;  4C9Y A;  3W3C A;  4HX4 A;  3TMO A;  4X0G A;  3TW7 A;  2BXY A;  4XLC A;  1FNN A;  1Y0U A;  1F4K A;  1T98 A;  1P7J A;  4M9Z A;  1ETK A;  3FIS A;  5A2Q K;  4A3C J;  3CCY A;  2NVX J;  1A31 A;  1R58 A;  2JPB A;  2ZJQ F;  4RB3 C;  1LVA A;  1M1E B;  1BR1 A;  2FSW A;  3JRA A;  3EET A;  4A2U A;  2PJR A;  2VQH A;  2IAI A;  2ZJP F;  3GTK J;  5LRS A;  1QO0 D;  4B09 A;  2F4O B;  3R4K A;  2L9N A;  1TNS A;  4XLA A;  1A6I A;  3K4C A;  3MWM A;  4RAF A;  4QPO A;  4UV9 A;  1JUP A;  2VT2 A;  4ITV A;  4UVB A;  1MD0 A;  3BR0 A;  1D8K A;  1FSH A;  5F08 A;  4RA2 A;  3CJQ B;  3LST A;  4II3 A;  4E7I A;  3HM5 A;  2CRG A;  3M9A A;  2DPD A;  3L2W A;  4NUB A;  2O8X A;  2DOF A;  3DEW A;  1YIJ I;  4XKC A;  2GBY A;  5KK1 A;  5ILU A;  1LVK A;  4KYW A;  3CJN A;  2HWV A;  3AL0 C;  1XPX A;  4BEH A;  3ZQI A;  4IRH A;  5ICF A;  1GVJ A;  2IW5 A;  3FXR A;  1JHH A;  4B44 A;  2DI3 A;  4UHT A;  3U1K A;  2L02 A;  1XMA A;  3LAJ A;  2F5C A;  2EIN H;  2LYC A;  4M6Y A;  3BTL A;  3FKI J;  4NDL A;  3D5R C;  4FX0 A;  4NQW A;  2QSH X;  2G9W A;  2W1O A;  2MAB A;  3OMY A;  2OUM A;  2JVG A;  5LHH A;  2FBK A;  1SC7 A;  4RLF A;  4XSZ F;  1O3S A;  1DDN A;  1IUF A;  5LGN A;  3HRU A;  4L0Y B;  4ZZL A;  1FP2 A;  1EH8 A;  1TL8 A;  3E0J B;  1NK2 P;  2OTL I;  5F27 A;  4HOB A;  3T1B A;  2CU7 A;  4G7O F;  1T56 A;  3F8F A;  1U0J A;  3C3W A;  3BZ6 A;  5H6R A;  3KET A;  2WAQ A;  3HHH A;  3O3K A;  1KZH A;  3REO A;  2JZY A;  2V26 A;  2KPM A;  3ZPL A;  3S15 J;  1IZ1 A;  4BHP A;  4YEJ A;  3BZC A;  1WFX A;  3TGN A;  5EGO B;  2WV1 A;  1LE8 A;  4JQF A;  4WCG A;  3B6C A;  1JE8 A;  3ZXS A;  3GTO J;  1MSE C;  2ISZ A;  2Y9Z A;  3AKZ A;  2O6G E;  2JT1 A;  5BOX A;  2OV7 A;  4UVC A;  3RIR A;  1IRX A;  4HBL A;  1R22 A;  4FE7 A;  4J01 A;  4I99 C;  5IYD J;  1Z0X A;  1QZY A;  3MKL A;  1U5T C;  2Q2E A;  3A03 A;  2P6T A;  1BA5 A;  2Z1D A;  2MW8 A;  2DTZ A;  2DU9 A;  4UY8 I;  5HS8 A;  5GP9 A;  4I09 A;  3MFK A;  1V3F A;  4JX5 A;  5B3S H;  1H9T A;  3DTK A;  3M3Y J;  1KQ8 A;  3QOD A;  2GIV A;  3WTV C;  4BL0 B;  2BVM A;  3S93 A;  1IAW A;  3ZP5 A;  1MIJ A;  2QCO A;  1R5H A;  1R7J A;  5KHD A;  2KL4 A;  3R0J A;  2E2I J;  4II2 A;  1XSX A;  4XRS G;  2Y48 A;  5BMZ A;  1OPC A;  3QPL A;  5GAE J;  4I6Z A;  4UUV A;  2DN0 A;  4LG0 B;  4IHW A;  3SEQ A;  3WOD F;  3V7R A;  4BEH B;  1UFM A;  5IT9 Z;  2GAU A;  3LAP A;  3KFW X;  1J09 A;  3GZ6 A;  1EA3 A;  3OV8 A;  3BZK A;  1JT6 A;  2ZFW A;  4ZYG A;  2MYS A;  2WAD A;  2VQC A;  2HS5 A;  3FK6 A;  2OTJ I;  4R1H A;  1VQ7 I;  2DT5 A;  1A04 A;  2E60 A;  5TJJ A;  3OWT A;  3PM1 A;  1LDK B;  4RDU A;  1P2F A;  1ZAR A;  5FLX Z;  3OSF A;  1G8X A;  4B8X A;  2CH0 A;  3DEE A;  4CSW A;  2PN6 A;  1B8I A;  4BQA A;  1JI8 A;  2FOK A;  2GOX B;  2HYF A;  2K7L A;  3WG7 H;  2VT3 A;  4F55 A;  3CCL I;  3BDD A;  4EGZ A;  2Q1Z B;  4XLE A;  1QBJ A;  5DS9 A;  1O3T A;  1HW2 A;  3TOB A;  2CW7 A;  4C3I J;  2LTP A;  2L0K A;  2W82 A;  2KIF A;  3E6M A;  5JHU A;  3V8J A;  2KRF A;  3T0Y A;  2R5Y A;  4IEJ A;  4C2M J;  1HC8 A;  2LD5 A;  3BTJ A;  5DV5 A;  4AYB N;  3M4O J;  1FBU A;  1ZG3 A;  2DMP A;  1LE8 B;  5IOZ A;  4OOI A;  3JCU C;  4ZDP A;  4IXA A;  2F4M B;  2P4W A;  1AWC A;  3BTC A;  3W2W A;  5D6E A;  2E34 A;  2TDX A;  2V9V A;  3V8K A;  1RR8 C;  5F0H A;  1D0Y A;  3C1D A;  2ESN A;  2X6X A;  1J9I A;  3LFK A;  1TNT A;  3FHN A;  3SZP A;  3BOQ A;  2EIM H;  4BYY A;  2VBY A;  3CMY A;  1ZQ3 P;  2BOL A;  1J75 A;  2MLG A;  5AIP A;  3E6D A;  4XOR A;  2VKV A;  5GAH J;  3AL0 B;  1R36 A;  3KYC B;  5D5X B;  1D3Y A;  4LLL A;  1FEX A;  3U1D A;  3FMQ A;  1TQM A;  3GTP J;  3A1Y A;  1IN4 A;  4U87 A;  3WU0 A;  1Y6I A;  4LFU A;  1SD7 A;  3VDX A;  1MBJ A;  3ASO H;  3ZQ7 A;  2K9L A;  5KNL A;  3E6B A;  1QRY A;  2DMQ A;  4AIK A;  2NVT J;  4IVN A;  3K4K A;  1RUN A;  1P4A A;  3VEP A;  3K70 D;  2ZCW A;  3AG4 H;  5K7H A;  5M5W J;  3SYT A;  3J7Y J;  3L2V A;  5C4J J;  2Z33 A;  2ZKZ A;  2E19 A;  4AID A;  1Y56 A;  2OA4 A;  5HLT A;  3KEO A;  5JI6 A;  3I56 I;  3L2C A;  4EJV A;  1P4W A;  4HEA 2;  4KIF A;  4HRI A;  3OYF A;  1E3O C;  2E7X A;  1PDN C;  5AIQ A;  2DW4 A;  4MIM A;  4EJT A;  1G2H A;  4B43 A;  4WWC A;  3SFZ A;  4BGD A;  1SAU A;  3RPU A;  3FZV A;  1TP4 A;  4IHS A;  1TZL A;  2CQX A;  3GUD A;  3ZR8 X;  2HOE A;  2COB A;  2M8G X;  2LY9 A;  2NVU B;  1N75 A;  3N97 A;  2YPR A;  2BY2 A;  2MG4 A;  2HOS A;  3KP4 A;  5B1A H;  1CQT A;  5J1R A;  3EYI A;  2A05 A;  3OYG A;  2M45 A;  1XGN A;  5F1J A;  1JKP C;  4D9J A;  3J7A O;  4XIC A;  1HXD A;  4OIN F;  1I6H J;  3PIO F;  4BU2 A;  2R7W A;  3OOP A;  2LOO A;  3EDP A;  3DU6 A;  1MNM C;  3WHB A;  4HV6 A;  1SVL A;  5D8L B;  3TQN A;  2R5Y B;  4C3J J;  4U0Y A;  1S7A A;  3JRH A;  5DDG A;  1FYL A;  1UMQ A;  2HFH A;  2HZD A;  2B63 J;  4G6D A;  2RVC A;  3IH3 A;  5ILS A;  4ABZ A;  1ZKG A;  4U88 A;  5LLQ A;  3JRB A;  5FFX A;  1D1B A;  2HKO A;  4LIV A;  2LKS A;  5JLX A;  1FYK A;  2GA2 A;  2BZT A;  5HLH A;  1G6N A;  5GPC A;  4OMZ A;  5F1R A;  4I0A A;  2EIL H;  3GFJ A;  2VKH A;  3GZ5 A;  3NAR A;  4KJZ A;  5CPR B;  1YQA A;  2ZME A;  3BR3 A;  3DV8 A;  5IP6 A;  5F0F A;  4A3L J;  1VQ9 I;  2VUM J;  2FQ3 A;  5ICG A;  5CJ9 A;  5HDG A;  4WXD A;  2X6Y A;  3I4N J;  1QQI A;  3F22 A;  2Q8K A;  2VC1 A;  3K4N A;  3JRE A;  2YUS A;  2IGK A;  1VQK I;  2ETH A;  3HHG A;  2FOW A;  3RKY A;  2E36 A;  1A5J A;  1ETW A;  3H3U A;  1UG0 A;  2QQ9 A;  5E18 F;  3VYU B;  3CO7 C;  3WTW C;  1U9O A;  1LDD A;  5DUI A;  1DU6 A;  2DT6 A;  2KQR A;  2RNG A;  3QWL A;  3JRC A;  5FD6 A;  4PJL A;  4LK1 F;  2R7V A;  1K79 A;  2HZT A;  2CO5 A;  3EPZ A;  5BNG A;  2JRM A;  1LFB A;  2X48 A;  3OR2 C;  3ERE D;  2CV2 A;  1A36 A;  4CCM A;  1BM9 A;  1RC9 A;  5H20 A;  1G3Y A;  3JW4 A;  3CCJ I;  1KYZ A;  3MZY A;  2H8R A;  5LRR A;  2H6C A;  3DBL B;  2BY3 A;  3B6A A;  3KE2 A;  4MGR A;  1GUU A;  2XVC A;  1I5Z A;  1ETV A;  3M8F A;  4MTE A;  3I4M J;  1MMA A;  1U8B A;  2EFQ A;  2IVM A;  4RGU A;  1ZG5 A;  1OCR H;  1ITY A;  1X1P A;  1YLF A;  2L7M P;  1YW7 A;  1P9Q C;  1R00 A;  2AXT C;  2LY2 A;  3KP5 A;  2V1N A;  3CUQ A;  2JMW A;  2O03 A;  1R1T A;  2QVO A;  3SFI A;  2VIX A;  3WTU C;  1FOK A;  4XMY A;  3CO6 C;  2LR8 A;  2B9S A;  5IP7 J;  1XS9 A;  1LEB A;  2JJ7 A;  3KP3 A;  1XGO A;  2VJI A;  4M72 A;  2PJP A;  1ZRD A;  1O3R A;  2HPI A;  3Q5F A;  4A3K J;  1W5S A;  2L9R A;  1SEU A;  4XKW A;  3IH4 A;  5BS6 A;  3E5U A;  1IGN A;  4E7H A;  4ENN A;  2O8K A;  2FNP A;  3OY9 A;  3BQZ A;  2CUE A;  3AG2 H;  2JSP A;  3BG7 A;  5FRO A;  2EIK H;  4IRG A;  4BJ5 C;  1MBH A;  1WRJ A;  3Q0W A;  2ZME B;  2FBH A;  1WH7 A;  4A3J J;  1QPM A;  1U9N A;  2PMZ N;  1XDU A;  4JOM A;  3A0B C;  4GGG A;  5F0C A;  4EJW A;  4D7M A;  3LSK A;  3CC4 I;  2JSC A;  2XAU A;  1KON A;  2QA4 I;  4I01 A;  2R92 J;  2XRL A;  4HYE A;  4FTH A;  3S1M J;  2WV0 A;  1I6X A;  3MKW B;  1BL0 A;  5L3B A;  3ISP A;  3KZZ A;  3MZH A;  2EZL A;  2LBF A;  1VQ8 I;  3SXY A;  1BIA A;  1FOY A;  3RZO J;  4RGS A;  2I10 A;  2IGN A;  4N0B A;  5ICC A;  1TQI A;  3WU1 B;  3S3N A;  4PJJ A;  2OZ6 A;  2JTV A;  1V5F A;  1FTT A;  1TQP A;  2QEN A;  1ORK A;  2X85 A;  3ZMS A;  1QGP A;  1RES A;  4D5C A;  4P9U A;  4S05 A;  3MEX A;  3MQ0 A;  2HPM A;  4IL6 C;  1AA7 A;  4CO8 A;  4YFX F;  4CHU A;  1Z3Y A;  2RKH A;  3FBI B;  4AWX B;  5D8K B;  3FXU A;  3HDD A;  1WQ2 A;  1Y1V J;  1AOY A;  1BI0 A;  1OMI A;  4XKB A;  2XAH A;  2KJB A;  4HZF A;  2Y2Z A;  3VYR B;  3KP6 A;  4RGR A;  1H89 C;  1JHF A;  3HGY A;  3CCU I;  4A3B J;  4P55 A;  2W25 A;  2ZNY A;  3HOT A;  1F1Z A;  4A93 J;  3EUH C;  2OF7 A;  2L7K A;  1Z77 A;  3H1C A;  3GW2 A;  3QYF A;  2D1V A;  5TIS C;  4ENM A;  4NB5 A;  2K5C A;  3VSL A;  3M7G A;  1VQN I;  3KLO A;  4BHC A;  1TWC J;  1PJR A;  1R4M B;  2LF8 A;  1ERD A;  2AQF A;  2QQ8 A;  2RV8 A;  2XDV A;  4MEY F;  3HRS A;  1RNL A;  2L9S A;  3HUG A;  1FYM A;  1MH4 A;  1T0F A;  4DZJ A;  1CF7 A;  3CMA I;  1AKH A;  3ELK A;  5CYV A;  4IHV A;  1QZE A;  3B73 A;  3JTH A;  2BVL A;  5F6F A;  4HF0 A;  1LFP A;  1V55 H;  2QWW A;  1YW8 A;  1AU7 A;  1FPQ A;  5AON A;  2R4G A;  3CES A;  4S0H B;  5BPI A;  1IN7 A;  5EZG A;  1W36 D;  2K27 A;  3K69 A;  4M3E A;  3DKX A;  3A01 A;  4WXC A;  1YRN A;  1HKS A;  1C0W A;  2EA4 A;  5EF6 A;  3LMM A;  3S2W A;  2W24 A;  2CQN A;  1HKT A;  4ESJ A;  2BYV E;  3D0S A;  1YIO A;  2WTE A;  3DU5 A;  2STT A;  1WI3 A;  3E3V A;  2E1M C;  2KDO A;  2RQQ A;  3EQL F;  5GPA A;  3FMS A;  4XR6 A;  5B5E C;  1SVM A;  2MSY A;  2EK5 A;  4UUS A;  1BJZ A;  1HW1 A;  3KPH A;  4RAG A;  5DYM A;  1YI2 I;  1E17 A;  1G4D A;  3CJT B;  2E2J J;  2EFO A;  3DKW A;  4E70 A;  3DTE A;  4AD9 A;  1HSJ A;  1U6G A;  4L5E A;  4LB5 A;  3J80 K;  4LJZ F;  4GCV A;  5LGU A;  1V5E A;  4XK4 A;  3RKQ A;  2ELH A;  4Y4R A;  5EYR A;  3DPL C;  2VXD A;  2DK5 A;  4P1W A;  2V7F A;  2L9V A;  1Y0N A;  1SMT A;  2GA1 A;  3LA7 A;  4XOP A;  1PVE A;  4AIH A;  1V4R A;  1WJE A;  3G2B A;  3I53 A;  3IKT A;  4I76 A;  4ENK A;  1WGX A;  4BY1 J;  4BXX J;  5LHG A;  2DJN A;  1E2X A;  1WKM A;  1POG A;  4M3G A;  4A3E J;  1YS6 A;  1USS A;  2BV6 A;  3V7S A;  5EJC A;  4CCK A;  1E3H A;  3C18 A;  3WTY C;  3ML6 A;  4EM1 A;  4HX7 A;  2P81 A;  4IO9 F;  4DOZ A;  2ID3 A;  1ON2 A;  4OU0 A;  3CME I;  4L9N A;  1ZAO A;  3CDH A;  3CCR I;  2YS9 A;  2M4K A;  4P9F A;  3JRI A;  2DYS H;  2PQ8 A;  5IYB J;  2DA1 A;  3K4J A;  4L5I A;  1IV8 A;  2VBW A;  2OCE A;  3WG9 A;  1FBQ A;  1CF7 B;  4EJU A;  1JGS A;  4E7K A;  4XLP F;  1I3A A;  3J81 Z;  3S1N J;  2CQ7 A;  2NNN A;  1TWA J;  1J5Y A;  4XON A;  1XD7 A;  3OYD A;  2VE9 A;  2M1B A;  4XQF A;  2XC7 A;  3A01 B;  2DTR A;  1TWF J;  3ROU A;  5E20 A;  2E1O A;  1W5C C;  2IGO A;  1FOX A;  2BEO A;  2MD5 A;  2HEO A;  2FNA A;  2LK2 A;  4NNJ A;  1BI3 A;  3OS0 A;  3ECH A;  3V42 A;  2EWN A;  2XRO A;  2ECC A;  3O2P E;  1K4S A;  5HLI A;  1XSD A;  4BH9 A;  5TRD A;  3HOW J;  1W7P A;  2LMD A;  2YU3 A;  2NOG A;  3IKV A;  4I98 B;  4M9X A;  1T39 A;  2AHQ A;  3P9K A;  3RYR A;  3CD6 I;  5DM7 F;  5K5O A;  4ZZD A;  2VBZ A;  2XKO A;  3ZQF A;  2MC4 A;  2OD5 A;  2XF7 A;  4BE1 A;  4G7Z F;  4UUS B;  1Y39 A;  2EPF A;  5GAD J;  4FX4 A;  2GLO A;  4P96 A;  5FGM A;  1PUF A;  2A6H F;  2HQN A;  3BJ6 A;  3LSG A;  4U7D A;  2NS8 A;  3PNT A;  4ZDO A;  3CCM I;  1YIT I;  1BJA A;  4PJN A;  4A12 A;  2W48 A;  4X6A J;  1OYI A;  3BY6 A;  2EJR A;  3PL8 A;  3KCC A;  5LBQ A;  1WH5 A;  2WB1 A;  4XM3 A;  4F52 A;  3EYY A;  1GVD A;  3ZRG A;  2KRH A;  3CMM A;  1N25 A;  3G1M A;  2PLY A;  3H9G A;  2IJL A;  2DCE A;  4YG2 F;  1IRG A;  2WAE A;  3I4P A;  2E1C A;  5KCM A;  3CCV I;  5TGT A;  1TLH B;  4I0B A;  4A0X A;  2F2E A;  2XPW A;  4OWR B;  3FIW A;  1OJL A;  3WGH A;  3TO7 A;  2O5R A;  4HSR A;  1OCT C;  1J7K A;  3LQR A;  4XBF A;  3ZMT A;  3D5L A;  2F5D A;  3K4M A;  1ON1 A;  2DA3 A;  2VI6 A;  4L9J A;  4V19 K;  2R7Q A;  3BJO A;  2QZ8 A;  2K9Q A;  3G1L A;  2QEX I;  2CSO A;  1YS7 A;  3K2Z A;  6PAX A;  1SD4 A;  3RCO A;  4GRI A;  1QU3 A;  3H0G J;  4ON0 A;  2DOE A;  2KDZ A;  1G3W A;  2FU4 A;  2E1M B;  3HOZ J;  5GTH C;  2K02 A;  2EZH A;  2MFZ A;  3TO6 A;  5HOO A;  4HW0 A;  4ZTJ A;  1BR4 A;  1K7A A;  1F5T A;  4DBR A;  3DEU A;  4HQE A;  2M2E A;  4A5N A;  1WPK A;  2PMU A;  2X1E A;  4MO7 A;  3J7Z I;  4A69 C;  1IXR C;  3TKY A;  1LKX A;  2EIJ H;  3H36 A;  2XGE A;  2V1U A;  1KU3 A;  2HVS A;  3KIO A;  2K40 A;  3DLL F;  1FIA A;  3H3V K;  1DPU A;  5HNH A;  1KU9 A;  3GME A;  3OIO A;  1WWX A;  2W57 A;  2X0L A;  2Q0O A;  3ZQC A;  2PJR B;  3GF2 A;  1QPI A;  2CFX A;  2OPT A;  4U7B A;  1VF9 A;  3K7A J;  2E5N A;  2W85 A;  4BNC A;  3BTI A;  2ELJ A;  4IHY A;  4A6E A;  1OFC X;  2J5P A;  4OIP F;  2CJJ A;  3HB9 A;  3ASN H;  4FIS A;  3CZ6 A;  1STZ A;  1B4A A;  4X1E A;  4JYK A;  4KT5 C;  4FCY A;  3Q3S A;  4Y17 A;  3OYK A;  3PSF A;  2LDU A;  3LSR A;  2MD0 A;  2OQR A;  3CF2 A;  4M9S A;  1DUX C;  1HA8 A;  1Z7L A;  2K85 A;  1SD6 A;  4OAY A;  5FLM J;  2KJC A;  1GLN A;  4DYQ A;  1LDJ A;  2ME6 A;  2IP2 A;  1WI9 A;  5J8C A;  2K9S A;  3ESW B;  2EV5 A;  1JXS A;  2MH2 A;  1UAA A;  1OQY A;  3PSI A;  3QOP A;  4D0P A;  1OCC H;  1HLV A;  1MBE A;  4B47 A;  3I5U A;  5CLS A;  1CGP A;  4NQW B;  1T08 B;  2KRC A;  3OR1 C;  3PQJ A;  2STW A;  2XSD C;  5ED4 A;  2OJE D;  4ZYD A;  1VQL I;  2DBB A;  1JTY A;  1S7O A;  1JTX A;  4BUP A;  3ZMD A;  4E6K G;  4IKF A;  1Z67 A;  1NG7 A;  2QQA A;  1T33 A;  1TW3 A;  3C2B A;  3H5A A;  4PGG A;  1W0U A;  2AO9 A;  2WY8 Q;  3QP6 A;  2HDC A;  4BS9 A;  3FK7 A;  2FXA A;  3OS1 A;  3HSF A;  1S7E A;  2KT0 A;  4A0Z A;  5E3O A;  4XN3 A;  5M5X J;  4B48 A;  1JT0 A;  3HKZ N;  1R49 A;  3V7C A;  4I2O A;  4A0Y A;  2GM4 A;  4XLH A;  4B3X A;  2W00 A;  4UV8 A;  4EQQ A;  1KQ9 A;  3JAM Z;  2KZV A;  3KLN A;  4KN7 X;  4IZZ A;  1NTC A;  3RQI A;  1IO2 A;  4O3M A;  1MMS A;  1O3Q A;  2EFN A;  2DFF A;  1ZGJ A;  4Y3O A;  1Q1H A;  3I3L A;  3PFY A; 
#chains in the Genus database with same CATH homology
 1QA6 A;  3I56 I;  1VQN I;  2ZJP F;  3DLL F;  1S72 I;  3G4S I;  5GAE J;  3CMA I;  3CF5 F;  1FOX A;  3CC2 I;  2JQ7 A;  3G71 I;  1YIJ I;  2OTJ I;  5GAG J;  1VQ7 I;  3CCE I;  1VQP I;  3PIO F;  3CCS I;  3CD6 I;  5DM7 F;  3G6E I;  1VQ5 I;  1FOW A;  1Y39 A;  5GAD J;  2K3F A;  5DM6 F;  3CCL I;  3CCM I;  1VQM I;  1YIT I;  4IOC F;  1YJW I;  3CC4 I;  2H8W A;  1HC8 A;  2QA4 I;  2OTL I;  1YI2 I;  3CJT B;  5JVG F;  1VQ9 I;  2E34 A;  1VQL I;  1VQ8 I;  1FOY A;  3PIP F;  3CCV I;  4IOA F;  1VQ6 I;  1YHQ I;  1VQK I;  2FOW A;  2NXN B;  5GAH J;  3CC7 I;  2E36 A;  1ACI A;  4V19 K;  1YJ9 I;  2QEX I;  3CCQ I;  1YJN I;  1VQO I;  2E35 A;  4IO9 F;  3CCJ I;  3CME I;  3I55 I;  3CCR I;  1MMS A;  3CCU I;  3J7Y J;  4UY8 I;  2ZJR F;  1VQ4 I;  2ZJQ F;  3J7Z I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...