1VQ5P

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq5P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq5P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq5P02
1YJWP 1KD1Q 1VQ9P 1VQ8P 3CCVP 1YI2P 1Q82Q 1NJIQ 1Q81Q 3CC2P 3CCUP 2QA4P 1K9MQ 3CMEP 1Q7YQ 1VQMP 3CPWO 1KC8Q 1QVFO 1VQKP 1W2BO 1VQLP 2OTJP 1N8RQ 1K8AQ 1VQNP 1VQPP 2OTLP 1Q86Q 1YITP 3OW2O 3CC4P 1YIJP 1KQSO 3G6EP 3CCSP 3CXCO 1JJ2O 3CMAP 3CCMP 1VQ7P 1VQ4P 1M1KQ 3CCLP 3CD6P 3G4SP 3CCQP 3CC7P 1YJNP 1VQ6P 1VQ5P 1S72P 3I56P 3CCRP 1M90Q 1YHQP 3CCJP 3G71P 1VQOP 1K73Q 3CCEP 3I55P 1YJ9P 2QEXP 1QVGO
chains in the Genus database with same CATH superfamily
1KD1Q 1TU3F 2AEJA 2M3BA 2WSFH 2E74B 5DJUB 3R4YA 2YXRB 3FXEA 2OYOA 2BEQD 4OGQD 2JYGA 2E76B 2YIUB 4ZKPA 5M1BA 2Y0EA 3CCVP 1L0LJ 1AUMA 5GTIH 1KB9E 5JPAA 5HV8A 5HGOA 2NPSD 1FZFA 4IFFA 2IYOA 4XA4A 2AVAA 2QRXA 2FYUE 2LL8A 3Q5RA 1M74A 2E75B 2E1MA 3OW2O 4XROA 1N73A 1URQB 1SQBK 2JU1A 1LTJA 1SQVK 2MF4A 3DS4A 3G9RA 4U0EA 1R8EA 5AVUB 1NOHA 5AW8B 3MIWA 1BE3E 1SQPG 1SQQK 1L4AD 2Z5HA 1LP1A 3HD7A 5KJ7A 3MGNA 1EZVG 4BRYB 2ITAA 1YJNP 1Q2NA 2A06E 1DEEG 1KZUB 1PP9D 4M0IA 2KOGA 3BVHA 1QEXA 2KODA 1S1CX 2Q9IA 2MD9A 3B5ND 4H44C 2KGDA 1RO2A 2AEMA 2HG5D 1Z6MA 2LR2A 4EIJA 1CEIA 2L9FA 2P1JA 1RNIA 2KG6A 1NU1K 3CXHE 1HWTC 1LWUC 3F89A 3N7NA 1LTSC 3I55P 3H1JD 5AW0B 2KGEA 1S4XA 4BXLA 3GHGA 5B66E 1WMKA 2UWJE 3L73J 1DX7A 4JPZB 1RF1C 3HE5A 2OYIC 3M91A 5CJ0A 3L75G 2OYHC 2LTEA 1ZR2A 1IC2A 1D1DA 1EZVE 3IR9A 2P9XA 2YO2A 4L76A 1VF5B 2C9LY 4U3FG 1RE3C 1J1EB 4PV1D 1IMPA 1T2KD 3L36A 3WU2E 1L0LD 1T8ZA 1HUCA 3H1KE 3L70J 2NO8A 3LMOA 1EC5A 1N7SB 1IFPA 5BVZA 4PD4I 2N6YA 3TGUJ 5KP8B 2GZEA 3HUSB 3II6A 4XFJA 2HFED 5CCGD 3TNUB 3P32A 2X2BA 2XZRA 3SSUA 1BSNA 1QL2A 1W5CE 2HPCB 7CEIA 3B5IA 1LT1A 1JEKA 2XNDH 2WWWA 5AVQB 2GYKA 1K04A 1RF0A 1FDMA 1QGKB 2FYZA 4RO0A 3L75E 2W6JH 2MR8A 2JAZA 3VMZA 4OH8B 3A0HE 4U3FE 4AYCA 4QMAA 2KZIA 5HGLA 5AVRB 4I1LA 2Q3EA 3NTEA 2VLOA 2K0XA 3RL0D 1NTKE 3K5BA 2YMKA 3HTKA 4XFXA 1JB0J 1JY2O 4W7YA 1PGOA 3P8CE 1LTAC 4PH1A 1LGHB 4IZ6A 4DZOA 1L4AA 2A45H 2G3AA 2I1KA 2EIAA 2QNWA 3F5HA 1Q81Q 1BGYG 3SFEC 1KILD 2ZFCA 5TJHA 2H89C 4CPGA 1MZ8A 1LWUA 4U7JA 4BPFA 2H88C 2JWDA 2D2CC 1H8AA 2L4BA 4TT3H 3FWLA 3H6PA 3M0AA 3S9OA 2OARA 3L74J 3L73G 5KP6B 1JNMA 3RK3D 2OYHA 1QX8A 1H89A 1VPCA 4GKGA 3DS5A 3V2NA 3G4SP 3L70D 1EIAA 1KB9H 2ZVOB 3CCEP 1M1JC 2NPSB 1L0NE 1SQQD 2M8LA 1Q82Q 2M5RA 1K8AQ 2I8DA 5AW6B 2IBZE 2I1JA 3BCCJ 3TGUG 3G6EP 3L72J 2OGUA 2KLUA 3G28A 4YXDC 5BU5A 4R4MA 2Q5UA 2LKMA 1PEUA 1NYHA 3M06A 4H0LB 1CZQA 1L0IA 1HGZA 4GT1A 3WBHA 2FQ2A 1JY2P 3O8ZA 3H1LE 3TK1A 5AW1B 1VQNP 2KK7A 3L71J 2J58A 1NU1D 2ZAEB 2FAEA 2N5HA 3LIEA 3AE7C 3VTPC 1IFJA 4U0AA 1EXIA 3LW5H 4W7ZA 5F2NA 3AEEC 3KQGA 1JTHA 1KFNA 3CXHH 2QJPB 3H1HD 3CXHI 1AF8A 1UIXA 2RN0A 4JF7A 5B66H 3TSIA 3D6YA 4RKUJ 3HE4B 1OMIA 1G1IA 2GDYA 3L74D 5CBNA 1SVFA 1EZVI 5KLIC 1NVOA 2HLOA 1FDOA 3IAOA 1N86A 5AVYB 1R5LA 1R5SA 4PV1B 3KDPB 3WU2H 3CMEP 2FVFA 1FZBA 1JUNA 4WY4A 2PEQA 1HVVA 1SQXG 2K9YA 3BATA 1IK9A 3JCUH 2N9BA 1H0TB 1MKMA 2E74C 2VSQA 3L4FA 3GKLC 5E79E 3B71A 2L91A 1JY2N 1G2CB 4I6MC 1DNYA 1GL2D 4JQ0D 2W90A 2E76C 2YIUC 4MN4C 1SQPK 1AFOA 1OW6A 1YYCA 1JCCA 1SLQA 3BCCG 1RE4A 2WSEH 1N8RQ 3L72G 4PD4D 2FYUJ 2GZJA 2O01N 2E75C 2XDJA 2FVEA 4IPYA 1U7MA 2N50A 1W2EA 2QVAA 3A0HH 3VMYA 1E5WA 2L5GB 2B87A 4D6TD 1NTZG 1YQ4C 1VHNA 1MFTA 1SFCB 2NRGA 1DIPA 1GXHA 1NTMJ 3G26A 5BS2A 2QA4P 3L71G 1PPJD 1SQXE 3IF4A 2XXMA 3RL0B 2N1TD 1SP4A 2FFDB 1S9KE 2M0BA 2FXMA 3CC7P 3EFGA 4HH2A 1M1JB 5H2FE 1M57D 1P84D 2BCCG 2PGDA 3CX5I 1M7LA 2C9NY 3WUVA 2K93A 5KLVG 1KILB 1LTGC 1G1JA 4HKGA 4YTPC 1RQUA 2AXCA 3FWNA 1PGPA 5EJDA 2W83C 3M0DC 2EG5A 3NFQA 2XKMA 5KJ7D 3LW5J 1AQTA 3H25A 3W68A 2Z44A 1NTZE 1KYOE 1HGVA 1NJIQ 1FOSF 2A45G 1ZRTD 2KSJA 3AE9C 2VRSA 2LPKA 2IFNA 2C0WA 4C7RA 1L0LK 3A7OA 1VKUA 4C7NA 1N2DC 1GPJA 2PNGA 2PY8A 3NTNA 2Z45A 1VF5C 2BCCE 3V5BA 1J1EC 2P10A 5KLVE 2M5AA 5HVCA 2CWOA 3DS1A 3A3YB 1ZLLA 3EFFK 2RH0A 2WPVB 1OFCX 3H32B 2ERHA 2WT7B 4MRTC 3H1KJ 1EDLA 1N7SC 3EJEA 2J5UA 4N3YB 3U1CA 2QIWA 4H13B 1YHQP 3G1GA 1T3UA 4LC1A 1HQBA 3EJBA 1YI2P 3H1ID 2ZYAA 1BCCE 1FZAA 2FYUG 2ZT9D 1URQA 1AA0A 1UNKA 5EW5E 1Q86Q 1NTMD 3G3ZA 1F80D 1LNQA 3L75J 2WSEJ 1LT9B 3ITKA 2KNCB 2WSCH 2IDBA 1BE3G 4U3FJ 1RQVA 3D71A 3Q2YA 3D70A 1W2BO 1KQGB 1NHLA 3RK2B 2K94A 3L37A 3VMXA 2A06G 4KJMA 3E7KA 2CPSA 1YBKA 1GK4A 4EYYQ 2N1TA 3DPHA 3CWBE 5APUA 4PXHB 4GR6A 1EDJA 1SQPD 3SWKA 1EZVD 1T3JA 3CI9A 2KOQA 2WVRA 5GTHE 5E79H 4H44D 3A2AA 3FGAD 5EFWB 2OTLP 2M8RA 2N98A 4WB4A 4XFYA 4F37A 3VN0A 3I56P 2CG5B 3GF7A 2O3JA 2KWLA 4GOFA 2KGAA 2LOLA 2NPSC 1L0NJ 2KP8A 3USSA 1E79H 3DS3A 3H1KG 3Q20A 2K9JA 3N4XA 1BGYJ 3HUSA 1VQ4P 2HPCA 3L75D 2B9BA 3MGEA 1XTGB 3UIAA 4H0LC 1AYIA 2R5DA 5KTBA 2KUBA 3RBZA 3H1LJ 4U3FD 5H2FH 1N73B 1M90Q 1NAFA 3M9HA 1LTJB 3B4SA 4N78D 2CPBA 3KZIE 2P2UA 1AJYA 2KIKA 2POHA 3CC2P 3B5NC 2ROQA 1OX3A 2MJZA 1EXJA 2IZ0A 1LP1B 2FQ1A 2KOSA 3HD7B 1NTKG 3CX5D 2QJPC 2WSCJ 1YTZI 1M1KQ 3JCUE 2WTYA 2LF4A 1KYOH 2WSFJ 1EDIA 1Y9BA 2BUOA 3NY7B 1YJWP 1UIIA 1OW8A 3P7KA 3HZQA 4U0BA 2QJYC 1X9VA 2JO1A 2KI7B 3MHVA 2JO0A 1PP9E 4NPDA 2YKQA 3CMAP 3EJDA 1IFNA 1OIPA 4PWVB 1VQOP 1UJZA 3D6ZA 3KPEA 4PV1C 1EMVA 2Y9YA 3PP5A 1LTBC 1JCDA 2HR3A 3PTZA 4DJGA 3PHLA 4I7ZC 3CXCO 2D2CD 1OVVA 3ZDMA 1BGYD 1AVOA 5CCGC 4K35A 2WPSA 1L0NG 2O1KA 2ZT9B 1FBMA 2A45I 1LJ2A 5KAIH 4TLFA 1HY8A 2IBZG 4WY4D 3L73D 2K5XA 1YIJP 1QRJA 4IFDK 1FJKA 1OWAA 3PRJA 1L0LE 3C1LA 3AE8C 3KXDA 4JBZA 1RF1A 2GM4A 2OYIA 3V4WA 1SFCC 3H1LG 3WUUA 3O6QA 2MR7A 2Z4EA 4OVNF 1SQXJ 3CC4P 1YTZT 4OGQB 3RL0C 4EI2A 4IL6E 2FFDC 5CBOA 1RE3A 3LRYA 4QNBA 2GUVA 1KB9I 4R0MA 3TGUD 1VQ8P 2AXTE 1GD2E 1M56D 3GZMA 2WMMA 1A43A 1K05A 1FS0E 1KILC 1K9MQ 3U1AA 2E5TA 1FOSE 1NKNA 3OJAB 1ZMEC 4M3LA 4O9BA 3CCMP 3HE4A 3AE1C 2BQ1E 1GZLA 1WT6A 4H2WC 3W67A 5GTHH 3E1RA 2J59M 2R3CA 1SQBG 2JR8A 5AW9B 3MZWB 2QE7H 1JM0A 3CCRP 4YXWH 1SQVG 2N9YB 3A5TA 3VYIA 4XFZA 3KHUA 1L4AB 1NTZJ 1KQFB 3EWKA 3A0BH 2JU2A 3H0DA 2EHTA 5BS1A 2KR5A 2KGCA 2B89A 2C0XA 1KILE 1VL2A 2FYUK 3JSVC 1GK6A 3B5NB 2L0QA 1H0TA 2IZ1A 2K0DX 2BCCJ 5APWA 1KC8Q 3WUTA 2PEJA 5KLVJ 1Y8AA 1WRGA 1YITP 1IUQA 1FZCB 5F2OA 4Z1MH 1S5LE 1NTMK 3CCQP 5AVVB 2YXQB 4H2YC 4H13C 1SQBE 1X8YA 2XT1A 1OXZA 1SQVE 2QJYB 1ZOYC 1PIXA 1NQ4A 3P8MC 1H88A 3L70E 1QVFO 3GLMA 2E43A 1MV8A 1OVUA 1A02J 2E74D 1CSBA 3KZIH 2CNRA 1SQQE 4WWIA 1SQXD 4JYBA 1JY3P 3KYQA 1SFCA 1S9KD 1LT9C 1OW7A 2Q1KA 2AFDA 3B4QA 2V7QH 1VQLP 2FFDA 3GF3A 4I7ZB 2E75D 3RK2C 1RO0A 2ZYDA 1M1JA 1URQD 3DS2A 5AW2B 3BCCD 4WBAA 3L72D 4C46A 4BPHA 2Y0CA 2FXPA 2CGQA 3RG2A 1NAYA 1NU1E 2NZ2A 5DJTB 2BEZF 1N7LA 1VQMP 2PEMA 1NTZD 1FZEA 2GA1A 2PEIA 1IFIA 3CCSP 3CWBJ 2PRRA 3R2PA 2BASA 3MTUE 3L71D 1PL5A 5DCKA 4ASWA 1DD3A 1K73Q 1BXIA 3ABVC 3TF5A 4AUWA 3H1HE 5APTA 1RY3A 1FDIA 4UB8H 4U0DA 3WMM0 2WPRA 2BCCD 1BE3J 3RBXA 2RKLA 4N6JA 5KLVD 3TDKA 5C39A 1GTWA 2HODB 5KP7B 5APVA 1FC2C 1JY3N 3QH9A 4WY4B 1K30A 2VLPA 2AEFA 5L8RJ 3H32A 3VMAA 2WT7A 3Q5SA 2JEEA 1HJ0A 3M9BA 1VQ7P 2HYNA 2Y0DA 1KORA 2KS1A 1PFIA 1Y47A 2OQQA 1VF5D 3RK3B 2KW2A 1BCCG 2ZYGA 4CA3A 4IL6H 1Q7YQ 5KAFE 3I5CA 2O1JA 4LLHA 1LT9A 1MZ9A 3HRNA 2AXTH 1IFDA 2OTKE 2LIUA 1N73C 2FXOA 1LTJC 5CCHC 1FJPA 2PENA 1ZV8A 3GZLA 2IBZI 1L2PA 1CI6B 1RHZB 4D6TE 3Q5PA 1KB9D 1VDFA 3HD7C 5KJ7C 2FYUD 1PPJE 2YO3A 2MVUA 2MY5A 3AE2C 2GUSA 3T97B 3G0VA 3CWBG 1IO4A 3GW6A 1IMQA 3VP8A 2R44A 1P84E 1FE6A 4EOTA 1PP9J 1L0NK 5KAIE 3MUDC 5AW5B 1BE3D 1AVYA 2IPPA 5TISE 2KSEA 5B5EE 1DD4A 4AQRD 1S5LH 2A06D 2P58A 4OWFA 2OTJP 3C8VA 3V6IA 4HB1A 4BRYA 2PAJA 2L6EA 2B88A 2YKPA 4DOJA 1DEBA 2GZGA 1S3JA 4EDFA 1X3OA 5CZDB 1NTKJ 1U57A 1KV4A 3G29A 3L35A 5AVXB 3RG6C 5HGNA 3S1KA 3VRLC 3M1MA 2WZ7A 2ZT9C 3CXHD 3CLQA 1M6NA 3M0DA 2M5AB 4WYMA 3GJNA 3S4RA 4K3AA 2WQYC 2ONTA 2BHVA 2MVVA 2YMYA 1ZNVA 4RJTA 5APXA 1EDKA 5AVZB 5K5GB 3RGUA 1PEOA 3TYYA 1GL2B 2DNWA 3H1IE 1M6EX 2K88A 2Q3IA 4OGQC 1VQ6P 5CCHA 1FZGA 1RF0C 3H4EA 1VQ5P 3A0BE 3G21A 3H1KD 2QEXP 1QVGO 1NTME 4ZMDA 3H47A 2W8ZA 4H0LD 2Q7CA 2LXCB 2QJKB 1KMIZ 1PGQA 1S2EA 1N7SA 1J1DB 3NMDA 3E1IA 4NPFX 2CQ8A 3AEFC 3TNUA 3MP7B 3FXDA 4ZKUA 1GU4A 4IOIH 5AW4B 2XZ1C 5BU8B 2FY8A 2H43A 1L4AC 3MUDA 2N1TB 1PP9G 2KORA 4Y99C 1PZQA 1SS1A 2SPZA 4NPEA 4WVZA 3IFMA 1NWQA 2K0YA 4COCA 2LKIA 1NTKD 4YPCA 1PV3A 3P8CD 4HJGH 1SQPE 3SWFA 1LTIC 3AEDC 2FADA 2K37A 3H1JG 2XV6A 1OVRA 2FACA 1FZCC 5APSA 1AV1A 3AEAC 2AF8A 1FR2A 1SQXK 1KYOI 1GW3A 2JYLA 4IL6X 5KAFH 1BSHA 4UB6E 1E6JP 2IX7C 1SQBJ 4NEOA 2K3RA 2KOPA 1SQVJ 3RL0g 5KKZB 2FBWC 2EHSA 4DT0A 3CL3D 4PD4H 2K9JB 5AVSB 2Q6QA 1BDDA 1L0LG 3U59A 1SQQJ 2R32A 1YJ9P 3MD0A 1IFMA 3PJSK 3Q3DA 1PEMA 1NKZB 2KXPB 1IZNB 3AE5C 2PEOA 1T2KC 3AE4C 3GHGB 2LIWA 2ZJSE 2QG4A 1PEQA 1L0ND 1KTMA 1X22A 3HE5B 3CCLP 1JJ2O 3H1JE 2W6AA 1NTZK 2ZXXA 4UB8E 1GDTA 2FYNB 1A8OA 4U0CA 1JO5A 2NPSA 3LIDA 2IBZD 1NH4A 2VLQA 3SFDC 2GDXA 1A02F 1SFCD 1P84H 2ZVNB 1D7MA 1P84I 4UHPB 1NU1J 3PH0A 1CW5A 2WITA 4N78E 2FHSC 2JGPA 4GIFA 5TISH 1PGJA 3AEGC 4L73A 1JMBA 2KLVA 5B5EH 2EFJA 3H1LD 5KLVK 1S5LX 5CMZA 4JYCA 2DGYA 1HF9A 1Z56A 2FKWB 3CX5E 2KOOA 3H1HJ 3V2RA 5HGMA 2JP3A 1YQ3C 2KB7P 2GDWA 1JMMA 3JC22 2WSSH 5APYA 1QLED 1X79B 3V4QA 3Q1MA 1IJDB 3GG2A 3B5NA 1MUUA 2N6ZA 2XV5A 3DS0A 1FZCA 1JY3O 2JQ4A 1SQBD 4WY4C 1IK7A 2KZJA 1SQVD 3HYBA 2YNYA 3OAKA 4GODA 2RMZA 3HTKB 2IFMA 1J2JB 1E0HA 2JWAA 4H44B 3RK3C 1NO4A 4IFMA 3L70G 1BGYE 4U0FA 4Y99B 2XNXA 4HKZH 2GZIA 5I4TG 1KQLA 1RE4C 4KHXA 1SQQG 3V2QA 1LWUB 1S72P 1KN7A 4H13D 2QSIA 3L73E 4XE5B 2G8YA 1RF1B 3BASA 5F2KA 2OYIB 1XTCC 1Q90D 1MFZA 3PLNA 2OYHB 3O6QB 1KQSO 1G2CA 5CCGA 2ZXEB 4D6TJ 3RK3E 4L75A 4PH0A 2CK3H 1NU1G 3G1IA 1GXGA 4PJ0E 4R4LA 3DTJA 1VQPP 2W27A 1BCCJ 1L0HA 1ZP0C 3OA7A 3RK2D 2FVAA 3AECC 3TGUE 4GR2A 3AE3C 2V4HA 3AE6C 1X0TA 3U43A 2E76D 3H1HG 3BRTB 4HYTB 2R3SA 1ZXGA 4COPA 2O01H 4RESB 3E2DA 2E42A 2XU6A 2M3EA 1KLPA 5GTIE 3L74G 2E5YA 4UB6H 1GMJA 2HODA 5AW7B 4LGDE 4GDOA 2MKVA 1KILA 5AVTB 4BWNA 2PEKA 2PFXA 1HTLC 3CCUP 2KYVA 1VQKP 4KT0J 1EQ7A 1KYOD 3FX0A 1JTHB 1M8OB 2GZFA 1ACPA 2QM7A 5AW3B 3V2PA 2Z5IA 2XZ0D 2K1AA 1ZN5A 5APQA 2KG8A 2K2QA 2D2CB 3IN6A 4I2LC 1URQC 2AFEA 3L74E 2N5IA 1GL2C 2PP6A 3H1IJ 2WPTA 2LXBA 2P67A 3VP9A 1CI6A 4B86A 3CPWO 1DH3A 2QJKC 2W6BA 4ASVA 4D6TG 1T8KA 1OR5A 1NGMB 1J1DC 4QKOA 3CD6P 1BCCD 2DW3A 3B8EB 1PPJG 3CX5H 3QWOC 2JJLA 3EQ2A 1VQ9P 5CCHD 2Y9ZA 3T97A 2YKOA 4BPGA 1DV5A 1NTKK 3BCCE 3L72E 1HBWA 2JB0A 2H7HA 2N1TC 2M8PA 1AQ5A 2IYPA 2KG9A 3HD7D 2JKVA 2K92A 1N7SD 1USEA 3CE7A 1FU1A 1ZR4A 3G71P 2KNCA 3NXSA 4PD4E 1U7JA 2B87B 1HJBA 1T6AA 4L74A 3L71E 2LMLA 1EOQA 3M9QA 1HH0A 2JDIH 1SQPJ 1QL1A 1KFMA 1FAVA 3BRVB 2V7QJ 3C9IA 3CWBD 2O01J 5AVWB 1BDCA 1BAJA 1ZMBA 4H2XC 1JOCA 3SWYA 4XRQA 2M8NA 2VLNA 4GOEA 5CJ4A 2Z46A 4A7PA 5KKZC 3AEBC 1ZW0A 3GMAA 4ZNCA 2L22A 2JBGA 2H8PD 3HUSC 4DG9A 1GU5A 2KS1B 3VOPA 1USDA 2QM8A 4DCKA 1LTTC 5KLIB 1GL2A 4W80A 4Y28J 3GHGC 2P7JA 1OZHA 3H1IG 5CHXA 1GW4A 3P05A 3H1JJ 4C7NB 3CCJP 2FQ0A 1RH5B 2FYNC 4PJ0H 2WPQA 1NTMG 1ZRTE 2R5BA
chains in the Genus database with same CATH topology
1KD1Q 1VQ9P 4XFZA 1E6JP 2PENA 4U0AA 1YI2P 2EIAA 1Q81Q 3G26A 3DS0A 5BS2A 2QA4P 1VQMP 2PEMA 1PEOA 2XXMA 5F2NA 4COPA 3DS3A 1Q86Q 3E2DA 3Q20A 3H0DA 2M8PA 1D1DA 2PEIA 5BS1A 3HYBA 3CXCO 3CCSP 1VQ4P 1M6EX 2P9XA 2JYGA 3CC7P 1VQ6P 3H4EA 1VQ5P 2OARA 3G21A 5DCKA 3G71P 1K73Q 1YJ9P 2QEXP 1QVGO 2PEKA 3CCVP 3MGEA 3H47A 1AUMA 1PEMA 5JPAA 5HGOA 2PEOA 3CCUP 1KC8Q 2PEJA 1VQKP 4U0FA 1W2BO 4U0DA 3G0VA 1M74A 1EOQA 1PEQA 1YITP 1IUQA 2E1MA 5F2OA 5I4TG 3OW2O 1YIJP 4XROA 3DS5A 1JJ2O 3CCLP 1QRJA 3G4SP 3CCQP 2EG5A 1EIAA 1S72P 1A8OA 4U0CA 1M90Q 3DS4A 3CCEP 4U0EA 1BAJA 3CMEP 2Z44A 2XT1A 1ZMBA 3B5IA 2M8LA 2PEQA 1Q82Q 5F2KA 1NJIQ 3CC2P 4XRQA 1K30A 1QVFO 3DPHA 2OTJP 2M8NA 1K8AQ 2L6EA 2Z46A 3CC4P 1KQSO 3G6EP 1VQ7P 1M1KQ 3G28A 1YJNP 2EFJA 4GR6A 2LF4A 3LRYA 3CCRP 4QNBA 2PY8A 1PEUA 4M0IA 4PH0A 2Z45A 3G29A 2BUOA 1YJWP 2DGYA 3RG6C 1VQ8P 4COCA 5HGNA 3VRLC 2KODA 3HZQA 1A43A 3M1MA 3WBHA 4U0BA 3G1IA 2CWOA 3DS1A 1K9MQ 1Q7YQ 3CPWO 5HGMA 1M6NA 1VQLP 1RO2A 3DTJA 2JO0A 4WYMA 5HGLA 1N8RQ 1VQNP 1VQPP 2OTLP 3NTEA 2XV6A 1RO0A 2ONTA 3CMAP 3CCMP 2BHVA 4XFYA 4GR2A 4IPYA 3DS2A 4XFXA 3CD6P 2BQ1E 1RNIA 3P05A 3I56P 1YHQP 3CCJP 1VQOP 4PH1A 3G1GA 2JYLA 3I55P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW P;  1KD1 Q;  1VQ9 P;  1VQ8 P;  3CCV P;  1YI2 P;  1Q82 Q;  1NJI Q;  1Q81 Q;  3CC2 P;  3CCU P;  2QA4 P;  1K9M Q;  3CME P;  1Q7Y Q;  1VQM P;  3CPW O;  1KC8 Q;  1QVF O;  1VQK P;  1W2B O;  1VQL P;  2OTJ P;  1N8R Q;  1K8A Q;  1VQN P;  1VQP P;  2OTL P;  1Q86 Q;  1YIT P;  3OW2 O;  3CC4 P;  1YIJ P;  1KQS O;  3G6E P;  3CCS P;  3CXC O;  1JJ2 O;  3CMA P;  3CCM P;  1VQ7 P;  1VQ4 P;  1M1K Q;  3CCL P;  3CD6 P;  3G4S P;  3CCQ P;  3CC7 P;  1YJN P;  1VQ6 P;  1VQ5 P;  1S72 P;  3I56 P;  3CCR P;  1M90 Q;  1YHQ P;  3CCJ P;  3G71 P;  1VQO P;  1K73 Q;  3CCE P;  3I55 P;  1YJ9 P;  2QEX P;  1QVG O; 
#chains in the Genus database with same CATH topology
 1KD1 Q;  1TU3 F;  2AEJ A;  2M3B A;  2WSF H;  2E74 B;  5DJU B;  3R4Y A;  2YXR B;  3FXE A;  2OYO A;  2BEQ D;  4OGQ D;  2JYG A;  2E76 B;  2YIU B;  4ZKP A;  5M1B A;  2Y0E A;  3CCV P;  1L0L J;  1AUM A;  5GTI H;  1KB9 E;  5JPA A;  5HV8 A;  5HGO A;  2NPS D;  1FZF A;  4IFF A;  2IYO A;  4XA4 A;  2AVA A;  2QRX A;  2FYU E;  2LL8 A;  3Q5R A;  1M74 A;  2E75 B;  2E1M A;  3OW2 O;  4XRO A;  1N73 A;  1URQ B;  1SQB K;  2JU1 A;  1LTJ A;  1SQV K;  2MF4 A;  3DS4 A;  3G9R A;  4U0E A;  1R8E A;  5AVU B;  1NOH A;  5AW8 B;  3MIW A;  1BE3 E;  1SQP G;  1SQQ K;  1L4A D;  2Z5H A;  1LP1 A;  3HD7 A;  5KJ7 A;  3MGN A;  1EZV G;  4BRY B;  2ITA A;  1YJN P;  1Q2N A;  2A06 E;  1DEE G;  1KZU B;  1PP9 D;  4M0I A;  2KOG A;  3BVH A;  1QEX A;  2KOD A;  1S1C X;  2Q9I A;  2MD9 A;  3B5N D;  4H44 C;  2KGD A;  1RO2 A;  2AEM A;  2HG5 D;  1Z6M A;  2LR2 A;  4EIJ A;  1CEI A;  2L9F A;  2P1J A;  1RNI A;  2KG6 A;  1NU1 K;  3CXH E;  1HWT C;  1LWU C;  3F89 A;  3N7N A;  1LTS C;  3I55 P;  3H1J D;  5AW0 B;  2KGE A;  1S4X A;  4BXL A;  3GHG A;  5B66 E;  1WMK A;  2UWJ E;  3L73 J;  1DX7 A;  4JPZ B;  1RF1 C;  3HE5 A;  2OYI C;  3M91 A;  5CJ0 A;  3L75 G;  2OYH C;  2LTE A;  1ZR2 A;  1IC2 A;  1D1D A;  1EZV E;  3IR9 A;  2P9X A;  2YO2 A;  4L76 A;  1VF5 B;  2C9L Y;  4U3F G;  1RE3 C;  1J1E B;  4PV1 D;  1IMP A;  1T2K D;  3L36 A;  3WU2 E;  1L0L D;  1T8Z A;  1HUC A;  3H1K E;  3L70 J;  2NO8 A;  3LMO A;  1EC5 A;  1N7S B;  1IFP A;  5BVZ A;  4PD4 I;  2N6Y A;  3TGU J;  5KP8 B;  2GZE A;  3HUS B;  3II6 A;  4XFJ A;  2HFE D;  5CCG D;  3TNU B;  3P32 A;  2X2B A;  2XZR A;  3SSU A;  1BSN A;  1QL2 A;  1W5C E;  2HPC B;  7CEI A;  3B5I A;  1LT1 A;  1JEK A;  2XND H;  2WWW A;  5AVQ B;  2GYK A;  1K04 A;  1RF0 A;  1FDM A;  1QGK B;  2FYZ A;  4RO0 A;  3L75 E;  2W6J H;  2MR8 A;  2JAZ A;  3VMZ A;  4OH8 B;  3A0H E;  4U3F E;  4AYC A;  4QMA A;  2KZI A;  5HGL A;  5AVR B;  4I1L A;  2Q3E A;  3NTE A;  2VLO A;  2K0X A;  3RL0 D;  1NTK E;  3K5B A;  2YMK A;  3HTK A;  4XFX A;  1JB0 J;  1JY2 O;  4W7Y A;  1PGO A;  3P8C E;  1LTA C;  4PH1 A;  1LGH B;  4IZ6 A;  4DZO A;  1L4A A;  2A45 H;  2G3A A;  2I1K A;  2EIA A;  2QNW A;  3F5H A;  1Q81 Q;  1BGY G;  3SFE C;  1KIL D;  2ZFC A;  5TJH A;  2H89 C;  4CPG A;  1MZ8 A;  1LWU A;  4U7J A;  4BPF A;  2H88 C;  2JWD A;  2D2C C;  1H8A A;  2L4B A;  4TT3 H;  3FWL A;  3H6P A;  3M0A A;  3S9O A;  2OAR A;  3L74 J;  3L73 G;  5KP6 B;  1JNM A;  3RK3 D;  2OYH A;  1QX8 A;  1H89 A;  1VPC A;  4GKG A;  3DS5 A;  3V2N A;  3G4S P;  3L70 D;  1EIA A;  1KB9 H;  2ZVO B;  3CCE P;  1M1J C;  2NPS B;  1L0N E;  1SQQ D;  2M8L A;  1Q82 Q;  2M5R A;  1K8A Q;  2I8D A;  5AW6 B;  2IBZ E;  2I1J A;  3BCC J;  3TGU G;  3G6E P;  3L72 J;  2OGU A;  2KLU A;  3G28 A;  4YXD C;  5BU5 A;  4R4M A;  2Q5U A;  2LKM A;  1PEU A;  1NYH A;  3M06 A;  4H0L B;  1CZQ A;  1L0I A;  1HGZ A;  4GT1 A;  3WBH A;  2FQ2 A;  1JY2 P;  3O8Z A;  3H1L E;  3TK1 A;  5AW1 B;  1VQN P;  2KK7 A;  3L71 J;  2J58 A;  1NU1 D;  2ZAE B;  2FAE A;  2N5H A;  3LIE A;  3AE7 C;  3VTP C;  1IFJ A;  4U0A A;  1EXI A;  3LW5 H;  4W7Z A;  5F2N A;  3AEE C;  3KQG A;  1JTH A;  1KFN A;  3CXH H;  2QJP B;  3H1H D;  3CXH I;  1AF8 A;  1UIX A;  2RN0 A;  4JF7 A;  5B66 H;  3TSI A;  3D6Y A;  4RKU J;  3HE4 B;  1OMI A;  1G1I A;  2GDY A;  3L74 D;  5CBN A;  1SVF A;  1EZV I;  5KLI C;  1NVO A;  2HLO A;  1FDO A;  3IAO A;  1N86 A;  5AVY B;  1R5L A;  1R5S A;  4PV1 B;  3KDP B;  3WU2 H;  3CME P;  2FVF A;  1FZB A;  1JUN A;  4WY4 A;  2PEQ A;  1HVV A;  1SQX G;  2K9Y A;  3BAT A;  1IK9 A;  3JCU H;  2N9B A;  1H0T B;  1MKM A;  2E74 C;  2VSQ A;  3L4F A;  3GKL C;  5E79 E;  3B71 A;  2L91 A;  1JY2 N;  1G2C B;  4I6M C;  1DNY A;  1GL2 D;  4JQ0 D;  2W90 A;  2E76 C;  2YIU C;  4MN4 C;  1SQP K;  1AFO A;  1OW6 A;  1YYC A;  1JCC A;  1SLQ A;  3BCC G;  1RE4 A;  2WSE H;  1N8R Q;  3L72 G;  4PD4 D;  2FYU J;  2GZJ A;  2O01 N;  2E75 C;  2XDJ A;  2FVE A;  4IPY A;  1U7M A;  2N50 A;  1W2E A;  2QVA A;  3A0H H;  3VMY A;  1E5W A;  2L5G B;  2B87 A;  4D6T D;  1NTZ G;  1YQ4 C;  1VHN A;  1MFT A;  1SFC B;  2NRG A;  1DIP A;  1GXH A;  1NTM J;  3G26 A;  5BS2 A;  2QA4 P;  3L71 G;  1PPJ D;  1SQX E;  3IF4 A;  2XXM A;  3RL0 B;  2N1T D;  1SP4 A;  2FFD B;  1S9K E;  2M0B A;  2FXM A;  3CC7 P;  3EFG A;  4HH2 A;  1M1J B;  5H2F E;  1M57 D;  1P84 D;  2BCC G;  2PGD A;  3CX5 I;  1M7L A;  2C9N Y;  3WUV A;  2K93 A;  5KLV G;  1KIL B;  1LTG C;  1G1J A;  4HKG A;  4YTP C;  1RQU A;  2AXC A;  3FWN A;  1PGP A;  5EJD A;  2W83 C;  3M0D C;  2EG5 A;  3NFQ A;  2XKM A;  5KJ7 D;  3LW5 J;  1AQT A;  3H25 A;  3W68 A;  2Z44 A;  1NTZ E;  1KYO E;  1HGV A;  1NJI Q;  1FOS F;  2A45 G;  1ZRT D;  2KSJ A;  3AE9 C;  2VRS A;  2LPK A;  2IFN A;  2C0W A;  4C7R A;  1L0L K;  3A7O A;  1VKU A;  4C7N A;  1N2D C;  1GPJ A;  2PNG A;  2PY8 A;  3NTN A;  2Z45 A;  1VF5 C;  2BCC E;  3V5B A;  1J1E C;  2P10 A;  5KLV E;  2M5A A;  5HVC A;  2CWO A;  3DS1 A;  3A3Y B;  1ZLL A;  3EFF K;  2RH0 A;  2WPV B;  1OFC X;  3H32 B;  2ERH A;  2WT7 B;  4MRT C;  3H1K J;  1EDL A;  1N7S C;  3EJE A;  2J5U A;  4N3Y B;  3U1C A;  2QIW A;  4H13 B;  1YHQ P;  3G1G A;  1T3U A;  4LC1 A;  1HQB A;  3EJB A;  1YI2 P;  3H1I D;  2ZYA A;  1BCC E;  1FZA A;  2FYU G;  2ZT9 D;  1URQ A;  1AA0 A;  1UNK A;  5EW5 E;  1Q86 Q;  1NTM D;  3G3Z A;  1F80 D;  1LNQ A;  3L75 J;  2WSE J;  1LT9 B;  3ITK A;  2KNC B;  2WSC H;  2IDB A;  1BE3 G;  4U3F J;  1RQV A;  3D71 A;  3Q2Y A;  3D70 A;  1W2B O;  1KQG B;  1NHL A;  3RK2 B;  2K94 A;  3L37 A;  3VMX A;  2A06 G;  4KJM A;  3E7K A;  2CPS A;  1YBK A;  1GK4 A;  4EYY Q;  2N1T A;  3DPH A;  3CWB E;  5APU A;  4PXH B;  4GR6 A;  1EDJ A;  1SQP D;  3SWK A;  1EZV D;  1T3J A;  3CI9 A;  2KOQ A;  2WVR A;  5GTH E;  5E79 H;  4H44 D;  3A2A A;  3FGA D;  5EFW B;  2OTL P;  2M8R A;  2N98 A;  4WB4 A;  4XFY A;  4F37 A;  3VN0 A;  3I56 P;  2CG5 B;  3GF7 A;  2O3J A;  2KWL A;  4GOF A;  2KGA A;  2LOL A;  2NPS C;  1L0N J;  2KP8 A;  3USS A;  1E79 H;  3DS3 A;  3H1K G;  3Q20 A;  2K9J A;  3N4X A;  1BGY J;  3HUS A;  1VQ4 P;  2HPC A;  3L75 D;  2B9B A;  3MGE A;  1XTG B;  3UIA A;  4H0L C;  1AYI A;  2R5D A;  5KTB A;  2KUB A;  3RBZ A;  3H1L J;  4U3F D;  5H2F H;  1N73 B;  1M90 Q;  1NAF A;  3M9H A;  1LTJ B;  3B4S A;  4N78 D;  2CPB A;  3KZI E;  2P2U A;  1AJY A;  2KIK A;  2POH A;  3CC2 P;  3B5N C;  2ROQ A;  1OX3 A;  2MJZ A;  1EXJ A;  2IZ0 A;  1LP1 B;  2FQ1 A;  2KOS A;  3HD7 B;  1NTK G;  3CX5 D;  2QJP C;  2WSC J;  1YTZ I;  1M1K Q;  3JCU E;  2WTY A;  2LF4 A;  1KYO H;  2WSF J;  1EDI A;  1Y9B A;  2BUO A;  3NY7 B;  1YJW P;  1UII A;  1OW8 A;  3P7K A;  3HZQ A;  4U0B A;  2QJY C;  1X9V A;  2JO1 A;  2KI7 B;  3MHV A;  2JO0 A;  1PP9 E;  4NPD A;  2YKQ A;  3CMA P;  3EJD A;  1IFN A;  1OIP A;  4PWV B;  1VQO P;  1UJZ A;  3D6Z A;  3KPE A;  4PV1 C;  1EMV A;  2Y9Y A;  3PP5 A;  1LTB C;  1JCD A;  2HR3 A;  3PTZ A;  4DJG A;  3PHL A;  4I7Z C;  3CXC O;  2D2C D;  1OVV A;  3ZDM A;  1BGY D;  1AVO A;  5CCG C;  4K35 A;  2WPS A;  1L0N G;  2O1K A;  2ZT9 B;  1FBM A;  2A45 I;  1LJ2 A;  5KAI H;  4TLF A;  1HY8 A;  2IBZ G;  4WY4 D;  3L73 D;  2K5X A;  1YIJ P;  1QRJ A;  4IFD K;  1FJK A;  1OWA A;  3PRJ A;  1L0L E;  3C1L A;  3AE8 C;  3KXD A;  4JBZ A;  1RF1 A;  2GM4 A;  2OYI A;  3V4W A;  1SFC C;  3H1L G;  3WUU A;  3O6Q A;  2MR7 A;  2Z4E A;  4OVN F;  1SQX J;  3CC4 P;  1YTZ T;  4OGQ B;  3RL0 C;  4EI2 A;  4IL6 E;  2FFD C;  5CBO A;  1RE3 A;  3LRY A;  4QNB A;  2GUV A;  1KB9 I;  4R0M A;  3TGU D;  1VQ8 P;  2AXT E;  1GD2 E;  1M56 D;  3GZM A;  2WMM A;  1A43 A;  1K05 A;  1FS0 E;  1KIL C;  1K9M Q;  3U1A A;  2E5T A;  1FOS E;  1NKN A;  3OJA B;  1ZME C;  4M3L A;  4O9B A;  3CCM P;  3HE4 A;  3AE1 C;  2BQ1 E;  1GZL A;  1WT6 A;  4H2W C;  3W67 A;  5GTH H;  3E1R A;  2J59 M;  2R3C A;  1SQB G;  2JR8 A;  5AW9 B;  3MZW B;  2QE7 H;  1JM0 A;  3CCR P;  4YXW H;  1SQV G;  2N9Y B;  3A5T A;  3VYI A;  4XFZ A;  3KHU A;  1L4A B;  1NTZ J;  1KQF B;  3EWK A;  3A0B H;  2JU2 A;  3H0D A;  2EHT A;  5BS1 A;  2KR5 A;  2KGC A;  2B89 A;  2C0X A;  1KIL E;  1VL2 A;  2FYU K;  3JSV C;  1GK6 A;  3B5N B;  2L0Q A;  1H0T A;  2IZ1 A;  2K0D X;  2BCC J;  5APW A;  1KC8 Q;  3WUT A;  2PEJ A;  5KLV J;  1Y8A A;  1WRG A;  1YIT P;  1IUQ A;  1FZC B;  5F2O A;  4Z1M H;  1S5L E;  1NTM K;  3CCQ P;  5AVV B;  2YXQ B;  4H2Y C;  4H13 C;  1SQB E;  1X8Y A;  2XT1 A;  1OXZ A;  1SQV E;  2QJY B;  1ZOY C;  1PIX A;  1NQ4 A;  3P8M C;  1H88 A;  3L70 E;  1QVF O;  3GLM A;  2E43 A;  1MV8 A;  1OVU A;  1A02 J;  2E74 D;  1CSB A;  3KZI H;  2CNR A;  1SQQ E;  4WWI A;  1SQX D;  4JYB A;  1JY3 P;  3KYQ A;  1SFC A;  1S9K D;  1LT9 C;  1OW7 A;  2Q1K A;  2AFD A;  3B4Q A;  2V7Q H;  1VQL P;  2FFD A;  3GF3 A;  4I7Z B;  2E75 D;  3RK2 C;  1RO0 A;  2ZYD A;  1M1J A;  1URQ D;  3DS2 A;  5AW2 B;  3BCC D;  4WBA A;  3L72 D;  4C46 A;  4BPH A;  2Y0C A;  2FXP A;  2CGQ A;  3RG2 A;  1NAY A;  1NU1 E;  2NZ2 A;  5DJT B;  2BEZ F;  1N7L A;  1VQM P;  2PEM A;  1NTZ D;  1FZE A;  2GA1 A;  2PEI A;  1IFI A;  3CCS P;  3CWB J;  2PRR A;  3R2P A;  2BAS A;  3MTU E;  3L71 D;  1PL5 A;  5DCK A;  4ASW A;  1DD3 A;  1K73 Q;  1BXI A;  3ABV C;  3TF5 A;  4AUW A;  3H1H E;  5APT A;  1RY3 A;  1FDI A;  4UB8 H;  4U0D A;  3WMM 0;  2WPR A;  2BCC D;  1BE3 J;  3RBX A;  2RKL A;  4N6J A;  5KLV D;  3TDK A;  5C39 A;  1GTW A;  2HOD B;  5KP7 B;  5APV A;  1FC2 C;  1JY3 N;  3QH9 A;  4WY4 B;  1K30 A;  2VLP A;  2AEF A;  5L8R J;  3H32 A;  3VMA A;  2WT7 A;  3Q5S A;  2JEE A;  1HJ0 A;  3M9B A;  1VQ7 P;  2HYN A;  2Y0D A;  1KOR A;  2KS1 A;  1PFI A;  1Y47 A;  2OQQ A;  1VF5 D;  3RK3 B;  2KW2 A;  1BCC G;  2ZYG A;  4CA3 A;  4IL6 H;  1Q7Y Q;  5KAF E;  3I5C A;  2O1J A;  4LLH A;  1LT9 A;  1MZ9 A;  3HRN A;  2AXT H;  1IFD A;  2OTK E;  2LIU A;  1N73 C;  2FXO A;  1LTJ C;  5CCH C;  1FJP A;  2PEN A;  1ZV8 A;  3GZL A;  2IBZ I;  1L2P A;  1CI6 B;  1RHZ B;  4D6T E;  3Q5P A;  1KB9 D;  1VDF A;  3HD7 C;  5KJ7 C;  2FYU D;  1PPJ E;  2YO3 A;  2MVU A;  2MY5 A;  3AE2 C;  2GUS A;  3T97 B;  3G0V A;  3CWB G;  1IO4 A;  3GW6 A;  1IMQ A;  3VP8 A;  2R44 A;  1P84 E;  1FE6 A;  4EOT A;  1PP9 J;  1L0N K;  5KAI E;  3MUD C;  5AW5 B;  1BE3 D;  1AVY A;  2IPP A;  5TIS E;  2KSE A;  5B5E E;  1DD4 A;  4AQR D;  1S5L H;  2A06 D;  2P58 A;  4OWF A;  2OTJ P;  3C8V A;  3V6I A;  4HB1 A;  4BRY A;  2PAJ A;  2L6E A;  2B88 A;  2YKP A;  4DOJ A;  1DEB A;  2GZG A;  1S3J A;  4EDF A;  1X3O A;  5CZD B;  1NTK J;  1U57 A;  1KV4 A;  3G29 A;  3L35 A;  5AVX B;  3RG6 C;  5HGN A;  3S1K A;  3VRL C;  3M1M A;  2WZ7 A;  2ZT9 C;  3CXH D;  3CLQ A;  1M6N A;  3M0D A;  2M5A B;  4WYM A;  3GJN A;  3S4R A;  4K3A A;  2WQY C;  2ONT A;  2BHV A;  2MVV A;  2YMY A;  1ZNV A;  4RJT A;  5APX A;  1EDK A;  5AVZ B;  5K5G B;  3RGU A;  1PEO A;  3TYY A;  1GL2 B;  2DNW A;  3H1I E;  1M6E X;  2K88 A;  2Q3I A;  4OGQ C;  1VQ6 P;  5CCH A;  1FZG A;  1RF0 C;  3H4E A;  1VQ5 P;  3A0B E;  3G21 A;  3H1K D;  2QEX P;  1QVG O;  1NTM E;  4ZMD A;  3H47 A;  2W8Z A;  4H0L D;  2Q7C A;  2LXC B;  2QJK B;  1KMI Z;  1PGQ A;  1S2E A;  1N7S A;  1J1D B;  3NMD A;  3E1I A;  4NPF X;  2CQ8 A;  3AEF C;  3TNU A;  3MP7 B;  3FXD A;  4ZKU A;  1GU4 A;  4IOI H;  5AW4 B;  2XZ1 C;  5BU8 B;  2FY8 A;  2H43 A;  1L4A C;  3MUD A;  2N1T B;  1PP9 G;  2KOR A;  4Y99 C;  1PZQ A;  1SS1 A;  2SPZ A;  4NPE A;  4WVZ A;  3IFM A;  1NWQ A;  2K0Y A;  4COC A;  2LKI A;  1NTK D;  4YPC A;  1PV3 A;  3P8C D;  4HJG H;  1SQP E;  3SWF A;  1LTI C;  3AED C;  2FAD A;  2K37 A;  3H1J G;  2XV6 A;  1OVR A;  2FAC A;  1FZC C;  5APS A;  1AV1 A;  3AEA C;  2AF8 A;  1FR2 A;  1SQX K;  1KYO I;  1GW3 A;  2JYL A;  4IL6 X;  5KAF H;  1BSH A;  4UB6 E;  1E6J P;  2IX7 C;  1SQB J;  4NEO A;  2K3R A;  2KOP A;  1SQV J;  3RL0 g;  5KKZ B;  2FBW C;  2EHS A;  4DT0 A;  3CL3 D;  4PD4 H;  2K9J B;  5AVS B;  2Q6Q A;  1BDD A;  1L0L G;  3U59 A;  1SQQ J;  2R32 A;  1YJ9 P;  3MD0 A;  1IFM A;  3PJS K;  3Q3D A;  1PEM A;  1NKZ B;  2KXP B;  1IZN B;  3AE5 C;  2PEO A;  1T2K C;  3AE4 C;  3GHG B;  2LIW A;  2ZJS E;  2QG4 A;  1PEQ A;  1L0N D;  1KTM A;  1X22 A;  3HE5 B;  3CCL P;  1JJ2 O;  3H1J E;  2W6A A;  1NTZ K;  2ZXX A;  4UB8 E;  1GDT A;  2FYN B;  1A8O A;  4U0C A;  1JO5 A;  2NPS A;  3LID A;  2IBZ D;  1NH4 A;  2VLQ A;  3SFD C;  2GDX A;  1A02 F;  1SFC D;  1P84 H;  2ZVN B;  1D7M A;  1P84 I;  4UHP B;  1NU1 J;  3PH0 A;  1CW5 A;  2WIT A;  4N78 E;  2FHS C;  2JGP A;  4GIF A;  5TIS H;  1PGJ A;  3AEG C;  4L73 A;  1JMB A;  2KLV A;  5B5E H;  2EFJ A;  3H1L D;  5KLV K;  1S5L X;  5CMZ A;  4JYC A;  2DGY A;  1HF9 A;  1Z56 A;  2FKW B;  3CX5 E;  2KOO A;  3H1H J;  3V2R A;  5HGM A;  2JP3 A;  1YQ3 C;  2KB7 P;  2GDW A;  1JMM A;  3JC2 2;  2WSS H;  5APY A;  1QLE D;  1X79 B;  3V4Q A;  3Q1M A;  1IJD B;  3GG2 A;  3B5N A;  1MUU A;  2N6Z A;  2XV5 A;  3DS0 A;  1FZC A;  1JY3 O;  2JQ4 A;  1SQB D;  4WY4 C;  1IK7 A;  2KZJ A;  1SQV D;  3HYB A;  2YNY A;  3OAK A;  4GOD A;  2RMZ A;  3HTK B;  2IFM A;  1J2J B;  1E0H A;  2JWA A;  4H44 B;  3RK3 C;  1NO4 A;  4IFM A;  3L70 G;  1BGY E;  4U0F A;  4Y99 B;  2XNX A;  4HKZ H;  2GZI A;  5I4T G;  1KQL A;  1RE4 C;  4KHX A;  1SQQ G;  3V2Q A;  1LWU B;  1S72 P;  1KN7 A;  4H13 D;  2QSI A;  3L73 E;  4XE5 B;  2G8Y A;  1RF1 B;  3BAS A;  5F2K A;  2OYI B;  1XTC C;  1Q90 D;  1MFZ A;  3PLN A;  2OYH B;  3O6Q B;  1KQS O;  1G2C A;  5CCG A;  2ZXE B;  4D6T J;  3RK3 E;  4L75 A;  4PH0 A;  2CK3 H;  1NU1 G;  3G1I A;  1GXG A;  4PJ0 E;  4R4L A;  3DTJ A;  1VQP P;  2W27 A;  1BCC J;  1L0H A;  1ZP0 C;  3OA7 A;  3RK2 D;  2FVA A;  3AEC C;  3TGU E;  4GR2 A;  3AE3 C;  2V4H A;  3AE6 C;  1X0T A;  3U43 A;  2E76 D;  3H1H G;  3BRT B;  4HYT B;  2R3S A;  1ZXG A;  4COP A;  2O01 H;  4RES B;  3E2D A;  2E42 A;  2XU6 A;  2M3E A;  1KLP A;  5GTI E;  3L74 G;  2E5Y A;  4UB6 H;  1GMJ A;  2HOD A;  5AW7 B;  4LGD E;  4GDO A;  2MKV A;  1KIL A;  5AVT B;  4BWN A;  2PEK A;  2PFX A;  1HTL C;  3CCU P;  2KYV A;  1VQK P;  4KT0 J;  1EQ7 A;  1KYO D;  3FX0 A;  1JTH B;  1M8O B;  2GZF A;  1ACP A;  2QM7 A;  5AW3 B;  3V2P A;  2Z5I A;  2XZ0 D;  2K1A A;  1ZN5 A;  5APQ A;  2KG8 A;  2K2Q A;  2D2C B;  3IN6 A;  4I2L C;  1URQ C;  2AFE A;  3L74 E;  2N5I A;  1GL2 C;  2PP6 A;  3H1I J;  2WPT A;  2LXB A;  2P67 A;  3VP9 A;  1CI6 A;  4B86 A;  3CPW O;  1DH3 A;  2QJK C;  2W6B A;  4ASV A;  4D6T G;  1T8K A;  1OR5 A;  1NGM B;  1J1D C;  4QKO A;  3CD6 P;  1BCC D;  2DW3 A;  3B8E B;  1PPJ G;  3CX5 H;  3QWO C;  2JJL A;  3EQ2 A;  1VQ9 P;  5CCH D;  2Y9Z A;  3T97 A;  2YKO A;  4BPG A;  1DV5 A;  1NTK K;  3BCC E;  3L72 E;  1HBW A;  2JB0 A;  2H7H A;  2N1T C;  2M8P A;  1AQ5 A;  2IYP A;  2KG9 A;  3HD7 D;  2JKV A;  2K92 A;  1N7S D;  1USE A;  3CE7 A;  1FU1 A;  1ZR4 A;  3G71 P;  2KNC A;  3NXS A;  4PD4 E;  1U7J A;  2B87 B;  1HJB A;  1T6A A;  4L74 A;  3L71 E;  2LML A;  1EOQ A;  3M9Q A;  1HH0 A;  2JDI H;  1SQP J;  1QL1 A;  1KFM A;  1FAV A;  3BRV B;  2V7Q J;  3C9I A;  3CWB D;  2O01 J;  5AVW B;  1BDC A;  1BAJ A;  1ZMB A;  4H2X C;  1JOC A;  3SWY A;  4XRQ A;  2M8N A;  2VLN A;  4GOE A;  5CJ4 A;  2Z46 A;  4A7P A;  5KKZ C;  3AEB C;  1ZW0 A;  3GMA A;  4ZNC A;  2L22 A;  2JBG A;  2H8P D;  3HUS C;  4DG9 A;  1GU5 A;  2KS1 B;  3VOP A;  1USD A;  2QM8 A;  4DCK A;  1LTT C;  5KLI B;  1GL2 A;  4W80 A;  4Y28 J;  3GHG C;  2P7J A;  1OZH A;  3H1I G;  5CHX A;  1GW4 A;  3P05 A;  3H1J J;  4C7N B;  3CCJ P;  2FQ0 A;  1RH5 B;  2FYN C;  4PJ0 H;  2WPQ A;  1NTM G;  1ZRT E;  2R5B A; 
#chains in the Genus database with same CATH homology
 1KD1 Q;  1VQ9 P;  4XFZ A;  1E6J P;  2PEN A;  4U0A A;  1YI2 P;  2EIA A;  1Q81 Q;  3G26 A;  3DS0 A;  5BS2 A;  2QA4 P;  1VQM P;  2PEM A;  1PEO A;  2XXM A;  5F2N A;  4COP A;  3DS3 A;  1Q86 Q;  3E2D A;  3Q20 A;  3H0D A;  2M8P A;  1D1D A;  2PEI A;  5BS1 A;  3HYB A;  3CXC O;  3CCS P;  1VQ4 P;  1M6E X;  2P9X A;  2JYG A;  3CC7 P;  1VQ6 P;  3H4E A;  1VQ5 P;  2OAR A;  3G21 A;  5DCK A;  3G71 P;  1K73 Q;  1YJ9 P;  2QEX P;  1QVG O;  2PEK A;  3CCV P;  3MGE A;  3H47 A;  1AUM A;  1PEM A;  5JPA A;  5HGO A;  2PEO A;  3CCU P;  1KC8 Q;  2PEJ A;  1VQK P;  4U0F A;  1W2B O;  4U0D A;  3G0V A;  1M74 A;  1EOQ A;  1PEQ A;  1YIT P;  1IUQ A;  2E1M A;  5F2O A;  5I4T G;  3OW2 O;  1YIJ P;  4XRO A;  3DS5 A;  1JJ2 O;  3CCL P;  1QRJ A;  3G4S P;  3CCQ P;  2EG5 A;  1EIA A;  1S72 P;  1A8O A;  4U0C A;  1M90 Q;  3DS4 A;  3CCE P;  4U0E A;  1BAJ A;  3CME P;  2Z44 A;  2XT1 A;  1ZMB A;  3B5I A;  2M8L A;  2PEQ A;  1Q82 Q;  5F2K A;  1NJI Q;  3CC2 P;  4XRQ A;  1K30 A;  1QVF O;  3DPH A;  2OTJ P;  2M8N A;  1K8A Q;  2L6E A;  2Z46 A;  3CC4 P;  1KQS O;  3G6E P;  1VQ7 P;  1M1K Q;  3G28 A;  1YJN P;  2EFJ A;  4GR6 A;  2LF4 A;  3LRY A;  3CCR P;  4QNB A;  2PY8 A;  1PEU A;  4M0I A;  4PH0 A;  2Z45 A;  3G29 A;  2BUO A;  1YJW P;  2DGY A;  3RG6 C;  1VQ8 P;  4COC A;  5HGN A;  3VRL C;  2KOD A;  3HZQ A;  1A43 A;  3M1M A;  3WBH A;  4U0B A;  3G1I A;  2CWO A;  3DS1 A;  1K9M Q;  1Q7Y Q;  3CPW O;  5HGM A;  1M6N A;  1VQL P;  1RO2 A;  3DTJ A;  2JO0 A;  4WYM A;  5HGL A;  1N8R Q;  1VQN P;  1VQP P;  2OTL P;  3NTE A;  2XV6 A;  1RO0 A;  2ONT A;  3CMA P;  3CCM P;  2BHV A;  4XFY A;  4GR2 A;  4IPY A;  3DS2 A;  4XFX A;  3CD6 P;  2BQ1 E;  1RNI A;  3P05 A;  3I56 P;  1YHQ P;  3CCJ P;  1VQO P;  4PH1 A;  3G1G A;  2JYL A;  3I55 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...