1VQ5L

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
150
structure length
145
Chain Sequence
b'TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vq5L02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1vq5L01
1Q81M 1YITL 1YIJO 3CD6O 1VQ9O 3CC4O 3CCEO 1YI2L 1VQ4L 1Q82M 1VQML 1VQKO 1VQ6L 1VQ8O 3CMAO 3CC7L 3CMEL 3CCJO 3CC2L 1K8AP 1S72L 3I56L 1K73M 3I55L 3CCUL 1VQPO 1YJWL 1KD1P 3CCQO 1K8AM 2QEXL 1M1KP 1YIJL 1VQ9L 3CCLO 3CC4L 1KD1M 3CCRL 3OW2N 1YJ9O 1M1KM 1VQOL 2OTJL 1VQ5O 1Q82P 3CPWN 1VQNL 3CMAL 2QA4O 3CCSL 1YJNL 1QVGN 3CCJL 3OW2K 1VQ7L 1KQSN 1K73P 1VQPL 2OTLO 3CPWK 3G6EL 3G71O 3CCVO 1W2BN 1JJ2N 3CD6L 1K9MM 3CCEL 1VQLO 1QVFN 3CCMO 1KC8M 2QA4L 1N8RP 1W2BK 1JJ2K 1VQKL 1NJIP 1YI2O 1VQ8L 1VQ4O 1QVFK 1Q7YP 1N8RM 1VQ6O 1NJIM 3CMEO 1Q7YM 3CC2O 3CCQL 1S72O 3I56O 3I55O 3CCUO 1K9MP 1YJWO 3CCLL 1QVGK 3CCML 2QEXO 1KC8P 1YHQO 1KQSK 1YJ9L 1M90M 3G4SO 3CCRO 1VQ5L 1YITO 1VQOO 3CXCN 2OTJO 1VQNO 3CCSO 1YJNO 2OTLL 1VQMO 1Q86P 1VQ7O 3CC7O 3CXCK 3G71L 3CCVL 1Q86M 1Q81P 1YHQL 1M90P 3G6EO 3G4SL 1VQLL
chains in the Genus database with same CATH superfamily
1Q81M 1YITL 1YIJO 3CD6O 1VQ9O 3CC4O 3CCEO 3NKDA 1YI2L 1VQ4L 1Q82M 1VQML 1VQKO 1VQ6L 1VQ8O 3CMAO 3CC7L 3CMEL 3CCJO 5DS6A 3CC2L 1K8AP 1S72L 3I56L 3I55L 3CCUL 1VQPO 1K73M 1YJWL 1KD1P 3CCQO 1K8AM 2QEXL 1M1KP 1YIJL 1VQ9L 3CCLO 3CC4L 1KD1M 3CCRL 3OW2N 1YJ9O 1M1KM 1VQOL 2OTJL 1VQ5O 1Q82P 3CPWN 1VQNL 3CMAL 2QA4O 3CCSL 1YJNL 1QVGN 3CCJL 3OW2K 1VQ7L 1KQSN 1K73P 1VQPL 2OTLO 3CPWK 5DQTA 3G6EL 3G71O 3CCVO 2YZSA 1W2BN 1JJ2N 3CD6L 1K9MM 3CCEL 1VQLO 1QVFN 3CCMO 1KC8M 2QA4L 5DQZA 1N8RP 1W2BK 1JJ2K 1VQKL 1NJIP 1YI2O 1VQ8L 1VQ4O 4QDLA 4P6IC 1QVFK 1Q7YP 1N8RM 1VQ6O 1NJIM 5DLJA 3CMEO 1Q7YM 3CC2O 5DS4A 3CCQL 1S72O 3I56O 3GODA 3I55O 3CCUO 1K9MP 1YJWO 3CCLL 1QVGK 4WJ0A 3CCML 2QEXO 1KC8P 1YHQO 1KQSK 1YJ9L 4W8KA 1M90M 3G4SO 3CCRO 1VQ5L 1YITO 1VQOO 5DS5A 3CXCN 2OTJO 1VQNO 5FCLA 3CCSO 4N06A 1YJNO 4XTKA 2OTLL 1VQMO 1Q86P 1VQ7O 3CC7O 3CXCK 3G71L 3CCVL 1Q86M 1Q81P 1YHQL 1M90P 3G6EO 3G4SL 1VQLL
chains in the Genus database with same CATH topology
1Q81M 1YITL 1YIJO 3CD6O 1VQ9O 3CC4O 3CCEO 3NKDA 1YI2L 1VQ4L 1Q82M 1VQML 1VQKO 1VQ6L 1VQ8O 3CMAO 3CC7L 3CMEL 3CCJO 5DS6A 3CC2L 1K8AP 1S72L 3I56L 3I55L 3CCUL 1VQPO 1K73M 1YJWL 1KD1P 3CCQO 1K8AM 2QEXL 1M1KP 1YIJL 1VQ9L 3CCLO 3CC4L 1KD1M 3CCRL 3OW2N 1YJ9O 1M1KM 1VQOL 2OTJL 1VQ5O 1Q82P 3CPWN 1VQNL 3CMAL 2QA4O 3CCSL 1YJNL 1QVGN 3CCJL 3OW2K 1VQ7L 1KQSN 1K73P 1VQPL 2OTLO 3CPWK 5DQTA 3G6EL 3G71O 3CCVO 2YZSA 1W2BN 1JJ2N 3CD6L 1K9MM 3CCEL 1VQLO 1QVFN 3CCMO 1KC8M 2QA4L 5DQZA 1N8RP 1W2BK 1JJ2K 1VQKL 1NJIP 1YI2O 1VQ8L 1VQ4O 4QDLA 4P6IC 1QVFK 1Q7YP 1N8RM 1VQ6O 1NJIM 5DLJA 3CMEO 1Q7YM 3CC2O 5DS4A 3CCQL 1S72O 3I56O 3GODA 3I55O 3CCUO 1K9MP 1YJWO 3CCLL 1QVGK 4WJ0A 3CCML 2QEXO 1KC8P 1YHQO 1KQSK 1YJ9L 4W8KA 1M90M 3G4SO 3CCRO 1VQ5L 1YITO 1VQOO 5DS5A 3CXCN 2OTJO 1VQNO 5FCLA 3CCSO 4N06A 1YJNO 4XTKA 2OTLL 1VQMO 1Q86P 1VQ7O 3CC7O 3CXCK 3G71L 3CCVL 1Q86M 1Q81P 1YHQL 1M90P 3G6EO 3G4SL 1VQLL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 M;  1YIT L;  1YIJ O;  3CD6 O;  1VQ9 O;  3CC4 O;  3CCE O;  1YI2 L;  1VQ4 L;  1Q82 M;  1VQM L;  1VQK O;  1VQ6 L;  1VQ8 O;  3CMA O;  3CC7 L;  3CME L;  3CCJ O;  3CC2 L;  1K8A P;  1S72 L;  3I56 L;  1K73 M;  3I55 L;  3CCU L;  1VQP O;  1YJW L;  1KD1 P;  3CCQ O;  1K8A M;  2QEX L;  1M1K P;  1YIJ L;  1VQ9 L;  3CCL O;  3CC4 L;  1KD1 M;  3CCR L;  3OW2 N;  1YJ9 O;  1M1K M;  1VQO L;  2OTJ L;  1VQ5 O;  1Q82 P;  3CPW N;  1VQN L;  3CMA L;  2QA4 O;  3CCS L;  1YJN L;  1QVG N;  3CCJ L;  3OW2 K;  1VQ7 L;  1KQS N;  1K73 P;  1VQP L;  2OTL O;  3CPW K;  3G6E L;  3G71 O;  3CCV O;  1W2B N;  1JJ2 N;  3CD6 L;  1K9M M;  3CCE L;  1VQL O;  1QVF N;  3CCM O;  1KC8 M;  2QA4 L;  1N8R P;  1W2B K;  1JJ2 K;  1VQK L;  1NJI P;  1YI2 O;  1VQ8 L;  1VQ4 O;  1QVF K;  1Q7Y P;  1N8R M;  1VQ6 O;  1NJI M;  3CME O;  1Q7Y M;  3CC2 O;  3CCQ L;  1S72 O;  3I56 O;  3I55 O;  3CCU O;  1K9M P;  1YJW O;  3CCL L;  1QVG K;  3CCM L;  2QEX O;  1KC8 P;  1YHQ O;  1KQS K;  1YJ9 L;  1M90 M;  3G4S O;  3CCR O;  1VQ5 L;  1YIT O;  1VQO O;  3CXC N;  2OTJ O;  1VQN O;  3CCS O;  1YJN O;  2OTL L;  1VQM O;  1Q86 P;  1VQ7 O;  3CC7 O;  3CXC K;  3G71 L;  3CCV L;  1Q86 M;  1Q81 P;  1YHQ L;  1M90 P;  3G6E O;  3G4S L;  1VQL L; 
#chains in the Genus database with same CATH topology
 1Q81 M;  1YIT L;  1YIJ O;  3CD6 O;  1VQ9 O;  3CC4 O;  3CCE O;  3NKD A;  1YI2 L;  1VQ4 L;  1Q82 M;  1VQM L;  1VQK O;  1VQ6 L;  1VQ8 O;  3CMA O;  3CC7 L;  3CME L;  3CCJ O;  5DS6 A;  3CC2 L;  1K8A P;  1S72 L;  3I56 L;  3I55 L;  3CCU L;  1VQP O;  1K73 M;  1YJW L;  1KD1 P;  3CCQ O;  1K8A M;  2QEX L;  1M1K P;  1YIJ L;  1VQ9 L;  3CCL O;  3CC4 L;  1KD1 M;  3CCR L;  3OW2 N;  1YJ9 O;  1M1K M;  1VQO L;  2OTJ L;  1VQ5 O;  1Q82 P;  3CPW N;  1VQN L;  3CMA L;  2QA4 O;  3CCS L;  1YJN L;  1QVG N;  3CCJ L;  3OW2 K;  1VQ7 L;  1KQS N;  1K73 P;  1VQP L;  2OTL O;  3CPW K;  5DQT A;  3G6E L;  3G71 O;  3CCV O;  2YZS A;  1W2B N;  1JJ2 N;  3CD6 L;  1K9M M;  3CCE L;  1VQL O;  1QVF N;  3CCM O;  1KC8 M;  2QA4 L;  5DQZ A;  1N8R P;  1W2B K;  1JJ2 K;  1VQK L;  1NJI P;  1YI2 O;  1VQ8 L;  1VQ4 O;  4QDL A;  4P6I C;  1QVF K;  1Q7Y P;  1N8R M;  1VQ6 O;  1NJI M;  5DLJ A;  3CME O;  1Q7Y M;  3CC2 O;  5DS4 A;  3CCQ L;  1S72 O;  3I56 O;  3GOD A;  3I55 O;  3CCU O;  1K9M P;  1YJW O;  3CCL L;  1QVG K;  4WJ0 A;  3CCM L;  2QEX O;  1KC8 P;  1YHQ O;  1KQS K;  1YJ9 L;  4W8K A;  1M90 M;  3G4S O;  3CCR O;  1VQ5 L;  1YIT O;  1VQO O;  5DS5 A;  3CXC N;  2OTJ O;  1VQN O;  5FCL A;  3CCS O;  4N06 A;  1YJN O;  4XTK A;  2OTL L;  1VQM O;  1Q86 P;  1VQ7 O;  3CC7 O;  3CXC K;  3G71 L;  3CCV L;  1Q86 M;  1Q81 P;  1YHQ L;  1M90 P;  3G6E O;  3G4S L;  1VQL L; 
#chains in the Genus database with same CATH homology
 1Q81 M;  1YIT L;  1YIJ O;  3CD6 O;  1VQ9 O;  3CC4 O;  3CCE O;  3NKD A;  1YI2 L;  1VQ4 L;  1Q82 M;  1VQM L;  1VQK O;  1VQ6 L;  1VQ8 O;  3CMA O;  3CC7 L;  3CME L;  3CCJ O;  5DS6 A;  3CC2 L;  1K8A P;  1S72 L;  3I56 L;  3I55 L;  3CCU L;  1VQP O;  1K73 M;  1YJW L;  1KD1 P;  3CCQ O;  1K8A M;  2QEX L;  1M1K P;  1YIJ L;  1VQ9 L;  3CCL O;  3CC4 L;  1KD1 M;  3CCR L;  3OW2 N;  1YJ9 O;  1M1K M;  1VQO L;  2OTJ L;  1VQ5 O;  1Q82 P;  3CPW N;  1VQN L;  3CMA L;  2QA4 O;  3CCS L;  1YJN L;  1QVG N;  3CCJ L;  3OW2 K;  1VQ7 L;  1KQS N;  1K73 P;  1VQP L;  2OTL O;  3CPW K;  5DQT A;  3G6E L;  3G71 O;  3CCV O;  2YZS A;  1W2B N;  1JJ2 N;  3CD6 L;  1K9M M;  3CCE L;  1VQL O;  1QVF N;  3CCM O;  1KC8 M;  2QA4 L;  5DQZ A;  1N8R P;  1W2B K;  1JJ2 K;  1VQK L;  1NJI P;  1YI2 O;  1VQ8 L;  1VQ4 O;  4QDL A;  4P6I C;  1QVF K;  1Q7Y P;  1N8R M;  1VQ6 O;  1NJI M;  5DLJ A;  3CME O;  1Q7Y M;  3CC2 O;  5DS4 A;  3CCQ L;  1S72 O;  3I56 O;  3GOD A;  3I55 O;  3CCU O;  1K9M P;  1YJW O;  3CCL L;  1QVG K;  4WJ0 A;  3CCM L;  2QEX O;  1KC8 P;  1YHQ O;  1KQS K;  1YJ9 L;  4W8K A;  1M90 M;  3G4S O;  3CCR O;  1VQ5 L;  1YIT O;  1VQO O;  5DS5 A;  3CXC N;  2OTJ O;  1VQN O;  5FCL A;  3CCS O;  4N06 A;  1YJN O;  4XTK A;  2OTL L;  1VQM O;  1Q86 P;  1VQ7 O;  3CC7 O;  3CXC K;  3G71 L;  3CCV L;  1Q86 M;  1Q81 P;  1YHQ L;  1M90 P;  3G6E O;  3G4S L;  1VQL L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...