1VQ5P

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq5P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq5P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq5P02
3OW2O 3I55P 1VQPP 1S72P 1M1KQ 3CCJP 1VQ7P 3CMEP 2QEXP 3CCEP 3CCLP 3CMAP 1YI2P 1Q81Q 1VQ8P 3CD6P 3CC2P 3G4SP 1Q86Q 1VQKP 1KD1Q 3CCUP 1YITP 2OTJP 1JJ2O 1KQSO 3CCMP 1YJNP 1NJIQ 1YIJP 1VQ9P 1Q82Q 2OTLP 1QVGO 3G6EP 3CPWO 1K9MQ 1VQNP 1K8AQ 1KC8Q 1Q7YQ 3G71P 1K73Q 1YHQP 1VQLP 3CCSP 3CC4P 1N8RQ 1QVFO 1VQ6P 1YJWP 3CCRP 1VQ5P 1VQ4P 1YJ9P 2QA4P 3CXCO 3CCVP 1VQOP 3CCQP 3CC7P 1VQMP 1W2BO 3I56P 1M90Q
chains in the Genus database with same CATH superfamily
2PEMA 2KWLA 1FZCB 4B86A 1S9KD 1URQC 2KZIA 2Z44A 4H2XC 1UNKA 2LTEA 3L75G 4PD4D 1RHZB 1KILE 2QIWA 3TYYA 2QJKC 1M1JC 2FFDA 1FOSF 3VP8A 1BGYJ 1QVGO 3O6QA 1JUNA 1VDFA 2Q3IA 2KSJA 1E6JP 4U3FG 1PP9G 1MZ9A 1M6NA 2ERHA 3D6ZA 2Z46A 4IFMA 2K94A 3BRTB 3AE3C 3B4QA 5APXA 2A45H 3HD7D 5KLVD 3AECC 2XNXA 1WRGA 5AVUB 5CCGA 1M6EX 2SPZA 2FYNC 1YTZT 2KORA 3CWBG 1SQBD 1IC2A 1IO4A 3L75D 1T3UA 1IMQA 2E75D 3CCQP 2YIUB 3BCCE 1EZVD 1L0NE 3CX5D 1LWUB 3GG2A 1JMBA 1IFMA 3HD7C 3FWNA 3SSUA 2XZ1C 1Z56A 3G0VA 3HE5B 4ZNCA 5AVXB 3KZIH 3L70J 5TJHA 1SQVE 3CCSP 3Q5SA 3D6YA 1VQOP 3PHLA 3G1IA 3H6PA 1VKUA 2Q6QA 3M0DC 1JCCA 4OWFA 4Y99C 5E79E 1JJ2O 1SP4A 2YKOA 1GU4A 1N73B 1IFJA 2JR8A 2GDXA 3P8CE 1A43A 4KT0J 2EFJA 2OYIA 2I1KA 4WY4D 5AVWB 2JQ4A 3VN0A 2M0BA 1VQ5P 1JY2P 3HUSA 4N3YB 1XTCC 1QRJA 1FZBA 1M7LA 1VF5D 2BCCJ 1RF1B 1EDLA 3CXHH 3M06A 1SQXE 2CQ8A 4YXWH 4XFZA 2L5GB 3VMYA 5AVZB 2HPCA 1MFZA 2WSCJ 1PPJG 2A06G 2M5AA 3OW2O 1SQQE 3CCEP 4ASWA 1U57A 1NOHA 3AE1C 1OFCX 3OAKA 1NJIQ 5AW9B 3P7KA 1YQ3C 2R32A 1X22A 3KQGA 3V2RA 1LTTC 3P32A 3FWLA 1IZNB 5CJ4A 1PPJD 1KFNA 1PPJE 5AVQB 2OYHB 2IYPA 2K0DX 4QKOA 3LIEA 1GK4A 3C8VA 5AVSB 2O01H 1LT9A 1NHLA 1YJ9P 2JYLA 2QNWA 2WITA 3VMAA 2KOGA 5AVVB 3B4SA 3I55P 3GHGB 3RGUA 2ZAEB 3E1IA 1L4AC 4Y28J 4PJ0H 1CI6B 5E79H 4H2YC 3G28A 1PEMA 1KILA 1ZOYC 1SLQA 1VQ6P 4AUWA 2IDBA 1HTLC 2A45I 3V5BA 3O6QB 4IZ6A 3V4QA 3EJDA 2M8PA 3RK3E 4H44B 2QJYC 1IFNA 2D2CC 1CW5A 4GOEA 1MKMA 2WPVB 1CEIA 1JNMA 4U3FD 1NU1K 1NVOA 1X9VA 3GLMA 2KB7P 3FX0A 4WVZA 2WSCH 1HGZA 1HY8A 3L72G 3EJEA 1AF8A 3IN6A 1QGKB 5APQA 3HYBA 2OYOA 3VTPC 1KQFB 4YTPC 3F5HA 2A45G 4W7ZA 4GODA 3CXHD 3HE4B 3H1KD 2N5IA 3H1HG 4JYBA 1EZVI 2BHVA 2M5AB 2E76D 2ZYDA 2GDYA 3H1JD 3K5BA 5KP7B 4D6TE 5BS1A 1S5LX 1NAFA 3RK3B 1DEBA 2JWAA 3T97B 1D7MA 1SQPE 4M0IA 2B88A 5BVZA 1OW7A 2FYUE 4UB8H 5EFWB 2I8DA 1UIXA 4DT0A 1S5LE 1M56D 1SQBJ 1HJ0A 3H32A 2KSEA 4H0LB 3Q3DA 1N73A 2ZT9C 1S1CX 1L0LD 3RBXA 2L0QA 2ZVOB 1OR5A 2GZGA 2H8PD 3RK3C 1QEXA 1M57D 2NPSB 1KMIZ 4L73A 1FOSE 2KS1A 1A02J 5B66H 1KZUB 1NTKK 3RK2C 3DS5A 1HVVA 1BGYE 3L37A 4ZKUA 1U7JA 3EFGA 5CCHA 1VQ8P 4U0BA 4XFXA 1ACPA 2PNGA 4IOIH 5KLVG 3L74G 1JY3N 3MTUE 5HGNA 2L91A 4LLHA 5GTHH 2FYUJ 1MUUA 3RK2D 1T8ZA 5AW3B 2JU2A 3U1AA 1LTJC 2NPSC 4XRQA 2G8YA 1TU3F 1P84I 3RG2A 2K9JA 2AXTE 5AW6B 5KTBA 1KD1Q 2K9YA 1BXIA 5GTIE 3L73J 4C7NA 2KZJA 3CWBE 2FVAA 4AQRD 5KAFH 4HB1A 1JTHA 1YHQP 1AFOA 2YMKA 3EJBA 3NMDA 3HZQA 1R5SA 2EG5A 3G9RA 1VHNA 1SQXJ 2E74D 4RO0A 5BU8B 3WUUA 1PP9D 1FZEA 1SQBK 2POHA 1NTKG 2E74B 3AEAC 5APUA 1L0LK 1ZRTE 1VQ9P 2W27A 1K9MQ 2Q3EA 1ZLLA 2O1KA 1G2CA 1KLPA 3JSVC 1OIPA 1J1DC 2LMLA 3TNUB 1JB0J 2GUSA 1EMVA 2ONTA 3CX5E 1L0ND 2PFXA 1BGYG 2QJPB 1IJDB 2B87A 1FBMA 1NTME 2KR5A 4GR6A 1NTMD 3V4WA 1GL2C 3DS0A 1RNIA 3PLNA 1S5LH 1JEKA 4WYMA 2H7HA 2JO0A 1FE6A 1LP1B 2V7QH 1BDCA 1RE4A 1RF1C 1FJKA 3H1ID 5APVA 2YIUC 1LJ2A 1DIPA 1FC2C 2Q7CA 2L6EA 2PEIA 1GXGA 2E1MA 2NPSD 3HD7B 4R0MA 2C0XA 1ZR2A 1AQ5A 2K1AA 1PL5A 1NTMG 2NZ2A 3H32B 2R5DA 1Q81Q 3MP7B 3E7KA 3BASA 2Y0DA 3TDKA 3TGUE 1LNQA 5AW7B 2H88C 1NAYA 1IK9A 2Z5HA 4U3FJ 3C1LA 3H1IG 2EHSA 2LKIA 2K37A 1N73C 4JPZB 3LRYA 3NTNA 2FQ1A 3ITKA 2HYNA 2AFEA 5KLVJ 1YI2P 3G26A 2E5YA 3G4SP 2FYUK 1R8EA 2KXPB 1NO4A 1N7SB 1SQVD 1SQVK 1J1DB 4N78D 1U7MA 3LW5J 1W2BO 2M8LA 1LTGC 5KKZB 1F80D 3H1IE 2Z4EA 4PD4E 3TNUA 1GU5A 5AVYB 2ZXXA 1DEEG 3SFEC 1KQGB 3L74D 5APSA 2E76B 3G6EP 5CMZA 1BDDA 3M0DA 1N86A 2E5TA 2N1TC 1EXJA 1RF0A 2C9NY 3KYQA 3H4EA 1L0LE 4BXLA 4UB6E 5KP6B 5AW2B 2XZRA 5GTHE 2FKWB 2KNCA 1LTSC 1NH4A 4CPGA 2KGCA 3AE4C 4HJGH 2R3CA 2MD9A 1QLED 1HUCA 1NTKE 2AXTH 2LPKA 1NKNA 1A8OA 1SS1A 2WSFJ 1DNYA 4IFDK 5APWA 1T2KC 2OYHC 2MR7A 3L71E 1JY2O 3GW6A 5I4TG 2RN0A 3S9OA 2KODA 2HFED 2IFNA 2J5UA 3KHUA 4MN4C 2XT1A 1BSNA 2MJZA 2M3BA 3USSA 3RL0D 1ZV8A 3CMEP 3AE9C 3JC22 2B87B 4IFFA 3Q2YA 1KILD 4HH2A 2KGDA 1RO0A 3RK2B 3JCUH 4H44C 5KP8B 3AE8C 1G1JA 1Y47A 3PP5A 1T6AA 2OYHA 1AJYA 2K88A 5M1BA 3DS4A 4BWNA 3ABVC 1FZGA 4OGQC 2M3EA 1HWTC 3G71P 5KAIH 4EYYQ 3E2DA 2MY5A 3RL0g 2Q5UA 1FDMA 1PEOA 4H2WC 3RK3D 3A0BE 3L73G 4Z1MH 1M8OB 3GHGA 2G3AA 3V2PA 3H1KJ 5KJ7C 3Q5PA 5AVRB 1H0TB 5KLVE 1SQPG 2GUVA 1NQ4A 1EDJA 1EXIA 4WB4A 2N1TA 2FACA 2BEQD 5HV8A 2EHTA 1ZP0C 4D6TG 1IMPA 2V4HA 2DW3A 1J1EB 1VPCA 5KJ7D 1AV1A 3AE6C 1Q7YQ 2DNWA 2AF8A 2JB0A 4R4MA 2RMZA 3CXCO 2KOOA 3I56P 4TLFA 2EIAA 2FVEA 4U0DA 1T2KD 1GL2B 1GW4A 1RY3A 3H1KG 4HKZH 3A2AA 3MIWA 2WPSA 5KLVK 1DV5A 3UIAA 4KJMA 4BRYB 1W2EA 3TGUD 4H13C 1L0LJ 1OX3A 1VF5C 2LIWA 4MRTC 1VQLP 1EZVE 4IPYA 1M90Q 2P7JA 1GW3A 2KLVA 2K0XA 1USDA 3GF3A 3BCCJ 1YITP 2E75B 3AEFC 2QRXA 1SQQG 2CPSA 2JEEA 2KLUA 4EI2A 1EC5A 1FZAA 1DH3A 4BPHA 1KILB 3CXHI 2FYUG 1L0IA 3AE5C 2O3JA 1BGYD 1P84H 1L0LG 3L74E 2W6JH 3B5NC 3M0AA 1PV3A 1FAVA 1SQXK 3DS1A 3CCMP 2JKVA 4WWIA 1IUQA 4UB6H 2ZVNB 3SWFA 2JO1A 5DCKA 3CX5I 2XV5A 1KB9D 1SQXD 3H1LD 3HUSC 5KAFE 2IBZD 4W7YA 3G21A 3MUDA 2MF4A 2WT7B 4U7JA 3G1GA 3M9BA 2FYUD 2ZXEB 1LT1A 3LW5H 2K92A 1IFDA 3DS3A 1ZNVA 4RESB 3L71D 1VQMP 2JDIH 3GMAA 1RH5B 4C7RA 1VQ7P 1LT9C 2XDJA 1URQA 2KYVA 2B9BA 2N9BA 1AQTA 3CC2P 4YXDC 3AE2C 1NTKJ 2WSSH 3T97A 3GZMA 1MFTA 2A06D 2LXBA 5KLIB 2YXQB 1KTMA 1SQXG 5KJ7A 1JO5A 1K05A 1PP9J 4JQ0D 2Y0CA 3TGUJ 4CA3A 5EJDA 1HQBA 2FQ2A 4QMAA 3CWBJ 2LKMA 5F2OA 1FZCC 2XNDH 1KYOH 4H13D 1YQ4C 3AEBC 3MHVA 4PV1B 1YIJP 4U3FE 5C39A 3EQ2A 4I7ZB 3SFDC 2FFDB 3KDPB 3GF7A 4UB8E 1SQPD 4PD4H 3CCLP 1PIXA 2BEZF 1NTMK 2QJPC 1GL2A 3CXHE 1RE3A 2GZEA 1LTIC 3H1JJ 1BCCE 1FDOA 2KOPA 3E1RA 1QL2A 4XA4A 3AEEC 4PJ0E 3AEGC 3QH9A 2P1JA 1OMIA 3VOPA 1LWUC 3H1IJ 1PGQA 3TSIA 1N7SC 5JPAA 4IL6E 2LOLA 1FZFA 2K9JB 1EZVG 2WSEJ 1LTAC 1SFCA 3ZDMA 5KKZC 1NWQA 3HTKB 1NTZE 4BRYA 2M8NA 1LTBC 2IYOA 3NTEA 1M1JB 2Q9IA 3H1KE 3L72D 1NYHA 5HVCA 2W8ZA 3L72E 2Q1KA 4PWVB 1Z6MA 3P8MC 3W67A 5H2FE 1WT6A 2WTYA 1ZW0A 3RL0C 2PENA 1RO2A 1XTGB 1LP1A 5TISH 4PH1A 1L0HA 1GD2E 4TT3H 3MD0A 3BATA 3FXEA 2KGEA 5DJTB 2LXCB 3G29A 1SQVJ 2V7QJ 2WPQA 5K5GB 5GTIH 3CPWO 2YO3A 2KP8A 2ZJSE 1N8RQ 2ROQA 1K04A 3HTKA 2HPCB 3M91A 1VQPP 4JF7A 2QM8A 1SQQJ 4Y99B 1ZRTD 2N5HA 2KG6A 4F37A 3GJNA 2P67A 2KK7A 3R2PA 1E0HA 1RF1A 5CCGD 2JU1A 1MV8A 4PD4I 2IBZG 3VMZA 4PH0A 1L0NJ 2KOQA 3H0DA 5APYA 3V2NA 4ASVA 2FBWC 4H44D 3P05A 3HRNA 2QEXP 2VRSA 2Z45A 3CD6P 1EDKA 2WPRA 3L4FA 2OARA 2FY8A 3VP9A 3H1HE 4WY4B 1CSBA 4LGDE 2QVAA 1MZ8A 5HGMA 3C9IA 5HGLA 1PEUA 3CMAP 3M9QA 3H25A 2HG5D 3NY7B 5F2NA 2LR2A 1BCCD 1GPJA 4DJGA 3JCUE 3KPEA 4U0EA 2D2CB 2IBZI 2OYIC 3AEDC 2NRGA 1X0TA 1BE3D 1P84E 3A3YB 3II6A 2W6BA 2Z5IA 5B66E 4EDFA 2VLOA 3H1LJ 4OGQB 2AVAA 3BVHA 1HJBA 2K3RA 5AW0B 1HBWA 2M5RA 4C46A 2WVRA 1KYOD 1SFCB 4BPGA 1GTWA 1GDTA 2WMMA 3WMM0 1K30A 5B5EE 2PAJA 1Y8AA 2FXPA 1RQVA 2R44A 3L71G 2O01N 2RKLA 1DD3A 2HODB 4DG9A 1GL2D 2QJYB 1EIAA 2HLOA 3H1JG 5CBOA 1GZLA 3RBZA 1YJNP 4H0LC 4RKUJ 1HGVA 1NTZG 3WU2H 3WU2E 2L22A 2O1JA 1YJWP 3VRLC 4O9BA 3CE7A 3B5ND 4D6TD 4EIJA 1JY2N 2KW2A 2WPTA 1NU1J 2PEJA 3H1LG 3S4RA 1KB9E 1KB9H 3L74J 2GZJA 2XU6A 3L70G 2LL8A 2Y9YA 5KLIC 3BCCG 1W5CE 3B8EB 1K73Q 1QVFO 3L75E 2ITAA 2QM7A 2PGDA 4HYTB 2BQ1E 4NPEA 3WBHA 2FYZA 2N98A 1AVOA 3SWYA 2E75C 2KIKA 4XFJA 5CZDB 1FZCA 2ZT9D 2BASA 4GDOA 1FU1A 3V2QA 1HH0A 4N6JA 3L70D 1SQBE 2QA4P 1AA0A 3EWKA 1RE3C 4LC1A 2K2QA 2CG5B 1SVFA 2L9FA 4NPFX 1SQVG 3TK1A 2OTJP 1YBKA 1BSHA 4DCKA 2D2CD 1VL2A 3GHGC 1VQNP 1L0NK 4PV1D 2E74C 2HODA 4GKGA 1QX8A 2RH0A 3CC7P 4H13B 2MVUA 5L8RJ 3W68A 4K3AA 3H1LE 2FVFA 3S1KA 1OW8A 2BCCD 3B5NB 2CGQA 4M3LA 2XV6A 2CWOA 3AE7C 2AEJA 5AW1B 1NTKD 2N50A 1PGPA 1S3JA 1PP9E 5TISE 5AVTB 2E76C 1AUMA 1BE3G 4YPCA 1PEQA 4U0CA 2IPPA 4U0FA 4WBAA 2AFDA 1PGJA 4OVNF 1KB9I 2QE7H 1OWAA 4XFYA 4XROA 1OXZA 1Q90D 2FAEA 1N2DC 3VYIA 5BU5A 2PY8A 3NXSA 2NPSA 1A02F 3VMXA 2IZ0A 1M1KQ 3H1HJ 1J2JB 1IFPA 2KS1B 2LIUA 4PXHB 2N6ZA 2XXMA 1VQKP 3IR9A 3N7NA 4I2LC 1ZMBA 2YNYA 3N4XA 4I7ZC 1BCCJ 1FS0E 1N7SA 2FFDC 2GM4A 1H0TA 4BPFA 3Q5RA 1EQ7A 4JYCA 2XKMA 4WY4A 1E5WA 1KFMA 2JAZA 1BE3J 4JBZA 1CI6A 2QSIA 2ZT9B 1KC8Q 3PTZA 2Y9ZA 3B71A 1SQPJ 2N9YB 4A7PA 1ZR4A 3PH0A 2H43A 3B5IA 1NKZB 4IL6X 3FXDA 2DGYA 1URQD 1URQB 1ZN5A 2MR8A 3L73D 1NU1G 2JGPA 2UWJE 3BCCD 5DJUB 1NGMB 1EOQA 4NEOA 2K93A 2PRRA 2X2BA 2OTKE 3I5CA 1JCDA 1RF0C 2K0YA 3F89A 2YKPA 2FYNB 3Q1MA 3IFMA 3EFFK 2JBGA 1L2PA 1NU1D 5CCHD 2GYKA 1PGOA 2KUBA 1H88A 5HGOA 1LGHB 3L71J 2I1JA 2JJLA 2W90A 1USEA 2W83C 1YYCA 3TGUG 2JWDA 1KORA 3R4YA 4WY4C 3OA7A 1M1JA 2W6AA 2E43A 5AW8B 1BAJA 4K35A 3CCUP 2GZFA 1L4AD 3MUDC 1NTZD 1SQBG 2WT7A 3L70E 5CCHC 4NPDA 1L4AB 1SQQK 3O8ZA 2CPBA 3LMOA 2KOSA 4COCA 2FADA 1DX7A 1ZXGA 1UJZA 1OZHA 1VF5B 2BUOA 5CCGC 4GR2A 3CL3D 1KYOE 3H47A 3L35A 4ZKPA 3WUVA 2P10A 2KNCB 4GIFA 2Y0EA 1AYIA 2GA1A 3KZIE 2E42A 2NO8A 2OGUA 1M74A 1IK7A 4QNBA 3A0HH 2YKQA 2LF4A 2VSQA 3HE4A 2KG8A 4U0AA 4OGQD 1Q82Q 2ZYAA 2P58A 1YTZI 3U59A 2AXCA 2OQQA 4DOJA 1RE4C 1KYOI 2N1TB 4H0LD 3M1MA 1LWUA 2P2UA 2A06E 2P9XA 4UHPB 2YO2A 2MKVA 1H89A 3L73E 1RQUA 3MGEA 3CCRP 5CHXA 2JYGA 3NFQA 1X8YA 5H2FH 3U1CA 2R3SA 1S72P 1FDIA 2PP6A 1JY3O 5CJ0A 1PFIA 4DZOA 5APTA 3BRVB 3L75J 3GZLA 1LT9B 3OJAB 1KILC 1NTMJ 2WSEH 3L72J 2L4BA 1S9KE 1OVUA 3MGNA 1JTHB 3A7OA 5CBNA 3DPHA 3DS2A 2YXRB 1GMJA 1NU1E 2H89C 2PEKA 1T8KA 4I6MC 2WWWA 2PEQA 1N7SD 1SQPK 3IAOA 3TF5A 2M8RA 2CNRA 2FQ0A 3GKLC 1GXHA 3PJSK 2OYIB 1QL1A 2C0WA 1LTJB 4N78E 1DD4A 3DTJA 4RJTA 4GT1A 5AW4B 1Y9BA 2IBZE 2BCCG 4L75A 1E79H 2KG9A 2BCCE 5F2KA 1KQSO 1D1DA 2OTLP 3Q20A 3CLQA 2N6YA 1J1EC 3CWBD 4OH8B 5AW5B 4D6TJ 3CI9A 1ZMEC 1SFCC 4L76A 2FXMA 1SQQD 1L4AA 3A5TA 2J59M 1G2CB 3QWOC 1OVRA 1NTZK 2N1TD 3A0BH 2GDWA 1KN7A 2JP3A 4HKGA 3L36A 1KQLA 4EOTA 4AYCA 3U43A 3CX5H 4ZMDA 3PRJA 2KI7B 1PZQA 5KAIE 1EDIA 1T3JA 1R5LA 2IFMA 1JOCA 2C9LY 4L74A 3LIDA 4IL6H 5B5EH 2VLQA 3A0HE 3V6IA 2YMYA 3HD7A 1OW6A 1FJPA 1OVVA 1JY3P 3D71A 4PV1C 3P8CD 1N7LA 1Q2NA 3SWKA 3G3ZA 1K8AQ 2ZYGA 2FHSC 1AVYA 1GK6A 4COPA 2GZIA 2WSFH 7CEIA 2O01J 1HF9A 3CCJP 3RL0B 1JM0A 2VLPA 1S2EA 1G1IA 3IF4A 1KV4A 1CZQA 5EW5E 3HE5A 2AEFA 3D70A 3KXDA 2QJKB 2IX7C 1LTJA 1L0NG 1S4XA 4R4LA 4KHXA 1BE3E 1P84D 2B89A 3FGAD 3MZWB 3M9HA 3WUTA 3H1HD 2MVVA 2HR3A 4XE5B 1IFIA 1UIIA 3HUSB 2WZ7A 2K5XA 2KGAA 3CC4P 1X3OA 1H8AA 1WMKA 2ZFCA 3RG6C 3CCVP 2FXOA 1VQ4P 4I1LA 1NTZJ 2AEMA 2J58A 2PEOA 2R5BA 1Q86Q 4C7NB 2WQYC 2IZ1A 3B5NA 1JMMA 2CK3H 3H1JE 1FR2A 1X79B 5BS2A 2VLNA 2QG4A 4W80A 1SFCD 4GOFA 2XZ0D 1BCCG
chains in the Genus database with same CATH topology
2JO0A 3DS5A 2M8PA 3H4EA 2PEMA 1VQPP 1S72P 3CCLP 1VQ8P 1BAJA 2Z44A 4U0BA 4XFXA 2OTJP 3CCUP 4XFZA 1K30A 2L6EA 3DS1A 3CCMP 2PEIA 5HGNA 1QVGO 1IUQA 2E1MA 1KC8Q 1K8AQ 1VQNP 4COPA 4PH0A 1A8OA 3H0DA 3CC7P 3HYBA 1E6JP 4XRQA 5DCKA 3OW2O 1M6NA 4COCA 3CCJP 2Z46A 3DPHA 3DS2A 3P05A 5I4TG 1EIAA 2BUOA 2QEXP 3CCEP 1Q81Q 5JPAA 3G21A 2Z45A 4GR2A 3CD6P 2PEKA 3H47A 1KD1Q 2KODA 2OARA 3G1GA 2PEQA 2XT1A 2XV6A 2CWOA 1YJNP 3B5IA 1NJIQ 1M6EX 2DGYA 2BHVA 1Q7YQ 1YHQP 3DS3A 3HZQA 1YJWP 3VRLC 1M74A 2EG5A 2M8NA 3CXCO 5BS1A 3CCQP 4QNBA 1VQMP 3I56P 5HGMA 2EIAA 3LRYA 3NTEA 1AUMA 4U0DA 5HGLA 1VQ7P 2PEJA 3CMEP 1PEUA 3DTJA 3CMAP 1YI2P 2LF4A 1PEQA 3G26A 4U0CA 4U0FA 3CC2P 3G4SP 5F2NA 3G0VA 4M0IA 1RO0A 5F2KA 4XFYA 1KQSO 4U0AA 1EOQA 1VQ9P 4XROA 1D1DA 1Q82Q 2OTLP 3Q20A 1K9MQ 4U0EA 1K73Q 1VQLP 1QVFO 3CCSP 3CC4P 2PENA 1RO2A 2PY8A 1YJ9P 2JYLA 3RG6C 3CCVP 1VQOP 4IPYA 1W2BO 3G1IA 1M90Q 1VQ4P 2ONTA 4PH1A 2M8LA 2BQ1E 3I55P 1M1KQ 5F2OA 2PEOA 3M1MA 3WBHA 3DS4A 1Q86Q 2XXMA 1VQKP 1YITP 2P9XA 1ZMBA 1JJ2O 3G28A 1PEMA 3G29A 5HGOA 1YIJP 4GR6A 1A43A 3G6EP 2EFJA 3CPWO 3DS0A 3G71P 1RNIA 1N8RQ 5BS2A 1VQ6P 1QRJA 3E2DA 3MGEA 3CCRP 1VQ5P 2QA4P 2JYGA 1PEOA 4WYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 O;  3I55 P;  1VQP P;  1S72 P;  1M1K Q;  3CCJ P;  1VQ7 P;  3CME P;  2QEX P;  3CCE P;  3CCL P;  3CMA P;  1YI2 P;  1Q81 Q;  1VQ8 P;  3CD6 P;  3CC2 P;  3G4S P;  1Q86 Q;  1VQK P;  1KD1 Q;  3CCU P;  1YIT P;  2OTJ P;  1JJ2 O;  1KQS O;  3CCM P;  1YJN P;  1NJI Q;  1YIJ P;  1VQ9 P;  1Q82 Q;  2OTL P;  1QVG O;  3G6E P;  3CPW O;  1K9M Q;  1VQN P;  1K8A Q;  1KC8 Q;  1Q7Y Q;  3G71 P;  1K73 Q;  1YHQ P;  1VQL P;  3CCS P;  3CC4 P;  1N8R Q;  1QVF O;  1VQ6 P;  1YJW P;  3CCR P;  1VQ5 P;  1VQ4 P;  1YJ9 P;  2QA4 P;  3CXC O;  3CCV P;  1VQO P;  3CCQ P;  3CC7 P;  1VQM P;  1W2B O;  3I56 P;  1M90 Q; 
#chains in the Genus database with same CATH topology
 2PEM A;  2KWL A;  1FZC B;  4B86 A;  1S9K D;  1URQ C;  2KZI A;  2Z44 A;  4H2X C;  1UNK A;  2LTE A;  3L75 G;  4PD4 D;  1RHZ B;  1KIL E;  2QIW A;  3TYY A;  2QJK C;  1M1J C;  2FFD A;  1FOS F;  3VP8 A;  1BGY J;  1QVG O;  3O6Q A;  1JUN A;  1VDF A;  2Q3I A;  2KSJ A;  1E6J P;  4U3F G;  1PP9 G;  1MZ9 A;  1M6N A;  2ERH A;  3D6Z A;  2Z46 A;  4IFM A;  2K94 A;  3BRT B;  3AE3 C;  3B4Q A;  5APX A;  2A45 H;  3HD7 D;  5KLV D;  3AEC C;  2XNX A;  1WRG A;  5AVU B;  5CCG A;  1M6E X;  2SPZ A;  2FYN C;  1YTZ T;  2KOR A;  3CWB G;  1SQB D;  1IC2 A;  1IO4 A;  3L75 D;  1T3U A;  1IMQ A;  2E75 D;  3CCQ P;  2YIU B;  3BCC E;  1EZV D;  1L0N E;  3CX5 D;  1LWU B;  3GG2 A;  1JMB A;  1IFM A;  3HD7 C;  3FWN A;  3SSU A;  2XZ1 C;  1Z56 A;  3G0V A;  3HE5 B;  4ZNC A;  5AVX B;  3KZI H;  3L70 J;  5TJH A;  1SQV E;  3CCS P;  3Q5S A;  3D6Y A;  1VQO P;  3PHL A;  3G1I A;  3H6P A;  1VKU A;  2Q6Q A;  3M0D C;  1JCC A;  4OWF A;  4Y99 C;  5E79 E;  1JJ2 O;  1SP4 A;  2YKO A;  1GU4 A;  1N73 B;  1IFJ A;  2JR8 A;  2GDX A;  3P8C E;  1A43 A;  4KT0 J;  2EFJ A;  2OYI A;  2I1K A;  4WY4 D;  5AVW B;  2JQ4 A;  3VN0 A;  2M0B A;  1VQ5 P;  1JY2 P;  3HUS A;  4N3Y B;  1XTC C;  1QRJ A;  1FZB A;  1M7L A;  1VF5 D;  2BCC J;  1RF1 B;  1EDL A;  3CXH H;  3M06 A;  1SQX E;  2CQ8 A;  4YXW H;  4XFZ A;  2L5G B;  3VMY A;  5AVZ B;  2HPC A;  1MFZ A;  2WSC J;  1PPJ G;  2A06 G;  2M5A A;  3OW2 O;  1SQQ E;  3CCE P;  4ASW A;  1U57 A;  1NOH A;  3AE1 C;  1OFC X;  3OAK A;  1NJI Q;  5AW9 B;  3P7K A;  1YQ3 C;  2R32 A;  1X22 A;  3KQG A;  3V2R A;  1LTT C;  3P32 A;  3FWL A;  1IZN B;  5CJ4 A;  1PPJ D;  1KFN A;  1PPJ E;  5AVQ B;  2OYH B;  2IYP A;  2K0D X;  4QKO A;  3LIE A;  1GK4 A;  3C8V A;  5AVS B;  2O01 H;  1LT9 A;  1NHL A;  1YJ9 P;  2JYL A;  2QNW A;  2WIT A;  3VMA A;  2KOG A;  5AVV B;  3B4S A;  3I55 P;  3GHG B;  3RGU A;  2ZAE B;  3E1I A;  1L4A C;  4Y28 J;  4PJ0 H;  1CI6 B;  5E79 H;  4H2Y C;  3G28 A;  1PEM A;  1KIL A;  1ZOY C;  1SLQ A;  1VQ6 P;  4AUW A;  2IDB A;  1HTL C;  2A45 I;  3V5B A;  3O6Q B;  4IZ6 A;  3V4Q A;  3EJD A;  2M8P A;  3RK3 E;  4H44 B;  2QJY C;  1IFN A;  2D2C C;  1CW5 A;  4GOE A;  1MKM A;  2WPV B;  1CEI A;  1JNM A;  4U3F D;  1NU1 K;  1NVO A;  1X9V A;  3GLM A;  2KB7 P;  3FX0 A;  4WVZ A;  2WSC H;  1HGZ A;  1HY8 A;  3L72 G;  3EJE A;  1AF8 A;  3IN6 A;  1QGK B;  5APQ A;  3HYB A;  2OYO A;  3VTP C;  1KQF B;  4YTP C;  3F5H A;  2A45 G;  4W7Z A;  4GOD A;  3CXH D;  3HE4 B;  3H1K D;  2N5I A;  3H1H G;  4JYB A;  1EZV I;  2BHV A;  2M5A B;  2E76 D;  2ZYD A;  2GDY A;  3H1J D;  3K5B A;  5KP7 B;  4D6T E;  5BS1 A;  1S5L X;  1NAF A;  3RK3 B;  1DEB A;  2JWA A;  3T97 B;  1D7M A;  1SQP E;  4M0I A;  2B88 A;  5BVZ A;  1OW7 A;  2FYU E;  4UB8 H;  5EFW B;  2I8D A;  1UIX A;  4DT0 A;  1S5L E;  1M56 D;  1SQB J;  1HJ0 A;  3H32 A;  2KSE A;  4H0L B;  3Q3D A;  1N73 A;  2ZT9 C;  1S1C X;  1L0L D;  3RBX A;  2L0Q A;  2ZVO B;  1OR5 A;  2GZG A;  2H8P D;  3RK3 C;  1QEX A;  1M57 D;  2NPS B;  1KMI Z;  4L73 A;  1FOS E;  2KS1 A;  1A02 J;  5B66 H;  1KZU B;  1NTK K;  3RK2 C;  3DS5 A;  1HVV A;  1BGY E;  3L37 A;  4ZKU A;  1U7J A;  3EFG A;  5CCH A;  1VQ8 P;  4U0B A;  4XFX A;  1ACP A;  2PNG A;  4IOI H;  5KLV G;  3L74 G;  1JY3 N;  3MTU E;  5HGN A;  2L91 A;  4LLH A;  5GTH H;  2FYU J;  1MUU A;  3RK2 D;  1T8Z A;  5AW3 B;  2JU2 A;  3U1A A;  1LTJ C;  2NPS C;  4XRQ A;  2G8Y A;  1TU3 F;  1P84 I;  3RG2 A;  2K9J A;  2AXT E;  5AW6 B;  5KTB A;  1KD1 Q;  2K9Y A;  1BXI A;  5GTI E;  3L73 J;  4C7N A;  2KZJ A;  3CWB E;  2FVA A;  4AQR D;  5KAF H;  4HB1 A;  1JTH A;  1YHQ P;  1AFO A;  2YMK A;  3EJB A;  3NMD A;  3HZQ A;  1R5S A;  2EG5 A;  3G9R A;  1VHN A;  1SQX J;  2E74 D;  4RO0 A;  5BU8 B;  3WUU A;  1PP9 D;  1FZE A;  1SQB K;  2POH A;  1NTK G;  2E74 B;  3AEA C;  5APU A;  1L0L K;  1ZRT E;  1VQ9 P;  2W27 A;  1K9M Q;  2Q3E A;  1ZLL A;  2O1K A;  1G2C A;  1KLP A;  3JSV C;  1OIP A;  1J1D C;  2LML A;  3TNU B;  1JB0 J;  2GUS A;  1EMV A;  2ONT A;  3CX5 E;  1L0N D;  2PFX A;  1BGY G;  2QJP B;  1IJD B;  2B87 A;  1FBM A;  1NTM E;  2KR5 A;  4GR6 A;  1NTM D;  3V4W A;  1GL2 C;  3DS0 A;  1RNI A;  3PLN A;  1S5L H;  1JEK A;  4WYM A;  2H7H A;  2JO0 A;  1FE6 A;  1LP1 B;  2V7Q H;  1BDC A;  1RE4 A;  1RF1 C;  1FJK A;  3H1I D;  5APV A;  2YIU C;  1LJ2 A;  1DIP A;  1FC2 C;  2Q7C A;  2L6E A;  2PEI A;  1GXG A;  2E1M A;  2NPS D;  3HD7 B;  4R0M A;  2C0X A;  1ZR2 A;  1AQ5 A;  2K1A A;  1PL5 A;  1NTM G;  2NZ2 A;  3H32 B;  2R5D A;  1Q81 Q;  3MP7 B;  3E7K A;  3BAS A;  2Y0D A;  3TDK A;  3TGU E;  1LNQ A;  5AW7 B;  2H88 C;  1NAY A;  1IK9 A;  2Z5H A;  4U3F J;  3C1L A;  3H1I G;  2EHS A;  2LKI A;  2K37 A;  1N73 C;  4JPZ B;  3LRY A;  3NTN A;  2FQ1 A;  3ITK A;  2HYN A;  2AFE A;  5KLV J;  1YI2 P;  3G26 A;  2E5Y A;  3G4S P;  2FYU K;  1R8E A;  2KXP B;  1NO4 A;  1N7S B;  1SQV D;  1SQV K;  1J1D B;  4N78 D;  1U7M A;  3LW5 J;  1W2B O;  2M8L A;  1LTG C;  5KKZ B;  1F80 D;  3H1I E;  2Z4E A;  4PD4 E;  3TNU A;  1GU5 A;  5AVY B;  2ZXX A;  1DEE G;  3SFE C;  1KQG B;  3L74 D;  5APS A;  2E76 B;  3G6E P;  5CMZ A;  1BDD A;  3M0D A;  1N86 A;  2E5T A;  2N1T C;  1EXJ A;  1RF0 A;  2C9N Y;  3KYQ A;  3H4E A;  1L0L E;  4BXL A;  4UB6 E;  5KP6 B;  5AW2 B;  2XZR A;  5GTH E;  2FKW B;  2KNC A;  1LTS C;  1NH4 A;  4CPG A;  2KGC A;  3AE4 C;  4HJG H;  2R3C A;  2MD9 A;  1QLE D;  1HUC A;  1NTK E;  2AXT H;  2LPK A;  1NKN A;  1A8O A;  1SS1 A;  2WSF J;  1DNY A;  4IFD K;  5APW A;  1T2K C;  2OYH C;  2MR7 A;  3L71 E;  1JY2 O;  3GW6 A;  5I4T G;  2RN0 A;  3S9O A;  2KOD A;  2HFE D;  2IFN A;  2J5U A;  3KHU A;  4MN4 C;  2XT1 A;  1BSN A;  2MJZ A;  2M3B A;  3USS A;  3RL0 D;  1ZV8 A;  3CME P;  3AE9 C;  3JC2 2;  2B87 B;  4IFF A;  3Q2Y A;  1KIL D;  4HH2 A;  2KGD A;  1RO0 A;  3RK2 B;  3JCU H;  4H44 C;  5KP8 B;  3AE8 C;  1G1J A;  1Y47 A;  3PP5 A;  1T6A A;  2OYH A;  1AJY A;  2K88 A;  5M1B A;  3DS4 A;  4BWN A;  3ABV C;  1FZG A;  4OGQ C;  2M3E A;  1HWT C;  3G71 P;  5KAI H;  4EYY Q;  3E2D A;  2MY5 A;  3RL0 g;  2Q5U A;  1FDM A;  1PEO A;  4H2W C;  3RK3 D;  3A0B E;  3L73 G;  4Z1M H;  1M8O B;  3GHG A;  2G3A A;  3V2P A;  3H1K J;  5KJ7 C;  3Q5P A;  5AVR B;  1H0T B;  5KLV E;  1SQP G;  2GUV A;  1NQ4 A;  1EDJ A;  1EXI A;  4WB4 A;  2N1T A;  2FAC A;  2BEQ D;  5HV8 A;  2EHT A;  1ZP0 C;  4D6T G;  1IMP A;  2V4H A;  2DW3 A;  1J1E B;  1VPC A;  5KJ7 D;  1AV1 A;  3AE6 C;  1Q7Y Q;  2DNW A;  2AF8 A;  2JB0 A;  4R4M A;  2RMZ A;  3CXC O;  2KOO A;  3I56 P;  4TLF A;  2EIA A;  2FVE A;  4U0D A;  1T2K D;  1GL2 B;  1GW4 A;  1RY3 A;  3H1K G;  4HKZ H;  3A2A A;  3MIW A;  2WPS A;  5KLV K;  1DV5 A;  3UIA A;  4KJM A;  4BRY B;  1W2E A;  3TGU D;  4H13 C;  1L0L J;  1OX3 A;  1VF5 C;  2LIW A;  4MRT C;  1VQL P;  1EZV E;  4IPY A;  1M90 Q;  2P7J A;  1GW3 A;  2KLV A;  2K0X A;  1USD A;  3GF3 A;  3BCC J;  1YIT P;  2E75 B;  3AEF C;  2QRX A;  1SQQ G;  2CPS A;  2JEE A;  2KLU A;  4EI2 A;  1EC5 A;  1FZA A;  1DH3 A;  4BPH A;  1KIL B;  3CXH I;  2FYU G;  1L0I A;  3AE5 C;  2O3J A;  1BGY D;  1P84 H;  1L0L G;  3L74 E;  2W6J H;  3B5N C;  3M0A A;  1PV3 A;  1FAV A;  1SQX K;  3DS1 A;  3CCM P;  2JKV A;  4WWI A;  1IUQ A;  4UB6 H;  2ZVN B;  3SWF A;  2JO1 A;  5DCK A;  3CX5 I;  2XV5 A;  1KB9 D;  1SQX D;  3H1L D;  3HUS C;  5KAF E;  2IBZ D;  4W7Y A;  3G21 A;  3MUD A;  2MF4 A;  2WT7 B;  4U7J A;  3G1G A;  3M9B A;  2FYU D;  2ZXE B;  1LT1 A;  3LW5 H;  2K92 A;  1IFD A;  3DS3 A;  1ZNV A;  4RES B;  3L71 D;  1VQM P;  2JDI H;  3GMA A;  1RH5 B;  4C7R A;  1VQ7 P;  1LT9 C;  2XDJ A;  1URQ A;  2KYV A;  2B9B A;  2N9B A;  1AQT A;  3CC2 P;  4YXD C;  3AE2 C;  1NTK J;  2WSS H;  3T97 A;  3GZM A;  1MFT A;  2A06 D;  2LXB A;  5KLI B;  2YXQ B;  1KTM A;  1SQX G;  5KJ7 A;  1JO5 A;  1K05 A;  1PP9 J;  4JQ0 D;  2Y0C A;  3TGU J;  4CA3 A;  5EJD A;  1HQB A;  2FQ2 A;  4QMA A;  3CWB J;  2LKM A;  5F2O A;  1FZC C;  2XND H;  1KYO H;  4H13 D;  1YQ4 C;  3AEB C;  3MHV A;  4PV1 B;  1YIJ P;  4U3F E;  5C39 A;  3EQ2 A;  4I7Z B;  3SFD C;  2FFD B;  3KDP B;  3GF7 A;  4UB8 E;  1SQP D;  4PD4 H;  3CCL P;  1PIX A;  2BEZ F;  1NTM K;  2QJP C;  1GL2 A;  3CXH E;  1RE3 A;  2GZE A;  1LTI C;  3H1J J;  1BCC E;  1FDO A;  2KOP A;  3E1R A;  1QL2 A;  4XA4 A;  3AEE C;  4PJ0 E;  3AEG C;  3QH9 A;  2P1J A;  1OMI A;  3VOP A;  1LWU C;  3H1I J;  1PGQ A;  3TSI A;  1N7S C;  5JPA A;  4IL6 E;  2LOL A;  1FZF A;  2K9J B;  1EZV G;  2WSE J;  1LTA C;  1SFC A;  3ZDM A;  5KKZ C;  1NWQ A;  3HTK B;  1NTZ E;  4BRY A;  2M8N A;  1LTB C;  2IYO A;  3NTE A;  1M1J B;  2Q9I A;  3H1K E;  3L72 D;  1NYH A;  5HVC A;  2W8Z A;  3L72 E;  2Q1K A;  4PWV B;  1Z6M A;  3P8M C;  3W67 A;  5H2F E;  1WT6 A;  2WTY A;  1ZW0 A;  3RL0 C;  2PEN A;  1RO2 A;  1XTG B;  1LP1 A;  5TIS H;  4PH1 A;  1L0H A;  1GD2 E;  4TT3 H;  3MD0 A;  3BAT A;  3FXE A;  2KGE A;  5DJT B;  2LXC B;  3G29 A;  1SQV J;  2V7Q J;  2WPQ A;  5K5G B;  5GTI H;  3CPW O;  2YO3 A;  2KP8 A;  2ZJS E;  1N8R Q;  2ROQ A;  1K04 A;  3HTK A;  2HPC B;  3M91 A;  1VQP P;  4JF7 A;  2QM8 A;  1SQQ J;  4Y99 B;  1ZRT D;  2N5H A;  2KG6 A;  4F37 A;  3GJN A;  2P67 A;  2KK7 A;  3R2P A;  1E0H A;  1RF1 A;  5CCG D;  2JU1 A;  1MV8 A;  4PD4 I;  2IBZ G;  3VMZ A;  4PH0 A;  1L0N J;  2KOQ A;  3H0D A;  5APY A;  3V2N A;  4ASV A;  2FBW C;  4H44 D;  3P05 A;  3HRN A;  2QEX P;  2VRS A;  2Z45 A;  3CD6 P;  1EDK A;  2WPR A;  3L4F A;  2OAR A;  2FY8 A;  3VP9 A;  3H1H E;  4WY4 B;  1CSB A;  4LGD E;  2QVA A;  1MZ8 A;  5HGM A;  3C9I A;  5HGL A;  1PEU A;  3CMA P;  3M9Q A;  3H25 A;  2HG5 D;  3NY7 B;  5F2N A;  2LR2 A;  1BCC D;  1GPJ A;  4DJG A;  3JCU E;  3KPE A;  4U0E A;  2D2C B;  2IBZ I;  2OYI C;  3AED C;  2NRG A;  1X0T A;  1BE3 D;  1P84 E;  3A3Y B;  3II6 A;  2W6B A;  2Z5I A;  5B66 E;  4EDF A;  2VLO A;  3H1L J;  4OGQ B;  2AVA A;  3BVH A;  1HJB A;  2K3R A;  5AW0 B;  1HBW A;  2M5R A;  4C46 A;  2WVR A;  1KYO D;  1SFC B;  4BPG A;  1GTW A;  1GDT A;  2WMM A;  3WMM 0;  1K30 A;  5B5E E;  2PAJ A;  1Y8A A;  2FXP A;  1RQV A;  2R44 A;  3L71 G;  2O01 N;  2RKL A;  1DD3 A;  2HOD B;  4DG9 A;  1GL2 D;  2QJY B;  1EIA A;  2HLO A;  3H1J G;  5CBO A;  1GZL A;  3RBZ A;  1YJN P;  4H0L C;  4RKU J;  1HGV A;  1NTZ G;  3WU2 H;  3WU2 E;  2L22 A;  2O1J A;  1YJW P;  3VRL C;  4O9B A;  3CE7 A;  3B5N D;  4D6T D;  4EIJ A;  1JY2 N;  2KW2 A;  2WPT A;  1NU1 J;  2PEJ A;  3H1L G;  3S4R A;  1KB9 E;  1KB9 H;  3L74 J;  2GZJ A;  2XU6 A;  3L70 G;  2LL8 A;  2Y9Y A;  5KLI C;  3BCC G;  1W5C E;  3B8E B;  1K73 Q;  1QVF O;  3L75 E;  2ITA A;  2QM7 A;  2PGD A;  4HYT B;  2BQ1 E;  4NPE A;  3WBH A;  2FYZ A;  2N98 A;  1AVO A;  3SWY A;  2E75 C;  2KIK A;  4XFJ A;  5CZD B;  1FZC A;  2ZT9 D;  2BAS A;  4GDO A;  1FU1 A;  3V2Q A;  1HH0 A;  4N6J A;  3L70 D;  1SQB E;  2QA4 P;  1AA0 A;  3EWK A;  1RE3 C;  4LC1 A;  2K2Q A;  2CG5 B;  1SVF A;  2L9F A;  4NPF X;  1SQV G;  3TK1 A;  2OTJ P;  1YBK A;  1BSH A;  4DCK A;  2D2C D;  1VL2 A;  3GHG C;  1VQN P;  1L0N K;  4PV1 D;  2E74 C;  2HOD A;  4GKG A;  1QX8 A;  2RH0 A;  3CC7 P;  4H13 B;  2MVU A;  5L8R J;  3W68 A;  4K3A A;  3H1L E;  2FVF A;  3S1K A;  1OW8 A;  2BCC D;  3B5N B;  2CGQ A;  4M3L A;  2XV6 A;  2CWO A;  3AE7 C;  2AEJ A;  5AW1 B;  1NTK D;  2N50 A;  1PGP A;  1S3J A;  1PP9 E;  5TIS E;  5AVT B;  2E76 C;  1AUM A;  1BE3 G;  4YPC A;  1PEQ A;  4U0C A;  2IPP A;  4U0F A;  4WBA A;  2AFD A;  1PGJ A;  4OVN F;  1KB9 I;  2QE7 H;  1OWA A;  4XFY A;  4XRO A;  1OXZ A;  1Q90 D;  2FAE A;  1N2D C;  3VYI A;  5BU5 A;  2PY8 A;  3NXS A;  2NPS A;  1A02 F;  3VMX A;  2IZ0 A;  1M1K Q;  3H1H J;  1J2J B;  1IFP A;  2KS1 B;  2LIU A;  4PXH B;  2N6Z A;  2XXM A;  1VQK P;  3IR9 A;  3N7N A;  4I2L C;  1ZMB A;  2YNY A;  3N4X A;  4I7Z C;  1BCC J;  1FS0 E;  1N7S A;  2FFD C;  2GM4 A;  1H0T A;  4BPF A;  3Q5R A;  1EQ7 A;  4JYC A;  2XKM A;  4WY4 A;  1E5W A;  1KFM A;  2JAZ A;  1BE3 J;  4JBZ A;  1CI6 A;  2QSI A;  2ZT9 B;  1KC8 Q;  3PTZ A;  2Y9Z A;  3B71 A;  1SQP J;  2N9Y B;  4A7P A;  1ZR4 A;  3PH0 A;  2H43 A;  3B5I A;  1NKZ B;  4IL6 X;  3FXD A;  2DGY A;  1URQ D;  1URQ B;  1ZN5 A;  2MR8 A;  3L73 D;  1NU1 G;  2JGP A;  2UWJ E;  3BCC D;  5DJU B;  1NGM B;  1EOQ A;  4NEO A;  2K93 A;  2PRR A;  2X2B A;  2OTK E;  3I5C A;  1JCD A;  1RF0 C;  2K0Y A;  3F89 A;  2YKP A;  2FYN B;  3Q1M A;  3IFM A;  3EFF K;  2JBG A;  1L2P A;  1NU1 D;  5CCH D;  2GYK A;  1PGO A;  2KUB A;  1H88 A;  5HGO A;  1LGH B;  3L71 J;  2I1J A;  2JJL A;  2W90 A;  1USE A;  2W83 C;  1YYC A;  3TGU G;  2JWD A;  1KOR A;  3R4Y A;  4WY4 C;  3OA7 A;  1M1J A;  2W6A A;  2E43 A;  5AW8 B;  1BAJ A;  4K35 A;  3CCU P;  2GZF A;  1L4A D;  3MUD C;  1NTZ D;  1SQB G;  2WT7 A;  3L70 E;  5CCH C;  4NPD A;  1L4A B;  1SQQ K;  3O8Z A;  2CPB A;  3LMO A;  2KOS A;  4COC A;  2FAD A;  1DX7 A;  1ZXG A;  1UJZ A;  1OZH A;  1VF5 B;  2BUO A;  5CCG C;  4GR2 A;  3CL3 D;  1KYO E;  3H47 A;  3L35 A;  4ZKP A;  3WUV A;  2P10 A;  2KNC B;  4GIF A;  2Y0E A;  1AYI A;  2GA1 A;  3KZI E;  2E42 A;  2NO8 A;  2OGU A;  1M74 A;  1IK7 A;  4QNB A;  3A0H H;  2YKQ A;  2LF4 A;  2VSQ A;  3HE4 A;  2KG8 A;  4U0A A;  4OGQ D;  1Q82 Q;  2ZYA A;  2P58 A;  1YTZ I;  3U59 A;  2AXC A;  2OQQ A;  4DOJ A;  1RE4 C;  1KYO I;  2N1T B;  4H0L D;  3M1M A;  1LWU A;  2P2U A;  2A06 E;  2P9X A;  4UHP B;  2YO2 A;  2MKV A;  1H89 A;  3L73 E;  1RQU A;  3MGE A;  3CCR P;  5CHX A;  2JYG A;  3NFQ A;  1X8Y A;  5H2F H;  3U1C A;  2R3S A;  1S72 P;  1FDI A;  2PP6 A;  1JY3 O;  5CJ0 A;  1PFI A;  4DZO A;  5APT A;  3BRV B;  3L75 J;  3GZL A;  1LT9 B;  3OJA B;  1KIL C;  1NTM J;  2WSE H;  3L72 J;  2L4B A;  1S9K E;  1OVU A;  3MGN A;  1JTH B;  3A7O A;  5CBN A;  3DPH A;  3DS2 A;  2YXR B;  1GMJ A;  1NU1 E;  2H89 C;  2PEK A;  1T8K A;  4I6M C;  2WWW A;  2PEQ A;  1N7S D;  1SQP K;  3IAO A;  3TF5 A;  2M8R A;  2CNR A;  2FQ0 A;  3GKL C;  1GXH A;  3PJS K;  2OYI B;  1QL1 A;  2C0W A;  1LTJ B;  4N78 E;  1DD4 A;  3DTJ A;  4RJT A;  4GT1 A;  5AW4 B;  1Y9B A;  2IBZ E;  2BCC G;  4L75 A;  1E79 H;  2KG9 A;  2BCC E;  5F2K A;  1KQS O;  1D1D A;  2OTL P;  3Q20 A;  3CLQ A;  2N6Y A;  1J1E C;  3CWB D;  4OH8 B;  5AW5 B;  4D6T J;  3CI9 A;  1ZME C;  1SFC C;  4L76 A;  2FXM A;  1SQQ D;  1L4A A;  3A5T A;  2J59 M;  1G2C B;  3QWO C;  1OVR A;  1NTZ K;  2N1T D;  3A0B H;  2GDW A;  1KN7 A;  2JP3 A;  4HKG A;  3L36 A;  1KQL A;  4EOT A;  4AYC A;  3U43 A;  3CX5 H;  4ZMD A;  3PRJ A;  2KI7 B;  1PZQ A;  5KAI E;  1EDI A;  1T3J A;  1R5L A;  2IFM A;  1JOC A;  2C9L Y;  4L74 A;  3LID A;  4IL6 H;  5B5E H;  2VLQ A;  3A0H E;  3V6I A;  2YMY A;  3HD7 A;  1OW6 A;  1FJP A;  1OVV A;  1JY3 P;  3D71 A;  4PV1 C;  3P8C D;  1N7L A;  1Q2N A;  3SWK A;  3G3Z A;  1K8A Q;  2ZYG A;  2FHS C;  1AVY A;  1GK6 A;  4COP A;  2GZI A;  2WSF H;  7CEI A;  2O01 J;  1HF9 A;  3CCJ P;  3RL0 B;  1JM0 A;  2VLP A;  1S2E A;  1G1I A;  3IF4 A;  1KV4 A;  1CZQ A;  5EW5 E;  3HE5 A;  2AEF A;  3D70 A;  3KXD A;  2QJK B;  2IX7 C;  1LTJ A;  1L0N G;  1S4X A;  4R4L A;  4KHX A;  1BE3 E;  1P84 D;  2B89 A;  3FGA D;  3MZW B;  3M9H A;  3WUT A;  3H1H D;  2MVV A;  2HR3 A;  4XE5 B;  1IFI A;  1UII A;  3HUS B;  2WZ7 A;  2K5X A;  2KGA A;  3CC4 P;  1X3O A;  1H8A A;  1WMK A;  2ZFC A;  3RG6 C;  3CCV P;  2FXO A;  1VQ4 P;  4I1L A;  1NTZ J;  2AEM A;  2J58 A;  2PEO A;  2R5B A;  1Q86 Q;  4C7N B;  2WQY C;  2IZ1 A;  3B5N A;  1JMM A;  2CK3 H;  3H1J E;  1FR2 A;  1X79 B;  5BS2 A;  2VLN A;  2QG4 A;  4W80 A;  1SFC D;  4GOF A;  2XZ0 D;  1BCC G; 
#chains in the Genus database with same CATH homology
 2JO0 A;  3DS5 A;  2M8P A;  3H4E A;  2PEM A;  1VQP P;  1S72 P;  3CCL P;  1VQ8 P;  1BAJ A;  2Z44 A;  4U0B A;  4XFX A;  2OTJ P;  3CCU P;  4XFZ A;  1K30 A;  2L6E A;  3DS1 A;  3CCM P;  2PEI A;  5HGN A;  1QVG O;  1IUQ A;  2E1M A;  1KC8 Q;  1K8A Q;  1VQN P;  4COP A;  4PH0 A;  1A8O A;  3H0D A;  3CC7 P;  3HYB A;  1E6J P;  4XRQ A;  5DCK A;  3OW2 O;  1M6N A;  4COC A;  3CCJ P;  2Z46 A;  3DPH A;  3DS2 A;  3P05 A;  5I4T G;  1EIA A;  2BUO A;  2QEX P;  3CCE P;  1Q81 Q;  5JPA A;  3G21 A;  2Z45 A;  4GR2 A;  3CD6 P;  2PEK A;  3H47 A;  1KD1 Q;  2KOD A;  2OAR A;  3G1G A;  2PEQ A;  2XT1 A;  2XV6 A;  2CWO A;  1YJN P;  3B5I A;  1NJI Q;  1M6E X;  2DGY A;  2BHV A;  1Q7Y Q;  1YHQ P;  3DS3 A;  3HZQ A;  1YJW P;  3VRL C;  1M74 A;  2EG5 A;  2M8N A;  3CXC O;  5BS1 A;  3CCQ P;  4QNB A;  1VQM P;  3I56 P;  5HGM A;  2EIA A;  3LRY A;  3NTE A;  1AUM A;  4U0D A;  5HGL A;  1VQ7 P;  2PEJ A;  3CME P;  1PEU A;  3DTJ A;  3CMA P;  1YI2 P;  2LF4 A;  1PEQ A;  3G26 A;  4U0C A;  4U0F A;  3CC2 P;  3G4S P;  5F2N A;  3G0V A;  4M0I A;  1RO0 A;  5F2K A;  4XFY A;  1KQS O;  4U0A A;  1EOQ A;  1VQ9 P;  4XRO A;  1D1D A;  1Q82 Q;  2OTL P;  3Q20 A;  1K9M Q;  4U0E A;  1K73 Q;  1VQL P;  1QVF O;  3CCS P;  3CC4 P;  2PEN A;  1RO2 A;  2PY8 A;  1YJ9 P;  2JYL A;  3RG6 C;  3CCV P;  1VQO P;  4IPY A;  1W2B O;  3G1I A;  1M90 Q;  1VQ4 P;  2ONT A;  4PH1 A;  2M8L A;  2BQ1 E;  3I55 P;  1M1K Q;  5F2O A;  2PEO A;  3M1M A;  3WBH A;  3DS4 A;  1Q86 Q;  2XXM A;  1VQK P;  1YIT P;  2P9X A;  1ZMB A;  1JJ2 O;  3G28 A;  1PEM A;  3G29 A;  5HGO A;  1YIJ P;  4GR6 A;  1A43 A;  3G6E P;  2EFJ A;  3CPW O;  3DS0 A;  3G71 P;  1RNI A;  1N8R Q;  5BS2 A;  1VQ6 P;  1QRJ A;  3E2D A;  3MGE A;  3CCR P;  1VQ5 P;  2QA4 P;  2JYG A;  1PEO A;  4WYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...