1VQ5P

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq5P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq5P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq5P02
3G6EP 1VQ8P 3CCUP 1VQ6P 1QVGO 2QA4P 3CCMP 3CCVP 3I55P 1YI2P 3CCQP 1W2BO 1Q86Q 1VQ5P 1NJIQ 1YIJP 1KQSO 1YJ9P 3CPWO 1KD1Q 3CC2P 3CCLP 3G71P 1QVFO 3CD6P 3OW2O 1VQPP 2OTLP 1VQKP 1Q82Q 1Q81Q 1S72P 1YJWP 1K73Q 1M1KQ 2QEXP 1M90Q 1YJNP 1VQNP 1VQOP 3CC7P 1YITP 3CMEP 3I56P 1Q7YQ 3CXCO 1KC8Q 3CMAP 1K9MQ 1VQLP 1JJ2O 3CCEP 1VQMP 3G4SP 1K8AQ 1N8RQ 3CCJP 1VQ9P 1VQ4P 3CCSP 2OTJP 3CCRP 3CC4P 1VQ7P 1YHQP
chains in the Genus database with same CATH superfamily
3B5NB 1SQPJ 3Q2YA 2MR8A 3RL0C 3G1IA 2KOQA 5CZDB 2QSIA 3DS5A 1BSHA 1YJNP 3RL0B 3SWYA 2P7JA 3HUSA 1JUNA 1FOSF 3CWBJ 3CL3D 2QA4P 1E79H 4U3FD 2XU6A 2J59M 2N1TD 5DJUB 4BRYA 2DW3A 4BWNA 2IYPA 1HJ0A 1EOQA 1NTMK 5APVA 5AVZB 2CGQA 1T3JA 1NTZE 2FQ0A 3H1KJ 1JY2P 4EIJA 1NTZD 1EZVG 1GD2E 1IMPA 1BCCG 4NPDA 3SWKA 2M0BA 4IL6X 2IFNA 3BRTB 4H13D 2J58A 1GK4A 1KB9I 5KAFE 2NO8A 5KAFH 5KKZC 3B5IA 3H1IE 2VLOA 1QEXA 3WBHA 3M0AA 4ZNCA 3H1ID 2KIKA 3KDPB 2H89C 3RK2D 2VLQA 4HKZH 3P8CE 2YIUC 3JSVC 1LP1B 3B4SA 1KQGB 3P8CD 2YIUB 5B5EH 1CZQA 1PGOA 5AW6B 4JYBA 3B5NA 2Z45A 3L75E 3NY7B 3G6EP 3MD0A 1NU1J 2AEJA 2AXTH 3L75D 4OGQD 3I5CA 1BCCJ 3L72E 4QMAA 1M90Q 1JNMA 5KLVE 3L72D 1K9MQ 2KGCA 1A02J 1Z6MA 1T6AA 1H89A 1BE3E 3NXSA 4CPGA 1DD4A 2PGDA 1FDIA 1L4AC 1BE3D 3I55P 3S1KA 1W2EA 3MUDA 2A06E 1L4AB 2NRGA 2L22A 2LXBA 4XFYA 2YO2A 2A06D 3P7KA 2OTKE 2FVAA 5APWA 3TGUG 3L4FA 2J5UA 3DS4A 1NKNA 3C9IA 3GF7A 1X3OA 1JMBA 1KYOE 2N50A 3CCMP 1M6EX 5AW1B 1VQ5P 1KYOD 3SFDC 5AVYB 4GR6A 2P1JA 2YMKA 3V5BA 1LTTC 1GU4A 2WPRA 5HGMA 3PTZA 2WZ7A 3MGNA 1H8AA 5AVTB 2LXCB 2YKOA 1LP1A 3GHGC 4IL6H 1YIJP 1LTAC 4PJ0E 2LPKA 1N73C 3HTKB 5DCKA 3GHGB 1N73B 3VMXA 1NHLA 2E42A 1L0LE 1PP9E 4RKUJ 3TGUJ 1PP9D 2KB7P 2XZRA 3B71A 2ITAA 1ZMEC 1YI2P 1GMJA 2K88A 2ZYAA 3BCCG 3F5HA 1M7LA 1MZ9A 3CC7P 3L73E 3I56P 4AQRD 1F80D 3L73D 3TK1A 5TJHA 1IFMA 1N2DC 3VN0A 4KJMA 1FZGA 3CE7A 5KP7B 1G1IA 1VDFA 1L4AA 1ZRTE 5B66H 3CCLP 1L0HA 1ZRTD 2Q5UA 1QGKB 2ONTA 5HVCA 1W5CE 3FGAD 3G4SP 2WMMA 3RBXA 1IC2A 5BU8B 3AE7C 3S9OA 2VLNA 2KG8A 4XROA 2AVAA 5EJDA 4L75A 1CI6B 1RO2A 2KOPA 3T97B 4UB6H 1QVFO 3BCCJ 4RJTA 3TNUB 2KOSA 4N78E 1P84E 1WRGA 1VQOP 2GZEA 3SSUA 3VOPA 3L70G 3ABVC 1U7MA 2XKMA 2NZ2A 5DJTB 2AF8A 2QJPC 2V7QJ 3N4XA 3HTKA 1X79B 2KP8A 2H43A 1NTME 3GHGA 1VPCA 2QJPB 1MFTA 1OXZA 1RE3C 1N73A 2G8YA 1NTMD 2P2UA 5KLVG 2KSJA 1R5LA 2Z5HA 2FYZA 1U7JA 1VQ9P 2P58A 1M57D 2MR7A 2N5IA 1KTMA 4R4MA 1FS0E 2JR8A 3H4EA 4UB8E 1VKUA 1N7SC 3L70J 3EFGA 4QNBA 4H13C 5CCHD 5AVRB 5CMZA 1N7SB 4H13B 1SQQG 2BEZF 3QWOC 3U1AA 1L0NK 1RQUA 1Q86Q 1VQNP 2FYUK 1J1DC 1DIPA 1J1DB 7CEIA 1UIXA 3G26A 2I8DA 2GZIA 1RHZB 2O01J 2GZGA 4H0LC 3SWFA 3KYQA 1ZLLA 2KR5A 1CI6A 2KSEA 3T97A 1G1JA 4H0LB 2MVUA 3IFMA 2R32A 2JGPA 3TNUA 1VQPP 1KQFB 2Q3EA 2KNCA 4NEOA 4YXDC 2FY8A 2WSCJ 3FWNA 3EQ2A 1SQQJ 3H1KD 2C9NY 5AW5B 4GOFA 2A45G 3HD7C 1E0HA 2YXQB 1JY2O 1RE3A 2B9BA 3HD7B 5I4TG 1R8EA 1USDA 2N9YB 1VHNA 4PD4H 3L71E 3AE4C 3RGUA 2G3AA 2FHSC 3L71D 3ITKA 2R3SA 2MD9A 3AE3C 3L37A 1X8YA 2L5GB 1SQXK 3LMOA 2CK3H 4H2XC 2IFMA 1ZW0A 2ZVOB 2FVFA 1BSNA 3KXDA 1K8AQ 5KJ7C 3WUUA 1N7SA 2FFDC 4XFJA 4NPFX 3E2DA 2W6JH 1S72P 4COCA 1VL2A 2FFDB 4GKGA 1NU1D 1IO4A 2PEQA 3U1CA 3G71P 3RG2A 4DZOA 5TISE 1YJWP 2K2QA 1NH4A 4HB1A 1PPJE 3M06A 2DNWA 3V2NA 3QH9A 4QKOA 1PPJD 1SQVE 1SQVD 4H44C 5AW2B 3GG2A 4H44B 4I1LA 1EIAA 3LRYA 3PH0A 3DPHA 1X0TA 2OYOA 3CMEP 2BCCJ 1OFCX 2JU1A 2KLVA 1R5SA 1OW7A 2Z44A 1EMVA 5HGNA 2JYGA 5GTIE 1HBWA 2OQQA 3A0HE 4Z1MH 1ACPA 1KILE 1S2EA 3HD7A 3VTPC 3H1LG 5CCGD 2KYVA 2PEIA 1KILD 1S3JA 3EJBA 4I2LC 3O8ZA 2K9JB 3DS0A 1LJ2A 3GZMA 5AW8B 2PEMA 2YKQA 1PGQA 2WVRA 4IPYA 4YTPC 3CXHH 3L74G 2QVAA 4EDFA 4WBAA 1RF1C 1HTLC 1Y47A 3JCUE 5KJ7A 1MV8A 2Y9ZA 3K5BA 2FFDA 1EXJA 1VQ6P 1AVYA 5CBNA 2HFED 3CX5I 3WMM0 1KD1Q 1FZFA 3E1RA 3H1LJ 3BASA 3W67A 1USEA 1CSBA 2NPSD 2GZJA 2OYHC 1ZR4A 3CCJP 2OYHB 2ZT9D 2N98A 1JB0J 1NO4A 2M3BA 1JY2N 1PV3A 4U3FE 4PV1D 3L74J 1NWQA 3G29A 1Y8AA 3GMAA 2AFEA 3Q1MA 2OYIA 1L0NE 1KN7A 2JP3A 1AF8A 2FYUE 1L0ND 3R4YA 2FKWB 2W6BA 3AE5C 2FYUD 3H32B 2YO3A 1VF5C 2FADA 2Y0DA 3D6ZA 1URQC 1VF5B 1XTCC 2Y9YA 3H1JE 5CJ0A 2JWDA 1URQB 2K9JA 3H1JD 2XZ1C 4D6TE 2C0XA 5EFWB 1GL2D 1OX3A 2GUVA 1AFOA 4D6TD 1T8ZA 2MKVA 5KKZB 1SQBG 2E76D 2KODA 2D2CD 2R5DA 1KYOI 4L76A 5B5EE 1SQPK 2CPSA 4OWFA 3U59A 2LTEA 2K1AA 2LIWA 1ZOYC 3HE4B 1GW3A 3H1HG 2IX7C 4Y99C 2O1KA 1HH0A 2AXTE 2E74C 2E75D 4Y99B 4TT3H 3Q5PA 2KZJA 2E74B 5HGOA 2P67A 2KXPB 1QRJA 1OW8A 1SQXE 1KMIZ 2OYHA 1NTKG 1NGMB 1IMQA 4GIFA 1SQXD 1LNQA 2XV5A 5BVZA 1SQBJ 4U0DA 1SS1A 1OR5A 2ZFCA 3WU2H 3H0DA 2LL8A 1FBMA 4BPFA 2M3EA 5H2FH 2A45I 2JO1A 1N86A 3CCEP 3F89A 2O01H 4GDOA 4WY4D 3H1HJ 1YHQP 3RK3C 4C7RA 4PWVB 4U0AA 3CCQP 4C46A 3RK3B 4UHPB 1SFCC 2AXCA 1KB9H 2XT1A 1IFPA 1URQA 2ZVNB 1IZNB 1SFCB 1JOCA 1JCCA 3NTNA 2KGEA 2Q6QA 3AE6C 5AVXB 1NTKJ 2OTJP 2WSCH 3Q5SA 5KAIH 3FX0A 2KWLA 3A0BE 3A0BH 1ZN5A 2KOOA 4IL6E 1BGYE 2M8NA 3UIAA 1GTWA 5EW5E 1BGYD 2QEXP 1WT6A 5BS2A 1NU1K 3NTEA 1NVOA 2LF4A 1HGVA 5AVUB 3HE4A 1NYHA 3D70A 1P84I 4GOEA 3WUVA 1K04A 1LWUC 1CEIA 4U7JA 1QVGO 5AW0B 2GZFA 1LWUB 2QIWA 1SQVK 1Q82Q 5CCGC 4AUWA 2AFDA 4JF7A 2KGAA 2E5YA 1NTZG 4ASVA 2QJYC 1KZUB 4JQ0D 3AE1C 2QM7A 2QJYB 2L6EA 3DTJA 4WB4A 5B66E 3DS2A 2QM8A 2WQYC 3M0DC 1RO0A 1IJDB 2VSQA 3RBZA 3H1IG 1BDDA 1AJYA 4XFXA 2Z4EA 2LKIA 2GDXA 1Y9BA 3LW5J 4UB6E 1SFCA 4K3AA 1BDCA 3EFFK 5CHXA 2XDJA 1FJPA 3PJSK 1ZXGA 2KG9A 2BCCD 2NPSC 5JPAA 2JB0A 1NTZJ 2NPSB 3L75G 1DH3A 2PP6A 1UIIA 1ZR2A 3L72G 2WTYA 1A43A 2GUSA 2N1TC 2KW2A 3B5ND 2XZ0D 4XFZA 2N1TB 1EDIA 1GDTA 1BE3G 3H1IJ 1H0TB 3RL0D 1LWUA 3EJDA 1KQLA 3M9QA 1M74A 3OW2O 2A06G 1BAJA 5CCGA 2N6ZA 2EIAA 1KC8Q 3G3ZA 1M1JC 2HPCB 2HODB 2WT7B 4GR2A 3B4QA 1G2CB 3BRVB 1M1JB 4H2YC 3L75J 1FJKA 1SQPE 2XV6A 3PLNA 5L8RJ 2AEFA 2IBZE 1SQPD 2E76C 3L72J 2K37A 2IBZD 3RK2C 1T8KA 5E79H 2D2CC 3HRNA 5KP6B 5KLVJ 2E76B 2KOGA 3RK2B 1MKMA 1ZP0C 2D2CB 3VYIA 1GPJA 3IAOA 2BEQD 2WPTA 3MTUE 3L35A 1PGJA 1BE3J 3PRJA 1OZHA 3CWBE 1QLED 5AW4B 1EXIA 3CWBD 5F2NA 2FAEA 2HR3A 5AW3B 4OGQC 2PEJA 2Q1KA 3VMAA 3AEDC 2WSSH 4OGQB 1GK6A 1L0LG 1PP9G 2GDYA 3H1KE 2QJKC 2LKMA 3FXEA 1BXIA 1W2BO 3H25A 4YXWH 2QJKB 1MZ8A 1WMKA 2N9BA 1PEMA 5GTHE 5GTHH 1QX8A 3L73G 2VLPA 2N1TA 1JM0A 4PD4E 5CJ4A 1H0TA 4F37A 2YMYA 4PD4D 2KG6A 3WUTA 3V2PA 3VRLC 2L9FA 1AV1A 3HZQA 2WSEJ 3AEFC 5BS1A 1OMIA 2WITA 3GW6A 2HPCA 3V4QA 2HODA 2WT7A 4DT0A 1L0LJ 1G2CA 1M1JA 1AQ5A 4XA4A 1PP9J 2YKPA 1L4AD 4O9BA 1YYCA 2ZYGA 2EHSA 2WWWA 1EZVE 1VQ8P 1NU1E 4L74A 5AVQB 4KHXA 4XRQA 2W90A 1BCCE 1EZVD 3Q5RA 2IZ1A 4DCKA 3W68A 3KPEA 3RG6C 1BCCD 1AA0A 4XE5B 1PL5A 1T2KD 1Q7YQ 2WPVB 1FOSE 3L73J 5CBOA 4IFDK 3R2PA 1FDMA 2ZXEB 1IK9A 3KZIH 2XXMA 3A7OA 1HJBA 1EC5A 1NTMG 3IF4A 3E7KA 4WVZA 1FR2A 1PIXA 3GLMA 1SQQK 4U0BA 3V4WA 1MUUA 5K5GB 2QNWA 3G21A 1OVUA 3D71A 1VQ4P 1RNIA 1DX7A 2R3CA 3L36A 4A7PA 2K0YA 3G28A 3S4RA 1JY3P 1LGHB 1DEEG 2W8ZA 2UWJE 3M9HA 1IUQA 3N7NA 2MY5A 5F2KA 1RQVA 2O1JA 1LT1A 2FVEA 3OAKA 3G9RA 1M8OB 3NMDA 2SPZA 2FXMA 1OW6A 1J2JB 2E43A 3CD6P 2MJZA 4ZKUA 2OARA 3CPWO 1FC2C 1FE6A 3CXHE 1NTMJ 2CQ8A 3TF5A 1M1KQ 3CXHD 5APXA 2PEOA 4IFFA 4PH0A 1SP4A 2JBGA 1SVFA 3TGUE 5HV8A 3VP9A 3TGUD 1RF1B 2QRXA 1JCDA 4DOJA 3AE2C 1DD3A 4K35A 2FACA 3H1KG 4JPZB 2LIUA 5F2OA 2C9LY 2IYOA 1IFJA 1KQSO 4L73A 3EWKA 2MF4A 1PGPA 4TLFA 4JYCA 3P05A 2FQ2A 1VQMP 2EHTA 3L71G 1A02F 5AVSB 2VRSA 2W6AA 3AEAC 1LTBC 3MP7B 3JC22 3OA7A 1PZQA 5CCHC 2EFJA 3MUDC 3LW5H 3BCCE 1VQKP 2IZ0A 3MGEA 4M0IA 3BCCD 1JO5A 3M1MA 3O6QB 4C7NB 4M3LA 2AEMA 3BATA 3MHVA 1PEUA 1IFNA 2FQ1A 3GZLA 1NU1G 4R4LA 2V7QH 3CCUP 2POHA 2YNYA 3MIWA 1KV4A 1OVVA 1FZEA 1LTSC 2P10A 2LMLA 1DV5A 1N7SD 3KQGA 2JWAA 1YTZI 4N6JA 1PPJG 1Z56A 3CX5E 3CX5H 1RF1A 2Q7CA 3L71J 1SQVG 3CX5D 1AQTA 5BU5A 2IPPA 2E1MA 1NJIQ 4COPA 1RY3A 1AVOA 2WPQA 2HG5D 5M1BA 1GW4A 4H0LD 5AVVB 2N5HA 1ZV8A 4NPEA 2ZJSE 3L70E 1HGZA 2C0WA 2RMZA 2CNRA 3CC4P 1ZNVA 2KK7A 1VQ7P 3L70D 4U0EA 2FBWC 1HUCA 2M5AB 1PEOA 1RE4C 4I7ZC 1S9KE 1IFIA 1YQ3C 4ASWA 1RF0C 3WU2E 4I7ZB 1S9KD 3IN6A 4AYCA 4ZMDA 3A5TA 2Y0EA 2K93A 1NAYA 5KLVD 5H2FE 3AECC 2GA1A 4H2WC 1SQVJ 1NQ4A 1HF9A 3HD7D 3H32A 2KS1B 2LR2A 2K9YA 4BPHA 2YXRB 5CCHA 1IK7A 1YQ4C 1KB9E 3O6QA 4LC1A 4C7NA 1KB9D 1KORA 1T2KC 1EDLA 2FYNC 1ZMBA 3HE5B 2K0DX 2E5TA 5KAIE 1KYOH 1FZAA 1SQQE 2O01N 2JJLA 2FYNB 2B87B 1SQQD 3DS1A 1QL2A 3C1LA 2H88C 5KJ7D 2PNGA 2WSFJ 1EDJA 1VQLP 2M8PA 2XNXA 3B8EB 1SLQA 4IOIH 2WSEH 1N7LA 1LTIC 4U3FG 4ZKPA 3TYYA 4CA3A 4PJ0H 4JBZA 2W83C 3BVHA 2K5XA 4BXLA 4PXHB 2KZIA 3AEEC 1LTJC 1SQBK 1L0NG 1KILC 2HLOA 1LTJB 1L0LD 4H44D 2FYUG 2I1JA 1KILB 1NOHA 2M5AA 1GZLA 2XNDH 1GU5A 2JEEA 2A45H 3CI9A 1RE4A 3FWLA 1IFDA 1RF0A 1K73Q 1DEBA 3H1JG 2I1KA 1HQBA 1DNYA 1N8RQ 4D6TG 3CCSP 3G1GA 3TDKA 2KS1A 2ZXXA 4U3FJ 2BUOA 1NTKK 3VP8A 2K92A 2KI7B 2JU2A 1AYIA 2L91A 1CW5A 1NKZB 3G0VA 1OWAA 3AEBC 4HYTB 1H88A 1YITP 1S4XA 2BCCE 2IBZI 1JTHB 4LGDE 1L0NJ 2L4BA 3HE5A 5HGLA 1S5LX 2FYUJ 1RH5B 2B87A 3MZWB 3FXDA 2ZT9C 4IZ6A 1M56D 1XTGB 2CPBA 1P84H 2ZT9B 4PV1C 2KNCB 4N78D 1P84D 3H1JJ 2WPSA 3CXCO 4OVNF 4PV1B 1JY3O 1SQXG 1JJ2O 2H7HA 3E1IA 4D6TJ 4GODA 1D1DA 2OGUA 2M5RA 1UNKA 2PRRA 4DJGA 1T3UA 4GT1A 1FZCC 3LIEA 1FDOA 1YTZT 1FZBA 2B89A 3HYBA 3TSIA 1FZCB 1LTJA 5APSA 3DS3A 1KILA 3H47A 3CCRP 2BQ1E 2QG4A 1GL2C 1K05A 4EOTA 4PD4I 3LIDA 4OH8B 3VMZA 1GL2B 2FXPA 3AE8C 3H1LE 2OTLP 1Q81Q 4UB8H 1AUMA 3H1LD 5E79E 2Y0CA 3M9BA 3AE9C 4YPCA 2RN0A 3SFEC 1SQXJ 3M0DA 4MN4C 4B86A 4HH2A 1GXHA 1VF5D 1LT9C 1KFMA 1URQD 3Q20A 3L74E 3C8VA 1BGYG 2RH0A 3A3YB 1NTZK 1LT9B 1S1CX 1EZVI 3L74D 2E75C 1JTHA 3CMAP 2K0XA 2E75B 2O3JA 1NAFA 3D6YA 2V4HA 2NPSA 1JEKA 2CG5B 3CCVP 4HKGA 1K30A 1YJ9P 1X9VA 2JYLA 3GKLC 1FU1A 3NFQA 2X2BA 1M6NA 5KP8B 3EJEA 1S5LE 3USSA 1FAVA 1S5LH 4W7YA 2B88A 4EYYQ 2IDBA 2Q9IA 2H8PD 1KFNA 4U0CA 2E74D 2R44A 4RO0A 2DGYA 5AW9B 1OIPA 4WY4C 3RL0g 1BGYJ 4WY4B 1FZCA 3GF3A 3P8MC 2EG5A 1HY8A 2KLUA 3M91A 2ZYDA 1J1EC 4N3YB 5C39A 4U0FA 2Z5IA 1J1EB 4HJGH 5KLVK 4LLHA 1Q90D 1HVVA 1GL2A 3ZDMA 2P9XA 2JQ4A 2N6YA 3CC2P 1U57A 5AW7B 2W27A 3VMYA 2BCCG 1UJZA 3RK3E 1JMMA 3A2AA 3CXHI 1X22A 1OVRA 3RK3D 2PY8A 3II6A 4EI2A 5KTBA 1QL1A 1SFCD 3KZIE 1SQBE 2M8RA 1D7MA 4W7ZA 4KT0J 1Q2NA 1LT9A 2JDIH 2ZAEB 1SQBD 1JY3N 5TISH 3V6IA 1TU3F 2ERHA 5APTA 3HUSC 2L0QA 1KLPA 4R0MA 2PAJA 3HUSB 2QE7H 3H1HE 2PENA 3H6PA 2M8LA 2K94A 3V2RA 4IFMA 3H1HD 1EDKA 4BPGA 1L2PA 3CLQA 2PEKA 2OYIC 2MVVA 2K3RA 2ROQA 4BRYB 1A8OA 4RESB 3OJAB 2KORA 1NTKE 2OYIB 4DG9A 1E5WA 3GJNA 1NTKD 2LOLA 2BHVA 2KUBA 2PFXA 5GTIH 1HWTC 2Z46A 1SQPG 4I6MC 1L0LK 3P32A 3A0HH 4WY4A 2FXOA 2IBZG 5APYA 5AVWB 2JKVA 4MRTC 1PEQA 2WSFH 3IR9A 1PFIA 4WWIA 2RKLA 1GXGA 5KLIC 4PH1A 3PHLA 3V2QA 2JAZA 3KHUA 5KLIB 2GDWA 1LTGC 5APQA 4WYMA 3CWBG 2KGDA 2GM4A 3PP5A 2BASA 2HYNA 1YBKA 3AEGC 5APUA 3Q3DA 2R5BA 2GYKA 2JO0A 2Q3IA 4W80A 4Y28J 1EQ7A 3U43A 1L0IA 3JCUH 2CWOA 1MFZA 3B5NC 1E6JP
chains in the Genus database with same CATH topology
3G6EP 2PEMA 2EFJA 4IPYA 1YI2P 3Q20A 3G28A 2BUOA 2KODA 1W2BO 1NJIQ 2M8NA 1VQKP 3G1IA 1PEMA 3G0VA 3MGEA 4M0IA 1M90Q 3DS5A 3H4EA 2QEXP 1YJNP 5BS2A 3CC7P 1YITP 3NTEA 1IUQA 1A43A 2LF4A 3M1MA 3I56P 3CMAP 1K9MQ 4XFZA 5F2KA 1K8AQ 1PEUA 5HGLA 4QNBA 1ZMBA 3E2DA 2PENA 1S72P 4COCA 2M8LA 3CCUP 1VQ6P 3VRLC 1QVGO 2QA4P 3CCVP 3I55P 3HZQA 1Q86Q 3CD6P 1K30A 1VQNP 2PEQA 2OARA 3DS1A 3CPWO 1YJ9P 1KD1Q 3G71P 3CCLP 1M74A 2JYLA 3OW2O 5BS1A 1Q82Q 1M6NA 4XFYA 5HGOA 1BAJA 1YJWP 2PEKA 1M1KQ 2ONTA 2PEOA 1QRJA 1A8OA 4PH0A 2EIAA 3CXCO 1KC8Q 1VQLP 1EOQA 2M8PA 3G26A 1JJ2O 3G4SP 4GR2A 3CCJP 3DS4A 1D1DA 4U0CA 2BHVA 1VQ8P 2DGYA 4XROA 2Z46A 2XV6A 2E1MA 1RO2A 4U0DA 4XRQA 2L6EA 1M6EX 3DTJA 4COPA 3CCMP 1VQ5P 1QVFO 3G29A 4GR6A 1VQPP 1EIAA 3LRYA 3RG6C 3DPHA 3H0DA 3DS2A 1VQOP 1PEQA 3CMEP 3HYBA 1Q7YQ 2EG5A 1RO0A 3CCEP 3DS3A 4PH1A 5HGMA 3H47A 3B5IA 3CCRP 3CC4P 2BQ1E 4U0FA 1VQ7P 2Z44A 1YHQP 5HGNA 4U0EA 4WYMA 3WBHA 2JYGA 4XFXA 5F2OA 4U0AA 1PEOA 2XXMA 2P9XA 3CCQP 1KQSO 1YIJP 3CC2P 5F2NA 2OTLP 5DCKA 2XT1A 1Q81Q 2PEIA 1K73Q 1AUMA 2PEJA 5I4TG 2JO0A 3P05A 4U0BA 3G21A 1VQMP 1VQ9P 1N8RQ 1VQ4P 3CCSP 3G1GA 2OTJP 2CWOA 3DS0A 5JPAA 1RNIA 2PY8A 2Z45A 1E6JP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E P;  1VQ8 P;  3CCU P;  1VQ6 P;  1QVG O;  2QA4 P;  3CCM P;  3CCV P;  3I55 P;  1YI2 P;  3CCQ P;  1W2B O;  1Q86 Q;  1VQ5 P;  1NJI Q;  1YIJ P;  1KQS O;  1YJ9 P;  3CPW O;  1KD1 Q;  3CC2 P;  3CCL P;  3G71 P;  1QVF O;  3CD6 P;  3OW2 O;  1VQP P;  2OTL P;  1VQK P;  1Q82 Q;  1Q81 Q;  1S72 P;  1YJW P;  1K73 Q;  1M1K Q;  2QEX P;  1M90 Q;  1YJN P;  1VQN P;  1VQO P;  3CC7 P;  1YIT P;  3CME P;  3I56 P;  1Q7Y Q;  3CXC O;  1KC8 Q;  3CMA P;  1K9M Q;  1VQL P;  1JJ2 O;  3CCE P;  1VQM P;  3G4S P;  1K8A Q;  1N8R Q;  3CCJ P;  1VQ9 P;  1VQ4 P;  3CCS P;  2OTJ P;  3CCR P;  3CC4 P;  1VQ7 P;  1YHQ P; 
#chains in the Genus database with same CATH topology
 3B5N B;  1SQP J;  3Q2Y A;  2MR8 A;  3RL0 C;  3G1I A;  2KOQ A;  5CZD B;  2QSI A;  3DS5 A;  1BSH A;  1YJN P;  3RL0 B;  3SWY A;  2P7J A;  3HUS A;  1JUN A;  1FOS F;  3CWB J;  3CL3 D;  2QA4 P;  1E79 H;  4U3F D;  2XU6 A;  2J59 M;  2N1T D;  5DJU B;  4BRY A;  2DW3 A;  4BWN A;  2IYP A;  1HJ0 A;  1EOQ A;  1NTM K;  5APV A;  5AVZ B;  2CGQ A;  1T3J A;  1NTZ E;  2FQ0 A;  3H1K J;  1JY2 P;  4EIJ A;  1NTZ D;  1EZV G;  1GD2 E;  1IMP A;  1BCC G;  4NPD A;  3SWK A;  2M0B A;  4IL6 X;  2IFN A;  3BRT B;  4H13 D;  2J58 A;  1GK4 A;  1KB9 I;  5KAF E;  2NO8 A;  5KAF H;  5KKZ C;  3B5I A;  3H1I E;  2VLO A;  1QEX A;  3WBH A;  3M0A A;  4ZNC A;  3H1I D;  2KIK A;  3KDP B;  2H89 C;  3RK2 D;  2VLQ A;  4HKZ H;  3P8C E;  2YIU C;  3JSV C;  1LP1 B;  3B4S A;  1KQG B;  3P8C D;  2YIU B;  5B5E H;  1CZQ A;  1PGO A;  5AW6 B;  4JYB A;  3B5N A;  2Z45 A;  3L75 E;  3NY7 B;  3G6E P;  3MD0 A;  1NU1 J;  2AEJ A;  2AXT H;  3L75 D;  4OGQ D;  3I5C A;  1BCC J;  3L72 E;  4QMA A;  1M90 Q;  1JNM A;  5KLV E;  3L72 D;  1K9M Q;  2KGC A;  1A02 J;  1Z6M A;  1T6A A;  1H89 A;  1BE3 E;  3NXS A;  4CPG A;  1DD4 A;  2PGD A;  1FDI A;  1L4A C;  1BE3 D;  3I55 P;  3S1K A;  1W2E A;  3MUD A;  2A06 E;  1L4A B;  2NRG A;  2L22 A;  2LXB A;  4XFY A;  2YO2 A;  2A06 D;  3P7K A;  2OTK E;  2FVA A;  5APW A;  3TGU G;  3L4F A;  2J5U A;  3DS4 A;  1NKN A;  3C9I A;  3GF7 A;  1X3O A;  1JMB A;  1KYO E;  2N50 A;  3CCM P;  1M6E X;  5AW1 B;  1VQ5 P;  1KYO D;  3SFD C;  5AVY B;  4GR6 A;  2P1J A;  2YMK A;  3V5B A;  1LTT C;  1GU4 A;  2WPR A;  5HGM A;  3PTZ A;  2WZ7 A;  3MGN A;  1H8A A;  5AVT B;  2LXC B;  2YKO A;  1LP1 A;  3GHG C;  4IL6 H;  1YIJ P;  1LTA C;  4PJ0 E;  2LPK A;  1N73 C;  3HTK B;  5DCK A;  3GHG B;  1N73 B;  3VMX A;  1NHL A;  2E42 A;  1L0L E;  1PP9 E;  4RKU J;  3TGU J;  1PP9 D;  2KB7 P;  2XZR A;  3B71 A;  2ITA A;  1ZME C;  1YI2 P;  1GMJ A;  2K88 A;  2ZYA A;  3BCC G;  3F5H A;  1M7L A;  1MZ9 A;  3CC7 P;  3L73 E;  3I56 P;  4AQR D;  1F80 D;  3L73 D;  3TK1 A;  5TJH A;  1IFM A;  1N2D C;  3VN0 A;  4KJM A;  1FZG A;  3CE7 A;  5KP7 B;  1G1I A;  1VDF A;  1L4A A;  1ZRT E;  5B66 H;  3CCL P;  1L0H A;  1ZRT D;  2Q5U A;  1QGK B;  2ONT A;  5HVC A;  1W5C E;  3FGA D;  3G4S P;  2WMM A;  3RBX A;  1IC2 A;  5BU8 B;  3AE7 C;  3S9O A;  2VLN A;  2KG8 A;  4XRO A;  2AVA A;  5EJD A;  4L75 A;  1CI6 B;  1RO2 A;  2KOP A;  3T97 B;  4UB6 H;  1QVF O;  3BCC J;  4RJT A;  3TNU B;  2KOS A;  4N78 E;  1P84 E;  1WRG A;  1VQO P;  2GZE A;  3SSU A;  3VOP A;  3L70 G;  3ABV C;  1U7M A;  2XKM A;  2NZ2 A;  5DJT B;  2AF8 A;  2QJP C;  2V7Q J;  3N4X A;  3HTK A;  1X79 B;  2KP8 A;  2H43 A;  1NTM E;  3GHG A;  1VPC A;  2QJP B;  1MFT A;  1OXZ A;  1RE3 C;  1N73 A;  2G8Y A;  1NTM D;  2P2U A;  5KLV G;  2KSJ A;  1R5L A;  2Z5H A;  2FYZ A;  1U7J A;  1VQ9 P;  2P58 A;  1M57 D;  2MR7 A;  2N5I A;  1KTM A;  4R4M A;  1FS0 E;  2JR8 A;  3H4E A;  4UB8 E;  1VKU A;  1N7S C;  3L70 J;  3EFG A;  4QNB A;  4H13 C;  5CCH D;  5AVR B;  5CMZ A;  1N7S B;  4H13 B;  1SQQ G;  2BEZ F;  3QWO C;  3U1A A;  1L0N K;  1RQU A;  1Q86 Q;  1VQN P;  2FYU K;  1J1D C;  1DIP A;  1J1D B;  7CEI A;  1UIX A;  3G26 A;  2I8D A;  2GZI A;  1RHZ B;  2O01 J;  2GZG A;  4H0L C;  3SWF A;  3KYQ A;  1ZLL A;  2KR5 A;  1CI6 A;  2KSE A;  3T97 A;  1G1J A;  4H0L B;  2MVU A;  3IFM A;  2R32 A;  2JGP A;  3TNU A;  1VQP P;  1KQF B;  2Q3E A;  2KNC A;  4NEO A;  4YXD C;  2FY8 A;  2WSC J;  3FWN A;  3EQ2 A;  1SQQ J;  3H1K D;  2C9N Y;  5AW5 B;  4GOF A;  2A45 G;  3HD7 C;  1E0H A;  2YXQ B;  1JY2 O;  1RE3 A;  2B9B A;  3HD7 B;  5I4T G;  1R8E A;  1USD A;  2N9Y B;  1VHN A;  4PD4 H;  3L71 E;  3AE4 C;  3RGU A;  2G3A A;  2FHS C;  3L71 D;  3ITK A;  2R3S A;  2MD9 A;  3AE3 C;  3L37 A;  1X8Y A;  2L5G B;  1SQX K;  3LMO A;  2CK3 H;  4H2X C;  2IFM A;  1ZW0 A;  2ZVO B;  2FVF A;  1BSN A;  3KXD A;  1K8A Q;  5KJ7 C;  3WUU A;  1N7S A;  2FFD C;  4XFJ A;  4NPF X;  3E2D A;  2W6J H;  1S72 P;  4COC A;  1VL2 A;  2FFD B;  4GKG A;  1NU1 D;  1IO4 A;  2PEQ A;  3U1C A;  3G71 P;  3RG2 A;  4DZO A;  5TIS E;  1YJW P;  2K2Q A;  1NH4 A;  4HB1 A;  1PPJ E;  3M06 A;  2DNW A;  3V2N A;  3QH9 A;  4QKO A;  1PPJ D;  1SQV E;  1SQV D;  4H44 C;  5AW2 B;  3GG2 A;  4H44 B;  4I1L A;  1EIA A;  3LRY A;  3PH0 A;  3DPH A;  1X0T A;  2OYO A;  3CME P;  2BCC J;  1OFC X;  2JU1 A;  2KLV A;  1R5S A;  1OW7 A;  2Z44 A;  1EMV A;  5HGN A;  2JYG A;  5GTI E;  1HBW A;  2OQQ A;  3A0H E;  4Z1M H;  1ACP A;  1KIL E;  1S2E A;  3HD7 A;  3VTP C;  3H1L G;  5CCG D;  2KYV A;  2PEI A;  1KIL D;  1S3J A;  3EJB A;  4I2L C;  3O8Z A;  2K9J B;  3DS0 A;  1LJ2 A;  3GZM A;  5AW8 B;  2PEM A;  2YKQ A;  1PGQ A;  2WVR A;  4IPY A;  4YTP C;  3CXH H;  3L74 G;  2QVA A;  4EDF A;  4WBA A;  1RF1 C;  1HTL C;  1Y47 A;  3JCU E;  5KJ7 A;  1MV8 A;  2Y9Z A;  3K5B A;  2FFD A;  1EXJ A;  1VQ6 P;  1AVY A;  5CBN A;  2HFE D;  3CX5 I;  3WMM 0;  1KD1 Q;  1FZF A;  3E1R A;  3H1L J;  3BAS A;  3W67 A;  1USE A;  1CSB A;  2NPS D;  2GZJ A;  2OYH C;  1ZR4 A;  3CCJ P;  2OYH B;  2ZT9 D;  2N98 A;  1JB0 J;  1NO4 A;  2M3B A;  1JY2 N;  1PV3 A;  4U3F E;  4PV1 D;  3L74 J;  1NWQ A;  3G29 A;  1Y8A A;  3GMA A;  2AFE A;  3Q1M A;  2OYI A;  1L0N E;  1KN7 A;  2JP3 A;  1AF8 A;  2FYU E;  1L0N D;  3R4Y A;  2FKW B;  2W6B A;  3AE5 C;  2FYU D;  3H32 B;  2YO3 A;  1VF5 C;  2FAD A;  2Y0D A;  3D6Z A;  1URQ C;  1VF5 B;  1XTC C;  2Y9Y A;  3H1J E;  5CJ0 A;  2JWD A;  1URQ B;  2K9J A;  3H1J D;  2XZ1 C;  4D6T E;  2C0X A;  5EFW B;  1GL2 D;  1OX3 A;  2GUV A;  1AFO A;  4D6T D;  1T8Z A;  2MKV A;  5KKZ B;  1SQB G;  2E76 D;  2KOD A;  2D2C D;  2R5D A;  1KYO I;  4L76 A;  5B5E E;  1SQP K;  2CPS A;  4OWF A;  3U59 A;  2LTE A;  2K1A A;  2LIW A;  1ZOY C;  3HE4 B;  1GW3 A;  3H1H G;  2IX7 C;  4Y99 C;  2O1K A;  1HH0 A;  2AXT E;  2E74 C;  2E75 D;  4Y99 B;  4TT3 H;  3Q5P A;  2KZJ A;  2E74 B;  5HGO A;  2P67 A;  2KXP B;  1QRJ A;  1OW8 A;  1SQX E;  1KMI Z;  2OYH A;  1NTK G;  1NGM B;  1IMQ A;  4GIF A;  1SQX D;  1LNQ A;  2XV5 A;  5BVZ A;  1SQB J;  4U0D A;  1SS1 A;  1OR5 A;  2ZFC A;  3WU2 H;  3H0D A;  2LL8 A;  1FBM A;  4BPF A;  2M3E A;  5H2F H;  2A45 I;  2JO1 A;  1N86 A;  3CCE P;  3F89 A;  2O01 H;  4GDO A;  4WY4 D;  3H1H J;  1YHQ P;  3RK3 C;  4C7R A;  4PWV B;  4U0A A;  3CCQ P;  4C46 A;  3RK3 B;  4UHP B;  1SFC C;  2AXC A;  1KB9 H;  2XT1 A;  1IFP A;  1URQ A;  2ZVN B;  1IZN B;  1SFC B;  1JOC A;  1JCC A;  3NTN A;  2KGE A;  2Q6Q A;  3AE6 C;  5AVX B;  1NTK J;  2OTJ P;  2WSC H;  3Q5S A;  5KAI H;  3FX0 A;  2KWL A;  3A0B E;  3A0B H;  1ZN5 A;  2KOO A;  4IL6 E;  1BGY E;  2M8N A;  3UIA A;  1GTW A;  5EW5 E;  1BGY D;  2QEX P;  1WT6 A;  5BS2 A;  1NU1 K;  3NTE A;  1NVO A;  2LF4 A;  1HGV A;  5AVU B;  3HE4 A;  1NYH A;  3D70 A;  1P84 I;  4GOE A;  3WUV A;  1K04 A;  1LWU C;  1CEI A;  4U7J A;  1QVG O;  5AW0 B;  2GZF A;  1LWU B;  2QIW A;  1SQV K;  1Q82 Q;  5CCG C;  4AUW A;  2AFD A;  4JF7 A;  2KGA A;  2E5Y A;  1NTZ G;  4ASV A;  2QJY C;  1KZU B;  4JQ0 D;  3AE1 C;  2QM7 A;  2QJY B;  2L6E A;  3DTJ A;  4WB4 A;  5B66 E;  3DS2 A;  2QM8 A;  2WQY C;  3M0D C;  1RO0 A;  1IJD B;  2VSQ A;  3RBZ A;  3H1I G;  1BDD A;  1AJY A;  4XFX A;  2Z4E A;  2LKI A;  2GDX A;  1Y9B A;  3LW5 J;  4UB6 E;  1SFC A;  4K3A A;  1BDC A;  3EFF K;  5CHX A;  2XDJ A;  1FJP A;  3PJS K;  1ZXG A;  2KG9 A;  2BCC D;  2NPS C;  5JPA A;  2JB0 A;  1NTZ J;  2NPS B;  3L75 G;  1DH3 A;  2PP6 A;  1UII A;  1ZR2 A;  3L72 G;  2WTY A;  1A43 A;  2GUS A;  2N1T C;  2KW2 A;  3B5N D;  2XZ0 D;  4XFZ A;  2N1T B;  1EDI A;  1GDT A;  1BE3 G;  3H1I J;  1H0T B;  3RL0 D;  1LWU A;  3EJD A;  1KQL A;  3M9Q A;  1M74 A;  3OW2 O;  2A06 G;  1BAJ A;  5CCG A;  2N6Z A;  2EIA A;  1KC8 Q;  3G3Z A;  1M1J C;  2HPC B;  2HOD B;  2WT7 B;  4GR2 A;  3B4Q A;  1G2C B;  3BRV B;  1M1J B;  4H2Y C;  3L75 J;  1FJK A;  1SQP E;  2XV6 A;  3PLN A;  5L8R J;  2AEF A;  2IBZ E;  1SQP D;  2E76 C;  3L72 J;  2K37 A;  2IBZ D;  3RK2 C;  1T8K A;  5E79 H;  2D2C C;  3HRN A;  5KP6 B;  5KLV J;  2E76 B;  2KOG A;  3RK2 B;  1MKM A;  1ZP0 C;  2D2C B;  3VYI A;  1GPJ A;  3IAO A;  2BEQ D;  2WPT A;  3MTU E;  3L35 A;  1PGJ A;  1BE3 J;  3PRJ A;  1OZH A;  3CWB E;  1QLE D;  5AW4 B;  1EXI A;  3CWB D;  5F2N A;  2FAE A;  2HR3 A;  5AW3 B;  4OGQ C;  2PEJ A;  2Q1K A;  3VMA A;  3AED C;  2WSS H;  4OGQ B;  1GK6 A;  1L0L G;  1PP9 G;  2GDY A;  3H1K E;  2QJK C;  2LKM A;  3FXE A;  1BXI A;  1W2B O;  3H25 A;  4YXW H;  2QJK B;  1MZ8 A;  1WMK A;  2N9B A;  1PEM A;  5GTH E;  5GTH H;  1QX8 A;  3L73 G;  2VLP A;  2N1T A;  1JM0 A;  4PD4 E;  5CJ4 A;  1H0T A;  4F37 A;  2YMY A;  4PD4 D;  2KG6 A;  3WUT A;  3V2P A;  3VRL C;  2L9F A;  1AV1 A;  3HZQ A;  2WSE J;  3AEF C;  5BS1 A;  1OMI A;  2WIT A;  3GW6 A;  2HPC A;  3V4Q A;  2HOD A;  2WT7 A;  4DT0 A;  1L0L J;  1G2C A;  1M1J A;  1AQ5 A;  4XA4 A;  1PP9 J;  2YKP A;  1L4A D;  4O9B A;  1YYC A;  2ZYG A;  2EHS A;  2WWW A;  1EZV E;  1VQ8 P;  1NU1 E;  4L74 A;  5AVQ B;  4KHX A;  4XRQ A;  2W90 A;  1BCC E;  1EZV D;  3Q5R A;  2IZ1 A;  4DCK A;  3W68 A;  3KPE A;  3RG6 C;  1BCC D;  1AA0 A;  4XE5 B;  1PL5 A;  1T2K D;  1Q7Y Q;  2WPV B;  1FOS E;  3L73 J;  5CBO A;  4IFD K;  3R2P A;  1FDM A;  2ZXE B;  1IK9 A;  3KZI H;  2XXM A;  3A7O A;  1HJB A;  1EC5 A;  1NTM G;  3IF4 A;  3E7K A;  4WVZ A;  1FR2 A;  1PIX A;  3GLM A;  1SQQ K;  4U0B A;  3V4W A;  1MUU A;  5K5G B;  2QNW A;  3G21 A;  1OVU A;  3D71 A;  1VQ4 P;  1RNI A;  1DX7 A;  2R3C A;  3L36 A;  4A7P A;  2K0Y A;  3G28 A;  3S4R A;  1JY3 P;  1LGH B;  1DEE G;  2W8Z A;  2UWJ E;  3M9H A;  1IUQ A;  3N7N A;  2MY5 A;  5F2K A;  1RQV A;  2O1J A;  1LT1 A;  2FVE A;  3OAK A;  3G9R A;  1M8O B;  3NMD A;  2SPZ A;  2FXM A;  1OW6 A;  1J2J B;  2E43 A;  3CD6 P;  2MJZ A;  4ZKU A;  2OAR A;  3CPW O;  1FC2 C;  1FE6 A;  3CXH E;  1NTM J;  2CQ8 A;  3TF5 A;  1M1K Q;  3CXH D;  5APX A;  2PEO A;  4IFF A;  4PH0 A;  1SP4 A;  2JBG A;  1SVF A;  3TGU E;  5HV8 A;  3VP9 A;  3TGU D;  1RF1 B;  2QRX A;  1JCD A;  4DOJ A;  3AE2 C;  1DD3 A;  4K35 A;  2FAC A;  3H1K G;  4JPZ B;  2LIU A;  5F2O A;  2C9L Y;  2IYO A;  1IFJ A;  1KQS O;  4L73 A;  3EWK A;  2MF4 A;  1PGP A;  4TLF A;  4JYC A;  3P05 A;  2FQ2 A;  1VQM P;  2EHT A;  3L71 G;  1A02 F;  5AVS B;  2VRS A;  2W6A A;  3AEA C;  1LTB C;  3MP7 B;  3JC2 2;  3OA7 A;  1PZQ A;  5CCH C;  2EFJ A;  3MUD C;  3LW5 H;  3BCC E;  1VQK P;  2IZ0 A;  3MGE A;  4M0I A;  3BCC D;  1JO5 A;  3M1M A;  3O6Q B;  4C7N B;  4M3L A;  2AEM A;  3BAT A;  3MHV A;  1PEU A;  1IFN A;  2FQ1 A;  3GZL A;  1NU1 G;  4R4L A;  2V7Q H;  3CCU P;  2POH A;  2YNY A;  3MIW A;  1KV4 A;  1OVV A;  1FZE A;  1LTS C;  2P10 A;  2LML A;  1DV5 A;  1N7S D;  3KQG A;  2JWA A;  1YTZ I;  4N6J A;  1PPJ G;  1Z56 A;  3CX5 E;  3CX5 H;  1RF1 A;  2Q7C A;  3L71 J;  1SQV G;  3CX5 D;  1AQT A;  5BU5 A;  2IPP A;  2E1M A;  1NJI Q;  4COP A;  1RY3 A;  1AVO A;  2WPQ A;  2HG5 D;  5M1B A;  1GW4 A;  4H0L D;  5AVV B;  2N5H A;  1ZV8 A;  4NPE A;  2ZJS E;  3L70 E;  1HGZ A;  2C0W A;  2RMZ A;  2CNR A;  3CC4 P;  1ZNV A;  2KK7 A;  1VQ7 P;  3L70 D;  4U0E A;  2FBW C;  1HUC A;  2M5A B;  1PEO A;  1RE4 C;  4I7Z C;  1S9K E;  1IFI A;  1YQ3 C;  4ASW A;  1RF0 C;  3WU2 E;  4I7Z B;  1S9K D;  3IN6 A;  4AYC A;  4ZMD A;  3A5T A;  2Y0E A;  2K93 A;  1NAY A;  5KLV D;  5H2F E;  3AEC C;  2GA1 A;  4H2W C;  1SQV J;  1NQ4 A;  1HF9 A;  3HD7 D;  3H32 A;  2KS1 B;  2LR2 A;  2K9Y A;  4BPH A;  2YXR B;  5CCH A;  1IK7 A;  1YQ4 C;  1KB9 E;  3O6Q A;  4LC1 A;  4C7N A;  1KB9 D;  1KOR A;  1T2K C;  1EDL A;  2FYN C;  1ZMB A;  3HE5 B;  2K0D X;  2E5T A;  5KAI E;  1KYO H;  1FZA A;  1SQQ E;  2O01 N;  2JJL A;  2FYN B;  2B87 B;  1SQQ D;  3DS1 A;  1QL2 A;  3C1L A;  2H88 C;  5KJ7 D;  2PNG A;  2WSF J;  1EDJ A;  1VQL P;  2M8P A;  2XNX A;  3B8E B;  1SLQ A;  4IOI H;  2WSE H;  1N7L A;  1LTI C;  4U3F G;  4ZKP A;  3TYY A;  4CA3 A;  4PJ0 H;  4JBZ A;  2W83 C;  3BVH A;  2K5X A;  4BXL A;  4PXH B;  2KZI A;  3AEE C;  1LTJ C;  1SQB K;  1L0N G;  1KIL C;  2HLO A;  1LTJ B;  1L0L D;  4H44 D;  2FYU G;  2I1J A;  1KIL B;  1NOH A;  2M5A A;  1GZL A;  2XND H;  1GU5 A;  2JEE A;  2A45 H;  3CI9 A;  1RE4 A;  3FWL A;  1IFD A;  1RF0 A;  1K73 Q;  1DEB A;  3H1J G;  2I1K A;  1HQB A;  1DNY A;  1N8R Q;  4D6T G;  3CCS P;  3G1G A;  3TDK A;  2KS1 A;  2ZXX A;  4U3F J;  2BUO A;  1NTK K;  3VP8 A;  2K92 A;  2KI7 B;  2JU2 A;  1AYI A;  2L91 A;  1CW5 A;  1NKZ B;  3G0V A;  1OWA A;  3AEB C;  4HYT B;  1H88 A;  1YIT P;  1S4X A;  2BCC E;  2IBZ I;  1JTH B;  4LGD E;  1L0N J;  2L4B A;  3HE5 A;  5HGL A;  1S5L X;  2FYU J;  1RH5 B;  2B87 A;  3MZW B;  3FXD A;  2ZT9 C;  4IZ6 A;  1M56 D;  1XTG B;  2CPB A;  1P84 H;  2ZT9 B;  4PV1 C;  2KNC B;  4N78 D;  1P84 D;  3H1J J;  2WPS A;  3CXC O;  4OVN F;  4PV1 B;  1JY3 O;  1SQX G;  1JJ2 O;  2H7H A;  3E1I A;  4D6T J;  4GOD A;  1D1D A;  2OGU A;  2M5R A;  1UNK A;  2PRR A;  4DJG A;  1T3U A;  4GT1 A;  1FZC C;  3LIE A;  1FDO A;  1YTZ T;  1FZB A;  2B89 A;  3HYB A;  3TSI A;  1FZC B;  1LTJ A;  5APS A;  3DS3 A;  1KIL A;  3H47 A;  3CCR P;  2BQ1 E;  2QG4 A;  1GL2 C;  1K05 A;  4EOT A;  4PD4 I;  3LID A;  4OH8 B;  3VMZ A;  1GL2 B;  2FXP A;  3AE8 C;  3H1L E;  2OTL P;  1Q81 Q;  4UB8 H;  1AUM A;  3H1L D;  5E79 E;  2Y0C A;  3M9B A;  3AE9 C;  4YPC A;  2RN0 A;  3SFE C;  1SQX J;  3M0D A;  4MN4 C;  4B86 A;  4HH2 A;  1GXH A;  1VF5 D;  1LT9 C;  1KFM A;  1URQ D;  3Q20 A;  3L74 E;  3C8V A;  1BGY G;  2RH0 A;  3A3Y B;  1NTZ K;  1LT9 B;  1S1C X;  1EZV I;  3L74 D;  2E75 C;  1JTH A;  3CMA P;  2K0X A;  2E75 B;  2O3J A;  1NAF A;  3D6Y A;  2V4H A;  2NPS A;  1JEK A;  2CG5 B;  3CCV P;  4HKG A;  1K30 A;  1YJ9 P;  1X9V A;  2JYL A;  3GKL C;  1FU1 A;  3NFQ A;  2X2B A;  1M6N A;  5KP8 B;  3EJE A;  1S5L E;  3USS A;  1FAV A;  1S5L H;  4W7Y A;  2B88 A;  4EYY Q;  2IDB A;  2Q9I A;  2H8P D;  1KFN A;  4U0C A;  2E74 D;  2R44 A;  4RO0 A;  2DGY A;  5AW9 B;  1OIP A;  4WY4 C;  3RL0 g;  1BGY J;  4WY4 B;  1FZC A;  3GF3 A;  3P8M C;  2EG5 A;  1HY8 A;  2KLU A;  3M91 A;  2ZYD A;  1J1E C;  4N3Y B;  5C39 A;  4U0F A;  2Z5I A;  1J1E B;  4HJG H;  5KLV K;  4LLH A;  1Q90 D;  1HVV A;  1GL2 A;  3ZDM A;  2P9X A;  2JQ4 A;  2N6Y A;  3CC2 P;  1U57 A;  5AW7 B;  2W27 A;  3VMY A;  2BCC G;  1UJZ A;  3RK3 E;  1JMM A;  3A2A A;  3CXH I;  1X22 A;  1OVR A;  3RK3 D;  2PY8 A;  3II6 A;  4EI2 A;  5KTB A;  1QL1 A;  1SFC D;  3KZI E;  1SQB E;  2M8R A;  1D7M A;  4W7Z A;  4KT0 J;  1Q2N A;  1LT9 A;  2JDI H;  2ZAE B;  1SQB D;  1JY3 N;  5TIS H;  3V6I A;  1TU3 F;  2ERH A;  5APT A;  3HUS C;  2L0Q A;  1KLP A;  4R0M A;  2PAJ A;  3HUS B;  2QE7 H;  3H1H E;  2PEN A;  3H6P A;  2M8L A;  2K94 A;  3V2R A;  4IFM A;  3H1H D;  1EDK A;  4BPG A;  1L2P A;  3CLQ A;  2PEK A;  2OYI C;  2MVV A;  2K3R A;  2ROQ A;  4BRY B;  1A8O A;  4RES B;  3OJA B;  2KOR A;  1NTK E;  2OYI B;  4DG9 A;  1E5W A;  3GJN A;  1NTK D;  2LOL A;  2BHV A;  2KUB A;  2PFX A;  5GTI H;  1HWT C;  2Z46 A;  1SQP G;  4I6M C;  1L0L K;  3P32 A;  3A0H H;  4WY4 A;  2FXO A;  2IBZ G;  5APY A;  5AVW B;  2JKV A;  4MRT C;  1PEQ A;  2WSF H;  3IR9 A;  1PFI A;  4WWI A;  2RKL A;  1GXG A;  5KLI C;  4PH1 A;  3PHL A;  3V2Q A;  2JAZ A;  3KHU A;  5KLI B;  2GDW A;  1LTG C;  5APQ A;  4WYM A;  3CWB G;  2KGD A;  2GM4 A;  3PP5 A;  2BAS A;  2HYN A;  1YBK A;  3AEG C;  5APU A;  3Q3D A;  2R5B A;  2GYK A;  2JO0 A;  2Q3I A;  4W80 A;  4Y28 J;  1EQ7 A;  3U43 A;  1L0I A;  3JCU H;  2CWO A;  1MFZ A;  3B5N C;  1E6J P; 
#chains in the Genus database with same CATH homology
 3G6E P;  2PEM A;  2EFJ A;  4IPY A;  1YI2 P;  3Q20 A;  3G28 A;  2BUO A;  2KOD A;  1W2B O;  1NJI Q;  2M8N A;  1VQK P;  3G1I A;  1PEM A;  3G0V A;  3MGE A;  4M0I A;  1M90 Q;  3DS5 A;  3H4E A;  2QEX P;  1YJN P;  5BS2 A;  3CC7 P;  1YIT P;  3NTE A;  1IUQ A;  1A43 A;  2LF4 A;  3M1M A;  3I56 P;  3CMA P;  1K9M Q;  4XFZ A;  5F2K A;  1K8A Q;  1PEU A;  5HGL A;  4QNB A;  1ZMB A;  3E2D A;  2PEN A;  1S72 P;  4COC A;  2M8L A;  3CCU P;  1VQ6 P;  3VRL C;  1QVG O;  2QA4 P;  3CCV P;  3I55 P;  3HZQ A;  1Q86 Q;  3CD6 P;  1K30 A;  1VQN P;  2PEQ A;  2OAR A;  3DS1 A;  3CPW O;  1YJ9 P;  1KD1 Q;  3G71 P;  3CCL P;  1M74 A;  2JYL A;  3OW2 O;  5BS1 A;  1Q82 Q;  1M6N A;  4XFY A;  5HGO A;  1BAJ A;  1YJW P;  2PEK A;  1M1K Q;  2ONT A;  2PEO A;  1QRJ A;  1A8O A;  4PH0 A;  2EIA A;  3CXC O;  1KC8 Q;  1VQL P;  1EOQ A;  2M8P A;  3G26 A;  1JJ2 O;  3G4S P;  4GR2 A;  3CCJ P;  3DS4 A;  1D1D A;  4U0C A;  2BHV A;  1VQ8 P;  2DGY A;  4XRO A;  2Z46 A;  2XV6 A;  2E1M A;  1RO2 A;  4U0D A;  4XRQ A;  2L6E A;  1M6E X;  3DTJ A;  4COP A;  3CCM P;  1VQ5 P;  1QVF O;  3G29 A;  4GR6 A;  1VQP P;  1EIA A;  3LRY A;  3RG6 C;  3DPH A;  3H0D A;  3DS2 A;  1VQO P;  1PEQ A;  3CME P;  3HYB A;  1Q7Y Q;  2EG5 A;  1RO0 A;  3CCE P;  3DS3 A;  4PH1 A;  5HGM A;  3H47 A;  3B5I A;  3CCR P;  3CC4 P;  2BQ1 E;  4U0F A;  1VQ7 P;  2Z44 A;  1YHQ P;  5HGN A;  4U0E A;  4WYM A;  3WBH A;  2JYG A;  4XFX A;  5F2O A;  4U0A A;  1PEO A;  2XXM A;  2P9X A;  3CCQ P;  1KQS O;  1YIJ P;  3CC2 P;  5F2N A;  2OTL P;  5DCK A;  2XT1 A;  1Q81 Q;  2PEI A;  1K73 Q;  1AUM A;  2PEJ A;  5I4T G;  2JO0 A;  3P05 A;  4U0B A;  3G21 A;  1VQM P;  1VQ9 P;  1N8R Q;  1VQ4 P;  3CCS P;  3G1G A;  2OTJ P;  2CWO A;  3DS0 A;  5JPA A;  1RNI A;  2PY8 A;  2Z45 A;  1E6J P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...