1VQ5P

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq5P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq5P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq5P02
1YJWP 1NJIQ 1Q86Q 1JJ2O 3CMEP 1VQMP 1M1KQ 1W2BO 3CMAP 2OTLP 1VQ4P 1KC8Q 2QA4P 1S72P 1Q7YQ 3CC7P 1VQ6P 1VQPP 1YJ9P 1K8AQ 3CC2P 1VQKP 1VQNP 1VQLP 1QVGO 1YHQP 3G4SP 3CCRP 3CCJP 1Q82Q 1K9MQ 1VQ8P 3G6EP 3CXCO 1K73Q 3CCEP 1YITP 3CCLP 3CCQP 1VQ7P 3CD6P 2OTJP 2QEXP 1QVFO 3CCVP 3CPWO 1N8RQ 3CCMP 1VQ9P 3CCUP 3I55P 1YJNP 1M90Q 3CC4P 3I56P 1Q81Q 3OW2O 1KD1Q 1KQSO 1VQ5P 3CCSP 1VQOP 1YI2P 1YIJP 3G71P
chains in the Genus database with same CATH superfamily
4XRQA 5AVXB 1JMBA 4GOEA 2CPBA 1GL2D 2XZ1C 2N9YB 1EZVG 2SPZA 1NTZD 1KTMA 4EIJA 1VQ7P 3F5HA 1L0NK 2FXOA 1FBMA 2K1AA 4I2LC 3H1HD 3RL0B 2NPSC 5KLVD 2CG5B 2R3CA 4IL6H 4BPGA 4AQRD 2YKPA 1CEIA 1FJKA 1BE3D 1QGKB 4W7ZA 1KB9H 1FAVA 1M1JB 2B89A 3HUSC 2M5RA 2P7JA 4Z1MH 1QLED 3F89A 3EJBA 3EWKA 1H0TB 2AFDA 1IFPA 4N3YB 2XZ0D 3L36A 3HUSA 2Q1KA 1VHNA 2QSIA 1BE3G 3G21A 1W2BO 3IF4A 4RO0A 1BGYD 5APSA 1J2JB 1L0LE 2ZVNB 1MZ8A 4HH2A 4OGQB 3B5IA 3Q5SA 1AYIA 1SQVG 5BU5A 2XDJA 1JY3N 2GDYA 1ZRTE 2POHA 1BXIA 2JWDA 4BPFA 1PEQA 1AA0A 1K30A 3U59A 2VLOA 2E74D 1YJWP 1KN7A 2JYGA 1X0TA 1JB0J 3P8CD 2KIKA 1CI6A 2A45I 3BRVB 2PEKA 2KLVA 2K2QA 1K73Q 1X8YA 2OYIC 4TT3H 5GTIE 1FZEA 1LTJB 3RK3E 1W5CE 1LJ2A 1EZVI 1GXHA 1EDKA 2FFDB 5HGOA 3VYIA 1IC2A 1QVGO 2P2UA 1FDIA 2OQQA 3Q5RA 1EZVE 2WSCJ 2KK7A 1GTWA 4H0LB 2N5IA 3PHLA 4IL6E 1S5LX 4XROA 4OH8B 3Q2YA 1GK6A 5HGLA 3CXHD 2JBGA 2XNXA 2XV5A 2B88A 3BASA 1MUUA 1VQLP 2Q6QA 2P58A 1PP9E 3CCEP 1S5LH 2MVVA 4N6JA 1G1IA 2AFEA 5KAFE 2M3EA 2JWAA 3Q1MA 1EMVA 3Q5PA 3H6PA 1URQD 3L74G 4JQ0D 1YJ9P 2IZ0A 5DJUB 1SFCD 2FBWC 4MN4C 2GZIA 4H2XC 3AE4C 4I6MC 5F2KA 3CPWO 2ZT9C 3IR9A 2JP3A 3G1IA 2R32A 3OAKA 2KZJA 2HODA 2D2CC 1DH3A 2H8PD 1T2KD 1HGVA 1YYCA 4COCA 1X3OA 5BVZA 2LTEA 2E43A 1SQBD 2C0XA 2QJPB 1KV4A 1NVOA 2FVFA 2AXTE 3GF7A 3LRYA 3R4YA 2KG8A 3A0BH 3FXEA 2WSSH 2NZ2A 1NJIQ 1CSBA 2PEJA 1FJPA 2JR8A 5H2FH 1JY3O 2JO1A 4I1LA 2E74B 3HD7A 1VL2A 1U57A 1K9MQ 4B86A 1PIXA 5KP7B 3ITKA 3KQGA 2WITA 1NTKJ 1YJNP 1EQ7A 2JEEA 2JO0A 1NTKD 4KHXA 1AVYA 1H88A 4H13C 3HRNA 3M9QA 3O6QA 2FYUG 1ZN5A 3D71A 2I1JA 4NPEA 2R5DA 2NRGA 3CCJP 4Y99B 1KILC 4MRTC 2K9YA 2L6EA 1FZCC 3HD7C 4JYCA 5E79E 2MVUA 3SFEC 5I4TG 2WPRA 3V4WA 4BPHA 1M6EX 2QM7A 2B9BA 2QIWA 2K5XA 3LMOA 2QRXA 1KYOD 4U0BA 1SQXD 3S4RA 5CCHD 2KS1B 1VQ8P 2E75C 3H1LD 3GLMA 2KWLA 3GF3A 4U0FA 4ZMDA 1RO0A 4IZ6A 3V2PA 2HG5D 3HTKB 2H43A 1N86A 5L8RJ 4U0EA 2KXPB 1Q86Q 2J58A 2M5AB 1HGZA 5JPAA 1E79H 2RMZA 2LKIA 1URQB 2ZXXA 3H1LG 5AVZB 3L4FA 1SQQD 2ONTA 2WZ7A 2AXTH 1UIXA 1SFCB 3VRLC 1OR5A 1PP9D 2YIUB 2EHSA 3M0DC 1AFOA 2W27A 1WMKA 1NGMB 1WRGA 2Z5IA 5KLVK 3WMM0 1CW5A 3B4QA 4PD4E 3B5NB 2A06G 2K0XA 2N1TB 1HF9A 1OZHA 2MY5A 1SP4A 3L35A 1G2CA 5AW2B 1M56D 2HPCB 3JSVC 1NOHA 5KP8B 1T6AA 2PGDA 1VQKP 4O9BA 2YXQB 3G29A 3AE7C 4EDFA 3PJSK 5E79H 2MJZA 5AW7B 1JUNA 2WPTA 2RN0A 5APYA 2FQ1A 2L0QA 1VDFA 4XFYA 1L0NJ 4KJMA 3FX0A 3GJNA 1JO5A 1HBWA 1OW7A 1LTIC 1FU1A 2OYIA 2BCCJ 4OWFA 4GT1A 2H89C 1PGQA 1DEBA 2XKMA 1JY3P 1PPJG 4M0IA 3TGUG 1OXZA 3FGAD 3I55P 1PEUA 3PH0A 1KB9E 1OFCX 1FR2A 1CI6B 4N78E 1D1DA 3HYBA 3V5BA 3W67A 3RG6C 1ZXGA 2C9NY 2ZYDA 2VSQA 2H88C 2GM4A 1YBKA 5AW5B 3AEFC 3MD0A 1RF0A 2QJKC 2OTLP 2Z5HA 1NTMD 4L73A 1KYOH 1SQBG 4PD4H 2CPSA 1KFNA 2YO2A 1DD4A 3L72G 2QEXP 1UNKA 4PD4D 2BASA 1Q2NA 3CWBJ 1SQPE 1N73A 4U3FJ 2WPVB 4C7RA 4NPDA 1M8OB 4Y99C 5KLIC 2NPSA 2AEFA 1FS0E 2FYNC 4F37A 2N1TC 3IN6A 3AEBC 3GHGB 5EJDA 5AW6B 5TISE 2JAZA 3B5ND 1LP1A 4WB4A 1KD1Q 1LTGC 3CCSP 2LMLA 3MTUE 3L75D 1SQPK 2B87A 1LTBC 3IAOA 2QA4P 2KI7B 2FYUE 4L75A 1EDJA 3PP5A 3G4SP 2MKVA 3P05A 3CCQP 5APUA 2CGQA 3VP9A 2O01J 3BCCE 3P7KA 2BEZF 1IK9A 1EDIA 5AW9B 3B4SA 2NPSB 4H44D 1T8KA 1T3JA 2JGPA 2CNRA 2FXMA 1IFIA 2O3JA 2PEQA 2JQ4A 1N2DC 3TGUD 3OW2O 1BE3E 2M8LA 3TGUJ 4LC1A 4C46A 1S1CX 2IPPA 1KC8Q 2XU6A 3L74E 1E6JP 4EOTA 1DX7A 1SFCA 3TK1A 1NHLA 3RK2B 4BRYA 2KB7P 1YITP 1KZUB 2P9XA 3L70J 1J1EB 1NAFA 2PY8A 1BGYJ 4C7NB 3GW6A 4RJTA 4ZKPA 5CZDB 3NY7B 2K94A 2KOSA 4K35A 5CCGA 1M1KQ 3PLNA 3CMAP 3E2DA 1OWAA 3AECC 1U7MA 1PPJE 2W6AA 3SFDC 2OYHA 1FZAA 2IDBA 5KKZB 2PNGA 2ZVOB 2M8RA 5HGNA 1LTJA 3HD7D 1NTMJ 2KS1A 1JOCA 2KOGA 2MR7A 1Z56A 5CJ0A 5KJ7A 3NTNA 3RGUA 4WY4A 2M3BA 1IUQA 3UIAA 4H13D 3H0DA 1L0HA 4I7ZC 2LF4A 2VLQA 2D2CB 4HKZH 2LXCB 4K3AA 2HLOA 1GMJA 1R5SA 1OVVA 2PENA 5TJHA 2L22A 5B66H 2IBZG 4PD4I 1Z6MA 2OYHB 1BAJA 3M0AA 3B5NC 2N9BA 1L0LG 3VMAA 1GK4A 1VQ4P 2ERHA 1P84D 1M1JA 2V7QJ 2R44A 1ZMBA 1JY2N 2ZJSE 3KZIE 4NPFX 1EDLA 3U43A 1FOSE 1N7SC 2IFNA 1VQOP 5CBOA 5K5GB 1OX3A 1L4AC 1NTZG 2NO8A 4H2YC 5AVRB 1FDOA 4WYMA 1JY2O 1QX8A 2OTKE 2K37A 3OJAB 3H1HJ 2UWJE 1E5WA 3KPEA 3KYQA 3V4QA 1RO2A 3M9BA 3CMEP 2GZGA 2KGDA 2KG9A 2Q7CA 4I7ZB 2LR2A 2CQ8A 2XT1A 4PWVB 1A43A 1NKNA 1ZV8A 1NU1G 3KXDA 2YIUC 4W80A 2KORA 1SQQE 3P8MC 2K92A 2FHSC 3HE4B 1IZNB 3DS1A 2Y9YA 3HE4A 3VN0A 2LIUA 4ASWA 1JMMA 3E1RA 5B5EE 2W8ZA 1KYOI 1DIPA 1PGJA 2WQYC 3NFQA 3MZWB 1VQ5P 3V2RA 3D6YA 2B87B 2IBZE 3L71J 3SWFA 4UHPB 1RE4A 2G3AA 2Y0DA 3EQ2A 1RQVA 1RE3C 2KOQA 1M57D 1SQVJ 1USDA 1OMIA 1EZVD 1FC2C 1BDCA 2K0DX 1L4AD 4OVNF 1Q90D 3VMXA 1N7SD 3AEGC 2QJPC 3L70E 2PAJA 3PRJA 1FZCB 3H1HG 4M3LA 2XV6A 3TYYA 3GHGA 1NU1D 5CHXA 1NTKE 2LPKA 2FYUK 3OA7A 3A3YB 1E0HA 3ZDMA 1EIAA 1IMQA 3WUUA 2WSCH 5AW0B 3CXHI 1LWUA 2Z44A 1H8AA 1EC5A 4DG9A 1Q81Q 2LXBA 5AW8B 3H1KD 3H1JE 1H89A 2HYNA 2AVAA 1EXIA 1GU5A 1KILE 1VQMP 1SVFA 1SQQG 4XFJA 3L73J 1P84H 3H32B 3H47A 1SLQA 2KSJA 1FZGA 3BCCG 1NQ4A 2VLNA 4JPZB 1KQFB 2VRSA 4PJ0E 3RL0g 2QJKB 1S3JA 1PPJD 4U7JA 3DPHA 3FWNA 1IO4A 1PFIA 2WWWA 3CWBE 3TNUB 1RF1B 2LIWA 1JNMA 4UB6H 2A06D 5CCHC 3TGUE 3BCCD 1RHZB 1N7LA 2KLUA 1LT9C 1UIIA 2M8PA 4U3FG 1ZR4A 2N50A 1YI2P 1QL2A 3CX5H 5KLIB 1KILD 1GDTA 1PGPA 2HR3A 4DOJA 2KW2A 2PEIA 1GW3A 1NAYA 1QVFO 1KB9I 5KLVG 3BRTB 2JB0A 1VKUA 1XTCC 1HTLC 1ZR2A 4WVZA 2JDIH 3VOPA 2FFDC 3CI9A 1JJ2O 2OYOA 3GG2A 2ZAEB 3M91A 4RKUJ 2E42A 3L71E 4XE5B 4PV1C 2LKMA 4IPYA 4D6TD 3CLQA 2HPCA 4WBAA 1NTMK 1XTGB 4PH0A 2QJYB 3T97B 1LT9B 5F2OA 1N7SB 1M7LA 3LW5J 5GTHE 4UB8H 2Z45A 3CC7P 3AEDC 2J59M 4H44C 3CX5I 4LLHA 1T2KC 3CXCO 1OW6A 2K9JB 2FFDA 4PJ0H 1KQGB 1SQPG 3RK3B 2ZT9D 4UB6E 3G26A 4R0MA 1BGYE 1GU4A 1JCCA 5HGMA 4C7NA 3GZMA 2YO3A 1X9VA 3G6EP 1KQLA 2ZYGA 1SQPD 4LGDE 3IFMA 1HY8A 2N6ZA 1BCCG 3MGEA 4KT0J 3EFGA 2FVEA 1LNQA 4Y28J 4L74A 2QNWA 4W7YA 3H1KJ 3RBZA 3N4XA 3MUDA 5CCHA 3RL0C 2N1TD 5KAIH 3L73D 2Q3EA 3H1IJ 1CZQA 3EJEA 3Q3DA 4XA4A 1PV3A 3TF5A 1HQBA 4R4LA 4YTPC 2W6BA 1ZOYC 2WPSA 2IZ1A 3SSUA 1L0NG 1YTZI 2I8DA 1W2EA 5B66E 3VMYA 2FKWB 3U1CA 3CWBD 3EFFK 4GR2A 2HFED 4BXLA 5CBNA 1S4XA 1LWUC 1T8ZA 1URQC 2O01H 3GZLA 4DCKA 1PEMA 3GHGC 1S72P 3U1AA 3A0HE 5BS2A 2QJYC 3KZIH 2QG4A 2BUOA 2GZEA 3LW5H 2E74C 1T3UA 3H1KG 4CA3A 2KOOA 2M8NA 3GKLC 4XFZA 2WSFJ 4QNBA 2ZXEB 1GPJA 2K9JA 2EFJA 1RE3A 2L91A 2BEQD 3C9IA 2AXCA 2FQ2A 2WVRA 2W6JH 3C1LA 1NU1E 1KMIZ 1LT1A 4IFMA 2A45H 2E76B 1HH0A 1NTME 2ZT9B 3CWBG 2CWOA 1FE6A 2BCCG 1QL1A 2JU1A 3TSIA 3MHVA 2KODA 2K3RA 2GZFA 1DV5A 2Q9IA 2V4HA 2IBZD 1JEKA 1EXJA 4U0AA 3FWLA 1BSHA 3CCLP 1KLPA 1GL2B 1MV8A 3AEAC 1GL2A 2P1JA 1RY3A 2EG5A 1GW4A 1RF1A 2FYUD 3G71P 4BRYB 1RF1C 3AE3C 1NH4A 1SQXJ 3AE2C 3G9RA 5B5EH 2AF8A 3DTJA 1MFTA 3H1LJ 1GL2C 2YKQA 3CX5D 2FAEA 5C39A 5KAFH 1NYHA 4H2WC 1PP9G 3V2NA 2MD9A 1JM0A 4U3FD 5APVA 2JJLA 3L74D 3QWOC 2HODB 1Y9BA 4GIFA 2Y9ZA 5AW4B 1PEOA 2M5AA 5APQA 1NO4A 1L4AA 4DT0A 1G1JA 1L0LJ 1N7SA 1EOQA 3L71G 1OVUA 4WWIA 1WT6A 1YQ4C 2BHVA 2JYLA 2NPSD 3AE6C 3M1MA 1AJYA 2FQ0A 2XZRA 1DEEG 2N6YA 2E75D 4WY4B 2P67A 3WUVA 1K8AQ 3VP8A 7CEIA 2N5HA 2FVAA 4GOFA 5KKZC 3JCUH 5AVSB 3B5NA 4QKOA 4IFFA 3A0BE 3CCVP 1ACPA 4PH1A 1P84E 3A2AA 2K88A 5H2FE 3H25A 1DNYA 2W83C 4N78D 3RK2D 2OARA 1YQ3C 1URQA 5KLVJ 3H1JJ 4GDOA 3USSA 4H0LC 2WSEJ 2O01N 4HKGA 3H1KE 3H1JD 1ZMEC 5HV8A 1QRJA 1SQQJ 3MGNA 2G8YA 3AE5C 2OYIB 3CC4P 5CJ4A 4GODA 2DW3A 1S9KD 3FXDA 2KGAA 3CE7A 1VQ6P 3VTPC 4IL6X 3H4EA 2A45G 2BCCD 1LTJC 2EHTA 3HUSB 3L70D 3LIEA 3O8ZA 4JBZA 1AQTA 3CX5E 3CCMP 4XFXA 3DS4A 5AW1B 3MUDC 1AQ5A 1RNIA 2I1KA 2BQ1E 1Y8AA 1AF8A 3L72J 5EW5E 3I5CA 4H13B 5CCGC 3L72D 3CCRP 2R3SA 3WU2H 3NTEA 1SQBJ 1BE3J 3L73G 2KOPA 2D2CD 3H1LE 2EIAA 5AW3B 2ZFCA 2IYOA 2OGUA 2WTYA 1SS1A 1NU1K 2KUBA 1U7JA 3C8VA 2FACA 2PRRA 1L0ND 4EI2A 1SFCC 1BCCJ 3RK3C 3K5BA 3CC2P 1IFNA 1H0TA 2P10A 1MKMA 1YTZT 1RH5B 3TNUA 4YPCA 1KQSO 3S1KA 2JU2A 1BGYG 3ABVC 4IOIH 1IMPA 3H1IG 2DGYA 2L5GB 1Q82Q 2E75B 4WY4D 2WT7A 5DJTB 3QH9A 2WT7B 2YKOA 2LOLA 1L0LD 3SWKA 3L75J 4AUWA 1SQVE 3MP7B 2WSFH 3RBXA 1HJBA 2R5BA 1AV1A 3PTZA 5GTIH 1PL5A 3H1HE 5CCGD 1L0IA 1LTAC 3Q20A 2KNCB 4QMAA 1NTZJ 1VQ9P 3NXSA 2C0WA 4JF7A 2O1JA 1ZLLA 4TLFA 1SQVK 1FDMA 1MZ9A 2N1TA 4JYBA 1Q7YQ 2M0BA 2RH0A 5AVYB 3CXHH 1NTMG 3WU2E 2PP6A 1YHQP 1S2EA 2KZIA 4D6TG 1ZNVA 3G28A 2OTJP 1LT9A 1N73C 1FZBA 2N98A 3H32A 5AVWB 1YIJP 3H1ID 1S5LE 1IK7A 1L0NE 4R4MA 2L9FA 1J1EC 1RF0C 3KDPB 1VF5D 3HTKA 3A0HH 5APXA 2GUSA 3NMDA 4YXWH 1S9KE 3T97A 2FADA 3DS2A 1USEA 1LGHB 1L4AB 2LL8A 2Q5UA 1BCCE 1JY2P 5GTHH 3BVHA 2JKVA 1A02F 1M90Q 1NTZK 1R5LA 3L71D 1Y47A 3TDKA 1JTHB 4PXHB 5AVTB 1IFMA 3VMZA 2WPQA 3P32A 1M74A 3B8EB 2PFXA 3WUTA 1RE4C 5BU8B 1VF5C 3L75G 3P8CE 1UJZA 1NU1J 2E1MA 2E76C 3B71A 3H1IE 4GR6A 2Q3IA 3V2QA 1R8EA 1SQPJ 1J1DC 4D6TJ 3L70G 5BS1A 4U3FE 1ZRTD 4ZKUA 4HYTB 1VPCA 2KGEA 3KHUA 5KAIE 3O6QB 4NEOA 1SQBE 2GUVA 4U0CA 1DD3A 1PP9J 3AE1C 1QEXA 2X2BA 1JTHA 4RESB 4YXDC 5F2NA 2Y0EA 3CD6P 1MFZA 5KLVE 3M0DA 1HJ0A 1FOSF 5CMZA 1KILB 1F80D 1M6NA 2IX7C 2WMMA 2MR8A 1A8OA 2A06E 3R2PA 2GYKA 2KSEA 1KFMA 3BCCJ 2CK3H 2KYVA 5M1BA 2KR5A 1OW8A 2H7HA 2J5UA 4OGQC 3MIWA 4HJGH 3WBHA 2E5YA 2YMKA 4L76A 2O1KA 3L73E 5KTBA 4PV1B 1VF5B 1KORA 3DS5A 4U0DA 3L75E 3D6ZA 3AE9C 2ZYAA 1IFDA 5AVVB 3EJDA 3D70A 3SWYA 2C9LY 2GA1A 1M1JC 2Z46A 3HE5A 2IBZI 2BCCE 1FZCA 1SQQK 2V7QH 1KILA 4AYCA 1NTZE 3N7NA 3L37A 1J1DB 5KJ7D 2KNCA 1GD2E 1AUMA 3HZQA 5EFWB 1GXGA 3DS0A 5AVQB 3RK3D 1NKZB 2YMYA 1IJDB 2ITAA 1IFJA 1PGOA 1OIPA 1LP1B 1D7MA 2L4BA 4COPA 2GDWA 2PEOA 4IFDK 3G0VA 1TU3F 2KG6A 3GMAA 1BDDA 1KB9D 4WY4C 1FZFA 5KJ7C 1HUCA 2WSEH 3RL0D 4CPGA 2XNDH 4D6TE 4H44B 2ROQA 2FY8A 2QE7H 3E1IA 1LTSC 4EYYQ 1X22A 3LIDA 2QVAA 4HB1A 4DJGA 5APWA 4ASVA 2GZJA 1SQBK 2FYNB 3JC22 2KGCA 1ZW0A 3AE8C 2K93A 1G2CB 1VQPP 2IYPA 1L0LK 2OYHC 2FYZA 2QM8A 3CL3D 5APTA 5AVUB 2E5TA 3W68A 3L74J 3V6IA 1JCDA 2Y0CA 1OVRA 3CCUP 1LTTC 2GDXA 1X79B 1A02J 4ZNCA 4OGQD 2KP8A 3AEEC 1SQVD 1NTKK 1HVVA 3BATA 3RK2C 2VLPA 1P84I 2FYUJ 2YXRB 4DZOA 1K05A 1AVOA 2AEMA 3I56P 3JCUE 1BCCD 1KYOE 1SQXE 3A7OA 2Z4EA 2PEMA 1NTKG 1ZP0C 2AEJA 2W90A 1GZLA 1RQUA 1NWQA 3HE5B 4PV1D 4UB8E 4GKGA 1HWTC 3HD7B 2XXMA 1N73B 1PZQA 3H1JG 1K04A 3DS3A 1LWUB 2DNWA 2IFMA 3A5TA 3M06A 1SQXK 3G1GA 3RG2A 3E7KA 2MF4A 4A7PA 5TISH 3II6A 2FXPA 2RKLA 1VQNP 2YNYA 2K0YA 1SQXG 4H0LD 5HVCA 4BWNA 2E76D 5KP6B 1N8RQ 3G3ZA 1L2PA 1BSNA 3S9OA 3M9HA 3L72E 3CXHE 5DCKA
chains in the Genus database with same CATH topology
1NJIQ 1A8OA 4XRQA 2PEJA 2OTLP 2OARA 2CWOA 1VQ4P 1KC8Q 5HGOA 1E6JP 1VQPP 3DS2A 2KODA 2DGYA 2PEIA 1QVGO 1K9MQ 4U0AA 1Q82Q 1ZMBA 1QRJA 1YITP 3CCLP 1VQ7P 2P9XA 2QEXP 1QVFO 3WBHA 2PY8A 3CCUP 1YJNP 1M90Q 3CC4P 2EG5A 4XROA 2JO0A 1VQOP 3G71P 1JJ2O 1M1KQ 5HGLA 3CMAP 2XV6A 3DS5A 4U0DA 1VQ6P 3DTJA 3E2DA 3H4EA 1VQKP 1VQLP 3CCJP 3G29A 4GR2A 3CCEP 4WYMA 4IPYA 1M74A 3Q20A 1EIAA 2L6EA 2Z46A 3CCMP 4XFXA 1VQ9P 3DS4A 2Z44A 4PH0A 3I56P 1Q81Q 1KD1Q 3CCSP 5F2OA 5I4TG 4XFYA 1RO2A 1PEMA 1M6EX 2E1MA 3CMEP 2PEMA 1RNIA 4GR6A 3G21A 5HGNA 1VQMP 1W2BO 2BQ1E 2QA4P 1S72P 2Z45A 1Q7YQ 3CC7P 5BS2A 1PEOA 1AUMA 3HZQA 3H47A 5BS1A 1YJ9P 4U0BA 2XT1A 3B5IA 3DS0A 1YHQP 1A43A 3G4SP 3CCRP 1VQ8P 3G28A 3CXCO 2OTJP 3P05A 2BUOA 2XXMA 3CCQP 3NTEA 3DS3A 4U0FA 1IUQA 5F2KA 1RO0A 4M0IA 2EIAA 3H0DA 3CPWO 1EOQA 3I55P 1PEUA 4COPA 2PEOA 2LF4A 2BHVA 1PEQA 3G1GA 3G1IA 3DPHA 4U0CA 1K30A 2JYLA 2M8NA 1YIJP 4XFZA 3DS1A 3M1MA 4U0EA 4QNBA 1YJWP 1Q86Q 2JYGA 3G0VA 3G26A 2EFJA 5HGMA 5JPAA 2PENA 1D1DA 3HYBA 4COCA 1K8AQ 3CC2P 2PEKA 1VQNP 3RG6C 2ONTA 5F2NA 3G6EP 1K73Q 3CD6P 2M8PA 3CCVP 2PEQA 3MGEA 1N8RQ 3VRLC 3LRYA 3OW2O 1BAJA 1KQSO 4PH1A 1VQ5P 1YI2P 2M8LA 1M6NA 5DCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW P;  1NJI Q;  1Q86 Q;  1JJ2 O;  3CME P;  1VQM P;  1M1K Q;  1W2B O;  3CMA P;  2OTL P;  1VQ4 P;  1KC8 Q;  2QA4 P;  1S72 P;  1Q7Y Q;  3CC7 P;  1VQ6 P;  1VQP P;  1YJ9 P;  1K8A Q;  3CC2 P;  1VQK P;  1VQN P;  1VQL P;  1QVG O;  1YHQ P;  3G4S P;  3CCR P;  3CCJ P;  1Q82 Q;  1K9M Q;  1VQ8 P;  3G6E P;  3CXC O;  1K73 Q;  3CCE P;  1YIT P;  3CCL P;  3CCQ P;  1VQ7 P;  3CD6 P;  2OTJ P;  2QEX P;  1QVF O;  3CCV P;  3CPW O;  1N8R Q;  3CCM P;  1VQ9 P;  3CCU P;  3I55 P;  1YJN P;  1M90 Q;  3CC4 P;  3I56 P;  1Q81 Q;  3OW2 O;  1KD1 Q;  1KQS O;  1VQ5 P;  3CCS P;  1VQO P;  1YI2 P;  1YIJ P;  3G71 P; 
#chains in the Genus database with same CATH topology
 4XRQ A;  5AVX B;  1JMB A;  4GOE A;  2CPB A;  1GL2 D;  2XZ1 C;  2N9Y B;  1EZV G;  2SPZ A;  1NTZ D;  1KTM A;  4EIJ A;  1VQ7 P;  3F5H A;  1L0N K;  2FXO A;  1FBM A;  2K1A A;  4I2L C;  3H1H D;  3RL0 B;  2NPS C;  5KLV D;  2CG5 B;  2R3C A;  4IL6 H;  4BPG A;  4AQR D;  2YKP A;  1CEI A;  1FJK A;  1BE3 D;  1QGK B;  4W7Z A;  1KB9 H;  1FAV A;  1M1J B;  2B89 A;  3HUS C;  2M5R A;  2P7J A;  4Z1M H;  1QLE D;  3F89 A;  3EJB A;  3EWK A;  1H0T B;  2AFD A;  1IFP A;  4N3Y B;  2XZ0 D;  3L36 A;  3HUS A;  2Q1K A;  1VHN A;  2QSI A;  1BE3 G;  3G21 A;  1W2B O;  3IF4 A;  4RO0 A;  1BGY D;  5APS A;  1J2J B;  1L0L E;  2ZVN B;  1MZ8 A;  4HH2 A;  4OGQ B;  3B5I A;  3Q5S A;  1AYI A;  1SQV G;  5BU5 A;  2XDJ A;  1JY3 N;  2GDY A;  1ZRT E;  2POH A;  1BXI A;  2JWD A;  4BPF A;  1PEQ A;  1AA0 A;  1K30 A;  3U59 A;  2VLO A;  2E74 D;  1YJW P;  1KN7 A;  2JYG A;  1X0T A;  1JB0 J;  3P8C D;  2KIK A;  1CI6 A;  2A45 I;  3BRV B;  2PEK A;  2KLV A;  2K2Q A;  1K73 Q;  1X8Y A;  2OYI C;  4TT3 H;  5GTI E;  1FZE A;  1LTJ B;  3RK3 E;  1W5C E;  1LJ2 A;  1EZV I;  1GXH A;  1EDK A;  2FFD B;  5HGO A;  3VYI A;  1IC2 A;  1QVG O;  2P2U A;  1FDI A;  2OQQ A;  3Q5R A;  1EZV E;  2WSC J;  2KK7 A;  1GTW A;  4H0L B;  2N5I A;  3PHL A;  4IL6 E;  1S5L X;  4XRO A;  4OH8 B;  3Q2Y A;  1GK6 A;  5HGL A;  3CXH D;  2JBG A;  2XNX A;  2XV5 A;  2B88 A;  3BAS A;  1MUU A;  1VQL P;  2Q6Q A;  2P58 A;  1PP9 E;  3CCE P;  1S5L H;  2MVV A;  4N6J A;  1G1I A;  2AFE A;  5KAF E;  2M3E A;  2JWA A;  3Q1M A;  1EMV A;  3Q5P A;  3H6P A;  1URQ D;  3L74 G;  4JQ0 D;  1YJ9 P;  2IZ0 A;  5DJU B;  1SFC D;  2FBW C;  4MN4 C;  2GZI A;  4H2X C;  3AE4 C;  4I6M C;  5F2K A;  3CPW O;  2ZT9 C;  3IR9 A;  2JP3 A;  3G1I A;  2R32 A;  3OAK A;  2KZJ A;  2HOD A;  2D2C C;  1DH3 A;  2H8P D;  1T2K D;  1HGV A;  1YYC A;  4COC A;  1X3O A;  5BVZ A;  2LTE A;  2E43 A;  1SQB D;  2C0X A;  2QJP B;  1KV4 A;  1NVO A;  2FVF A;  2AXT E;  3GF7 A;  3LRY A;  3R4Y A;  2KG8 A;  3A0B H;  3FXE A;  2WSS H;  2NZ2 A;  1NJI Q;  1CSB A;  2PEJ A;  1FJP A;  2JR8 A;  5H2F H;  1JY3 O;  2JO1 A;  4I1L A;  2E74 B;  3HD7 A;  1VL2 A;  1U57 A;  1K9M Q;  4B86 A;  1PIX A;  5KP7 B;  3ITK A;  3KQG A;  2WIT A;  1NTK J;  1YJN P;  1EQ7 A;  2JEE A;  2JO0 A;  1NTK D;  4KHX A;  1AVY A;  1H88 A;  4H13 C;  3HRN A;  3M9Q A;  3O6Q A;  2FYU G;  1ZN5 A;  3D71 A;  2I1J A;  4NPE A;  2R5D A;  2NRG A;  3CCJ P;  4Y99 B;  1KIL C;  4MRT C;  2K9Y A;  2L6E A;  1FZC C;  3HD7 C;  4JYC A;  5E79 E;  2MVU A;  3SFE C;  5I4T G;  2WPR A;  3V4W A;  4BPH A;  1M6E X;  2QM7 A;  2B9B A;  2QIW A;  2K5X A;  3LMO A;  2QRX A;  1KYO D;  4U0B A;  1SQX D;  3S4R A;  5CCH D;  2KS1 B;  1VQ8 P;  2E75 C;  3H1L D;  3GLM A;  2KWL A;  3GF3 A;  4U0F A;  4ZMD A;  1RO0 A;  4IZ6 A;  3V2P A;  2HG5 D;  3HTK B;  2H43 A;  1N86 A;  5L8R J;  4U0E A;  2KXP B;  1Q86 Q;  2J58 A;  2M5A B;  1HGZ A;  5JPA A;  1E79 H;  2RMZ A;  2LKI A;  1URQ B;  2ZXX A;  3H1L G;  5AVZ B;  3L4F A;  1SQQ D;  2ONT A;  2WZ7 A;  2AXT H;  1UIX A;  1SFC B;  3VRL C;  1OR5 A;  1PP9 D;  2YIU B;  2EHS A;  3M0D C;  1AFO A;  2W27 A;  1WMK A;  1NGM B;  1WRG A;  2Z5I A;  5KLV K;  3WMM 0;  1CW5 A;  3B4Q A;  4PD4 E;  3B5N B;  2A06 G;  2K0X A;  2N1T B;  1HF9 A;  1OZH A;  2MY5 A;  1SP4 A;  3L35 A;  1G2C A;  5AW2 B;  1M56 D;  2HPC B;  3JSV C;  1NOH A;  5KP8 B;  1T6A A;  2PGD A;  1VQK P;  4O9B A;  2YXQ B;  3G29 A;  3AE7 C;  4EDF A;  3PJS K;  5E79 H;  2MJZ A;  5AW7 B;  1JUN A;  2WPT A;  2RN0 A;  5APY A;  2FQ1 A;  2L0Q A;  1VDF A;  4XFY A;  1L0N J;  4KJM A;  3FX0 A;  3GJN A;  1JO5 A;  1HBW A;  1OW7 A;  1LTI C;  1FU1 A;  2OYI A;  2BCC J;  4OWF A;  4GT1 A;  2H89 C;  1PGQ A;  1DEB A;  2XKM A;  1JY3 P;  1PPJ G;  4M0I A;  3TGU G;  1OXZ A;  3FGA D;  3I55 P;  1PEU A;  3PH0 A;  1KB9 E;  1OFC X;  1FR2 A;  1CI6 B;  4N78 E;  1D1D A;  3HYB A;  3V5B A;  3W67 A;  3RG6 C;  1ZXG A;  2C9N Y;  2ZYD A;  2VSQ A;  2H88 C;  2GM4 A;  1YBK A;  5AW5 B;  3AEF C;  3MD0 A;  1RF0 A;  2QJK C;  2OTL P;  2Z5H A;  1NTM D;  4L73 A;  1KYO H;  1SQB G;  4PD4 H;  2CPS A;  1KFN A;  2YO2 A;  1DD4 A;  3L72 G;  2QEX P;  1UNK A;  4PD4 D;  2BAS A;  1Q2N A;  3CWB J;  1SQP E;  1N73 A;  4U3F J;  2WPV B;  4C7R A;  4NPD A;  1M8O B;  4Y99 C;  5KLI C;  2NPS A;  2AEF A;  1FS0 E;  2FYN C;  4F37 A;  2N1T C;  3IN6 A;  3AEB C;  3GHG B;  5EJD A;  5AW6 B;  5TIS E;  2JAZ A;  3B5N D;  1LP1 A;  4WB4 A;  1KD1 Q;  1LTG C;  3CCS P;  2LML A;  3MTU E;  3L75 D;  1SQP K;  2B87 A;  1LTB C;  3IAO A;  2QA4 P;  2KI7 B;  2FYU E;  4L75 A;  1EDJ A;  3PP5 A;  3G4S P;  2MKV A;  3P05 A;  3CCQ P;  5APU A;  2CGQ A;  3VP9 A;  2O01 J;  3BCC E;  3P7K A;  2BEZ F;  1IK9 A;  1EDI A;  5AW9 B;  3B4S A;  2NPS B;  4H44 D;  1T8K A;  1T3J A;  2JGP A;  2CNR A;  2FXM A;  1IFI A;  2O3J A;  2PEQ A;  2JQ4 A;  1N2D C;  3TGU D;  3OW2 O;  1BE3 E;  2M8L A;  3TGU J;  4LC1 A;  4C46 A;  1S1C X;  2IPP A;  1KC8 Q;  2XU6 A;  3L74 E;  1E6J P;  4EOT A;  1DX7 A;  1SFC A;  3TK1 A;  1NHL A;  3RK2 B;  4BRY A;  2KB7 P;  1YIT P;  1KZU B;  2P9X A;  3L70 J;  1J1E B;  1NAF A;  2PY8 A;  1BGY J;  4C7N B;  3GW6 A;  4RJT A;  4ZKP A;  5CZD B;  3NY7 B;  2K94 A;  2KOS A;  4K35 A;  5CCG A;  1M1K Q;  3PLN A;  3CMA P;  3E2D A;  1OWA A;  3AEC C;  1U7M A;  1PPJ E;  2W6A A;  3SFD C;  2OYH A;  1FZA A;  2IDB A;  5KKZ B;  2PNG A;  2ZVO B;  2M8R A;  5HGN A;  1LTJ A;  3HD7 D;  1NTM J;  2KS1 A;  1JOC A;  2KOG A;  2MR7 A;  1Z56 A;  5CJ0 A;  5KJ7 A;  3NTN A;  3RGU A;  4WY4 A;  2M3B A;  1IUQ A;  3UIA A;  4H13 D;  3H0D A;  1L0H A;  4I7Z C;  2LF4 A;  2VLQ A;  2D2C B;  4HKZ H;  2LXC B;  4K3A A;  2HLO A;  1GMJ A;  1R5S A;  1OVV A;  2PEN A;  5TJH A;  2L22 A;  5B66 H;  2IBZ G;  4PD4 I;  1Z6M A;  2OYH B;  1BAJ A;  3M0A A;  3B5N C;  2N9B A;  1L0L G;  3VMA A;  1GK4 A;  1VQ4 P;  2ERH A;  1P84 D;  1M1J A;  2V7Q J;  2R44 A;  1ZMB A;  1JY2 N;  2ZJS E;  3KZI E;  4NPF X;  1EDL A;  3U43 A;  1FOS E;  1N7S C;  2IFN A;  1VQO P;  5CBO A;  5K5G B;  1OX3 A;  1L4A C;  1NTZ G;  2NO8 A;  4H2Y C;  5AVR B;  1FDO A;  4WYM A;  1JY2 O;  1QX8 A;  2OTK E;  2K37 A;  3OJA B;  3H1H J;  2UWJ E;  1E5W A;  3KPE A;  3KYQ A;  3V4Q A;  1RO2 A;  3M9B A;  3CME P;  2GZG A;  2KGD A;  2KG9 A;  2Q7C A;  4I7Z B;  2LR2 A;  2CQ8 A;  2XT1 A;  4PWV B;  1A43 A;  1NKN A;  1ZV8 A;  1NU1 G;  3KXD A;  2YIU C;  4W80 A;  2KOR A;  1SQQ E;  3P8M C;  2K92 A;  2FHS C;  3HE4 B;  1IZN B;  3DS1 A;  2Y9Y A;  3HE4 A;  3VN0 A;  2LIU A;  4ASW A;  1JMM A;  3E1R A;  5B5E E;  2W8Z A;  1KYO I;  1DIP A;  1PGJ A;  2WQY C;  3NFQ A;  3MZW B;  1VQ5 P;  3V2R A;  3D6Y A;  2B87 B;  2IBZ E;  3L71 J;  3SWF A;  4UHP B;  1RE4 A;  2G3A A;  2Y0D A;  3EQ2 A;  1RQV A;  1RE3 C;  2KOQ A;  1M57 D;  1SQV J;  1USD A;  1OMI A;  1EZV D;  1FC2 C;  1BDC A;  2K0D X;  1L4A D;  4OVN F;  1Q90 D;  3VMX A;  1N7S D;  3AEG C;  2QJP C;  3L70 E;  2PAJ A;  3PRJ A;  1FZC B;  3H1H G;  4M3L A;  2XV6 A;  3TYY A;  3GHG A;  1NU1 D;  5CHX A;  1NTK E;  2LPK A;  2FYU K;  3OA7 A;  3A3Y B;  1E0H A;  3ZDM A;  1EIA A;  1IMQ A;  3WUU A;  2WSC H;  5AW0 B;  3CXH I;  1LWU A;  2Z44 A;  1H8A A;  1EC5 A;  4DG9 A;  1Q81 Q;  2LXB A;  5AW8 B;  3H1K D;  3H1J E;  1H89 A;  2HYN A;  2AVA A;  1EXI A;  1GU5 A;  1KIL E;  1VQM P;  1SVF A;  1SQQ G;  4XFJ A;  3L73 J;  1P84 H;  3H32 B;  3H47 A;  1SLQ A;  2KSJ A;  1FZG A;  3BCC G;  1NQ4 A;  2VLN A;  4JPZ B;  1KQF B;  2VRS A;  4PJ0 E;  3RL0 g;  2QJK B;  1S3J A;  1PPJ D;  4U7J A;  3DPH A;  3FWN A;  1IO4 A;  1PFI A;  2WWW A;  3CWB E;  3TNU B;  1RF1 B;  2LIW A;  1JNM A;  4UB6 H;  2A06 D;  5CCH C;  3TGU E;  3BCC D;  1RHZ B;  1N7L A;  2KLU A;  1LT9 C;  1UII A;  2M8P A;  4U3F G;  1ZR4 A;  2N50 A;  1YI2 P;  1QL2 A;  3CX5 H;  5KLI B;  1KIL D;  1GDT A;  1PGP A;  2HR3 A;  4DOJ A;  2KW2 A;  2PEI A;  1GW3 A;  1NAY A;  1QVF O;  1KB9 I;  5KLV G;  3BRT B;  2JB0 A;  1VKU A;  1XTC C;  1HTL C;  1ZR2 A;  4WVZ A;  2JDI H;  3VOP A;  2FFD C;  3CI9 A;  1JJ2 O;  2OYO A;  3GG2 A;  2ZAE B;  3M91 A;  4RKU J;  2E42 A;  3L71 E;  4XE5 B;  4PV1 C;  2LKM A;  4IPY A;  4D6T D;  3CLQ A;  2HPC A;  4WBA A;  1NTM K;  1XTG B;  4PH0 A;  2QJY B;  3T97 B;  1LT9 B;  5F2O A;  1N7S B;  1M7L A;  3LW5 J;  5GTH E;  4UB8 H;  2Z45 A;  3CC7 P;  3AED C;  2J59 M;  4H44 C;  3CX5 I;  4LLH A;  1T2K C;  3CXC O;  1OW6 A;  2K9J B;  2FFD A;  4PJ0 H;  1KQG B;  1SQP G;  3RK3 B;  2ZT9 D;  4UB6 E;  3G26 A;  4R0M A;  1BGY E;  1GU4 A;  1JCC A;  5HGM A;  4C7N A;  3GZM A;  2YO3 A;  1X9V A;  3G6E P;  1KQL A;  2ZYG A;  1SQP D;  4LGD E;  3IFM A;  1HY8 A;  2N6Z A;  1BCC G;  3MGE A;  4KT0 J;  3EFG A;  2FVE A;  1LNQ A;  4Y28 J;  4L74 A;  2QNW A;  4W7Y A;  3H1K J;  3RBZ A;  3N4X A;  3MUD A;  5CCH A;  3RL0 C;  2N1T D;  5KAI H;  3L73 D;  2Q3E A;  3H1I J;  1CZQ A;  3EJE A;  3Q3D A;  4XA4 A;  1PV3 A;  3TF5 A;  1HQB A;  4R4L A;  4YTP C;  2W6B A;  1ZOY C;  2WPS A;  2IZ1 A;  3SSU A;  1L0N G;  1YTZ I;  2I8D A;  1W2E A;  5B66 E;  3VMY A;  2FKW B;  3U1C A;  3CWB D;  3EFF K;  4GR2 A;  2HFE D;  4BXL A;  5CBN A;  1S4X A;  1LWU C;  1T8Z A;  1URQ C;  2O01 H;  3GZL A;  4DCK A;  1PEM A;  3GHG C;  1S72 P;  3U1A A;  3A0H E;  5BS2 A;  2QJY C;  3KZI H;  2QG4 A;  2BUO A;  2GZE A;  3LW5 H;  2E74 C;  1T3U A;  3H1K G;  4CA3 A;  2KOO A;  2M8N A;  3GKL C;  4XFZ A;  2WSF J;  4QNB A;  2ZXE B;  1GPJ A;  2K9J A;  2EFJ A;  1RE3 A;  2L91 A;  2BEQ D;  3C9I A;  2AXC A;  2FQ2 A;  2WVR A;  2W6J H;  3C1L A;  1NU1 E;  1KMI Z;  1LT1 A;  4IFM A;  2A45 H;  2E76 B;  1HH0 A;  1NTM E;  2ZT9 B;  3CWB G;  2CWO A;  1FE6 A;  2BCC G;  1QL1 A;  2JU1 A;  3TSI A;  3MHV A;  2KOD A;  2K3R A;  2GZF A;  1DV5 A;  2Q9I A;  2V4H A;  2IBZ D;  1JEK A;  1EXJ A;  4U0A A;  3FWL A;  1BSH A;  3CCL P;  1KLP A;  1GL2 B;  1MV8 A;  3AEA C;  1GL2 A;  2P1J A;  1RY3 A;  2EG5 A;  1GW4 A;  1RF1 A;  2FYU D;  3G71 P;  4BRY B;  1RF1 C;  3AE3 C;  1NH4 A;  1SQX J;  3AE2 C;  3G9R A;  5B5E H;  2AF8 A;  3DTJ A;  1MFT A;  3H1L J;  1GL2 C;  2YKQ A;  3CX5 D;  2FAE A;  5C39 A;  5KAF H;  1NYH A;  4H2W C;  1PP9 G;  3V2N A;  2MD9 A;  1JM0 A;  4U3F D;  5APV A;  2JJL A;  3L74 D;  3QWO C;  2HOD B;  1Y9B A;  4GIF A;  2Y9Z A;  5AW4 B;  1PEO A;  2M5A A;  5APQ A;  1NO4 A;  1L4A A;  4DT0 A;  1G1J A;  1L0L J;  1N7S A;  1EOQ A;  3L71 G;  1OVU A;  4WWI A;  1WT6 A;  1YQ4 C;  2BHV A;  2JYL A;  2NPS D;  3AE6 C;  3M1M A;  1AJY A;  2FQ0 A;  2XZR A;  1DEE G;  2N6Y A;  2E75 D;  4WY4 B;  2P67 A;  3WUV A;  1K8A Q;  3VP8 A;  7CEI A;  2N5H A;  2FVA A;  4GOF A;  5KKZ C;  3JCU H;  5AVS B;  3B5N A;  4QKO A;  4IFF A;  3A0B E;  3CCV P;  1ACP A;  4PH1 A;  1P84 E;  3A2A A;  2K88 A;  5H2F E;  3H25 A;  1DNY A;  2W83 C;  4N78 D;  3RK2 D;  2OAR A;  1YQ3 C;  1URQ A;  5KLV J;  3H1J J;  4GDO A;  3USS A;  4H0L C;  2WSE J;  2O01 N;  4HKG A;  3H1K E;  3H1J D;  1ZME C;  5HV8 A;  1QRJ A;  1SQQ J;  3MGN A;  2G8Y A;  3AE5 C;  2OYI B;  3CC4 P;  5CJ4 A;  4GOD A;  2DW3 A;  1S9K D;  3FXD A;  2KGA A;  3CE7 A;  1VQ6 P;  3VTP C;  4IL6 X;  3H4E A;  2A45 G;  2BCC D;  1LTJ C;  2EHT A;  3HUS B;  3L70 D;  3LIE A;  3O8Z A;  4JBZ A;  1AQT A;  3CX5 E;  3CCM P;  4XFX A;  3DS4 A;  5AW1 B;  3MUD C;  1AQ5 A;  1RNI A;  2I1K A;  2BQ1 E;  1Y8A A;  1AF8 A;  3L72 J;  5EW5 E;  3I5C A;  4H13 B;  5CCG C;  3L72 D;  3CCR P;  2R3S A;  3WU2 H;  3NTE A;  1SQB J;  1BE3 J;  3L73 G;  2KOP A;  2D2C D;  3H1L E;  2EIA A;  5AW3 B;  2ZFC A;  2IYO A;  2OGU A;  2WTY A;  1SS1 A;  1NU1 K;  2KUB A;  1U7J A;  3C8V A;  2FAC A;  2PRR A;  1L0N D;  4EI2 A;  1SFC C;  1BCC J;  3RK3 C;  3K5B A;  3CC2 P;  1IFN A;  1H0T A;  2P10 A;  1MKM A;  1YTZ T;  1RH5 B;  3TNU A;  4YPC A;  1KQS O;  3S1K A;  2JU2 A;  1BGY G;  3ABV C;  4IOI H;  1IMP A;  3H1I G;  2DGY A;  2L5G B;  1Q82 Q;  2E75 B;  4WY4 D;  2WT7 A;  5DJT B;  3QH9 A;  2WT7 B;  2YKO A;  2LOL A;  1L0L D;  3SWK A;  3L75 J;  4AUW A;  1SQV E;  3MP7 B;  2WSF H;  3RBX A;  1HJB A;  2R5B A;  1AV1 A;  3PTZ A;  5GTI H;  1PL5 A;  3H1H E;  5CCG D;  1L0I A;  1LTA C;  3Q20 A;  2KNC B;  4QMA A;  1NTZ J;  1VQ9 P;  3NXS A;  2C0W A;  4JF7 A;  2O1J A;  1ZLL A;  4TLF A;  1SQV K;  1FDM A;  1MZ9 A;  2N1T A;  4JYB A;  1Q7Y Q;  2M0B A;  2RH0 A;  5AVY B;  3CXH H;  1NTM G;  3WU2 E;  2PP6 A;  1YHQ P;  1S2E A;  2KZI A;  4D6T G;  1ZNV A;  3G28 A;  2OTJ P;  1LT9 A;  1N73 C;  1FZB A;  2N98 A;  3H32 A;  5AVW B;  1YIJ P;  3H1I D;  1S5L E;  1IK7 A;  1L0N E;  4R4M A;  2L9F A;  1J1E C;  1RF0 C;  3KDP B;  1VF5 D;  3HTK A;  3A0H H;  5APX A;  2GUS A;  3NMD A;  4YXW H;  1S9K E;  3T97 A;  2FAD A;  3DS2 A;  1USE A;  1LGH B;  1L4A B;  2LL8 A;  2Q5U A;  1BCC E;  1JY2 P;  5GTH H;  3BVH A;  2JKV A;  1A02 F;  1M90 Q;  1NTZ K;  1R5L A;  3L71 D;  1Y47 A;  3TDK A;  1JTH B;  4PXH B;  5AVT B;  1IFM A;  3VMZ A;  2WPQ A;  3P32 A;  1M74 A;  3B8E B;  2PFX A;  3WUT A;  1RE4 C;  5BU8 B;  1VF5 C;  3L75 G;  3P8C E;  1UJZ A;  1NU1 J;  2E1M A;  2E76 C;  3B71 A;  3H1I E;  4GR6 A;  2Q3I A;  3V2Q A;  1R8E A;  1SQP J;  1J1D C;  4D6T J;  3L70 G;  5BS1 A;  4U3F E;  1ZRT D;  4ZKU A;  4HYT B;  1VPC A;  2KGE A;  3KHU A;  5KAI E;  3O6Q B;  4NEO A;  1SQB E;  2GUV A;  4U0C A;  1DD3 A;  1PP9 J;  3AE1 C;  1QEX A;  2X2B A;  1JTH A;  4RES B;  4YXD C;  5F2N A;  2Y0E A;  3CD6 P;  1MFZ A;  5KLV E;  3M0D A;  1HJ0 A;  1FOS F;  5CMZ A;  1KIL B;  1F80 D;  1M6N A;  2IX7 C;  2WMM A;  2MR8 A;  1A8O A;  2A06 E;  3R2P A;  2GYK A;  2KSE A;  1KFM A;  3BCC J;  2CK3 H;  2KYV A;  5M1B A;  2KR5 A;  1OW8 A;  2H7H A;  2J5U A;  4OGQ C;  3MIW A;  4HJG H;  3WBH A;  2E5Y A;  2YMK A;  4L76 A;  2O1K A;  3L73 E;  5KTB A;  4PV1 B;  1VF5 B;  1KOR A;  3DS5 A;  4U0D A;  3L75 E;  3D6Z A;  3AE9 C;  2ZYA A;  1IFD A;  5AVV B;  3EJD A;  3D70 A;  3SWY A;  2C9L Y;  2GA1 A;  1M1J C;  2Z46 A;  3HE5 A;  2IBZ I;  2BCC E;  1FZC A;  1SQQ K;  2V7Q H;  1KIL A;  4AYC A;  1NTZ E;  3N7N A;  3L37 A;  1J1D B;  5KJ7 D;  2KNC A;  1GD2 E;  1AUM A;  3HZQ A;  5EFW B;  1GXG A;  3DS0 A;  5AVQ B;  3RK3 D;  1NKZ B;  2YMY A;  1IJD B;  2ITA A;  1IFJ A;  1PGO A;  1OIP A;  1LP1 B;  1D7M A;  2L4B A;  4COP A;  2GDW A;  2PEO A;  4IFD K;  3G0V A;  1TU3 F;  2KG6 A;  3GMA A;  1BDD A;  1KB9 D;  4WY4 C;  1FZF A;  5KJ7 C;  1HUC A;  2WSE H;  3RL0 D;  4CPG A;  2XND H;  4D6T E;  4H44 B;  2ROQ A;  2FY8 A;  2QE7 H;  3E1I A;  1LTS C;  4EYY Q;  1X22 A;  3LID A;  2QVA A;  4HB1 A;  4DJG A;  5APW A;  4ASV A;  2GZJ A;  1SQB K;  2FYN B;  3JC2 2;  2KGC A;  1ZW0 A;  3AE8 C;  2K93 A;  1G2C B;  1VQP P;  2IYP A;  1L0L K;  2OYH C;  2FYZ A;  2QM8 A;  3CL3 D;  5APT A;  5AVU B;  2E5T A;  3W68 A;  3L74 J;  3V6I A;  1JCD A;  2Y0C A;  1OVR A;  3CCU P;  1LTT C;  2GDX A;  1X79 B;  1A02 J;  4ZNC A;  4OGQ D;  2KP8 A;  3AEE C;  1SQV D;  1NTK K;  1HVV A;  3BAT A;  3RK2 C;  2VLP A;  1P84 I;  2FYU J;  2YXR B;  4DZO A;  1K05 A;  1AVO A;  2AEM A;  3I56 P;  3JCU E;  1BCC D;  1KYO E;  1SQX E;  3A7O A;  2Z4E A;  2PEM A;  1NTK G;  1ZP0 C;  2AEJ A;  2W90 A;  1GZL A;  1RQU A;  1NWQ A;  3HE5 B;  4PV1 D;  4UB8 E;  4GKG A;  1HWT C;  3HD7 B;  2XXM A;  1N73 B;  1PZQ A;  3H1J G;  1K04 A;  3DS3 A;  1LWU B;  2DNW A;  2IFM A;  3A5T A;  3M06 A;  1SQX K;  3G1G A;  3RG2 A;  3E7K A;  2MF4 A;  4A7P A;  5TIS H;  3II6 A;  2FXP A;  2RKL A;  1VQN P;  2YNY A;  2K0Y A;  1SQX G;  4H0L D;  5HVC A;  4BWN A;  2E76 D;  5KP6 B;  1N8R Q;  3G3Z A;  1L2P A;  1BSN A;  3S9O A;  3M9H A;  3L72 E;  3CXH E;  5DCK A; 
#chains in the Genus database with same CATH homology
 1NJI Q;  1A8O A;  4XRQ A;  2PEJ A;  2OTL P;  2OAR A;  2CWO A;  1VQ4 P;  1KC8 Q;  5HGO A;  1E6J P;  1VQP P;  3DS2 A;  2KOD A;  2DGY A;  2PEI A;  1QVG O;  1K9M Q;  4U0A A;  1Q82 Q;  1ZMB A;  1QRJ A;  1YIT P;  3CCL P;  1VQ7 P;  2P9X A;  2QEX P;  1QVF O;  3WBH A;  2PY8 A;  3CCU P;  1YJN P;  1M90 Q;  3CC4 P;  2EG5 A;  4XRO A;  2JO0 A;  1VQO P;  3G71 P;  1JJ2 O;  1M1K Q;  5HGL A;  3CMA P;  2XV6 A;  3DS5 A;  4U0D A;  1VQ6 P;  3DTJ A;  3E2D A;  3H4E A;  1VQK P;  1VQL P;  3CCJ P;  3G29 A;  4GR2 A;  3CCE P;  4WYM A;  4IPY A;  1M74 A;  3Q20 A;  1EIA A;  2L6E A;  2Z46 A;  3CCM P;  4XFX A;  1VQ9 P;  3DS4 A;  2Z44 A;  4PH0 A;  3I56 P;  1Q81 Q;  1KD1 Q;  3CCS P;  5F2O A;  5I4T G;  4XFY A;  1RO2 A;  1PEM A;  1M6E X;  2E1M A;  3CME P;  2PEM A;  1RNI A;  4GR6 A;  3G21 A;  5HGN A;  1VQM P;  1W2B O;  2BQ1 E;  2QA4 P;  1S72 P;  2Z45 A;  1Q7Y Q;  3CC7 P;  5BS2 A;  1PEO A;  1AUM A;  3HZQ A;  3H47 A;  5BS1 A;  1YJ9 P;  4U0B A;  2XT1 A;  3B5I A;  3DS0 A;  1YHQ P;  1A43 A;  3G4S P;  3CCR P;  1VQ8 P;  3G28 A;  3CXC O;  2OTJ P;  3P05 A;  2BUO A;  2XXM A;  3CCQ P;  3NTE A;  3DS3 A;  4U0F A;  1IUQ A;  5F2K A;  1RO0 A;  4M0I A;  2EIA A;  3H0D A;  3CPW O;  1EOQ A;  3I55 P;  1PEU A;  4COP A;  2PEO A;  2LF4 A;  2BHV A;  1PEQ A;  3G1G A;  3G1I A;  3DPH A;  4U0C A;  1K30 A;  2JYL A;  2M8N A;  1YIJ P;  4XFZ A;  3DS1 A;  3M1M A;  4U0E A;  4QNB A;  1YJW P;  1Q86 Q;  2JYG A;  3G0V A;  3G26 A;  2EFJ A;  5HGM A;  5JPA A;  2PEN A;  1D1D A;  3HYB A;  4COC A;  1K8A Q;  3CC2 P;  2PEK A;  1VQN P;  3RG6 C;  2ONT A;  5F2N A;  3G6E P;  1K73 Q;  3CD6 P;  2M8P A;  3CCV P;  2PEQ A;  3MGE A;  1N8R Q;  3VRL C;  3LRY A;  3OW2 O;  1BAJ A;  1KQS O;  4PH1 A;  1VQ5 P;  1YI2 P;  2M8L A;  1M6N A;  5DCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...