1VQ5P

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq5P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq5P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq5P02
3CCVP 3G4SP 1M90Q 3I56P 3CCQP 1YITP 1VQ7P 1Q81Q 1W2BO 1YHQP 3I55P 1N8RQ 1VQNP 1VQ9P 3CCSP 1S72P 1VQMP 1YJWP 3CCUP 1QVGO 3CMAP 1K8AQ 3CPWO 3G71P 3OW2O 1VQ5P 1YJNP 1VQKP 2OTLP 3CCRP 3CD6P 1Q82Q 1VQOP 1VQLP 1K9MQ 2OTJP 1VQ8P 3CMEP 1KC8Q 1Q86Q 1JJ2O 1KD1Q 1YI2P 1M1KQ 1NJIQ 3G6EP 1KQSO 3CC7P 1YJ9P 3CCLP 1VQ6P 3CXCO 2QEXP 2QA4P 3CC4P 1QVFO 1VQ4P 3CCMP 1K73Q 3CCEP 1VQPP 1Q7YQ 3CC2P 3CCJP 1YIJP
chains in the Genus database with same CATH superfamily
2Q3IA 3L71G 2GUSA 2HFED 1Q81Q 5CCGA 1VQ9P 1OR5A 3G3ZA 2N50A 2V7QJ 3P7KA 1J1DC 3M0DA 4N3YB 3H1JE 2ZFCA 2GDWA 3G9RA 1L0NK 2NPSB 3L70E 2IBZI 5B5EE 3RK3D 1LWUA 1T2KC 2GUVA 3V6IA 5KJ7A 2C9NY 2E43A 4WY4B 1RE4C 3H1LE 2BCCD 3UIAA 1L0NJ 2B89A 5TISH 3EFFK 1GMJA 5AW1B 3O6QA 1L0ND 1KFMA 1JNMA 2RMZA 2MKVA 1EZVE 1OW7A 2K5XA 2FYNC 3H1HJ 1IO4A 1DNYA 1T3UA 1QX8A 2C0WA 3CX5E 4R4LA 3G28A 5APSA 4UB6H 1S5LE 1YJNP 1J1EC 2K0YA 1EQ7A 3HTKA 2E76B 1MFTA 1CI6B 2KGDA 2QA4P 1UJZA 3RG6C 2PEJA 3G29A 3AEAC 4PD4E 1JY2P 3AEBC 2K0DX 1Q90D 2Y9ZA 1ZOYC 2EHSA 3F5HA 1S1CX 3G21A 3BATA 1H0TB 1XTCC 3WBHA 1MKMA 2IBZE 3RGUA 5CBOA 3CC2P 2E75C 2IX7C 5CCHC 2E75B 3T97A 4PH1A 1NKNA 2M3BA 1E0HA 5C39A 1MV8A 1YQ3C 2CPBA 1NQ4A 4NPDA 2UWJE 1PEOA 4LLHA 2XU6A 1FZFA 3G1GA 2WPTA 3QWOC 1NTZE 2FY8A 1EZVI 1FS0E 3L74E 2KOQA 1SQXG 3HTKB 2ZYGA 3D6YA 1VQNP 2I1KA 1AQ5A 1LP1B 1SQQE 5KJ7D 4BWNA 5AVWB 3R4YA 2M8LA 1N86A 5DJTB 1PP9G 1FZEA 1KB9D 3MZWB 2P67A 1A43A 1QVFO 3HD7D 3WU2H 3PH0A 2LR2A 3WUVA 4N78D 1JM0A 4ZMDA 3BCCE 3N7NA 3L71J 3HD7A 4RKUJ 2GDYA 2WSCH 3CMAP 4PWVB 1LJ2A 1S9KE 2MJZA 4HB1A 3V4QA 3AECC 1L4AC 2B87B 1G2CA 4DG9A 1L4AB 4IPYA 2QEXP 5AW9B 2Y9YA 1LTGC 2LIUA 2KG8A 1N2DC 2O3JA 2NPSC 1D1DA 2ROQA 2R44A 1H89A 1DD3A 3NFQA 2GA1A 1NAYA 5KLVD 3C8VA 3HUSC 2W83C 1BSHA 2JR8A 2K1AA 1FDIA 1PEUA 3DS2A 3DS3A 2WZ7A 1RF1A 5BS1A 1SQPK 3ITKA 1JB0J 2OYIA 1VQ5P 4BPHA 1QL1A 1URQB 2OTJP 3L37A 2N1TA 2NZ2A 4N6JA 2OQQA 3CC7P 3L73D 1L0LD 2NPSD 2JYGA 2HODA 3A3YB 4XROA 2JWAA 1AJYA 2IDBA 1PGOA 5APUA 1SFCC 4WBAA 5E79E 3CD6P 3AE5C 3PJSK 1VHNA 4L75A 4W80A 1VQ6P 4GODA 4OGQB 2KP8A 4K35A 1SQPJ 1ZMBA 3VYIA 5KAIE 2FAEA 1SQPD 2QJPB 2OYOA 3U43A 3MIWA 2LTEA 3TGUE 4WY4D 4HYTB 3MHVA 2W90A 1Z56A 2M5AA 1LT9C 3RL0C 1LTIC 5BU8B 3RK3B 2W6AA 1JEKA 2KS1A 3SWFA 1LT1A 3RK3E 2BEZF 1PIXA 1OX3A 1Y8AA 1ZXGA 4U3FD 5KAFE 2L5GB 1VQMP 2ONTA 2FYUD 1OWAA 3PP5A 1M1JA 4IL6E 1IFMA 3H0DA 3OAKA 1ZLLA 1KILA 1W2EA 1U7JA 2O01J 2YXRB 2N9BA 1RO2A 3VN0A 2OYHC 1BE3D 2CQ8A 2YO3A 2E74B 2PEIA 3RL0B 5AW5B 1S9KD 1ZRTD 1RF0A 1VF5D 1DH3A 3R2PA 1DEBA 1ZR2A 3A0HE 1J1DB 2QJYB 2E74C 1HGZA 2IBZD 4UB8E 1KYOI 2M5AB 1FOSE 1IFJA 4PH0A 3HE5B 5AW4B 4Y99B 2BCCJ 1FZCB 2C9LY 1IFPA 1M74A 3Q5RA 2YKQA 2Z5HA 4PV1C 2LKIA 3B4SA 2FFDA 2AF8A 2E42A 2JAZA 2QE7H 3MP7B 2W8ZA 2LIWA 1N7SC 2A06D 1SQPE 1M6NA 4XA4A 3H1IJ 3RK3C 1URQC 5GTIH 1FJPA 1G1IA 1LT9B 1KQSO 1RY3A 2QSIA 5HVCA 1BGYE 5CMZA 1JOCA 4U0BA 4YXWH 4CPGA 2LXCB 5F2NA 2N6ZA 5TJHA 2VLPA 4JBZA 2K9JB 2IZ1A 3Q2YA 3LMOA 3U59A 2WT7A 5CHXA 4WB4A 2MD9A 4H0LC 3H1IG 4CA3A 4ZKUA 4RESB 1FZCA 1IC2A 2Q3EA 1S72P 3E1IA 1HWTC 3CWBJ 1LWUB 1VQKP 2O1JA 2RKLA 1OW8A 1IUQA 3M9HA 4U0EA 1SQVK 2ZT9C 4C7RA 3PHLA 1T2KD 3HZQA 1NKZB 1QRJA 2H88C 4LC1A 2KLVA 3TNUA 3RBXA 5B66H 3FX0A 1VQOP 3H1JG 3AE8C 1OFCX 2Q9IA 1LNQA 2AXCA 1J2JB 3H25A 2OYHA 2MR7A 2L91A 3L71E 2KWLA 2J58A 2JYLA 2ZAEB 3IFMA 1LTJA 2P10A 4C7NB 1N8RQ 2ZT9B 1HVVA 1U7MA 1GW4A 1GW3A 3I5CA 1SQQJ 4W7YA 2Q6QA 3IAOA 2KYVA 3IN6A 1VQ7P 2PGDA 3B4QA 3A2AA 5BS2A 3H1KJ 1NTZD 3KZIH 2EHTA 3L74J 4H0LB 3Q3DA 4MRTC 2POHA 3H1IE 1BCCD 1R5SA 3A5TA 2B88A 5H2FE 2CG5B 1OVUA 2E75D 2M8PA 4IFFA 2G8YA 1KTMA 2BCCE 2E76C 1BCCG 4UB6E 1S5LH 5KTBA 1GL2B 1GK6A 2ZVOB 5L8RJ 1KLPA 1KB9I 1X0TA 3EJDA 1SQPG 1PV3A 1BDDA 3AEDC 4PV1B 2Z46A 4GKGA 2OYIB 3IF4A 1NTKD 3CCUP 1PPJD 2OGUA 2XZRA 2K88A 3TF5A 3VMYA 5KAFH 3H1LD 1WMKA 2KUBA 3CCLP 5AVTB 1NU1D 4WY4C 1BCCJ 1D7MA 4ZKPA 3HUSA 1RF1C 3K5BA 1IFNA 1SQXK 1SQXJ 2LKMA 3W67A 5CCHA 1DX7A 2QJYC 2WPSA 2FKWB 3MUDC 1L0IA 2CPSA 1SQQK 3IR9A 1CSBA 2GZEA 2JU1A 1KMIZ 2XDJA 1L0NE 4KHXA 2GYKA 3CC4P 1J1EB 1KB9H 2NPSA 2O01N 1NTMG 3FWLA 2B87A 1G2CB 3CCQP 4HKGA 1HGVA 3H32A 1FAVA 2D2CC 1U57A 3AEFC 1MFZA 1K8AQ 1EZVG 1IMQA 1JY3O 2VSQA 2BUOA 2J5UA 3TGUJ 2WVRA 2P58A 3L74D 4RJTA 1RE4A 2KOPA 2DNWA 4HH2A 1JO5A 2H43A 5AVRB 1KYOD 2E5TA 2CGQA 2E74D 2QG4A 1M8OB 2VRSA 1VKUA 1M1JC 4HKZH 3M0DC 3CMEP 2X2BA 1S3JA 2DGYA 3G0VA 5EW5E 4WVZA 1BE3G 1URQA 2FVAA 1UNKA 2R32A 5APXA 5HGMA 1FE6A 5K5GB 5AVXB 4XFYA 2PFXA 1X9VA 1X3OA 2AEJA 3Q1MA 3T97B 3NXSA 5F2KA 1USEA 3M06A 1KN7A 1VQ4P 3G26A 3RK2C 3MGEA 3B5ND 2AFDA 4DT0A 2OTKE 3A7OA 2ZVNB 1NH4A 2N5IA 2L0QA 1OW6A 2BHVA 1FDMA 4BPGA 2N1TC 2I1JA 3F89A 1KQGB 2ZJSE 3CL3D 1E5WA 5H2FH 5GTHE 2QJKC 2D2CB 1JMMA 3CXHH 2EIAA 2DW3A 4U3FJ 2AVAA 3CX5D 2VLQA 1T6AA 3CXHD 1PPJE 4K3AA 4BPFA 4HJGH 2KOSA 2L6EA 4C7NA 5GTHH 1L0LE 3BCCJ 4BRYB 4BRYA 1DV5A 2XXMA 4I6MC 4YPCA 2Q7CA 1NWQA 1RH5B 4AUWA 1T3JA 2FXMA 3L72G 3KYQA 1W2BO 3H1HD 2GM4A 5GTIE 3U1AA 1NYHA 2PEMA 1SVFA 5KLVE 3HE4A 3CE7A 1NJIQ 1ACPA 2HR3A 4H2WC 2WSSH 2Y0CA 3BCCG 2FADA 2ERHA 4IL6H 2HPCB 2MVVA 1JMBA 4JYCA 2H8PD 4F37A 2YMKA 1JCCA 5AVZB 2KG6A 1M6EX 5HGLA 1BCCE 5AW0B 2JO1A 4MN4C 5KKZB 1SQVD 1PEMA 2O1KA 2GZFA 2M8NA 1PPJG 1JCDA 1SQQG 4PV1D 1N73C 3V5BA 4TT3H 3G1IA 2EFJA 1LTJB 2XT1A 3RL0D 4U0CA 5AW2B 1N73A 1SLQA 3CXHI 5CJ4A 1K05A 2O01H 3EQ2A 5AVVB 1KYOH 4DOJA 1G1JA 7CEIA 3KPEA 1KILD 3HD7B 2FVEA 2KZIA 1LTTC 1ZV8A 1GDTA 3L75D 2L4BA 1E6JP 3DS5A 3A0HH 3B5NB 3VOPA 1AV1A 4UB8H 1SQVG 1N7LA 5JPAA 1QL2A 1S4XA 2SPZA 2IYPA 1JY2N 1AYIA 1ZNVA 3AE6C 2KK7A 1Q7YQ 3L71D 1LTJC 3H1HE 2WMMA 1CEIA 1ZP0C 1BXIA 3O8ZA 1PFIA 1SP4A 1SQBK 2KXPB 1OVRA 5M1BA 2PP6A 2R5DA 3M0AA 4PD4I 4PD4D 1RF0C 4H44C 3CCSP 1L0LJ 4OVNF 1PGQA 1S2EA 5E79H 3B71A 1DIPA 1HJ0A 2N1TB 1K9MQ 4D6TD 1GL2A 5APTA 3TGUG 1GZLA 1HBWA 2LOLA 3LW5J 3KHUA 1NHLA 2FHSC 5APYA 3WUUA 3VRLC 2GZJA 1FR2A 2W27A 1AA0A 3L70G 3L73J 2JEEA 1FU1A 1FDOA 2KOGA 2WSCJ 1NGMB 2A45I 2RH0A 2ZXXA 2NO8A 2WSFJ 5KJ7C 3DS1A 3PRJA 1S5LX 3NY7B 2CWOA 3AE2C 5KP6B 1FZBA 3I55P 3L75E 1VDFA 2Y0EA 2QJKB 1ZW0A 3GW6A 4TLFA 1IK7A 4Y28J 2FFDB 3H4EA 3SWKA 4IFMA 2R3SA 1GPJA 2P1JA 3HE4B 3GG2A 1A02F 2JU2A 3H32B 2VLOA 4OWFA 4QKOA 1SQQD 2KG9A 3CX5I 2WT7B 3NMDA 2KNCA 2FQ2A 4XFJA 3H47A 2CK3H 5KLIC 3W68A 3AE3C 2FFDC 3LW5H 3Q20A 2XV6A 1CI6A 3CXCO 1IMPA 4N78E 2FXPA 2XKMA 2HODB 2KSEA 3WU2E 2N9YB 3E7KA 2E1MA 1MZ9A 2Q1KA 1WRGA 2PEQA 1DD4A 1SQVJ 2CNRA 3M9QA 3S1KA 3BRTB 3AEGC 1RNIA 1RQVA 2Z5IA 3M91A 3CCJP 3VMXA 3L75G 3TDKA 3EJEA 4H2YC 2OTLP 3FGAD 1VF5C 3CWBG 1X79B 3CWBD 1JTHA 1Y47A 4PJ0H 1RO0A 1SQXE 1HTLC 2R5BA 3I56P 1L4AA 5HGOA 3WMM0 5CZDB 1L0LG 2M5RA 5AVUB 2K37A 2YKOA 1EIAA 2N98A 4YTPC 3VP9A 3VTPC 2WWWA 2XNDH 4XE5B 2XZ0D 3GKLC 1QEXA 4A7PA 3GHGC 1BGYD 5B5EH 2HYNA 1YBKA 3BASA 3H1KG 4BXLA 2N5HA 4GOFA 5F2OA 3H1ID 2YNYA 3JC22 2KOOA 1EZVD 4JYBA 1AUMA 1M1KQ 1EDJA 2JB0A 5KP8B 3PTZA 3MD0A 4XFZA 3FXEA 4GR2A 2P7JA 1BAJA 2N6YA 4JF7A 1Y9BA 3G71P 2PRRA 1L2PA 3SSUA 3MGNA 3LRYA 4GR6A 1QGKB 2C0XA 2LL8A 3H1KE 1FBMA 3E1RA 1P84I 2M3EA 5B66E 1YJWP 4M0IA 3HUSB 1NTZK 1F80D 2ITAA 1GU5A 2K9JA 1HY8A 3RL0g 2JP3A 4NEOA 2ZT9D 1NTME 3S4RA 3EFGA 3JCUH 2LF4A 4H13B 4GT1A 3TGUD 4LGDE 1DEEG 1LWUC 2FYUJ 5AW7B 4H13C 2W6JH 2P9XA 3QH9A 3D6ZA 5CCGD 4IOIH 1KV4A 1VPCA 3B5NA 2JGPA 3C1LA 1A8OA 3KZIE 2JO0A 3GJNA 4GDOA 2EG5A 1UIIA 3V4WA 1H8AA 2GZGA 3SFEC 3L73G 2K0XA 1L4AD 1K30A 2FYUE 5BVZA 3H6PA 1YI2P 2J59M 3CWBE 2PEOA 1JY2O 3AE7C 5EJDA 2AEMA 4QNBA 1YIJP 2H7HA 3DPHA 2NRGA 3P8MC 3L74G 4IFDK 1KYOE 3L72E 2Z45A 2M0BA 4XFXA 3M9BA 3GZLA 2KGEA 1QVGO 4U7JA 2FBWC 1NU1J 2W6BA 2KR5A 3DS0A 1IFIA 3Q5PA 5AW8B 1JUNA 1USDA 2MY5A 2K92A 1NTKJ 1FZAA 5APQA 1LTAC 1H88A 1MZ8A 3B5NC 1HH0A 2IBZG 1BGYJ 2KW2A 2BASA 1JY3N 2Z44A 4U0AA 1L0HA 2OARA 3P05A 1URQD 5I4TG 1NTZJ 1KQFB 1K73Q 4U3FG 3USSA 2Q5UA 1EC5A 1GTWA 3RG2A 1ZN5A 3GHGB 1KORA 1Z6MA 1SQBJ 4M3LA 1N73B 4B86A 5KLVG 3TSIA 1IZNB 2QM7A 1E79H 2K3RA 1FJKA 4JPZB 4U0DA 1EMVA 2YXQB 1N7SB 1UIXA 2R3CA 2Z4EA 3DS4A 2YIUC 1SQXD 2KIKA 1HF9A 4D6TE 3CI9A 5CCHD 3D71A 1OZHA 2FXOA 1VF5B 1EOQA 3GF3A 1FZCC 1KC8Q 2HPCA 1XTGB 4Y99C 2A06G 2B9BA 2KNCB 1M7LA 2WQYC 1YYCA 1K04A 3OA7A 2IFMA 2WSEH 2QNWA 2PAJA 2QIWA 4DZOA 3ABVC 3C9IA 4COCA 3EJBA 1CZQA 3ZDMA 4D6TJ 4D6TG 1LT9A 1L0LK 3HE5A 3L36A 3CCMP 4NPEA 2QJPC 2AFEA 3AE4C 4GOEA 3FWNA 1RF1B 4U0FA 1M90Q 1NTKK 1AF8A 3O6QB 1NOHA 5KP7B 3WUTA 3L70J 2PENA 2MF4A 2FQ0A 1SFCB 1NU1K 1R8EA 5KLIB 4H44D 1JJ2O 1SQVE 1YQ4C 2OYIC 4L76A 1SQBE 1W5CE 3P32A 2KGCA 2IZ0A 2YIUB 3H1JJ 1KFNA 2JDIH 1EDLA 4I2LC 1KILE 2A45H 3H1KD 1ZR4A 3VMAA 1BGYG 1LTSC 3AE1C 1RHZB 3OJAB 2BQ1E 4O9BA 3P8CE 2RN0A 4R0MA 1IK9A 2WSEJ 4YXDC 3CCEP 1AQTA 1EDKA 1WT6A 5BU5A 4ZNCA 4NPFX 4R4MA 1PZQA 1NTKE 4C46A 1EXJA 5AW6B 1PP9D 3NTEA 4DJGA 5EFWB 3KQGA 4PJ0E 4OGQC 1PGJA 1Q82Q 1NU1E 3CXHE 2ZXEB 4EDFA 2PNGA 1NTZG 4PD4H 3PLNA 3L72J 2BCCG 4EIJA 3GMAA 3D70A 1PEQA 3L75J 5APVA 3A0BH 1OIPA 1JY3P 1R5LA 5AW3B 1GU4A 4I7ZC 2IFNA 2KS1B 1L0NG 4OH8B 1IJDB 3HRNA 4EOTA 1EDIA 3BVHA 1IFDA 1PP9J 3VMZA 3A0BE 4EI2A 3G4SP 3TNUB 3U1CA 3RK2D 1NVOA 2KODA 2V4HA 1YTZI 5AVQB 2JWDA 1HQBA 3KDPB 3V2PA 3H1JD 3N4XA 5CJ0A 1SQBG 2A45G 3S9OA 1GXHA 2E76D 2L9FA 2FYUG 4RO0A 1YJ9P 4H2XC 1LTBC 2GZIA 1GL2D 1NTMJ 3JSVC 1KB9E 1FZGA 2I8DA 4WWIA 2AEFA 1OXZA 3L72D 1CW5A 3AE9C 3P8CD 1BDCA 3CPWO 1SFCA 2KZJA 1N7SA 1GK4A 3MTUE 3L70D 1Q86Q 4QMAA 5KAIH 2FYZA 2V7QH 3CX5H 3KXDA 3EWKA 1HJBA 2E5YA 1NTKG 1SS1A 2VLNA 4EYYQ 1SFCD 4AYCA 4H44B 1GXGA 4Z1MH 3BCCD 3TK1A 1AVYA 2FVFA 1LP1A 4H0LD 3DTJA 3OW2O 2XZ1C 1M56D 1GL2C 3V2NA 2JBGA 1ZRTE 3Q5SA 2AXTE 4GIFA 2FQ1A 3E2DA 3GLMA 1YITP 4W7ZA 1BE3E 2K9YA 2LMLA 3BRVB 3SWYA 3M1MA 1OVVA 1VL2A 2KGAA 4COPA 2XNXA 1LGHB 3V2QA 2HLOA 1PL5A 3RBZA 5CBNA 1TU3F 5AVYB 2WPQA 1H0TA 1BE3J 2FYNB 2WITA 3NTNA 1P84D 1OMIA 1YHQP 1AVOA 1BSNA 3HD7C 5TISE 4IL6X 2K94A 2N1TD 1N7SD 3V2RA 3H1LG 5KLVK 3LIDA 2MR8A 1KZUB 1QLED 2IYOA 2IPPA 2YO2A 1T8ZA 2LXBA 5HV8A 2YKPA 3GHGA 2KORA 2H89C 3GF7A 2PEKA 1NO4A 2A06E 3GZMA 4JQ0D 4AQRD 5HGNA 5KLVJ 3SFDC 2WTYA 1A02J 1VQ8P 1GD2E 5KKZC 3H1LJ 1KQLA 2OYHB 1MUUA 2K93A 1VQPP 3II6A 4PXHB 3H1HG 5CCGC 1NTMK 4L74A 5APWA 2P2UA 1YTZT 3CCRP 2WSFH 2Y0DA 2YMYA 1KD1Q 1SQBD 2LPKA 4UHPB 1EXIA 2BEQD 2KB7P 4I7ZB 4L73A 3CCVP 2XV5A 3B8EB 3TYYA 5DJUB 3RK2B 4U3FE 2D2CD 2QVAA 3FXDA 2WPRA 3L35A 1NAFA 1HUCA 3AEEC 3VP8A 1RE3A 1NU1G 3CLQA 2G3AA 3JCUE 1PP9E 1M57D 5AVSB 4ASVA 2FYUK 2JJLA 1RE3C 2MVUA 1RQUA 3LIEA 4IZ6A 1T8KA 3MUDA 1X22A 2WPVB 2PY8A 4XRQA 1P84E 1FOSF 2KI7B 2ZYDA 2M8RA 4KJMA 1M1JB 5DCKA 2KLUA 4KT0J 3L4FA 2QM8A 4WY4A 1KILC 2JKVA 4ASWA 4I1LA 2KSJA 2FACA 2L22A 3HYBA 1Q2NA 1AFOA 2GDXA 1X8YA 2K2QA 1P84H 1KILB 1NTMD 2HG5D 1FC2C 2AXTH 4H13D 4WYMA 3L73E 1VQLP 4DCKA 1JTHB 2ZYAA 1PGPA 3G6EP 2JQ4A 2QRXA 3B5IA 1ZMEC 4OGQD
chains in the Genus database with same CATH topology
1PEUA 3DS2A 4PH1A 1RO2A 2M8PA 3DS3A 1A8OA 1Q81Q 2JO0A 5BS1A 1W2BO 3DS4A 1VQ9P 1S72P 2EG5A 5F2OA 3NTEA 1PEOA 3DTJA 3OW2O 1VQ5P 1VQKP 2PEMA 3H47A 2PEIA 3CCRP 3G1GA 1Q82Q 1IUQA 1K30A 1EOQA 2OTJP 3CMEP 1KC8Q 1KD1Q 2DGYA 1AUMA 4U0EA 1YI2P 3G0VA 3Q20A 1NJIQ 2XV6A 1M1KQ 3CC7P 3CXCO 2PEOA 2JYGA 1PEQA 4QNBA 1YIJP 3CCVP 3DPHA 3E2DA 1YITP 4XROA 2E1MA 4XFZA 5HGMA 4PH0A 4GR2A 3HZQA 1VQNP 2Z46A 1QRJA 2Z45A 3CCSP 4XFXA 1BAJA 3CCUP 1QVGO 3M1MA 4XFYA 3G71P 2PEQA 1M6EX 5HGLA 3CD6P 3DS0A 4COCA 1VQOP 4COPA 1K9MQ 5F2KA 2M8LA 1VQ6P 1M74A 3CCLP 1PEMA 3LRYA 4GR6A 2M8NA 1A43A 1QVFO 1VQ4P 3CCMP 1RNIA 3CCJP 1ZMBA 3G4SP 3G26A 4U0FA 3MGEA 1M90Q 2JYLA 3G1IA 2KODA 3G28A 2EFJA 1YHQP 1N8RQ 2XT1A 2PY8A 3VRLC 4U0CA 1YJWP 4XRQA 1M6NA 2BHVA 3CMAP 2OTLP 4M0IA 1YJNP 2PENA 2Z44A 4U0AA 2OARA 3P05A 5DCKA 1JJ2O 1KQSO 5I4TG 1YJ9P 4IPYA 2QEXP 2QA4P 3CC4P 1K73Q 3DS1A 2EIAA 1RO0A 2P9XA 3RG6C 2PEJA 3G29A 1E6JP 2CWOA 3DS5A 3HYBA 3I56P 4U0BA 3CCQP 1VQ7P 2PEKA 3I55P 5BS2A 5HGOA 2LF4A 1D1DA 1VQMP 2ONTA 5F2NA 3CPWO 1K8AQ 5JPAA 5HGNA 2BQ1E 3H4EA 4WYMA 3G21A 2BUOA 1VQLP 1VQ8P 2L6EA 1Q86Q 1EIAA 3WBHA 3H0DA 3G6EP 3CC2P 3CCEP 1VQPP 3B5IA 2XXMA 4U0DA 1Q7YQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV P;  3G4S P;  1M90 Q;  3I56 P;  3CCQ P;  1YIT P;  1VQ7 P;  1Q81 Q;  1W2B O;  1YHQ P;  3I55 P;  1N8R Q;  1VQN P;  1VQ9 P;  3CCS P;  1S72 P;  1VQM P;  1YJW P;  3CCU P;  1QVG O;  3CMA P;  1K8A Q;  3CPW O;  3G71 P;  3OW2 O;  1VQ5 P;  1YJN P;  1VQK P;  2OTL P;  3CCR P;  3CD6 P;  1Q82 Q;  1VQO P;  1VQL P;  1K9M Q;  2OTJ P;  1VQ8 P;  3CME P;  1KC8 Q;  1Q86 Q;  1JJ2 O;  1KD1 Q;  1YI2 P;  1M1K Q;  1NJI Q;  3G6E P;  1KQS O;  3CC7 P;  1YJ9 P;  3CCL P;  1VQ6 P;  3CXC O;  2QEX P;  2QA4 P;  3CC4 P;  1QVF O;  1VQ4 P;  3CCM P;  1K73 Q;  3CCE P;  1VQP P;  1Q7Y Q;  3CC2 P;  3CCJ P;  1YIJ P; 
#chains in the Genus database with same CATH topology
 2Q3I A;  3L71 G;  2GUS A;  2HFE D;  1Q81 Q;  5CCG A;  1VQ9 P;  1OR5 A;  3G3Z A;  2N50 A;  2V7Q J;  3P7K A;  1J1D C;  3M0D A;  4N3Y B;  3H1J E;  2ZFC A;  2GDW A;  3G9R A;  1L0N K;  2NPS B;  3L70 E;  2IBZ I;  5B5E E;  3RK3 D;  1LWU A;  1T2K C;  2GUV A;  3V6I A;  5KJ7 A;  2C9N Y;  2E43 A;  4WY4 B;  1RE4 C;  3H1L E;  2BCC D;  3UIA A;  1L0N J;  2B89 A;  5TIS H;  3EFF K;  1GMJ A;  5AW1 B;  3O6Q A;  1L0N D;  1KFM A;  1JNM A;  2RMZ A;  2MKV A;  1EZV E;  1OW7 A;  2K5X A;  2FYN C;  3H1H J;  1IO4 A;  1DNY A;  1T3U A;  1QX8 A;  2C0W A;  3CX5 E;  4R4L A;  3G28 A;  5APS A;  4UB6 H;  1S5L E;  1YJN P;  1J1E C;  2K0Y A;  1EQ7 A;  3HTK A;  2E76 B;  1MFT A;  1CI6 B;  2KGD A;  2QA4 P;  1UJZ A;  3RG6 C;  2PEJ A;  3G29 A;  3AEA C;  4PD4 E;  1JY2 P;  3AEB C;  2K0D X;  1Q90 D;  2Y9Z A;  1ZOY C;  2EHS A;  3F5H A;  1S1C X;  3G21 A;  3BAT A;  1H0T B;  1XTC C;  3WBH A;  1MKM A;  2IBZ E;  3RGU A;  5CBO A;  3CC2 P;  2E75 C;  2IX7 C;  5CCH C;  2E75 B;  3T97 A;  4PH1 A;  1NKN A;  2M3B A;  1E0H A;  5C39 A;  1MV8 A;  1YQ3 C;  2CPB A;  1NQ4 A;  4NPD A;  2UWJ E;  1PEO A;  4LLH A;  2XU6 A;  1FZF A;  3G1G A;  2WPT A;  3QWO C;  1NTZ E;  2FY8 A;  1EZV I;  1FS0 E;  3L74 E;  2KOQ A;  1SQX G;  3HTK B;  2ZYG A;  3D6Y A;  1VQN P;  2I1K A;  1AQ5 A;  1LP1 B;  1SQQ E;  5KJ7 D;  4BWN A;  5AVW B;  3R4Y A;  2M8L A;  1N86 A;  5DJT B;  1PP9 G;  1FZE A;  1KB9 D;  3MZW B;  2P67 A;  1A43 A;  1QVF O;  3HD7 D;  3WU2 H;  3PH0 A;  2LR2 A;  3WUV A;  4N78 D;  1JM0 A;  4ZMD A;  3BCC E;  3N7N A;  3L71 J;  3HD7 A;  4RKU J;  2GDY A;  2WSC H;  3CMA P;  4PWV B;  1LJ2 A;  1S9K E;  2MJZ A;  4HB1 A;  3V4Q A;  3AEC C;  1L4A C;  2B87 B;  1G2C A;  4DG9 A;  1L4A B;  4IPY A;  2QEX P;  5AW9 B;  2Y9Y A;  1LTG C;  2LIU A;  2KG8 A;  1N2D C;  2O3J A;  2NPS C;  1D1D A;  2ROQ A;  2R44 A;  1H89 A;  1DD3 A;  3NFQ A;  2GA1 A;  1NAY A;  5KLV D;  3C8V A;  3HUS C;  2W83 C;  1BSH A;  2JR8 A;  2K1A A;  1FDI A;  1PEU A;  3DS2 A;  3DS3 A;  2WZ7 A;  1RF1 A;  5BS1 A;  1SQP K;  3ITK A;  1JB0 J;  2OYI A;  1VQ5 P;  4BPH A;  1QL1 A;  1URQ B;  2OTJ P;  3L37 A;  2N1T A;  2NZ2 A;  4N6J A;  2OQQ A;  3CC7 P;  3L73 D;  1L0L D;  2NPS D;  2JYG A;  2HOD A;  3A3Y B;  4XRO A;  2JWA A;  1AJY A;  2IDB A;  1PGO A;  5APU A;  1SFC C;  4WBA A;  5E79 E;  3CD6 P;  3AE5 C;  3PJS K;  1VHN A;  4L75 A;  4W80 A;  1VQ6 P;  4GOD A;  4OGQ B;  2KP8 A;  4K35 A;  1SQP J;  1ZMB A;  3VYI A;  5KAI E;  2FAE A;  1SQP D;  2QJP B;  2OYO A;  3U43 A;  3MIW A;  2LTE A;  3TGU E;  4WY4 D;  4HYT B;  3MHV A;  2W90 A;  1Z56 A;  2M5A A;  1LT9 C;  3RL0 C;  1LTI C;  5BU8 B;  3RK3 B;  2W6A A;  1JEK A;  2KS1 A;  3SWF A;  1LT1 A;  3RK3 E;  2BEZ F;  1PIX A;  1OX3 A;  1Y8A A;  1ZXG A;  4U3F D;  5KAF E;  2L5G B;  1VQM P;  2ONT A;  2FYU D;  1OWA A;  3PP5 A;  1M1J A;  4IL6 E;  1IFM A;  3H0D A;  3OAK A;  1ZLL A;  1KIL A;  1W2E A;  1U7J A;  2O01 J;  2YXR B;  2N9B A;  1RO2 A;  3VN0 A;  2OYH C;  1BE3 D;  2CQ8 A;  2YO3 A;  2E74 B;  2PEI A;  3RL0 B;  5AW5 B;  1S9K D;  1ZRT D;  1RF0 A;  1VF5 D;  1DH3 A;  3R2P A;  1DEB A;  1ZR2 A;  3A0H E;  1J1D B;  2QJY B;  2E74 C;  1HGZ A;  2IBZ D;  4UB8 E;  1KYO I;  2M5A B;  1FOS E;  1IFJ A;  4PH0 A;  3HE5 B;  5AW4 B;  4Y99 B;  2BCC J;  1FZC B;  2C9L Y;  1IFP A;  1M74 A;  3Q5R A;  2YKQ A;  2Z5H A;  4PV1 C;  2LKI A;  3B4S A;  2FFD A;  2AF8 A;  2E42 A;  2JAZ A;  2QE7 H;  3MP7 B;  2W8Z A;  2LIW A;  1N7S C;  2A06 D;  1SQP E;  1M6N A;  4XA4 A;  3H1I J;  3RK3 C;  1URQ C;  5GTI H;  1FJP A;  1G1I A;  1LT9 B;  1KQS O;  1RY3 A;  2QSI A;  5HVC A;  1BGY E;  5CMZ A;  1JOC A;  4U0B A;  4YXW H;  4CPG A;  2LXC B;  5F2N A;  2N6Z A;  5TJH A;  2VLP A;  4JBZ A;  2K9J B;  2IZ1 A;  3Q2Y A;  3LMO A;  3U59 A;  2WT7 A;  5CHX A;  4WB4 A;  2MD9 A;  4H0L C;  3H1I G;  4CA3 A;  4ZKU A;  4RES B;  1FZC A;  1IC2 A;  2Q3E A;  1S72 P;  3E1I A;  1HWT C;  3CWB J;  1LWU B;  1VQK P;  2O1J A;  2RKL A;  1OW8 A;  1IUQ A;  3M9H A;  4U0E A;  1SQV K;  2ZT9 C;  4C7R A;  3PHL A;  1T2K D;  3HZQ A;  1NKZ B;  1QRJ A;  2H88 C;  4LC1 A;  2KLV A;  3TNU A;  3RBX A;  5B66 H;  3FX0 A;  1VQO P;  3H1J G;  3AE8 C;  1OFC X;  2Q9I A;  1LNQ A;  2AXC A;  1J2J B;  3H25 A;  2OYH A;  2MR7 A;  2L91 A;  3L71 E;  2KWL A;  2J58 A;  2JYL A;  2ZAE B;  3IFM A;  1LTJ A;  2P10 A;  4C7N B;  1N8R Q;  2ZT9 B;  1HVV A;  1U7M A;  1GW4 A;  1GW3 A;  3I5C A;  1SQQ J;  4W7Y A;  2Q6Q A;  3IAO A;  2KYV A;  3IN6 A;  1VQ7 P;  2PGD A;  3B4Q A;  3A2A A;  5BS2 A;  3H1K J;  1NTZ D;  3KZI H;  2EHT A;  3L74 J;  4H0L B;  3Q3D A;  4MRT C;  2POH A;  3H1I E;  1BCC D;  1R5S A;  3A5T A;  2B88 A;  5H2F E;  2CG5 B;  1OVU A;  2E75 D;  2M8P A;  4IFF A;  2G8Y A;  1KTM A;  2BCC E;  2E76 C;  1BCC G;  4UB6 E;  1S5L H;  5KTB A;  1GL2 B;  1GK6 A;  2ZVO B;  5L8R J;  1KLP A;  1KB9 I;  1X0T A;  3EJD A;  1SQP G;  1PV3 A;  1BDD A;  3AED C;  4PV1 B;  2Z46 A;  4GKG A;  2OYI B;  3IF4 A;  1NTK D;  3CCU P;  1PPJ D;  2OGU A;  2XZR A;  2K88 A;  3TF5 A;  3VMY A;  5KAF H;  3H1L D;  1WMK A;  2KUB A;  3CCL P;  5AVT B;  1NU1 D;  4WY4 C;  1BCC J;  1D7M A;  4ZKP A;  3HUS A;  1RF1 C;  3K5B A;  1IFN A;  1SQX K;  1SQX J;  2LKM A;  3W67 A;  5CCH A;  1DX7 A;  2QJY C;  2WPS A;  2FKW B;  3MUD C;  1L0I A;  2CPS A;  1SQQ K;  3IR9 A;  1CSB A;  2GZE A;  2JU1 A;  1KMI Z;  2XDJ A;  1L0N E;  4KHX A;  2GYK A;  3CC4 P;  1J1E B;  1KB9 H;  2NPS A;  2O01 N;  1NTM G;  3FWL A;  2B87 A;  1G2C B;  3CCQ P;  4HKG A;  1HGV A;  3H32 A;  1FAV A;  2D2C C;  1U57 A;  3AEF C;  1MFZ A;  1K8A Q;  1EZV G;  1IMQ A;  1JY3 O;  2VSQ A;  2BUO A;  2J5U A;  3TGU J;  2WVR A;  2P58 A;  3L74 D;  4RJT A;  1RE4 A;  2KOP A;  2DNW A;  4HH2 A;  1JO5 A;  2H43 A;  5AVR B;  1KYO D;  2E5T A;  2CGQ A;  2E74 D;  2QG4 A;  1M8O B;  2VRS A;  1VKU A;  1M1J C;  4HKZ H;  3M0D C;  3CME P;  2X2B A;  1S3J A;  2DGY A;  3G0V A;  5EW5 E;  4WVZ A;  1BE3 G;  1URQ A;  2FVA A;  1UNK A;  2R32 A;  5APX A;  5HGM A;  1FE6 A;  5K5G B;  5AVX B;  4XFY A;  2PFX A;  1X9V A;  1X3O A;  2AEJ A;  3Q1M A;  3T97 B;  3NXS A;  5F2K A;  1USE A;  3M06 A;  1KN7 A;  1VQ4 P;  3G26 A;  3RK2 C;  3MGE A;  3B5N D;  2AFD A;  4DT0 A;  2OTK E;  3A7O A;  2ZVN B;  1NH4 A;  2N5I A;  2L0Q A;  1OW6 A;  2BHV A;  1FDM A;  4BPG A;  2N1T C;  2I1J A;  3F89 A;  1KQG B;  2ZJS E;  3CL3 D;  1E5W A;  5H2F H;  5GTH E;  2QJK C;  2D2C B;  1JMM A;  3CXH H;  2EIA A;  2DW3 A;  4U3F J;  2AVA A;  3CX5 D;  2VLQ A;  1T6A A;  3CXH D;  1PPJ E;  4K3A A;  4BPF A;  4HJG H;  2KOS A;  2L6E A;  4C7N A;  5GTH H;  1L0L E;  3BCC J;  4BRY B;  4BRY A;  1DV5 A;  2XXM A;  4I6M C;  4YPC A;  2Q7C A;  1NWQ A;  1RH5 B;  4AUW A;  1T3J A;  2FXM A;  3L72 G;  3KYQ A;  1W2B O;  3H1H D;  2GM4 A;  5GTI E;  3U1A A;  1NYH A;  2PEM A;  1SVF A;  5KLV E;  3HE4 A;  3CE7 A;  1NJI Q;  1ACP A;  2HR3 A;  4H2W C;  2WSS H;  2Y0C A;  3BCC G;  2FAD A;  2ERH A;  4IL6 H;  2HPC B;  2MVV A;  1JMB A;  4JYC A;  2H8P D;  4F37 A;  2YMK A;  1JCC A;  5AVZ B;  2KG6 A;  1M6E X;  5HGL A;  1BCC E;  5AW0 B;  2JO1 A;  4MN4 C;  5KKZ B;  1SQV D;  1PEM A;  2O1K A;  2GZF A;  2M8N A;  1PPJ G;  1JCD A;  1SQQ G;  4PV1 D;  1N73 C;  3V5B A;  4TT3 H;  3G1I A;  2EFJ A;  1LTJ B;  2XT1 A;  3RL0 D;  4U0C A;  5AW2 B;  1N73 A;  1SLQ A;  3CXH I;  5CJ4 A;  1K05 A;  2O01 H;  3EQ2 A;  5AVV B;  1KYO H;  4DOJ A;  1G1J A;  7CEI A;  3KPE A;  1KIL D;  3HD7 B;  2FVE A;  2KZI A;  1LTT C;  1ZV8 A;  1GDT A;  3L75 D;  2L4B A;  1E6J P;  3DS5 A;  3A0H H;  3B5N B;  3VOP A;  1AV1 A;  4UB8 H;  1SQV G;  1N7L A;  5JPA A;  1QL2 A;  1S4X A;  2SPZ A;  2IYP A;  1JY2 N;  1AYI A;  1ZNV A;  3AE6 C;  2KK7 A;  1Q7Y Q;  3L71 D;  1LTJ C;  3H1H E;  2WMM A;  1CEI A;  1ZP0 C;  1BXI A;  3O8Z A;  1PFI A;  1SP4 A;  1SQB K;  2KXP B;  1OVR A;  5M1B A;  2PP6 A;  2R5D A;  3M0A A;  4PD4 I;  4PD4 D;  1RF0 C;  4H44 C;  3CCS P;  1L0L J;  4OVN F;  1PGQ A;  1S2E A;  5E79 H;  3B71 A;  1DIP A;  1HJ0 A;  2N1T B;  1K9M Q;  4D6T D;  1GL2 A;  5APT A;  3TGU G;  1GZL A;  1HBW A;  2LOL A;  3LW5 J;  3KHU A;  1NHL A;  2FHS C;  5APY A;  3WUU A;  3VRL C;  2GZJ A;  1FR2 A;  2W27 A;  1AA0 A;  3L70 G;  3L73 J;  2JEE A;  1FU1 A;  1FDO A;  2KOG A;  2WSC J;  1NGM B;  2A45 I;  2RH0 A;  2ZXX A;  2NO8 A;  2WSF J;  5KJ7 C;  3DS1 A;  3PRJ A;  1S5L X;  3NY7 B;  2CWO A;  3AE2 C;  5KP6 B;  1FZB A;  3I55 P;  3L75 E;  1VDF A;  2Y0E A;  2QJK B;  1ZW0 A;  3GW6 A;  4TLF A;  1IK7 A;  4Y28 J;  2FFD B;  3H4E A;  3SWK A;  4IFM A;  2R3S A;  1GPJ A;  2P1J A;  3HE4 B;  3GG2 A;  1A02 F;  2JU2 A;  3H32 B;  2VLO A;  4OWF A;  4QKO A;  1SQQ D;  2KG9 A;  3CX5 I;  2WT7 B;  3NMD A;  2KNC A;  2FQ2 A;  4XFJ A;  3H47 A;  2CK3 H;  5KLI C;  3W68 A;  3AE3 C;  2FFD C;  3LW5 H;  3Q20 A;  2XV6 A;  1CI6 A;  3CXC O;  1IMP A;  4N78 E;  2FXP A;  2XKM A;  2HOD B;  2KSE A;  3WU2 E;  2N9Y B;  3E7K A;  2E1M A;  1MZ9 A;  2Q1K A;  1WRG A;  2PEQ A;  1DD4 A;  1SQV J;  2CNR A;  3M9Q A;  3S1K A;  3BRT B;  3AEG C;  1RNI A;  1RQV A;  2Z5I A;  3M91 A;  3CCJ P;  3VMX A;  3L75 G;  3TDK A;  3EJE A;  4H2Y C;  2OTL P;  3FGA D;  1VF5 C;  3CWB G;  1X79 B;  3CWB D;  1JTH A;  1Y47 A;  4PJ0 H;  1RO0 A;  1SQX E;  1HTL C;  2R5B A;  3I56 P;  1L4A A;  5HGO A;  3WMM 0;  5CZD B;  1L0L G;  2M5R A;  5AVU B;  2K37 A;  2YKO A;  1EIA A;  2N98 A;  4YTP C;  3VP9 A;  3VTP C;  2WWW A;  2XND H;  4XE5 B;  2XZ0 D;  3GKL C;  1QEX A;  4A7P A;  3GHG C;  1BGY D;  5B5E H;  2HYN A;  1YBK A;  3BAS A;  3H1K G;  4BXL A;  2N5H A;  4GOF A;  5F2O A;  3H1I D;  2YNY A;  3JC2 2;  2KOO A;  1EZV D;  4JYB A;  1AUM A;  1M1K Q;  1EDJ A;  2JB0 A;  5KP8 B;  3PTZ A;  3MD0 A;  4XFZ A;  3FXE A;  4GR2 A;  2P7J A;  1BAJ A;  2N6Y A;  4JF7 A;  1Y9B A;  3G71 P;  2PRR A;  1L2P A;  3SSU A;  3MGN A;  3LRY A;  4GR6 A;  1QGK B;  2C0X A;  2LL8 A;  3H1K E;  1FBM A;  3E1R A;  1P84 I;  2M3E A;  5B66 E;  1YJW P;  4M0I A;  3HUS B;  1NTZ K;  1F80 D;  2ITA A;  1GU5 A;  2K9J A;  1HY8 A;  3RL0 g;  2JP3 A;  4NEO A;  2ZT9 D;  1NTM E;  3S4R A;  3EFG A;  3JCU H;  2LF4 A;  4H13 B;  4GT1 A;  3TGU D;  4LGD E;  1DEE G;  1LWU C;  2FYU J;  5AW7 B;  4H13 C;  2W6J H;  2P9X A;  3QH9 A;  3D6Z A;  5CCG D;  4IOI H;  1KV4 A;  1VPC A;  3B5N A;  2JGP A;  3C1L A;  1A8O A;  3KZI E;  2JO0 A;  3GJN A;  4GDO A;  2EG5 A;  1UII A;  3V4W A;  1H8A A;  2GZG A;  3SFE C;  3L73 G;  2K0X A;  1L4A D;  1K30 A;  2FYU E;  5BVZ A;  3H6P A;  1YI2 P;  2J59 M;  3CWB E;  2PEO A;  1JY2 O;  3AE7 C;  5EJD A;  2AEM A;  4QNB A;  1YIJ P;  2H7H A;  3DPH A;  2NRG A;  3P8M C;  3L74 G;  4IFD K;  1KYO E;  3L72 E;  2Z45 A;  2M0B A;  4XFX A;  3M9B A;  3GZL A;  2KGE A;  1QVG O;  4U7J A;  2FBW C;  1NU1 J;  2W6B A;  2KR5 A;  3DS0 A;  1IFI A;  3Q5P A;  5AW8 B;  1JUN A;  1USD A;  2MY5 A;  2K92 A;  1NTK J;  1FZA A;  5APQ A;  1LTA C;  1H88 A;  1MZ8 A;  3B5N C;  1HH0 A;  2IBZ G;  1BGY J;  2KW2 A;  2BAS A;  1JY3 N;  2Z44 A;  4U0A A;  1L0H A;  2OAR A;  3P05 A;  1URQ D;  5I4T G;  1NTZ J;  1KQF B;  1K73 Q;  4U3F G;  3USS A;  2Q5U A;  1EC5 A;  1GTW A;  3RG2 A;  1ZN5 A;  3GHG B;  1KOR A;  1Z6M A;  1SQB J;  4M3L A;  1N73 B;  4B86 A;  5KLV G;  3TSI A;  1IZN B;  2QM7 A;  1E79 H;  2K3R A;  1FJK A;  4JPZ B;  4U0D A;  1EMV A;  2YXQ B;  1N7S B;  1UIX A;  2R3C A;  2Z4E A;  3DS4 A;  2YIU C;  1SQX D;  2KIK A;  1HF9 A;  4D6T E;  3CI9 A;  5CCH D;  3D71 A;  1OZH A;  2FXO A;  1VF5 B;  1EOQ A;  3GF3 A;  1FZC C;  1KC8 Q;  2HPC A;  1XTG B;  4Y99 C;  2A06 G;  2B9B A;  2KNC B;  1M7L A;  2WQY C;  1YYC A;  1K04 A;  3OA7 A;  2IFM A;  2WSE H;  2QNW A;  2PAJ A;  2QIW A;  4DZO A;  3ABV C;  3C9I A;  4COC A;  3EJB A;  1CZQ A;  3ZDM A;  4D6T J;  4D6T G;  1LT9 A;  1L0L K;  3HE5 A;  3L36 A;  3CCM P;  4NPE A;  2QJP C;  2AFE A;  3AE4 C;  4GOE A;  3FWN A;  1RF1 B;  4U0F A;  1M90 Q;  1NTK K;  1AF8 A;  3O6Q B;  1NOH A;  5KP7 B;  3WUT A;  3L70 J;  2PEN A;  2MF4 A;  2FQ0 A;  1SFC B;  1NU1 K;  1R8E A;  5KLI B;  4H44 D;  1JJ2 O;  1SQV E;  1YQ4 C;  2OYI C;  4L76 A;  1SQB E;  1W5C E;  3P32 A;  2KGC A;  2IZ0 A;  2YIU B;  3H1J J;  1KFN A;  2JDI H;  1EDL A;  4I2L C;  1KIL E;  2A45 H;  3H1K D;  1ZR4 A;  3VMA A;  1BGY G;  1LTS C;  3AE1 C;  1RHZ B;  3OJA B;  2BQ1 E;  4O9B A;  3P8C E;  2RN0 A;  4R0M A;  1IK9 A;  2WSE J;  4YXD C;  3CCE P;  1AQT A;  1EDK A;  1WT6 A;  5BU5 A;  4ZNC A;  4NPF X;  4R4M A;  1PZQ A;  1NTK E;  4C46 A;  1EXJ A;  5AW6 B;  1PP9 D;  3NTE A;  4DJG A;  5EFW B;  3KQG A;  4PJ0 E;  4OGQ C;  1PGJ A;  1Q82 Q;  1NU1 E;  3CXH E;  2ZXE B;  4EDF A;  2PNG A;  1NTZ G;  4PD4 H;  3PLN A;  3L72 J;  2BCC G;  4EIJ A;  3GMA A;  3D70 A;  1PEQ A;  3L75 J;  5APV A;  3A0B H;  1OIP A;  1JY3 P;  1R5L A;  5AW3 B;  1GU4 A;  4I7Z C;  2IFN A;  2KS1 B;  1L0N G;  4OH8 B;  1IJD B;  3HRN A;  4EOT A;  1EDI A;  3BVH A;  1IFD A;  1PP9 J;  3VMZ A;  3A0B E;  4EI2 A;  3G4S P;  3TNU B;  3U1C A;  3RK2 D;  1NVO A;  2KOD A;  2V4H A;  1YTZ I;  5AVQ B;  2JWD A;  1HQB A;  3KDP B;  3V2P A;  3H1J D;  3N4X A;  5CJ0 A;  1SQB G;  2A45 G;  3S9O A;  1GXH A;  2E76 D;  2L9F A;  2FYU G;  4RO0 A;  1YJ9 P;  4H2X C;  1LTB C;  2GZI A;  1GL2 D;  1NTM J;  3JSV C;  1KB9 E;  1FZG A;  2I8D A;  4WWI A;  2AEF A;  1OXZ A;  3L72 D;  1CW5 A;  3AE9 C;  3P8C D;  1BDC A;  3CPW O;  1SFC A;  2KZJ A;  1N7S A;  1GK4 A;  3MTU E;  3L70 D;  1Q86 Q;  4QMA A;  5KAI H;  2FYZ A;  2V7Q H;  3CX5 H;  3KXD A;  3EWK A;  1HJB A;  2E5Y A;  1NTK G;  1SS1 A;  2VLN A;  4EYY Q;  1SFC D;  4AYC A;  4H44 B;  1GXG A;  4Z1M H;  3BCC D;  3TK1 A;  1AVY A;  2FVF A;  1LP1 A;  4H0L D;  3DTJ A;  3OW2 O;  2XZ1 C;  1M56 D;  1GL2 C;  3V2N A;  2JBG A;  1ZRT E;  3Q5S A;  2AXT E;  4GIF A;  2FQ1 A;  3E2D A;  3GLM A;  1YIT P;  4W7Z A;  1BE3 E;  2K9Y A;  2LML A;  3BRV B;  3SWY A;  3M1M A;  1OVV A;  1VL2 A;  2KGA A;  4COP A;  2XNX A;  1LGH B;  3V2Q A;  2HLO A;  1PL5 A;  3RBZ A;  5CBN A;  1TU3 F;  5AVY B;  2WPQ A;  1H0T A;  1BE3 J;  2FYN B;  2WIT A;  3NTN A;  1P84 D;  1OMI A;  1YHQ P;  1AVO A;  1BSN A;  3HD7 C;  5TIS E;  4IL6 X;  2K94 A;  2N1T D;  1N7S D;  3V2R A;  3H1L G;  5KLV K;  3LID A;  2MR8 A;  1KZU B;  1QLE D;  2IYO A;  2IPP A;  2YO2 A;  1T8Z A;  2LXB A;  5HV8 A;  2YKP A;  3GHG A;  2KOR A;  2H89 C;  3GF7 A;  2PEK A;  1NO4 A;  2A06 E;  3GZM A;  4JQ0 D;  4AQR D;  5HGN A;  5KLV J;  3SFD C;  2WTY A;  1A02 J;  1VQ8 P;  1GD2 E;  5KKZ C;  3H1L J;  1KQL A;  2OYH B;  1MUU A;  2K93 A;  1VQP P;  3II6 A;  4PXH B;  3H1H G;  5CCG C;  1NTM K;  4L74 A;  5APW A;  2P2U A;  1YTZ T;  3CCR P;  2WSF H;  2Y0D A;  2YMY A;  1KD1 Q;  1SQB D;  2LPK A;  4UHP B;  1EXI A;  2BEQ D;  2KB7 P;  4I7Z B;  4L73 A;  3CCV P;  2XV5 A;  3B8E B;  3TYY A;  5DJU B;  3RK2 B;  4U3F E;  2D2C D;  2QVA A;  3FXD A;  2WPR A;  3L35 A;  1NAF A;  1HUC A;  3AEE C;  3VP8 A;  1RE3 A;  1NU1 G;  3CLQ A;  2G3A A;  3JCU E;  1PP9 E;  1M57 D;  5AVS B;  4ASV A;  2FYU K;  2JJL A;  1RE3 C;  2MVU A;  1RQU A;  3LIE A;  4IZ6 A;  1T8K A;  3MUD A;  1X22 A;  2WPV B;  2PY8 A;  4XRQ A;  1P84 E;  1FOS F;  2KI7 B;  2ZYD A;  2M8R A;  4KJM A;  1M1J B;  5DCK A;  2KLU A;  4KT0 J;  3L4F A;  2QM8 A;  4WY4 A;  1KIL C;  2JKV A;  4ASW A;  4I1L A;  2KSJ A;  2FAC A;  2L22 A;  3HYB A;  1Q2N A;  1AFO A;  2GDX A;  1X8Y A;  2K2Q A;  1P84 H;  1KIL B;  1NTM D;  2HG5 D;  1FC2 C;  2AXT H;  4H13 D;  4WYM A;  3L73 E;  1VQL P;  4DCK A;  1JTH B;  2ZYA A;  1PGP A;  3G6E P;  2JQ4 A;  2QRX A;  3B5I A;  1ZME C;  4OGQ D; 
#chains in the Genus database with same CATH homology
 1PEU A;  3DS2 A;  4PH1 A;  1RO2 A;  2M8P A;  3DS3 A;  1A8O A;  1Q81 Q;  2JO0 A;  5BS1 A;  1W2B O;  3DS4 A;  1VQ9 P;  1S72 P;  2EG5 A;  5F2O A;  3NTE A;  1PEO A;  3DTJ A;  3OW2 O;  1VQ5 P;  1VQK P;  2PEM A;  3H47 A;  2PEI A;  3CCR P;  3G1G A;  1Q82 Q;  1IUQ A;  1K30 A;  1EOQ A;  2OTJ P;  3CME P;  1KC8 Q;  1KD1 Q;  2DGY A;  1AUM A;  4U0E A;  1YI2 P;  3G0V A;  3Q20 A;  1NJI Q;  2XV6 A;  1M1K Q;  3CC7 P;  3CXC O;  2PEO A;  2JYG A;  1PEQ A;  4QNB A;  1YIJ P;  3CCV P;  3DPH A;  3E2D A;  1YIT P;  4XRO A;  2E1M A;  4XFZ A;  5HGM A;  4PH0 A;  4GR2 A;  3HZQ A;  1VQN P;  2Z46 A;  1QRJ A;  2Z45 A;  3CCS P;  4XFX A;  1BAJ A;  3CCU P;  1QVG O;  3M1M A;  4XFY A;  3G71 P;  2PEQ A;  1M6E X;  5HGL A;  3CD6 P;  3DS0 A;  4COC A;  1VQO P;  4COP A;  1K9M Q;  5F2K A;  2M8L A;  1VQ6 P;  1M74 A;  3CCL P;  1PEM A;  3LRY A;  4GR6 A;  2M8N A;  1A43 A;  1QVF O;  1VQ4 P;  3CCM P;  1RNI A;  3CCJ P;  1ZMB A;  3G4S P;  3G26 A;  4U0F A;  3MGE A;  1M90 Q;  2JYL A;  3G1I A;  2KOD A;  3G28 A;  2EFJ A;  1YHQ P;  1N8R Q;  2XT1 A;  2PY8 A;  3VRL C;  4U0C A;  1YJW P;  4XRQ A;  1M6N A;  2BHV A;  3CMA P;  2OTL P;  4M0I A;  1YJN P;  2PEN A;  2Z44 A;  4U0A A;  2OAR A;  3P05 A;  5DCK A;  1JJ2 O;  1KQS O;  5I4T G;  1YJ9 P;  4IPY A;  2QEX P;  2QA4 P;  3CC4 P;  1K73 Q;  3DS1 A;  2EIA A;  1RO0 A;  2P9X A;  3RG6 C;  2PEJ A;  3G29 A;  1E6J P;  2CWO A;  3DS5 A;  3HYB A;  3I56 P;  4U0B A;  3CCQ P;  1VQ7 P;  2PEK A;  3I55 P;  5BS2 A;  5HGO A;  2LF4 A;  1D1D A;  1VQM P;  2ONT A;  5F2N A;  3CPW O;  1K8A Q;  5JPA A;  5HGN A;  2BQ1 E;  3H4E A;  4WYM A;  3G21 A;  2BUO A;  1VQL P;  1VQ8 P;  2L6E A;  1Q86 Q;  1EIA A;  3WBH A;  3H0D A;  3G6E P;  3CC2 P;  3CCE P;  1VQP P;  3B5I A;  2XXM A;  4U0D A;  1Q7Y Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...