1VQ5P

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq5P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq5P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq5P02
1VQNP 1YIJP 3CMEP 3OW2O 3CC7P 1VQ7P 3CC2P 1VQ5P 1QVFO 1K8AQ 3CCJP 1W2BO 1Q81Q 1KQSO 3CD6P 1KD1Q 2OTLP 3CCQP 3I56P 3CXCO 3CCVP 1M90Q 2QA4P 1VQMP 1Q86Q 3CCRP 1Q82Q 1VQ4P 1VQOP 1VQKP 3CCLP 1YHQP 3CCSP 1Q7YQ 1YJWP 1VQ9P 1VQLP 1YJNP 1YI2P 3G4SP 3CCMP 1K73Q 1VQ8P 3CC4P 1K9MQ 1QVGO 2OTJP 3G6EP 3CPWO 3I55P 1N8RQ 3CCUP 3CMAP 1M1KQ 1VQ6P 1NJIQ 1S72P 1JJ2O 1VQPP 1KC8Q 1YITP 2QEXP 3CCEP 3G71P 1YJ9P
chains in the Genus database with same CATH superfamily
3NFQA 4BRYB 1H8AA 5HGLA 2M8LA 4RESB 1K30A 3NXSA 5GTHE 5AVQB 3JCUE 4N78D 1HWTC 2BCCJ 2L22A 2KLUA 3L75E 4NEOA 1LTJB 1NU1G 2JO1A 2YKPA 3CMAP 1M1JB 2XZRA 2KXPB 3GZLA 1JY3O 4WY4A 1LTGC 5AVSB 4C7RA 1RF1A 3BASA 4HJGH 2K1AA 1X3OA 2LF4A 3B5NB 4IL6E 1A8OA 2Y0CA 3PH0A 1Q2NA 1BDDA 3MUDA 5BU5A 2FAEA 4C7NA 2Q7CA 1W5CE 2WT7B 1L0NK 1DNYA 2C9LY 2KG6A 3L71E 1SQXD 3B71A 5KLVD 1CEIA 1GTWA 1NTZK 1VKUA 1OR5A 2PNGA 2ZVNB 1BCCD 1NTKG 2GUVA 1EDJA 4N78E 1HH0A 1VQ7P 3FX0A 1DIPA 2KOOA 2QJYC 3HUSA 3AE5C 2MVUA 1URQC 3H1ID 4JBZA 3DTJA 5APQA 1K73Q 1DH3A 5KLIC 3RG6C 2QJKB 1BGYD 1RO2A 1L4AB 2MJZA 1GL2A 3HE5B 2K94A 1GW4A 2V7QH 2FBWC 4ZKUA 3CI9A 3RBXA 5EJDA 4L76A 1FU1A 1BE3G 1FZFA 3WUTA 4BRYA 2HODB 1NTMD 1EMVA 1PPJD 3C8VA 1XTGB 3L71G 4N3YB 3AEBC 1YIJP 2CGQA 2ZYAA 4A7PA 3MTUE 3GHGA 2J59M 1ZR4A 2WPQA 3A0HE 1RE4C 2AXTE 1NU1E 1JOCA 3F89A 3JSVC 3CCSP 5HGNA 1BE3D 1IUQA 2IDBA 2E74C 2BEZF 2OYHA 4HYTB 1OW7A 1RE3A 1JJ2O 1KILE 1FZCA 3TGUE 1KV4A 1YYCA 2WWWA 2QVAA 5APUA 1FZEA 2M5RA 1FAVA 3G3ZA 4KT0J 3B5ND 5DJTB 3CCRP 2NRGA 1YI2P 3EQ2A 2QG4A 3TK1A 2KODA 1JY3P 3V4WA 2P7JA 3R4YA 5HGOA 3H1JE 5KKZC 1FJPA 4HB1A 1HTLC 2IZ1A 2XNXA 1X22A 3TSIA 1BGYG 1GU4A 2KS1A 2A06E 3AE3C 4Y99C 4H13D 2KWLA 3AEAC 5B66H 1RE4A 3U1AA 2JJLA 2N1TD 1A43A 5APYA 4KHXA 1HF9A 3G71P 2RMZA 1RF0C 4U3FJ 4XFZA 4GDOA 1BSNA 2E76C 1KB9E 2QM7A 2ITAA 2IFNA 1PEQA 2R44A 1PEOA 2OYIB 1E6JP 3TGUG 2N5HA 2JWDA 3BRVB 1ZW0A 1Z6MA 1L4AD 2CG5B 1NYHA 1XTCC 2E75D 3HE4B 1S1CX 2N9BA 2N1TB 3JCUH 1KMIZ 2K9JB 2WSEJ 1L0LJ 4N6JA 3SFEC 3G0VA 3L75D 4IL6X 2QJPB 2GZJA 2ZJSE 1MZ8A 3TGUJ 3CWBG 3NTNA 2YIUC 4C46A 2OTLP 2Q9IA 2AF8A 2BCCE 3H32A 2AEJA 4BPGA 3DS5A 1SQBD 3DS3A 4K3AA 2Z5HA 1JO5A 1VQ9P 1LWUB 4PXHB 1E5WA 3AE7C 2Q3EA 2GDYA 1SQPK 2B87B 2P9XA 1EZVD 2KLVA 3AE1C 3H1KE 5EW5E 3GHGB 3H4EA 1IMPA 4H2XC 2GDWA 1LWUC 5KLVK 1GXGA 1IFMA 5DCKA 4NPFX 1OFCX 2LL8A 1BDCA 1IFJA 1N7SC 3GF7A 2WVRA 3H1IE 1PGPA 2O01J 2QA4P 3KZIE 2R3SA 4AUWA 3GHGC 1NU1J 5KKZB 2WSSH 1ACPA 1U7JA 1S5LE 1PFIA 2MY5A 2WSFJ 2JU2A 1KYOH 5CBOA 4U3FD 4F37A 5CBNA 2XV6A 2KG8A 1ZLLA 1Q7YQ 1M56D 3PLNA 3L73E 1X9VA 4BPHA 2JKVA 3EFFK 1KYOI 1W2EA 4RO0A 3LRYA 4CA3A 3I5CA 1SQXE 3CCQP 3L73J 1DEBA 2FYNC 2KOSA 2WQYC 1VQKP 2XZ1C 1SLQA 5GTIE 1VQLP 2IZ0A 2EHTA 1IFNA 1T8ZA 2ZXXA 1NTKJ 4XE5B 1FZBA 3FXDA 1IK7A 2W27A 1LGHB 1KFMA 2N9YB 1R5SA 3AE2C 3S4RA 2GUSA 1AV1A 3L70D 1YHQP 2YO3A 5K5GB 2YKQA 3RL0B 4PV1B 3H1JD 2XU6A 2V4HA 4W7ZA 3H0DA 1IFDA 5AW9B 2GZFA 3SWFA 2KB7P 4MRTC 1OW6A 2IYOA 3H1KG 3VMYA 2BQ1E 2W6BA 3AEDC 1U57A 1LTSC 3M9HA 3OAKA 1L0LE 1ZXGA 1FR2A 3O6QB 1H89A 3AE6C 1Y8AA 1CI6B 1S3JA 2KUBA 3A2AA 5KLVG 1N7LA 1P84H 1T3JA 4Y28J 3DS2A 1M1KQ 3L74G 2IPPA 2NPSC 3M0DC 3R2PA 3BVHA 4PV1D 4UB6H 1EOQA 3GMAA 5F2OA 1BE3E 2BCCG 3L70J 2O1JA 4MN4C 2K92A 2K9JA 5L8RJ 1KZUB 2EFJA 5AVRB 3HYBA 2WPSA 3H1IG 1KILA 4K35A 3P32A 2HPCA 1SQBJ 1JCCA 2Y0EA 5KJ7C 1ZOYC 3Q3DA 2K2QA 2L0QA 3B4SA 1JEKA 4JQ0D 1JMBA 1NTZJ 1FZGA 4H0LC 3CCMP 3G28A 1AVYA 2GZIA 4ZMDA 4IPYA 1ZMEC 5HV8A 3VMXA 3BCCJ 3Q2YA 1P84I 2Q3IA 2GM4A 3CMEP 5TJHA 1NTZE 4D6TG 3H1HJ 2R3CA 4W80A 2N98A 2FQ2A 2FACA 1RE3C 2P58A 4PD4I 2NPSD 3FWLA 1ZNVA 3U1CA 3U43A 1SQBG 3CX5D 4TT3H 3V4QA 4UB8E 4UB8H 5H2FE 5CCHC 2HLOA 4WYMA 3H1LG 5CCGC 3M91A 2JO0A 1FC2C 1IC2A 1Z56A 3CXCO 1FOSF 2WZ7A 1D1DA 2P10A 3PRJA 2KSEA 2K93A 3WUUA 3EFGA 2Z44A 4WB4A 1M8OB 2IBZI 2Z4EA 5GTHH 2GDXA 3OW2O 2R5BA 2LOLA 2LKMA 4BPFA 1LT9C 1SVFA 2FXPA 3PJSK 4L74A 2KG9A 1E79H 3HTKA 2HR3A 3H32B 1T2KD 3MP7B 2H88C 4GODA 2MKVA 5KAIH 1SQBE 1GMJA 1D7MA 5AW2B 1JMMA 2E75C 2O01H 4H0LB 3RL0g 1BXIA 3GF3A 3RBZA 1LTTC 2ZVOB 4I1LA 3OA7A 3CX5I 1NKZB 2E43A 2WPVB 4OGQD 2MF4A 2YXQB 5APXA 5CMZA 2ZAEB 4H13C 1NH4A 3MD0A 2M8RA 3CD6P 3CCVP 4OVNF 1VQMP 2JYGA 1H0TB 1VPCA 3MHVA 2I1KA 2CWOA 1EXJA 1SQXG 2JBGA 1NTZG 1PGQA 1S72P 2WSEH 2HPCB 1KORA 2W6JH 3M1MA 3P7KA 3RK2B 2KSJA 3RG2A 3ITKA 1FZCC 1JTHB 1VQ4P 1IJDB 2WMMA 4PH1A 2ZFCA 3II6A 1RY3A 5EFWB 2AFEA 2BASA 2PEQA 2FADA 3H47A 2XXMA 4YXWH 2M5AB 1LJ2A 2LR2A 3SWYA 3RK2D 1Q86Q 1RF1B 5TISH 3H1LJ 1IK9A 1SQVE 2FVAA 3F5HA 5KLVJ 1KQLA 1SQQD 2O01N 1PV3A 1AQ5A 5M1BA 1KILB 1OW8A 4EYYQ 3H1HG 4HKGA 1NVOA 1Q81Q 1EZVG 1PGJA 4U7JA 3V2NA 2KP8A 1KQGB 3A7OA 2FFDA 3KDPB 2N50A 3RK3C 1VQ8P 1ZMBA 2MR7A 1ZP0C 3AEGC 3MGNA 2ROQA 1JY2N 5C39A 1A02F 2HG5D 4WY4C 2QJKC 3H1LE 4H0LD 1KILD 3MGEA 2JWAA 3M0AA 5APTA 2RN0A 2WITA 2PFXA 1EIAA 4OGQB 1QLED 3CL3D 3JC22 3HE5A 4U0AA 5HVCA 4EIJA 2AXTH 1S9KE 1R8EA 5CCGA 1LT9B 4YTPC 1ZRTE 2L6EA 1OVUA 4IFFA 4PD4H 2QSIA 3I56P 1JCDA 2YIUB 3MZWB 1FDIA 1YQ4C 4L73A 4TLFA 2B88A 2QJYB 1SQQK 3G4SP 2XKMA 3HZQA 3G6EP 1SQXK 2V7QJ 1UIIA 1LTJA 3KPEA 1WRGA 2KGCA 3L72E 2LXBA 2OYOA 3KXDA 5CJ0A 4O9BA 1KB9D 1SQVK 2W90A 1EDIA 1SS1A 1N8RQ 4C7NB 1EQ7A 1VQ6P 2QE7H 2L9FA 1X8YA 3IR9A 2QM8A 4R4LA 1MFTA 2FYUD 5AW6B 1H0TA 4GKGA 1J1DC 1BCCJ 3B5NA 3E7KA 5AW7B 3RL0D 4XROA 3AE4C 1HQBA 3NMDA 1G1IA 2CNRA 3P05A 2NO8A 1LT9A 1SQVG 4Y99B 3RL0C 1NWQA 1GDTA 3D6ZA 2IBZG 4H44B 2KOPA 4OGQC 1LTJC 5KLIB 3V5BA 2AXCA 1RHZB 3LIEA 1NU1K 1GD2E 1L0LD 4DJGA 3L4FA 5JPAA 2EG5A 3O8ZA 1KB9H 1K04A 2M8NA 4U3FG 1OIPA 1CZQA 3B5IA 3L74E 1K05A 1PIXA 1KYOE 2JB0A 2Y9YA 1QRJA 1RO0A 1SQPD 3WUVA 2LPKA 2KI7B 3GW6A 2PEJA 1SQQJ 3AECC 1PL5A 1JY3N 5TISE 3HE4A 4KJMA 1YQ3C 2WTYA 2KZIA 1LTBC 1SQBK 3KZIH 2B87A 3M0DA 1FS0E 3L72J 3FWNA 1PPJE 3H1HD 1L0LG 5CCHA 2FVFA 1LWUA 2AVAA 2FYUG 2H89C 5AW5B 1RQVA 2JDIH 3H1KJ 3TYYA 5B5EH 3RGUA 1USEA 3D70A 3CCEP 3A0HH 1URQA 2E74D 2A06G 3ZDMA 5AVVB 3VYIA 2L91A 1GXHA 2KS1B 1N73A 3GJNA 3EWKA 1SQQE 2ZYGA 1L0LK 1NTME 5AW4B 3VMZA 5KAFH 1AQTA 3IN6A 2N5IA 3L72G 1OZHA 3U59A 2KGEA 2QJPC 3E1RA 2E5YA 4XFXA 1HGZA 2WPTA 2JEEA 3L72D 2PGDA 3RK3B 2OYIA 2PEMA 2KORA 3CWBD 3PTZA 5I4TG 2JAZA 2W6AA 3V2PA 3A0BH 1JM0A 3L35A 2M0BA 2BEQD 2ZT9B 3KYQA 4IFMA 2FYUE 2O1KA 1N7SA 4AQRD 1RQUA 4I7ZB 2KIKA 5E79E 3N7NA 4DCKA 1IO4A 2CK3H 3CXHH 5B5EE 2RKLA 4DG9A 4L75A 2VLQA 3Q5RA 2GZGA 1AYIA 3P8MC 2WSCH 2Z46A 2G3AA 5AVXB 1PP9D 1BCCE 1EXIA 2WSCJ 3CXHD 3BATA 1PP9G 1M74A 2POHA 2LKIA 4NPDA 3G29A 1NTMK 2FQ0A 2D2CB 3QWOC 2E5TA 2OTJP 1AA0A 2VLPA 3L36A 2ONTA 1FJKA 1KC8Q 4PJ0E 2WSFH 2N6YA 4PH0A 1VQ5P 1GK6A 1RH5B 4I6MC 1E0HA 5AW3B 3MUDC 5B66E 2OQQA 2PEIA 1FZAA 4IL6H 1MKMA 1VF5B 3E1IA 3P8CD 2LXCB 2C0WA 1IFIA 1J1DB 2E74B 4UHPB 2E76B 4M3LA 3WU2E 2H43A 3G21A 2AFDA 2L4BA 1LNQA 3W67A 2Q5UA 3BRTB 2YKOA 4EI2A 1YTZI 1UIXA 1IZNB 4JF7A 1NU1D 1KILC 1UNKA 2JQ4A 3I55P 4HKZH 2PEOA 2K37A 1SFCA 3GZMA 4EDFA 3CWBJ 1SQPJ 1L0NE 2Z5IA 3NY7B 2NPSB 1PPJG 3L70G 3S9OA 1J1EC 4U0EA 1NTZD 4GT1A 4PWVB 1NHLA 3T97B 3HRNA 3CC4P 1OMIA 1QGKB 4WY4B 3HD7D 1EZVE 1QX8A 3CLQA 2QRXA 3H1JJ 4XFYA 2PRRA 2KR5A 2Q1KA 1EDLA 3D6YA 2KOQA 1MV8A 2O3JA 2BHVA 2FQ1A 4ASWA 2VSQA 1T8KA 2FY8A 1CSBA 1GL2D 3G9RA 2A45I 1SQPG 2AEMA 3DS0A 1U7MA 1BCCG 1NTKD 3L73D 5KTBA 1MFZA 3HD7B 2KGAA 2MVVA 5AW8B 5CJ4A 4RJTA 1J2JB 3NTEA 1DD3A 3EJBA 5AVWB 4R0MA 3S1KA 1NOHA 2J5UA 1PP9E 1KTMA 1YITP 5HGMA 1RNIA 1TU3F 1BAJA 1WT6A 4R4MA 4XRQA 1W2BO 1JY2O 3AEFC 2JGPA 1S9KD 3DS4A 1S2EA 1NAYA 4DZOA 2KGDA 3GG2A 2NPSA 4Z1MH 3BCCE 3G1IA 2KYVA 1KQFB 3W68A 1FBMA 5CHXA 2OTKE 2XT1A 2KW2A 1PGOA 1JUNA 2YXRB 1BSHA 3B8EB 3IAOA 1RF0A 1KQSO 1SQPE 2G8YA 2EIAA 3VN0A 2B9BA 2NZ2A 4GR6A 1PP9J 1JTHA 4GOEA 2JYLA 3M06A 2OYIC 1P84D 4IZ6A 1HJ0A 1PEUA 2PP6A 3V2RA 5APSA 3H1IJ 3IF4A 1BE3J 3L70E 2L5GB 2R32A 2KNCA 2VRSA 1S5LH 2VLNA 1Q90D 2IYPA 4YPCA 1Q82Q 1VDFA 2H7HA 3CPWO 3CXHE 3EJDA 5AVYB 5E79H 1A02J 3PHLA 4H44D 3FXEA 4D6TE 1IMQA 4AYCA 4H44C 5AVUB 3OJAB 2GA1A 1L0NJ 3Q1MA 1KN7A 1LTIC 3HTKB 1VHNA 1T3UA 2EHSA 3TNUB 3CWBE 2W83C 4NPEA 4W7YA 3L37A 3L75J 4U3FE 3RK3E 4PJ0H 3L74D 2YMKA 4I2LC 2KNCB 1NTKE 5F2NA 4DOJA 2PENA 4XA4A 1FDOA 1L0IA 2LMLA 1N7SB 1Y47A 2QNWA 5KP8B 1NKNA 2FYUK 1OXZA 3CC7P 3H25A 3C9IA 2FYUJ 2HYNA 1YJWP 2FXOA 2PY8A 4COPA 2B89A 1OVRA 2XZ0D 3BCCG 3CC2P 1NGMB 3M9BA 2FYZA 1M1JC 1M6EX 3V2QA 1SQQG 2CPBA 5GTIH 1JNMA 5APVA 1S5LX 4COCA 2HFED 2PEKA 1VL2A 1CI6A 1L0HA 1AJYA 3O6QA 5AW1B 1K8AQ 3G1GA 4U0CA 1KFNA 4IFDK 2CPSA 4JYBA 5DJUB 2C0XA 1ZR2A 1SFCB 1LT1A 5KP6B 2XDJA 1FZCB 4IOIH 2ZT9D 4H13B 2MD9A 1GZLA 4GOFA 3Q20A 2K0XA 3ABVC 1N86A 2K0DX 1T6AA 3A5TA 5KLVE 1ZV8A 1EZVI 1T2KC 5AW0B 2KZJA 2DGYA 1SFCD 3L75G 1M6NA 2MR8A 1L0ND 2CQ8A 1YJ9P 1NTMG 2FKWB 2I8DA 1DEEG 3CCJP 2VLOA 1GW3A 3USSA 1HUCA 2X2BA 1AVOA 1H88A 4WWIA 3UIAA 5KJ7D 3VOPA 4GR2A 1GU5A 2SPZA 2UWJE 2IX7C 1L0NG 3VTPC 3T97A 1L2PA 4EOTA 2D2CC 5F2KA 4H2YC 4XFJA 3FGAD 3Q5SA 1WMKA 1P84E 1LTAC 2KK7A 2ZXEB 1NTKK 3VMAA 2P1JA 2K88A 2LTEA 4B86A 1HJBA 1YBKA 1SQVD 3AE8C 3CX5H 2LIWA 4PD4E 1QL2A 1VQNP 3CE7A 2W8ZA 5KAIE 5CCHD 2ERHA 1QEXA 2FFDB 4WVZA 2FXMA 3AE9C 1KD1Q 3SFDC 2M8PA 2C9NY 2OYHC 1SFCC 1VQOP 2WT7A 3CXHI 4I7ZC 5CCGD 2P2UA 4OH8B 3D71A 2AEFA 1N2DC 1LP1B 2QEXP 2FYNB 2A45G 1M1JA 2BUOA 3G26A 4D6TJ 4RKUJ 4QNBA 1MZ9A 3BCCD 3CX5E 3LW5J 3H1LD 3A0BE 2M5AA 4WY4D 1NAFA 3HUSB 3A3YB 1X0TA 3AEEC 3RK3D 1BGYE 2XNDH 5AVTB 3B4QA 4PV1C 1UJZA 2N1TC 1AUMA 3WBHA 2K3RA 1F80D 2ZYDA 3Q5PA 1DV5A 1M57D 1PEMA 1QL1A 2M3BA 1NQ4A 3QH9A 1PZQA 1G1JA 2OGUA 1URQD 2IFMA 3GLMA 3DPHA 1QVFO 4LC1A 2YNYA 5AVZB 2YMYA 2YO2A 2RH0A 3LIDA 1NTMJ 2FHSC 2JP3A 1AFOA 3L74J 2N6ZA 3E2DA 4QMAA 2Z45A 3L71J 1YTZT 2K5XA 2E42A 1HBWA 1DD4A 4ZKPA 1IFPA 2WPRA 1SQXJ 4H2WC 2E75B 1ZN5A 1S4XA 1GL2C 4JYCA 3WU2H 3TF5A 2K9YA 3K5BA 1Y9BA 2D2CD 1G2CB 3H1JG 1X79B 2FFDC 1FDMA 4U0BA 3TNUA 1YJNP 1N73B 2FVEA 1SP4A 2IBZE 1M7LA 4U0DA 1SQVJ 1J1EB 3TDKA 1JY2P 4ZNCA 4GIFA 1OWAA 3M9QA 1G2CA 1HVVA 4UB6E 2KOGA 1AF8A 1L4AC 1VF5D 2GZEA 1GK4A 2A45H 2A06D 4PD4D 1OX3A 2E76D 3C1LA 2N1TA 1NJIQ 3RK2C 2OYHB 2OARA 3KHUA 2P67A 3GKLC 5BU8B 3VP8A 2M3EA 3P8CE 4U0FA 2JR8A 3HD7C 1BGYJ 3CCLP 1KLPA 1KYOD 4BWNA 5BVZA 2Q6QA 5CZDB 1VQPP 3WMM0 2HODA 2R5DA 2K0YA 5BS1A 7CEIA 3LW5H 2DW3A 1RF1C 2XV5A 1OVVA 3HUSC 3SSUA 1M90Q 3TGUD 2IBZD 4LGDE 5BS2A 4HH2A 1JB0J 3EJEA 1KB9I 4OWFA 2E1MA 4D6TD 2J58A 1L4AA 3VRLC 3CCUP 3B5NC 4BXLA 2I1JA 1URQB 4DT0A 5KJ7A 4JPZB 3N4XA 1GPJA 2DNWA 4M0IA 1VF5C 1EDKA 3IFMA 3LMOA 1DX7A 1HGVA 2BCCD 4LLHA 1N73C 2ZT9C 1NO4A 4WBAA 1GL2B 3DS1A 5H2FH 1N7SD 1FE6A 3H6PA 3V6IA 1MUUA 1LP1A 5KAFE 3SWKA 1K9MQ 1QVGO 1CW5A 1FOSE 2QIWA 3H1HE 3VP9A 2Y9ZA 3L73G 1USDA 3MIWA 1HY8A 4YXDC 3PP5A 2PAJA 4QKOA 2H8PD 2Y0DA 3KQGA 1R5LA 3H1KD 4CPGA 2JU1A 3L71D 4ASVA 3HD7A 1ZRTD 2LIUA 5APWA 2GYKA 5KP7B 1EC5A
chains in the Genus database with same CATH topology
3M1MA 3CC7P 2L6EA 3B5IA 5HGLA 4XFZA 2M8LA 3G71P 1K30A 2BQ1E 4U0FA 3CCJP 1KQSO 2EIAA 3I56P 3CXCO 2QA4P 1QRJA 1VQ4P 4U0EA 3CCLP 1AUMA 4GR6A 1RO0A 3WBHA 1YJWP 1PEOA 1PEQA 1D1DA 1E6JP 4GR2A 2JYLA 3G4SP 2PEJA 2PY8A 3HZQA 3CC4P 4PH1A 3G6EP 4COPA 1PEMA 3CMAP 1PEUA 3DS2A 1M1KQ 2Z44A 2Z46A 4XFYA 1VQPP 2PEQA 1EOQA 5BS1A 5F2KA 1YIJP 3OW2O 3CC2P 3H47A 2XXMA 3DPHA 1QVFO 3G0VA 5F2OA 2XV6A 2BHVA 1M90Q 1M74A 1Q86Q 1Q82Q 5BS2A 3G29A 1M6EX 3CCSP 1Q7YQ 2EFJA 2LF4A 3E2DA 5HGNA 1IUQA 1A8OA 2Z45A 3HYBA 2OTJP 2E1MA 3CPWO 1N8RQ 3DS0A 3VRLC 3CCUP 4COCA 1VQ6P 2PEKA 2ONTA 1JJ2O 1KC8Q 3CCEP 2OTLP 1VQNP 3LRYA 4PH0A 1VQ5P 4M0IA 3NTEA 1K8AQ 3DS5A 3G1GA 1Q81Q 1KD1Q 4U0CA 3CCQP 2M8PA 3DS3A 3CCRP 3DS1A 1VQOP 1VQKP 1VQ9P 4U0BA 1VQLP 1YJNP 1YI2P 2PEIA 3CCMP 3G28A 4XROA 1VQ8P 1K9MQ 1QVGO 4IPYA 1ZMBA 4U0DA 2P9XA 3P05A 2KODA 1YITP 5HGMA 2QEXP 3Q20A 1RNIA 4XFXA 3G21A 3CMEP 5HGOA 2BUOA 1VQ7P 1BAJA 3G26A 4XRQA 1W2BO 3MGEA 3CD6P 4QNBA 2PEMA 3CCVP 1VQMP 3DS4A 2JYGA 1YHQP 3H4EA 3G1IA 5I4TG 3DTJA 5F2NA 1EIAA 2CWOA 1K73Q 2PENA 3RG6C 5DCKA 3I55P 2DGYA 5JPAA 2PEOA 4U0AA 1A43A 3H0DA 2XT1A 4WYMA 1NJIQ 2EG5A 1S72P 1RO2A 1M6NA 2OARA 2JO0A 1YJ9P 2M8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN P;  1YIJ P;  3CME P;  3OW2 O;  3CC7 P;  1VQ7 P;  3CC2 P;  1VQ5 P;  1QVF O;  1K8A Q;  3CCJ P;  1W2B O;  1Q81 Q;  1KQS O;  3CD6 P;  1KD1 Q;  2OTL P;  3CCQ P;  3I56 P;  3CXC O;  3CCV P;  1M90 Q;  2QA4 P;  1VQM P;  1Q86 Q;  3CCR P;  1Q82 Q;  1VQ4 P;  1VQO P;  1VQK P;  3CCL P;  1YHQ P;  3CCS P;  1Q7Y Q;  1YJW P;  1VQ9 P;  1VQL P;  1YJN P;  1YI2 P;  3G4S P;  3CCM P;  1K73 Q;  1VQ8 P;  3CC4 P;  1K9M Q;  1QVG O;  2OTJ P;  3G6E P;  3CPW O;  3I55 P;  1N8R Q;  3CCU P;  3CMA P;  1M1K Q;  1VQ6 P;  1NJI Q;  1S72 P;  1JJ2 O;  1VQP P;  1KC8 Q;  1YIT P;  2QEX P;  3CCE P;  3G71 P;  1YJ9 P; 
#chains in the Genus database with same CATH topology
 3NFQ A;  4BRY B;  1H8A A;  5HGL A;  2M8L A;  4RES B;  1K30 A;  3NXS A;  5GTH E;  5AVQ B;  3JCU E;  4N78 D;  1HWT C;  2BCC J;  2L22 A;  2KLU A;  3L75 E;  4NEO A;  1LTJ B;  1NU1 G;  2JO1 A;  2YKP A;  3CMA P;  1M1J B;  2XZR A;  2KXP B;  3GZL A;  1JY3 O;  4WY4 A;  1LTG C;  5AVS B;  4C7R A;  1RF1 A;  3BAS A;  4HJG H;  2K1A A;  1X3O A;  2LF4 A;  3B5N B;  4IL6 E;  1A8O A;  2Y0C A;  3PH0 A;  1Q2N A;  1BDD A;  3MUD A;  5BU5 A;  2FAE A;  4C7N A;  2Q7C A;  1W5C E;  2WT7 B;  1L0N K;  1DNY A;  2C9L Y;  2KG6 A;  3L71 E;  1SQX D;  3B71 A;  5KLV D;  1CEI A;  1GTW A;  1NTZ K;  1VKU A;  1OR5 A;  2PNG A;  2ZVN B;  1BCC D;  1NTK G;  2GUV A;  1EDJ A;  4N78 E;  1HH0 A;  1VQ7 P;  3FX0 A;  1DIP A;  2KOO A;  2QJY C;  3HUS A;  3AE5 C;  2MVU A;  1URQ C;  3H1I D;  4JBZ A;  3DTJ A;  5APQ A;  1K73 Q;  1DH3 A;  5KLI C;  3RG6 C;  2QJK B;  1BGY D;  1RO2 A;  1L4A B;  2MJZ A;  1GL2 A;  3HE5 B;  2K94 A;  1GW4 A;  2V7Q H;  2FBW C;  4ZKU A;  3CI9 A;  3RBX A;  5EJD A;  4L76 A;  1FU1 A;  1BE3 G;  1FZF A;  3WUT A;  4BRY A;  2HOD B;  1NTM D;  1EMV A;  1PPJ D;  3C8V A;  1XTG B;  3L71 G;  4N3Y B;  3AEB C;  1YIJ P;  2CGQ A;  2ZYA A;  4A7P A;  3MTU E;  3GHG A;  2J59 M;  1ZR4 A;  2WPQ A;  3A0H E;  1RE4 C;  2AXT E;  1NU1 E;  1JOC A;  3F89 A;  3JSV C;  3CCS P;  5HGN A;  1BE3 D;  1IUQ A;  2IDB A;  2E74 C;  2BEZ F;  2OYH A;  4HYT B;  1OW7 A;  1RE3 A;  1JJ2 O;  1KIL E;  1FZC A;  3TGU E;  1KV4 A;  1YYC A;  2WWW A;  2QVA A;  5APU A;  1FZE A;  2M5R A;  1FAV A;  3G3Z A;  4KT0 J;  3B5N D;  5DJT B;  3CCR P;  2NRG A;  1YI2 P;  3EQ2 A;  2QG4 A;  3TK1 A;  2KOD A;  1JY3 P;  3V4W A;  2P7J A;  3R4Y A;  5HGO A;  3H1J E;  5KKZ C;  1FJP A;  4HB1 A;  1HTL C;  2IZ1 A;  2XNX A;  1X22 A;  3TSI A;  1BGY G;  1GU4 A;  2KS1 A;  2A06 E;  3AE3 C;  4Y99 C;  4H13 D;  2KWL A;  3AEA C;  5B66 H;  1RE4 A;  3U1A A;  2JJL A;  2N1T D;  1A43 A;  5APY A;  4KHX A;  1HF9 A;  3G71 P;  2RMZ A;  1RF0 C;  4U3F J;  4XFZ A;  4GDO A;  1BSN A;  2E76 C;  1KB9 E;  2QM7 A;  2ITA A;  2IFN A;  1PEQ A;  2R44 A;  1PEO A;  2OYI B;  1E6J P;  3TGU G;  2N5H A;  2JWD A;  3BRV B;  1ZW0 A;  1Z6M A;  1L4A D;  2CG5 B;  1NYH A;  1XTC C;  2E75 D;  3HE4 B;  1S1C X;  2N9B A;  2N1T B;  3JCU H;  1KMI Z;  2K9J B;  2WSE J;  1L0L J;  4N6J A;  3SFE C;  3G0V A;  3L75 D;  4IL6 X;  2QJP B;  2GZJ A;  2ZJS E;  1MZ8 A;  3TGU J;  3CWB G;  3NTN A;  2YIU C;  4C46 A;  2OTL P;  2Q9I A;  2AF8 A;  2BCC E;  3H32 A;  2AEJ A;  4BPG A;  3DS5 A;  1SQB D;  3DS3 A;  4K3A A;  2Z5H A;  1JO5 A;  1VQ9 P;  1LWU B;  4PXH B;  1E5W A;  3AE7 C;  2Q3E A;  2GDY A;  1SQP K;  2B87 B;  2P9X A;  1EZV D;  2KLV A;  3AE1 C;  3H1K E;  5EW5 E;  3GHG B;  3H4E A;  1IMP A;  4H2X C;  2GDW A;  1LWU C;  5KLV K;  1GXG A;  1IFM A;  5DCK A;  4NPF X;  1OFC X;  2LL8 A;  1BDC A;  1IFJ A;  1N7S C;  3GF7 A;  2WVR A;  3H1I E;  1PGP A;  2O01 J;  2QA4 P;  3KZI E;  2R3S A;  4AUW A;  3GHG C;  1NU1 J;  5KKZ B;  2WSS H;  1ACP A;  1U7J A;  1S5L E;  1PFI A;  2MY5 A;  2WSF J;  2JU2 A;  1KYO H;  5CBO A;  4U3F D;  4F37 A;  5CBN A;  2XV6 A;  2KG8 A;  1ZLL A;  1Q7Y Q;  1M56 D;  3PLN A;  3L73 E;  1X9V A;  4BPH A;  2JKV A;  3EFF K;  1KYO I;  1W2E A;  4RO0 A;  3LRY A;  4CA3 A;  3I5C A;  1SQX E;  3CCQ P;  3L73 J;  1DEB A;  2FYN C;  2KOS A;  2WQY C;  1VQK P;  2XZ1 C;  1SLQ A;  5GTI E;  1VQL P;  2IZ0 A;  2EHT A;  1IFN A;  1T8Z A;  2ZXX A;  1NTK J;  4XE5 B;  1FZB A;  3FXD A;  1IK7 A;  2W27 A;  1LGH B;  1KFM A;  2N9Y B;  1R5S A;  3AE2 C;  3S4R A;  2GUS A;  1AV1 A;  3L70 D;  1YHQ P;  2YO3 A;  5K5G B;  2YKQ A;  3RL0 B;  4PV1 B;  3H1J D;  2XU6 A;  2V4H A;  4W7Z A;  3H0D A;  1IFD A;  5AW9 B;  2GZF A;  3SWF A;  2KB7 P;  4MRT C;  1OW6 A;  2IYO A;  3H1K G;  3VMY A;  2BQ1 E;  2W6B A;  3AED C;  1U57 A;  1LTS C;  3M9H A;  3OAK A;  1L0L E;  1ZXG A;  1FR2 A;  3O6Q B;  1H89 A;  3AE6 C;  1Y8A A;  1CI6 B;  1S3J A;  2KUB A;  3A2A A;  5KLV G;  1N7L A;  1P84 H;  1T3J A;  4Y28 J;  3DS2 A;  1M1K Q;  3L74 G;  2IPP A;  2NPS C;  3M0D C;  3R2P A;  3BVH A;  4PV1 D;  4UB6 H;  1EOQ A;  3GMA A;  5F2O A;  1BE3 E;  2BCC G;  3L70 J;  2O1J A;  4MN4 C;  2K92 A;  2K9J A;  5L8R J;  1KZU B;  2EFJ A;  5AVR B;  3HYB A;  2WPS A;  3H1I G;  1KIL A;  4K35 A;  3P32 A;  2HPC A;  1SQB J;  1JCC A;  2Y0E A;  5KJ7 C;  1ZOY C;  3Q3D A;  2K2Q A;  2L0Q A;  3B4S A;  1JEK A;  4JQ0 D;  1JMB A;  1NTZ J;  1FZG A;  4H0L C;  3CCM P;  3G28 A;  1AVY A;  2GZI A;  4ZMD A;  4IPY A;  1ZME C;  5HV8 A;  3VMX A;  3BCC J;  3Q2Y A;  1P84 I;  2Q3I A;  2GM4 A;  3CME P;  5TJH A;  1NTZ E;  4D6T G;  3H1H J;  2R3C A;  4W80 A;  2N98 A;  2FQ2 A;  2FAC A;  1RE3 C;  2P58 A;  4PD4 I;  2NPS D;  3FWL A;  1ZNV A;  3U1C A;  3U43 A;  1SQB G;  3CX5 D;  4TT3 H;  3V4Q A;  4UB8 E;  4UB8 H;  5H2F E;  5CCH C;  2HLO A;  4WYM A;  3H1L G;  5CCG C;  3M91 A;  2JO0 A;  1FC2 C;  1IC2 A;  1Z56 A;  3CXC O;  1FOS F;  2WZ7 A;  1D1D A;  2P10 A;  3PRJ A;  2KSE A;  2K93 A;  3WUU A;  3EFG A;  2Z44 A;  4WB4 A;  1M8O B;  2IBZ I;  2Z4E A;  5GTH H;  2GDX A;  3OW2 O;  2R5B A;  2LOL A;  2LKM A;  4BPF A;  1LT9 C;  1SVF A;  2FXP A;  3PJS K;  4L74 A;  2KG9 A;  1E79 H;  3HTK A;  2HR3 A;  3H32 B;  1T2K D;  3MP7 B;  2H88 C;  4GOD A;  2MKV A;  5KAI H;  1SQB E;  1GMJ A;  1D7M A;  5AW2 B;  1JMM A;  2E75 C;  2O01 H;  4H0L B;  3RL0 g;  1BXI A;  3GF3 A;  3RBZ A;  1LTT C;  2ZVO B;  4I1L A;  3OA7 A;  3CX5 I;  1NKZ B;  2E43 A;  2WPV B;  4OGQ D;  2MF4 A;  2YXQ B;  5APX A;  5CMZ A;  2ZAE B;  4H13 C;  1NH4 A;  3MD0 A;  2M8R A;  3CD6 P;  3CCV P;  4OVN F;  1VQM P;  2JYG A;  1H0T B;  1VPC A;  3MHV A;  2I1K A;  2CWO A;  1EXJ A;  1SQX G;  2JBG A;  1NTZ G;  1PGQ A;  1S72 P;  2WSE H;  2HPC B;  1KOR A;  2W6J H;  3M1M A;  3P7K A;  3RK2 B;  2KSJ A;  3RG2 A;  3ITK A;  1FZC C;  1JTH B;  1VQ4 P;  1IJD B;  2WMM A;  4PH1 A;  2ZFC A;  3II6 A;  1RY3 A;  5EFW B;  2AFE A;  2BAS A;  2PEQ A;  2FAD A;  3H47 A;  2XXM A;  4YXW H;  2M5A B;  1LJ2 A;  2LR2 A;  3SWY A;  3RK2 D;  1Q86 Q;  1RF1 B;  5TIS H;  3H1L J;  1IK9 A;  1SQV E;  2FVA A;  3F5H A;  5KLV J;  1KQL A;  1SQQ D;  2O01 N;  1PV3 A;  1AQ5 A;  5M1B A;  1KIL B;  1OW8 A;  4EYY Q;  3H1H G;  4HKG A;  1NVO A;  1Q81 Q;  1EZV G;  1PGJ A;  4U7J A;  3V2N A;  2KP8 A;  1KQG B;  3A7O A;  2FFD A;  3KDP B;  2N50 A;  3RK3 C;  1VQ8 P;  1ZMB A;  2MR7 A;  1ZP0 C;  3AEG C;  3MGN A;  2ROQ A;  1JY2 N;  5C39 A;  1A02 F;  2HG5 D;  4WY4 C;  2QJK C;  3H1L E;  4H0L D;  1KIL D;  3MGE A;  2JWA A;  3M0A A;  5APT A;  2RN0 A;  2WIT A;  2PFX A;  1EIA A;  4OGQ B;  1QLE D;  3CL3 D;  3JC2 2;  3HE5 A;  4U0A A;  5HVC A;  4EIJ A;  2AXT H;  1S9K E;  1R8E A;  5CCG A;  1LT9 B;  4YTP C;  1ZRT E;  2L6E A;  1OVU A;  4IFF A;  4PD4 H;  2QSI A;  3I56 P;  1JCD A;  2YIU B;  3MZW B;  1FDI A;  1YQ4 C;  4L73 A;  4TLF A;  2B88 A;  2QJY B;  1SQQ K;  3G4S P;  2XKM A;  3HZQ A;  3G6E P;  1SQX K;  2V7Q J;  1UII A;  1LTJ A;  3KPE A;  1WRG A;  2KGC A;  3L72 E;  2LXB A;  2OYO A;  3KXD A;  5CJ0 A;  4O9B A;  1KB9 D;  1SQV K;  2W90 A;  1EDI A;  1SS1 A;  1N8R Q;  4C7N B;  1EQ7 A;  1VQ6 P;  2QE7 H;  2L9F A;  1X8Y A;  3IR9 A;  2QM8 A;  4R4L A;  1MFT A;  2FYU D;  5AW6 B;  1H0T A;  4GKG A;  1J1D C;  1BCC J;  3B5N A;  3E7K A;  5AW7 B;  3RL0 D;  4XRO A;  3AE4 C;  1HQB A;  3NMD A;  1G1I A;  2CNR A;  3P05 A;  2NO8 A;  1LT9 A;  1SQV G;  4Y99 B;  3RL0 C;  1NWQ A;  1GDT A;  3D6Z A;  2IBZ G;  4H44 B;  2KOP A;  4OGQ C;  1LTJ C;  5KLI B;  3V5B A;  2AXC A;  1RHZ B;  3LIE A;  1NU1 K;  1GD2 E;  1L0L D;  4DJG A;  3L4F A;  5JPA A;  2EG5 A;  3O8Z A;  1KB9 H;  1K04 A;  2M8N A;  4U3F G;  1OIP A;  1CZQ A;  3B5I A;  3L74 E;  1K05 A;  1PIX A;  1KYO E;  2JB0 A;  2Y9Y A;  1QRJ A;  1RO0 A;  1SQP D;  3WUV A;  2LPK A;  2KI7 B;  3GW6 A;  2PEJ A;  1SQQ J;  3AEC C;  1PL5 A;  1JY3 N;  5TIS E;  3HE4 A;  4KJM A;  1YQ3 C;  2WTY A;  2KZI A;  1LTB C;  1SQB K;  3KZI H;  2B87 A;  3M0D A;  1FS0 E;  3L72 J;  3FWN A;  1PPJ E;  3H1H D;  1L0L G;  5CCH A;  2FVF A;  1LWU A;  2AVA A;  2FYU G;  2H89 C;  5AW5 B;  1RQV A;  2JDI H;  3H1K J;  3TYY A;  5B5E H;  3RGU A;  1USE A;  3D70 A;  3CCE P;  3A0H H;  1URQ A;  2E74 D;  2A06 G;  3ZDM A;  5AVV B;  3VYI A;  2L91 A;  1GXH A;  2KS1 B;  1N73 A;  3GJN A;  3EWK A;  1SQQ E;  2ZYG A;  1L0L K;  1NTM E;  5AW4 B;  3VMZ A;  5KAF H;  1AQT A;  3IN6 A;  2N5I A;  3L72 G;  1OZH A;  3U59 A;  2KGE A;  2QJP C;  3E1R A;  2E5Y A;  4XFX A;  1HGZ A;  2WPT A;  2JEE A;  3L72 D;  2PGD A;  3RK3 B;  2OYI A;  2PEM A;  2KOR A;  3CWB D;  3PTZ A;  5I4T G;  2JAZ A;  2W6A A;  3V2P A;  3A0B H;  1JM0 A;  3L35 A;  2M0B A;  2BEQ D;  2ZT9 B;  3KYQ A;  4IFM A;  2FYU E;  2O1K A;  1N7S A;  4AQR D;  1RQU A;  4I7Z B;  2KIK A;  5E79 E;  3N7N A;  4DCK A;  1IO4 A;  2CK3 H;  3CXH H;  5B5E E;  2RKL A;  4DG9 A;  4L75 A;  2VLQ A;  3Q5R A;  2GZG A;  1AYI A;  3P8M C;  2WSC H;  2Z46 A;  2G3A A;  5AVX B;  1PP9 D;  1BCC E;  1EXI A;  2WSC J;  3CXH D;  3BAT A;  1PP9 G;  1M74 A;  2POH A;  2LKI A;  4NPD A;  3G29 A;  1NTM K;  2FQ0 A;  2D2C B;  3QWO C;  2E5T A;  2OTJ P;  1AA0 A;  2VLP A;  3L36 A;  2ONT A;  1FJK A;  1KC8 Q;  4PJ0 E;  2WSF H;  2N6Y A;  4PH0 A;  1VQ5 P;  1GK6 A;  1RH5 B;  4I6M C;  1E0H A;  5AW3 B;  3MUD C;  5B66 E;  2OQQ A;  2PEI A;  1FZA A;  4IL6 H;  1MKM A;  1VF5 B;  3E1I A;  3P8C D;  2LXC B;  2C0W A;  1IFI A;  1J1D B;  2E74 B;  4UHP B;  2E76 B;  4M3L A;  3WU2 E;  2H43 A;  3G21 A;  2AFD A;  2L4B A;  1LNQ A;  3W67 A;  2Q5U A;  3BRT B;  2YKO A;  4EI2 A;  1YTZ I;  1UIX A;  1IZN B;  4JF7 A;  1NU1 D;  1KIL C;  1UNK A;  2JQ4 A;  3I55 P;  4HKZ H;  2PEO A;  2K37 A;  1SFC A;  3GZM A;  4EDF A;  3CWB J;  1SQP J;  1L0N E;  2Z5I A;  3NY7 B;  2NPS B;  1PPJ G;  3L70 G;  3S9O A;  1J1E C;  4U0E A;  1NTZ D;  4GT1 A;  4PWV B;  1NHL A;  3T97 B;  3HRN A;  3CC4 P;  1OMI A;  1QGK B;  4WY4 B;  3HD7 D;  1EZV E;  1QX8 A;  3CLQ A;  2QRX A;  3H1J J;  4XFY A;  2PRR A;  2KR5 A;  2Q1K A;  1EDL A;  3D6Y A;  2KOQ A;  1MV8 A;  2O3J A;  2BHV A;  2FQ1 A;  4ASW A;  2VSQ A;  1T8K A;  2FY8 A;  1CSB A;  1GL2 D;  3G9R A;  2A45 I;  1SQP G;  2AEM A;  3DS0 A;  1U7M A;  1BCC G;  1NTK D;  3L73 D;  5KTB A;  1MFZ A;  3HD7 B;  2KGA A;  2MVV A;  5AW8 B;  5CJ4 A;  4RJT A;  1J2J B;  3NTE A;  1DD3 A;  3EJB A;  5AVW B;  4R0M A;  3S1K A;  1NOH A;  2J5U A;  1PP9 E;  1KTM A;  1YIT P;  5HGM A;  1RNI A;  1TU3 F;  1BAJ A;  1WT6 A;  4R4M A;  4XRQ A;  1W2B O;  1JY2 O;  3AEF C;  2JGP A;  1S9K D;  3DS4 A;  1S2E A;  1NAY A;  4DZO A;  2KGD A;  3GG2 A;  2NPS A;  4Z1M H;  3BCC E;  3G1I A;  2KYV A;  1KQF B;  3W68 A;  1FBM A;  5CHX A;  2OTK E;  2XT1 A;  2KW2 A;  1PGO A;  1JUN A;  2YXR B;  1BSH A;  3B8E B;  3IAO A;  1RF0 A;  1KQS O;  1SQP E;  2G8Y A;  2EIA A;  3VN0 A;  2B9B A;  2NZ2 A;  4GR6 A;  1PP9 J;  1JTH A;  4GOE A;  2JYL A;  3M06 A;  2OYI C;  1P84 D;  4IZ6 A;  1HJ0 A;  1PEU A;  2PP6 A;  3V2R A;  5APS A;  3H1I J;  3IF4 A;  1BE3 J;  3L70 E;  2L5G B;  2R32 A;  2KNC A;  2VRS A;  1S5L H;  2VLN A;  1Q90 D;  2IYP A;  4YPC A;  1Q82 Q;  1VDF A;  2H7H A;  3CPW O;  3CXH E;  3EJD A;  5AVY B;  5E79 H;  1A02 J;  3PHL A;  4H44 D;  3FXE A;  4D6T E;  1IMQ A;  4AYC A;  4H44 C;  5AVU B;  3OJA B;  2GA1 A;  1L0N J;  3Q1M A;  1KN7 A;  1LTI C;  3HTK B;  1VHN A;  1T3U A;  2EHS A;  3TNU B;  3CWB E;  2W83 C;  4NPE A;  4W7Y A;  3L37 A;  3L75 J;  4U3F E;  3RK3 E;  4PJ0 H;  3L74 D;  2YMK A;  4I2L C;  2KNC B;  1NTK E;  5F2N A;  4DOJ A;  2PEN A;  4XA4 A;  1FDO A;  1L0I A;  2LML A;  1N7S B;  1Y47 A;  2QNW A;  5KP8 B;  1NKN A;  2FYU K;  1OXZ A;  3CC7 P;  3H25 A;  3C9I A;  2FYU J;  2HYN A;  1YJW P;  2FXO A;  2PY8 A;  4COP A;  2B89 A;  1OVR A;  2XZ0 D;  3BCC G;  3CC2 P;  1NGM B;  3M9B A;  2FYZ A;  1M1J C;  1M6E X;  3V2Q A;  1SQQ G;  2CPB A;  5GTI H;  1JNM A;  5APV A;  1S5L X;  4COC A;  2HFE D;  2PEK A;  1VL2 A;  1CI6 A;  1L0H A;  1AJY A;  3O6Q A;  5AW1 B;  1K8A Q;  3G1G A;  4U0C A;  1KFN A;  4IFD K;  2CPS A;  4JYB A;  5DJU B;  2C0X A;  1ZR2 A;  1SFC B;  1LT1 A;  5KP6 B;  2XDJ A;  1FZC B;  4IOI H;  2ZT9 D;  4H13 B;  2MD9 A;  1GZL A;  4GOF A;  3Q20 A;  2K0X A;  3ABV C;  1N86 A;  2K0D X;  1T6A A;  3A5T A;  5KLV E;  1ZV8 A;  1EZV I;  1T2K C;  5AW0 B;  2KZJ A;  2DGY A;  1SFC D;  3L75 G;  1M6N A;  2MR8 A;  1L0N D;  2CQ8 A;  1YJ9 P;  1NTM G;  2FKW B;  2I8D A;  1DEE G;  3CCJ P;  2VLO A;  1GW3 A;  3USS A;  1HUC A;  2X2B A;  1AVO A;  1H88 A;  4WWI A;  3UIA A;  5KJ7 D;  3VOP A;  4GR2 A;  1GU5 A;  2SPZ A;  2UWJ E;  2IX7 C;  1L0N G;  3VTP C;  3T97 A;  1L2P A;  4EOT A;  2D2C C;  5F2K A;  4H2Y C;  4XFJ A;  3FGA D;  3Q5S A;  1WMK A;  1P84 E;  1LTA C;  2KK7 A;  2ZXE B;  1NTK K;  3VMA A;  2P1J A;  2K88 A;  2LTE A;  4B86 A;  1HJB A;  1YBK A;  1SQV D;  3AE8 C;  3CX5 H;  2LIW A;  4PD4 E;  1QL2 A;  1VQN P;  3CE7 A;  2W8Z A;  5KAI E;  5CCH D;  2ERH A;  1QEX A;  2FFD B;  4WVZ A;  2FXM A;  3AE9 C;  1KD1 Q;  3SFD C;  2M8P A;  2C9N Y;  2OYH C;  1SFC C;  1VQO P;  2WT7 A;  3CXH I;  4I7Z C;  5CCG D;  2P2U A;  4OH8 B;  3D71 A;  2AEF A;  1N2D C;  1LP1 B;  2QEX P;  2FYN B;  2A45 G;  1M1J A;  2BUO A;  3G26 A;  4D6T J;  4RKU J;  4QNB A;  1MZ9 A;  3BCC D;  3CX5 E;  3LW5 J;  3H1L D;  3A0B E;  2M5A A;  4WY4 D;  1NAF A;  3HUS B;  3A3Y B;  1X0T A;  3AEE C;  3RK3 D;  1BGY E;  2XND H;  5AVT B;  3B4Q A;  4PV1 C;  1UJZ A;  2N1T C;  1AUM A;  3WBH A;  2K3R A;  1F80 D;  2ZYD A;  3Q5P A;  1DV5 A;  1M57 D;  1PEM A;  1QL1 A;  2M3B A;  1NQ4 A;  3QH9 A;  1PZQ A;  1G1J A;  2OGU A;  1URQ D;  2IFM A;  3GLM A;  3DPH A;  1QVF O;  4LC1 A;  2YNY A;  5AVZ B;  2YMY A;  2YO2 A;  2RH0 A;  3LID A;  1NTM J;  2FHS C;  2JP3 A;  1AFO A;  3L74 J;  2N6Z A;  3E2D A;  4QMA A;  2Z45 A;  3L71 J;  1YTZ T;  2K5X A;  2E42 A;  1HBW A;  1DD4 A;  4ZKP A;  1IFP A;  2WPR A;  1SQX J;  4H2W C;  2E75 B;  1ZN5 A;  1S4X A;  1GL2 C;  4JYC A;  3WU2 H;  3TF5 A;  2K9Y A;  3K5B A;  1Y9B A;  2D2C D;  1G2C B;  3H1J G;  1X79 B;  2FFD C;  1FDM A;  4U0B A;  3TNU A;  1YJN P;  1N73 B;  2FVE A;  1SP4 A;  2IBZ E;  1M7L A;  4U0D A;  1SQV J;  1J1E B;  3TDK A;  1JY2 P;  4ZNC A;  4GIF A;  1OWA A;  3M9Q A;  1G2C A;  1HVV A;  4UB6 E;  2KOG A;  1AF8 A;  1L4A C;  1VF5 D;  2GZE A;  1GK4 A;  2A45 H;  2A06 D;  4PD4 D;  1OX3 A;  2E76 D;  3C1L A;  2N1T A;  1NJI Q;  3RK2 C;  2OYH B;  2OAR A;  3KHU A;  2P67 A;  3GKL C;  5BU8 B;  3VP8 A;  2M3E A;  3P8C E;  4U0F A;  2JR8 A;  3HD7 C;  1BGY J;  3CCL P;  1KLP A;  1KYO D;  4BWN A;  5BVZ A;  2Q6Q A;  5CZD B;  1VQP P;  3WMM 0;  2HOD A;  2R5D A;  2K0Y A;  5BS1 A;  7CEI A;  3LW5 H;  2DW3 A;  1RF1 C;  2XV5 A;  1OVV A;  3HUS C;  3SSU A;  1M90 Q;  3TGU D;  2IBZ D;  4LGD E;  5BS2 A;  4HH2 A;  1JB0 J;  3EJE A;  1KB9 I;  4OWF A;  2E1M A;  4D6T D;  2J58 A;  1L4A A;  3VRL C;  3CCU P;  3B5N C;  4BXL A;  2I1J A;  1URQ B;  4DT0 A;  5KJ7 A;  4JPZ B;  3N4X A;  1GPJ A;  2DNW A;  4M0I A;  1VF5 C;  1EDK A;  3IFM A;  3LMO A;  1DX7 A;  1HGV A;  2BCC D;  4LLH A;  1N73 C;  2ZT9 C;  1NO4 A;  4WBA A;  1GL2 B;  3DS1 A;  5H2F H;  1N7S D;  1FE6 A;  3H6P A;  3V6I A;  1MUU A;  1LP1 A;  5KAF E;  3SWK A;  1K9M Q;  1QVG O;  1CW5 A;  1FOS E;  2QIW A;  3H1H E;  3VP9 A;  2Y9Z A;  3L73 G;  1USD A;  3MIW A;  1HY8 A;  4YXD C;  3PP5 A;  2PAJ A;  4QKO A;  2H8P D;  2Y0D A;  3KQG A;  1R5L A;  3H1K D;  4CPG A;  2JU1 A;  3L71 D;  4ASV A;  3HD7 A;  1ZRT D;  2LIU A;  5APW A;  2GYK A;  5KP7 B;  1EC5 A; 
#chains in the Genus database with same CATH homology
 3M1M A;  3CC7 P;  2L6E A;  3B5I A;  5HGL A;  4XFZ A;  2M8L A;  3G71 P;  1K30 A;  2BQ1 E;  4U0F A;  3CCJ P;  1KQS O;  2EIA A;  3I56 P;  3CXC O;  2QA4 P;  1QRJ A;  1VQ4 P;  4U0E A;  3CCL P;  1AUM A;  4GR6 A;  1RO0 A;  3WBH A;  1YJW P;  1PEO A;  1PEQ A;  1D1D A;  1E6J P;  4GR2 A;  2JYL A;  3G4S P;  2PEJ A;  2PY8 A;  3HZQ A;  3CC4 P;  4PH1 A;  3G6E P;  4COP A;  1PEM A;  3CMA P;  1PEU A;  3DS2 A;  1M1K Q;  2Z44 A;  2Z46 A;  4XFY A;  1VQP P;  2PEQ A;  1EOQ A;  5BS1 A;  5F2K A;  1YIJ P;  3OW2 O;  3CC2 P;  3H47 A;  2XXM A;  3DPH A;  1QVF O;  3G0V A;  5F2O A;  2XV6 A;  2BHV A;  1M90 Q;  1M74 A;  1Q86 Q;  1Q82 Q;  5BS2 A;  3G29 A;  1M6E X;  3CCS P;  1Q7Y Q;  2EFJ A;  2LF4 A;  3E2D A;  5HGN A;  1IUQ A;  1A8O A;  2Z45 A;  3HYB A;  2OTJ P;  2E1M A;  3CPW O;  1N8R Q;  3DS0 A;  3VRL C;  3CCU P;  4COC A;  1VQ6 P;  2PEK A;  2ONT A;  1JJ2 O;  1KC8 Q;  3CCE P;  2OTL P;  1VQN P;  3LRY A;  4PH0 A;  1VQ5 P;  4M0I A;  3NTE A;  1K8A Q;  3DS5 A;  3G1G A;  1Q81 Q;  1KD1 Q;  4U0C A;  3CCQ P;  2M8P A;  3DS3 A;  3CCR P;  3DS1 A;  1VQO P;  1VQK P;  1VQ9 P;  4U0B A;  1VQL P;  1YJN P;  1YI2 P;  2PEI A;  3CCM P;  3G28 A;  4XRO A;  1VQ8 P;  1K9M Q;  1QVG O;  4IPY A;  1ZMB A;  4U0D A;  2P9X A;  3P05 A;  2KOD A;  1YIT P;  5HGM A;  2QEX P;  3Q20 A;  1RNI A;  4XFX A;  3G21 A;  3CME P;  5HGO A;  2BUO A;  1VQ7 P;  1BAJ A;  3G26 A;  4XRQ A;  1W2B O;  3MGE A;  3CD6 P;  4QNB A;  2PEM A;  3CCV P;  1VQM P;  3DS4 A;  2JYG A;  1YHQ P;  3H4E A;  3G1I A;  5I4T G;  3DTJ A;  5F2N A;  1EIA A;  2CWO A;  1K73 Q;  2PEN A;  3RG6 C;  5DCK A;  3I55 P;  2DGY A;  5JPA A;  2PEO A;  4U0A A;  1A43 A;  3H0D A;  2XT1 A;  4WYM A;  1NJI Q;  2EG5 A;  1S72 P;  1RO2 A;  1M6N A;  2OAR A;  2JO0 A;  1YJ9 P;  2M8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...