1VQ5Q

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq5Q00
1YJNQ 1VQ4Q 3CCRQ 3CCJQ 1QVGP 1YJWQ 1K8AR 1K9MR 2OTLQ 3I55Q 1YI2Q 1VQMQ 1KC8R 3CC4Q 1VQNQ 3CCMQ 3CC7Q 1YJ9Q 2QEXQ 3OW2P 1YITQ 3CCSQ 1W2BP 3CD6Q 1Q7YR 2OTJQ 3I56Q 1K73R 3CC2Q 1Q81R 1Q86R 3CCVQ 1YHQQ 1VQ6Q 1YIJQ 1Q82R 1N8RR 1KD1R 1M1KR 3CMAQ 3CCQQ 1VQ5Q 1S72Q 1VQLQ 3G6EQ 1NJIR 2QA4Q 3G71Q 3CPWP 1VQ8Q 3CXCP 3CMEQ 1JJ2P 1VQKQ 1QVFP 1M90R 1KQSP 3CCLQ 3CCEQ 3G4SQ 1VQOQ 1VQ7Q 1VQPQ 1VQ9Q 3CCUQ
chains in the Genus database with same CATH superfamily
2EQKA 4PLIA 3X26B 2DBKA 5GJVB 5I21A 4M75A 2W10A 1N9RA 2EFIA 2QEXQ 2K7AA 1VQ8T 2E12A 3SB2A 2D0QB 3UWNA 2ZPBB 4JLGA 3ZFJA 2JN0A 9ATCB 4MZPA 1WNLA 1EIFA 2OTLT 2WSFE 3NGPA 2CUDA 1E6GA 4QVCA 5FRNA 4M7DC 4J8OA 1OZ3A 1SHGA 3BE3A 3QWXX 2NLUA 4J6YA 3MPUB 1MMGA 2O31A 4RTZA 1YIJQ 1C1AA 4C92D 4WF2A 1Z9ZA 3QYHB 1QVFA 1QWFA 2M51A 4C8QF 5LJ3j 1IGQA 3S6WA 2E6NA 2K5LA 2RF0A 2H3JA 5GMKe 2XD0A 1QKXA 1UECA 1YHQA 2FZGB 3GP8A 1M3CA 3EG3A 1ZSGA 2E4HA 2OTJQ 3CC2A 3OS1A 1OZ2A 3BDUA 3QBYA 1YNZA 4PKCC 2HNIA 4RKUE 2BKDN 1JXOA 3H0IA 5GAMf 4PJOB 5AYFA 1WHGA 3META 5KE2A 1QVPA 4CRIA 1VQ5A 2LMJA 3RIRA 4FW1A 3G4ST 5L8RE 2ZGWA 5GAMg 4M77E 2F1LA 4A54A 3LH5A 1RAGB 1N9SA 1IREB 2V8IA 1T3SA 1M1KR 1WZOA 2DPPB 2RMOA 3OB9A 3LW5E 1M90R 4OMNA 2L0AA 2R57A 3QYGB 1Q86U 3L2RA 3CCUQ 1M1GA 2CZ7B 2DJZA 1C6VX 4RTVA 1K8AR 1NYFA 2ZPFB 5D7UA 3OMCA 4XTZA 2RI5A 1VQNQ 1JQQA 4JZ4A 1OOTA 3OW2P 1M1KC 4QQ6A 2LJ1A 4E6RA 3PVQA 2CZ6B 2X35A 5I22A 5KYUB 2AK5A 3S3OA 5KYUA 3OYGA 2K3BA 4ZN1A 3G71Q 3C4SA 2HDAA 2F5KA 4XAXB 1RACB 1SSFA 2C06A 3FLGA 2D6FA 2B8AA 2PVGB 2KMTA 1GFDA 4YTLA 3VRYA 1YI2Q 1QKWA 4PLLA 3HFNA 1TG0A 3LGFA 2WACA 1AZEA 5GAOn 1KD1R 1WJQA 2HKQB 4ZTJA 2XDBA 4M7AF 1QVGS 1N5ZA 2OAWA 4XTXA 3QJ6A 2KEAA 2DL3A 2ED0A 4OGEA 4WTOB 1MV0B 2DL8A 4LDUA 5J3BA 2LQKA 4F7UF 2X9HA 2C0OA 2BE9B 2CT3A 6AT1B 2F2XA 4QQGA 1WGSA 2KYMA 1WLPB 2JZ2A 3RBBB 1JJ2S 2QQ9A 2ECZA 2VGNA 1I81A 4HXJA 3CC4Q 3NPFA 4RTUA 2YDLA 5GAOr 3JCMd 4J9BA 1ZSZC 1XTDA 4QW2A 1RAHB 2ZPEB 5GAMh 1TUDA 4CC4B 4JDSA 2GTJA 3H8ZA 2HL5C 4XTWA 4C92G 4OGCA 4E7SA 1ZUKA 2RH2A 2HSPA 1VQ5T 1RI0A 4D6WA 3JB9J 1VQ6T 4FSSA 5FU7B 2PVOB 2YRDA 4C0ZA 3CD6T 2HBWA 1VA7A 4PFOA 2JS0A 3VRZA 1X6BA 2LT1A 1NEGA 4OMMA 2SRCA 1N8RU 1M4ZA 2GBQA 1RAIB 3JCMg 3I5SA 1WJRA 1RADB 2J06A 3PT9A 3N5BB 2EKOA 2MWPA 3M55A 1RAAB 4IIOA 1UGSB 2IIMA 3SFMA 5J39A 2KRNA 1M8MA 1QMCA 2MCNA 3GIBA 3PMIA 2LX9A 1KC8U 4B6MA 1Q95G 2F69A 3R6OA 2M16A 3MCAB 2HCKA 4AG1C 2FPEA 4LDYA 4L59A 3CPWP 3ME9A 1W70A 1XQHA 3M0PA 1YJ9A 1AEYA 2YUQA 4C0FA 5FRMA 4OMFB 3P8DA 1GCQA 4FYXB 2X4JA 3JSCA 5IN1A 1D0YA 5IT9E 1WA7A 3X20B 1VQ7A 3A5ZB 2KT8A 2VGMA 3ER0A 1YCYA 2HKNA 2I2LA 2VXEA 1VQ4A 1VQKQ 2YWWA 4X9DA 1NBEB 4AG2C 3S3NA 1BKBA 2WSCE 2RM4A 4AFZC 3L2UA 3OY9A 2Y4XA 4LD9K 5GMKi 3CCLT 2E6ZA 4AFSC 3CMAA 2G6FX 1KQSS 1ZHIA 1G83A 5EC7A 3CEYA 2A0FB 2DIQA 2MWOA 4HT9A 3JRZA 1AHJB 4X9CA 2E65A 4M7DB 3X28B 1FWZA 2HEQA 5LJ3h 3WVEB 2QG9B 2EKHA 2QQRA 4F04B 2JS2A 1OYXA 1UJYA 3CBOA 2J05A 5L23A 1M1FA 2CS7A 2EGCA 3M0RA 4LDWA 3I56T 2E64A 2BUDA 3DB4A 2D8HA 4M7AD 2QQAA 3E1SA 3M54A 2DRMA 2XDDA 2DYIA 1VQOT 1JEGA 1K73U 4ZN3A 1W1FA 2L2PA 4Z02A 1X27A 1RLQC 2NYSA 3EHRA 2KYBA 4E7ZA 4OMOA 4K11A 1GBQA 4BE1A 2RB6A 1TOVA 1VQLA 2QA4T 2DVJA 3OYFA 1WHKA 2EYXA 5GJWB 3L2QA 3H9NA 1KQSP 3UA6A 4M75C 5FU6B 1WI7A 3CCMA 1ZX6A 3TQ7P 2DTHA 3UA7A 1KIKA 4F7UE 1X69A 1VQ9T 3RDVA 5KYXA 1BBZA 4NOYA 2CSQA 1QCFA 3CBPA 2PTKA 4GY5A 4XU3A 1VQ4T 1X2QA 5KCHA 5DLOA 1D0XA 1T0HA 2DO3A 1WDXA 5GAMd 3NTIA 3EGXA 4M78B 3V8JA 1ZQ1A 4QKUA 5GAOq 1G8XA 2CUBA 3GF5A 4Q5WA 3CCQA 2K5IA 2DZ9A 2BE7D 2DTOA 3A8HB 3H0HA 1YI2T 1M8VA 5HK3A 4AFUC 4RG2A 5IXBA 4A4EA 2ABLA 4A53A 1Q7YC 1UJ0A 2O4XA 1W2BS 1D3BA 2KAFA 2LNHB 4C5HA 4EMKC 3A1PA 2X51A 4E2FB 3NTHA 3CCRA 2DZCA 2MAMA 5HKCA 4DOWA 2CP0A 5KYWA 5FROA 1YI2A 2CT4A 2D0NA 3REAB 3HKSA 4DEYA 1OEBA 3JB9F 2XDPA 1YWOA 2VC8A 4V2SA 1B07A 2RJCA 2BZXA 4PJOD 1NLPC 1WPYA 2HSEB 3OYJA 4C8QD 1TWBA 4C92F 3WVDB 4JRQA 2KY9A 1K9MC 2ZAEA 2PUOB 4M77C 4OB2B 4E7KA 3EGUA 1BU1A 4PJOC 1SRLA 2I0NA 5A0GA 1UB4A 2JOYA 4M7AA 1Q7YU 1KK7A 1TUGB 1U5SA 2E41A 2RHYA 3MEVA 1X75C 4OVAA 1YITA 3LWHA 4JRKA 3L2VA 1Q81C 3EG2A 1IHVA 1VQPQ 4BY6B 1YCSB 1PSFA 3FIFA 2EQIA 1R8OB 1Y96B 1Y96A 4M78G 2VWFA 1S72T 5LJ5j 2AZSA 4M78D 1NPRA 4J83A 1AOJA 4KRTA 1K76A 5KE3A 4MMLA 2X3WD 3CCVT 4J7FA 4BD3A 3SD4A 3TSWA 4M7AG 2KI7A 3CCJT 3AT1B 1WFWA 1PRLC 1NJIC 3GBQA 2X3XD 3JCMW 3OBWA 3M57A 2EGEA 2GFAA 2RK1A 2DTIA 2LQ8A 1FX7A 1GBRA 3VS4A 4ZNXA 4M78A 3CCEQ 2AHJB 2HD0A 4DBHA 1VQOQ 3JCMf 1NLOC 2ENMA 1YITT 3S3MA 4J9CA 2OAUA 3HFOA 5GANe 2FZKB 2JW4A 4C8QA 5CK9A 3G71T 3PNWC 3G4SA 1H92A 1VQ6Q 1K73C 3CBMA 3QG1A 1H641 1QCOA 4KULA 4OMQA 1G2BA 3U23A 2GQVA 1K4US 3JB9H 1WJSA 2ATCB 3PE0A 4FYVB 2K4YA 1YFNA 2IVWA 2K2MA 3D7SB 5LJ3f 4M77D 3GNFB 2DAQA 2RD1A 1U06A 3VS7A 4IUPA 2A28A 3QIIA 3RKWA 2C0TA 3EFOB 3CCVQ 2KQWA 3QXEB 3EG0A 3GLXA 3UT1A 4C8QE 3A8GB 3CPFA 2YLCA 3MP1A 1YP5A 4C92C 1Y07A 2AKKA 2CZ1B 2DXBA 3OQ5A 3VYHB 2JJ9A 1BI2A 1NM7A 5LJ3d 2QDYB 1WHMA 3QZ5B 4KGVB 5CR2A 2DJQA 2AIRB 1GCQC 4Z88A 3JCMe 3REBB 3V7SA 5A0DA 1QLYA 4R55A 4J5YA 2QGGA 1LNXA 1H8KA 4LD6A 5FU7C 5FLXE 2KXDA 1AD5A 1QW1A 3ZL7C 1ZA1B 1WQ7A 2VKNA 1MUZA 4OP0A 2VVKA 3EFRA 2LTOA 3LGLA 4Y28E 4KT0E 1VQOA 5GANd 2QTVA 3L42A 4PJNA 1M90U 2BIVA 4J6WA 2X4WA 5GAOl 3VS1A 4OMLA 4RCCA 3P8BB 4EMHA 4M78E 2RO0A 4A4KA 4DOVA 1KD1U 3HHTB 1MNDA 2XI9A 4KH1B 4NS5A 4BI8B 2DYBA 2CH4A 2ESWA 2KVQG 1RAFB 2CP2A 1SF9A 2JTFA 3HRSA 4HVVA 1UHFA 1ABQA 1M2OA 5FWCA 4XQ3A 1VQ5Q 1WYXA 1JJ2A 2EWNA 3DKMA 4EMKB 3G6EQ 4LN2A 1EZZB 3KBGA 1CKAA 2QEXT 1BCOA 4BE2A 1H3ZA 2LCCA 2QDLA 1RLPC 4M77G 4GLMA 3OS0A 3MEUA 1M27C 1UG1A 1HJDA 3M0QA 2GNCA 2DILA 3TU4K 4BDYA 2COYA 1VIFA 1VIEA 2JUFA 2DKGA 2XMFA 1PM3A 1WIEA 2LC4A 4TVRA 3OYLA 1KD1C 1VQ4Q 4J6XA 2L8DA 1JBMA 2LVMA 5IHNA 2O01E 2JM8A 1I1JA 1WXUA 3L2ZA 3CCLA 2FRYA 1D09B 3NTKA 4RG8A 4FSXA 2DLPA 3EFOA 3X24B 5GMKj 1S72Q 4C92B 1U1TA 2LX7A 2DNUA 1XJWB 2J6FA 1Y57A 1B3QA 3M59A 2M1HA 3VU3C 2K6DA 2A36A 1M30A 2DL4A 2E3IA 1Q86R 4XTVA 2NUPA 3FJ5A 1U8RA 3M9QA 4X34A 3OW2S 1TUCA 4PFPA 1R0CB 4CI0C 1D1CA 1KHIA 3IQLA 5D6XA 1P92A 1NE8A 2XKOC 4CC3A 1SKUB 3JB9G 5D6YA 1VOMA 5HK0A 4E7IA 3I5RA 3J80E 1K73R 1UHCA 3M58A 4RTYA 1VQMA 2YRCA 1CKBA 2CP3A 3X25B 4UC4A 4QT7A 3MP8A 1QP2A 1MMDA 4M7AC 2VYTA 4WCIA 3HL8A 1YJNT 4BE0A 3OS5A 1W4SA 1HK9A 3EGXB 2CKKA 1IO6A 2HL3A 1O9SA 2P0QA 3CCEA 1KC8C 1NJIU 4OB1B 1UGVA 2FEIA 2HQXA 1OULA 4O6JA 2JXBA 2QTXA 2OTJT 4RMOA 2JVVA 4M7DE 3JV3A 5LJ5e 2L3RA 3EG9B 2BZ8A 3VS3A 5KCOA 1KC8R 5GANj 4X1VA 5GANh 3HRUA 1JXMA 2CSIA 2MF2A 3JCMQ 2A3LA 3ASKA 3QPHA 5KYYA 1UDLA 3CC2T 1W6XA 1YWPA 2WSEE 4IURA 1ZLMA 3BDLA 1WQWA 3I9QA 4PJLA 4M75F 2EYQA 2JMAA 1F1BB 4C92A 2FL7A 3G6EA 1UUEA 3JAME 2E10A 1RUWA 3E9GA 1YJ9Q 2P84A 1OI1A 4HA8A 1N8RR 3CMAQ 4KH0B 1I07A 4HVUA 5KH6A 1OU9A 3OYIA 1A0NB 1VYTA 3VJPA 4Y92A 2VV5A 2NWMA 1FXXA 3TREA 2COZA 3RUXA 1QVGP 1TU0B 4BACA 2OTLQ 1Y0MA 2XK0A 2Y4YA 2LRQA 2LT4A 4B9XA 1Q7YR 3A8MB 1E7OA 4QVDA 4OF1A 3F70A 3CCQT 1D1AA 4N0AC 1ZSZA 1U3OA 4ELYC 1VQ8Q 4HCZA 1UTIA 2EBPA 2FG0A 2JTMA 4MZTA 3T9NA 4B9WA 1YJ9T 5GAN2 2CP6A 1ABOA 5C6SA 3CCMQ 3CCRT 4C5GA 1OU8A 5I2SA 1HSQA 1QWEA 3ULRB 2K2VA 4FYWB 4JPBW 1VQLQ 4IUTA 4Z89A 1V76A 4M7AB 1WHJA 1X2KA 2LZ6B 2DXCA 3I55T 3QUIA 1VQNA 2RK2A 5IHIA 2ZPIB 2L89A 2J6KA 5KYYB 1AWXA 2DX1A 3DLMA 4A63B 3OS2A 3WXMB 2X4XA 1HYOA 1D3BB 4PJMA 1YBYA 5HCKA 3VV0A 4M7DD 2RQVA 1FYNA 4IUUA 2BTTA 2O9SA 2HAXA 1SG5A 3QO3A 4PK4A 1HD3A 3CD6A 2KT1A 1ZUYA 3A98A 5GANf 4JRIA 4M75B 1GCPA 4R0KA 5FU6C 3JCMc 2V26A 3UDCA 4JS5A 5GAN7 3CC7Q 1GRIA 2VB6A 4IUQA 4JJDA 3P8HA 4XU0A 4C0DC 2DERA 2OTLA 1RAEB 4JRPA 3QKJA 1QCNA 2MK5A 4LE9A 2DXUA 4LDXA 2MI6A 3M53A 1DJ7B 2CZ0B 1HXDA 2DE0X 1SPKA 1IB8A 1ZSZB 5M9OA 1VQ6A 2QASA 3JCMX 5AT1B 2HQHA 3PGGA 5FWBA 4ZTFA 3CCUT 1M1KU 4DQ2A 2DBMA 3OW2A 1PG5B 4QQDA 1MNEA 2V1RA 3CMET 4PJOE 3OSVA 4D8KA 1BI1A 2VASA 1FMVA 1JB0E 4J9FA 5GMKm 1PD1A 2RN8A 1VQMT 1M9SA 3M4GA 3CC4A 5GAOp 3JCMJ 1OV3A 2QK0A 2D9TA 1I5LA 2NUTA 1AZGB 2XHCA 2L3PA 3H0FA 1VQPA 5A0LA 3M0UA 5I11A 2D8JA 3TSZA 4F17A 1VQ8A 1PWTA 2DVEA 2EYZA 2FRWA 4DA4A 5HY6A 3C0CA 1Q81U 3G7ZA 2BZYA 2M0OA 3CXCA 4GBQA 2R58A 1AWOA 3CCJQ 1R0BG 3E2UA 4A4HA 1D0ZA 3OBYA 3GPLA 1YJWT 2DMOA 2X4YA 5LJ5h 4JJBA 1KQ1A 2NUPB 4ORZA 4E47A 1PHTA 4M77A 5IAYA 2IPOB 2RQTA 5A2QE 4MZMA 5CKFA 3C95A 1VQ9Q 1K0XA 1OPKA 2GCXA 1NZ9A 3J7AF 4MMKA 1MMNA 2RHIA 4BY6C 1JRIA 1PSEA 4LNPA 1I8FA 2K5FA 2LJ3A 4HT8A 2SEMA 2CP5A 2GF7A 3A8LB 4LUEA 2FB7A 2V1QA 3V8KA 4ZGDB 1LPLA 2EW3A 2DETA 2ZZDA 4XTUA 1TTHB 1QVGA 1E6HA 1VQ7Q 1PKTA 1IGUA 3FB9A 1M2VA 3RR6A 3FEOA 3OYDA 2QXFA 2YRVA 4FL6A 3QSUA 5CKDA 3I56Q 2DL5A 3UATA 1B7TA 1NG2A 8AT1B 1MGQA 2YLBA 4DBRA 2ZPGB 3CMAT 5LJ3e 2JM9A 2CH4W 3QWYA 2LCSA 2FYKA 1BIBA 3CXCS 4AT1B 4AFQC 2KK4A 1M3BA 1K9MR 1K9AA 3CCVA 3E9FA 3OYAA 3VKIA 2PVDB 1K8AU 3VS2A 1GXIE 1X43A 2RI3A 4E7LA 4JLIA 2KBTA 2CDTA 4M75E 1Z9QA 4BDZA 4XU1A 1BIAA 1K9MU 2KSSA 1IZ6A 4J9GA 3A8OB 3LLRA 2RQUA 1XNIA 3MEAA 2E5QA 2M02A 3Q1JA 2K3YA 2XICA 1KJWA 4N0AA 3H6ZA 2ED1A 2IG0A 4HKEA 4C8QC 4E7HA 2MOXA 1GL5A 3BW1A 3BY7A 4PFZA 4VUBA 2GQIA 5C0MA 3URGA 2DD4A 3TEEA 4A4GA 3EAEA 3PTAA 1BK2A 3M0SA 3I55Q 3RKYA 5KYXB 2RQRA 2E3HA 4FU6A 2M0YA 2A7YA 3KUFA 1OQKA 3CCSQ 2KE9A 4FT4A 3NFCA 1JU5C 2YUNA 2COWA 3JCMP 1AT1B 2AZVA 2VUBA 2KGTA 3L2WA 3SHWA 8ATCB 5CKEA 4FT2A 3LX7A 3M5AA 4EMGA 5CVIA 5ECAA 3CD6Q 1LCKA 4KBMB 3LWIA 3CPWS 1M2VB 2O88A 2DEQA 3CCQQ 3L1AA 1Y7XA 2OI3A 3O5ZA 1JJ2P 1OX8A 3OYHA 3MKDA 2OTJA 5GMKh 4DEXA 2G3RA 4D8DA 3ZEHA 1VQ7T 5GAN8 4BI4A 3CCET 4NL2A 2JMCA 5LL6S 5KYWB 4IUVA 1WXBA 1BI3A 4PNOA 4HCKA 1G3TA 2EQJA 2DK3A 2EAYA 2O2OA 4M7DA 3VS0A 2MIOA 4Z8AA 4O5VA 4OMPA 4BUGA 4ESRA 1PRMC 4C8QB 4LDVA 3OYBA 4C0GA 3CC4T 2FVUA 2FHDA 5I2MA 2DD5A 4DBFA 2CP7A 2VXFA 3BFMA 5GAMj 1WX6A 2JTEA 3OYKA 1N6AA 2EJGA 2L3SA 2RJEA 3M4YA 3VYGA 2CYZB 4C5IA 1YHQQ 1S72A 1T3LA 5LJ5g 3RKXA 2KR3A 2ROLA 2AT1B 4M7DG 2V8JA 2K9GA 2YT6A 5CQXA 2QQBA 1G3SA 2K57A 5GAMe 3PFSA 3OYEA 2ROTA 1VQPT 1WXTA 3PVLA 1MMAA 5LJ5f 1M90C 5IXFA 4MDXA 4JS4A 3SWNA 5CO7A 4FIBA 2OX7A 3DB3A 3CCJA 2MPXC 2DEUA 2DA9A 1AVZC 4F7UA 3HSBA 4F7UB 4PL6A 2DF6A 4M7DF 3OSSC 3ZBDA 4M78F 2C0IA 5CCAA 5CIUA 4J9EA 2JT4A 1BCMA 1N8RC 3MEWA 1NEBA 1EFNA 4FCYA 4LUDA 2P4TA 2H8HA 2FPDA 2YUOA 4PJOG 1VQNT 3UF4A 1SSHA 1K1ZA 1ZA2B 3M56A 4JZ3A 2K79A 2LJ0A 1LOJA 4RUGA 3MHXA 2FZCB 3EH2A 2FPFA 1KG1A 1UGQB 1GFCA 1JO8A 3C94A 2Y90A 4GLKA 1G5VA 1LVKA 3O8VA 1TH7A 2EPDA 1VYUA 4PJOF 1YHQT 2HQEA 4ZGJB 3G1JA 4EMKA 4BB7A 1Y71A 3JB9D 1OX9A 4ZGEB 4N4GA 2EQMA 1R77A 2KNBB 1SRMA 3MJXA 2PU9B 2DM1A 1AWJA 4C0DB 2GTOA 3GNGA 1D1BA 1XOVA 2MYSA 2QA4Q 2PUKB 4NL3A 3NMZC 1YIJT 4DBQA 2P0KA 2YXYA 4C8QG 4ATOA 3CCMT 2P4RA 4OB0B 3SWNC 2JNGA 3HP9A 4PJJA 4EPCA 3CCUA 1OPLA 1K8AC 2HMAA 3CCSA 1Q82U 3UPUA 4XK8E 3QJYA 1QVFS 1ZBJA 4M75D 3EHQA 4ANJA 2J6OA 2A08A 3RESA 1V29B 2YSQA 3JCMb 1WHHA 3MO8A 4BI3A 2PNIA 1BYMA 4KUDK 4F14A 1YJNA 1UGPB 3VUBA 1YITQ 2XU8A 3VUZA 4EDUA 1WHLA 3CMEA 2Z0WA 3INZA 2GFUA 4JJNK 4A4FA 1X01A 2DL7A 4P5NA 4RTXA 3VS6A 3QDRB 1KFZA 2QGFB 2QAZA 4CC7A 1I4K1 2K3XA 2GGRA 4ME7A 3CQTA 1VUBA 4FM4B 2DIGA 2H3EB 1PCXA 4FYYB 1ACMB 3QHSA 3CPWA 4N4IA 3VS5A 3EH1A 5CKHA 3CCST 5GAN3 4EIKA 4IKFA 1QVFP 4RTTA 3QDFA 5GAN6 3PIPA 3PMTA 2EJFA 2AKLA 1ZUUA 4C5EA 2LNVA 2RJDA 5GANg 1YJWQ 3J81E 1MHNA 5DLQE 2KXCA 3HPWA 1IHWA 2F2WA 3QZ9B 2QA4A 2E70A 2LQNA 4MDWA 3CC7A 5DY9A 1S1NA 1B34A 3RNJA 1G3WA 1AWWA 2L3QA 1RL2A 4E7JA 1U1SA 3TVTA 4M4ZA 2EQUA 1IRXA 2PQWA 3JCMV 3M0TA 1T0JA 3I35A 3EG9A 2J7IA 4M75G 3SDZA 1NJIR 4HVWA 3OYYA 3CMEQ 3E19A 1I5OB 3R6NA 1VQ9A 2RQWA 3MP6A 4XTYA 4L5GA 1YJNQ 4JUVA 2DXTA 4II1A 2F5TX 3C12A 2EVRA 1KQ2A 2DFUA 3SEMA 1UGRB 1PD0A 4F7UG 1LJOA 1UE9A 2A37A 4CC2A 3KFVA 3JCMh 1X6OA 3FJPA 2L5QA 2EJ9A 4L6V5 1G3YA 3RMSA 4JJCA 2HZYA 1BB9A 2EYWA 2MMPA 4OB3B 1H3HA 2YUPA 2E5KA 2KRSA 5LJ3g 4PJOA 2DRKA 5GAN5 1PC0A 2RNAA 3G71A 2NUTB 4HCBA 2QYZA 2EIFA 3LYIA 1KQSA 1YN8A 3CXCP 2CGHA 2KDSA 1IXDA 4M7AE 3FC3A 1SEMA 2EGAA 3RMQA 4XU2A 3OA6A 3DLLA 1VQKA 2YHTA 4M77B 4J9HA 1QP3A 2KRMA 2RHUA 3CC2Q 1KHCA 1UFFA 7AT1B 1Q82R 2LP5A 5KYNA 3THKA 3EGDA 3FRNA 2FO0A 5EG2A 3V8LA 4ELZC 4KGXB 2E1HA 1RABB 3CCRQ 1C0MA 1PKSA 1VYVA 2O4XB 1YJWA 1W2BA 1B34B 2B86A 4HCCA 2R5AA 2QEXA 1W2BP 1Q82C 1FMWA 2QI2A 1EX4A 2F2VA 3OMGA 2R5MA 3EG1A 5CKBA 1N27A 4AMCA 3G6ET 4RCBA 5GMKl 2LCLA 1K0SA 5LJ5d 1I0CA 4KGZB 2HBPA 1VQMQ 4LXCA 4R56A 1TXQA 3I56A 3LH0A 4J9DA 3H41A 1V1CA 5GAOm 5IHKA 5IH2A 3EFSA 4N4HA 3OYCA 4IIMA 5CQYA 4J7IA 1X6GA 1YIJA 3FDRA 1TS9A 3CCLQ 1O75A 1ARKA 1M5Q1 3HTRA 2M9UA 2RJFA 1SHFA 2O9VA 2OJ2A 2XIDA 1KSWA 2QQSA 2ZCFB 2XG8D 1BI0A 2KROA 3TCJA 1Q81R 4M78C 1MV3A 1VQKT 5GAN4 4M77F 1M3AA 5D6WA 2LDMA 4F16A 3RERA 1CSKA 4Y91A 3CC7T 3AHUA 1QQJA 3G4SQ 3SWNB 1NPPA 2W0ZA 3PIOA 2RPNA 2RHZA 1UEBA 2NUZA 2RHXA 1Q86C 1FMKA 4J9IA 5FW9A 3HRTA 1RI9A 1PNJA 2EYYA 5J26A 3OYMA 1VQLT 4RTWA 2RI2A 3JB9I 4C92E 2LQWA 5CAIA 2V8KA 2P0PA 3I55A 1NYGA 2PZ1A 3KXTA 3OYNA 3GOXA 2RA2A 1TSFA 1ZBXA 2CREA 3V7CA 3V7RA 1J3TA 4FW2A 5DM7R 4QVZA 2ZPHB 3EGDB 4KUIA 2D1XA 3NHNA
chains in the Genus database with same CATH topology
1YJNQ 1VQ4Q 3CCRQ 3CCJQ 1QVGP 1YJWQ 1K8AR 1K9MR 2OTLQ 3I55Q 1YI2Q 1VQMQ 1KC8R 3CC4Q 1VQNQ 3CCMQ 3CC7Q 1YJ9Q 2QEXQ 3OW2P 1YITQ 3CCSQ 1W2BP 3CD6Q 1Q7YR 2OTJQ 3I56Q 1K73R 3CC2Q 1Q81R 1Q86R 3CCVQ 1YHQQ 1VQ6Q 1YIJQ 1Q82R 1N8RR 1KD1R 1M1KR 3CMAQ 3CCQQ 1VQ5Q 1S72Q 1VQLQ 3G6EQ 1NJIR 2QA4Q 3G71Q 3CPWP 1VQ8Q 3CXCP 3CMEQ 1JJ2P 1VQKQ 1QVFP 1M90R 1KQSP 3CCLQ 3CCEQ 3G4SQ 1VQOQ 1VQ7Q 1VQPQ 1VQ9Q 3CCUQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN Q;  1VQ4 Q;  3CCR Q;  3CCJ Q;  1QVG P;  1YJW Q;  1K8A R;  1K9M R;  2OTL Q;  3I55 Q;  1YI2 Q;  1VQM Q;  1KC8 R;  3CC4 Q;  1VQN Q;  3CCM Q;  3CC7 Q;  1YJ9 Q;  2QEX Q;  3OW2 P;  1YIT Q;  3CCS Q;  1W2B P;  3CD6 Q;  1Q7Y R;  2OTJ Q;  3I56 Q;  1K73 R;  3CC2 Q;  1Q81 R;  1Q86 R;  3CCV Q;  1YHQ Q;  1VQ6 Q;  1YIJ Q;  1Q82 R;  1N8R R;  1KD1 R;  1M1K R;  3CMA Q;  3CCQ Q;  1VQ5 Q;  1S72 Q;  1VQL Q;  3G6E Q;  1NJI R;  2QA4 Q;  3G71 Q;  3CPW P;  1VQ8 Q;  3CXC P;  3CME Q;  1JJ2 P;  1VQK Q;  1QVF P;  1M90 R;  1KQS P;  3CCL Q;  3CCE Q;  3G4S Q;  1VQO Q;  1VQ7 Q;  1VQP Q;  1VQ9 Q;  3CCU Q; 
#chains in the Genus database with same CATH topology
 2EQK A;  4PLI A;  3X26 B;  2DBK A;  5GJV B;  5I21 A;  4M75 A;  2W10 A;  1N9R A;  2EFI A;  2QEX Q;  2K7A A;  1VQ8 T;  2E12 A;  3SB2 A;  2D0Q B;  3UWN A;  2ZPB B;  4JLG A;  3ZFJ A;  2JN0 A;  9ATC B;  4MZP A;  1WNL A;  1EIF A;  2OTL T;  2WSF E;  3NGP A;  2CUD A;  1E6G A;  4QVC A;  5FRN A;  4M7D C;  4J8O A;  1OZ3 A;  1SHG A;  3BE3 A;  3QWX X;  2NLU A;  4J6Y A;  3MPU B;  1MMG A;  2O31 A;  4RTZ A;  1YIJ Q;  1C1A A;  4C92 D;  4WF2 A;  1Z9Z A;  3QYH B;  1QVF A;  1QWF A;  2M51 A;  4C8Q F;  5LJ3 j;  1IGQ A;  3S6W A;  2E6N A;  2K5L A;  2RF0 A;  2H3J A;  5GMK e;  2XD0 A;  1QKX A;  1UEC A;  1YHQ A;  2FZG B;  3GP8 A;  1M3C A;  3EG3 A;  1ZSG A;  2E4H A;  2OTJ Q;  3CC2 A;  3OS1 A;  1OZ2 A;  3BDU A;  3QBY A;  1YNZ A;  4PKC C;  2HNI A;  4RKU E;  2BKD N;  1JXO A;  3H0I A;  5GAM f;  4PJO B;  5AYF A;  1WHG A;  3MET A;  5KE2 A;  1QVP A;  4CRI A;  1VQ5 A;  2LMJ A;  3RIR A;  4FW1 A;  3G4S T;  5L8R E;  2ZGW A;  5GAM g;  4M77 E;  2F1L A;  4A54 A;  3LH5 A;  1RAG B;  1N9S A;  1IRE B;  2V8I A;  1T3S A;  1M1K R;  1WZO A;  2DPP B;  2RMO A;  3OB9 A;  3LW5 E;  1M90 R;  4OMN A;  2L0A A;  2R57 A;  3QYG B;  1Q86 U;  3L2R A;  3CCU Q;  1M1G A;  2CZ7 B;  2DJZ A;  1C6V X;  4RTV A;  1K8A R;  1NYF A;  2ZPF B;  5D7U A;  3OMC A;  4XTZ A;  2RI5 A;  1VQN Q;  1JQQ A;  4JZ4 A;  1OOT A;  3OW2 P;  1M1K C;  4QQ6 A;  2LJ1 A;  4E6R A;  3PVQ A;  2CZ6 B;  2X35 A;  5I22 A;  5KYU B;  2AK5 A;  3S3O A;  5KYU A;  3OYG A;  2K3B A;  4ZN1 A;  3G71 Q;  3C4S A;  2HDA A;  2F5K A;  4XAX B;  1RAC B;  1SSF A;  2C06 A;  3FLG A;  2D6F A;  2B8A A;  2PVG B;  2KMT A;  1GFD A;  4YTL A;  3VRY A;  1YI2 Q;  1QKW A;  4PLL A;  3HFN A;  1TG0 A;  3LGF A;  2WAC A;  1AZE A;  5GAO n;  1KD1 R;  1WJQ A;  2HKQ B;  4ZTJ A;  2XDB A;  4M7A F;  1QVG S;  1N5Z A;  2OAW A;  4XTX A;  3QJ6 A;  2KEA A;  2DL3 A;  2ED0 A;  4OGE A;  4WTO B;  1MV0 B;  2DL8 A;  4LDU A;  5J3B A;  2LQK A;  4F7U F;  2X9H A;  2C0O A;  2BE9 B;  2CT3 A;  6AT1 B;  2F2X A;  4QQG A;  1WGS A;  2KYM A;  1WLP B;  2JZ2 A;  3RBB B;  1JJ2 S;  2QQ9 A;  2ECZ A;  2VGN A;  1I81 A;  4HXJ A;  3CC4 Q;  3NPF A;  4RTU A;  2YDL A;  5GAO r;  3JCM d;  4J9B A;  1ZSZ C;  1XTD A;  4QW2 A;  1RAH B;  2ZPE B;  5GAM h;  1TUD A;  4CC4 B;  4JDS A;  2GTJ A;  3H8Z A;  2HL5 C;  4XTW A;  4C92 G;  4OGC A;  4E7S A;  1ZUK A;  2RH2 A;  2HSP A;  1VQ5 T;  1RI0 A;  4D6W A;  3JB9 J;  1VQ6 T;  4FSS A;  5FU7 B;  2PVO B;  2YRD A;  4C0Z A;  3CD6 T;  2HBW A;  1VA7 A;  4PFO A;  2JS0 A;  3VRZ A;  1X6B A;  2LT1 A;  1NEG A;  4OMM A;  2SRC A;  1N8R U;  1M4Z A;  2GBQ A;  1RAI B;  3JCM g;  3I5S A;  1WJR A;  1RAD B;  2J06 A;  3PT9 A;  3N5B B;  2EKO A;  2MWP A;  3M55 A;  1RAA B;  4IIO A;  1UGS B;  2IIM A;  3SFM A;  5J39 A;  2KRN A;  1M8M A;  1QMC A;  2MCN A;  3GIB A;  3PMI A;  2LX9 A;  1KC8 U;  4B6M A;  1Q95 G;  2F69 A;  3R6O A;  2M16 A;  3MCA B;  2HCK A;  4AG1 C;  2FPE A;  4LDY A;  4L59 A;  3CPW P;  3ME9 A;  1W70 A;  1XQH A;  3M0P A;  1YJ9 A;  1AEY A;  2YUQ A;  4C0F A;  5FRM A;  4OMF B;  3P8D A;  1GCQ A;  4FYX B;  2X4J A;  3JSC A;  5IN1 A;  1D0Y A;  5IT9 E;  1WA7 A;  3X20 B;  1VQ7 A;  3A5Z B;  2KT8 A;  2VGM A;  3ER0 A;  1YCY A;  2HKN A;  2I2L A;  2VXE A;  1VQ4 A;  1VQK Q;  2YWW A;  4X9D A;  1NBE B;  4AG2 C;  3S3N A;  1BKB A;  2WSC E;  2RM4 A;  4AFZ C;  3L2U A;  3OY9 A;  2Y4X A;  4LD9 K;  5GMK i;  3CCL T;  2E6Z A;  4AFS C;  3CMA A;  2G6F X;  1KQS S;  1ZHI A;  1G83 A;  5EC7 A;  3CEY A;  2A0F B;  2DIQ A;  2MWO A;  4HT9 A;  3JRZ A;  1AHJ B;  4X9C A;  2E65 A;  4M7D B;  3X28 B;  1FWZ A;  2HEQ A;  5LJ3 h;  3WVE B;  2QG9 B;  2EKH A;  2QQR A;  4F04 B;  2JS2 A;  1OYX A;  1UJY A;  3CBO A;  2J05 A;  5L23 A;  1M1F A;  2CS7 A;  2EGC A;  3M0R A;  4LDW A;  3I56 T;  2E64 A;  2BUD A;  3DB4 A;  2D8H A;  4M7A D;  2QQA A;  3E1S A;  3M54 A;  2DRM A;  2XDD A;  2DYI A;  1VQO T;  1JEG A;  1K73 U;  4ZN3 A;  1W1F A;  2L2P A;  4Z02 A;  1X27 A;  1RLQ C;  2NYS A;  3EHR A;  2KYB A;  4E7Z A;  4OMO A;  4K11 A;  1GBQ A;  4BE1 A;  2RB6 A;  1TOV A;  1VQL A;  2QA4 T;  2DVJ A;  3OYF A;  1WHK A;  2EYX A;  5GJW B;  3L2Q A;  3H9N A;  1KQS P;  3UA6 A;  4M75 C;  5FU6 B;  1WI7 A;  3CCM A;  1ZX6 A;  3TQ7 P;  2DTH A;  3UA7 A;  1KIK A;  4F7U E;  1X69 A;  1VQ9 T;  3RDV A;  5KYX A;  1BBZ A;  4NOY A;  2CSQ A;  1QCF A;  3CBP A;  2PTK A;  4GY5 A;  4XU3 A;  1VQ4 T;  1X2Q A;  5KCH A;  5DLO A;  1D0X A;  1T0H A;  2DO3 A;  1WDX A;  5GAM d;  3NTI A;  3EGX A;  4M78 B;  3V8J A;  1ZQ1 A;  4QKU A;  5GAO q;  1G8X A;  2CUB A;  3GF5 A;  4Q5W A;  3CCQ A;  2K5I A;  2DZ9 A;  2BE7 D;  2DTO A;  3A8H B;  3H0H A;  1YI2 T;  1M8V A;  5HK3 A;  4AFU C;  4RG2 A;  5IXB A;  4A4E A;  2ABL A;  4A53 A;  1Q7Y C;  1UJ0 A;  2O4X A;  1W2B S;  1D3B A;  2KAF A;  2LNH B;  4C5H A;  4EMK C;  3A1P A;  2X51 A;  4E2F B;  3NTH A;  3CCR A;  2DZC A;  2MAM A;  5HKC A;  4DOW A;  2CP0 A;  5KYW A;  5FRO A;  1YI2 A;  2CT4 A;  2D0N A;  3REA B;  3HKS A;  4DEY A;  1OEB A;  3JB9 F;  2XDP A;  1YWO A;  2VC8 A;  4V2S A;  1B07 A;  2RJC A;  2BZX A;  4PJO D;  1NLP C;  1WPY A;  2HSE B;  3OYJ A;  4C8Q D;  1TWB A;  4C92 F;  3WVD B;  4JRQ A;  2KY9 A;  1K9M C;  2ZAE A;  2PUO B;  4M77 C;  4OB2 B;  4E7K A;  3EGU A;  1BU1 A;  4PJO C;  1SRL A;  2I0N A;  5A0G A;  1UB4 A;  2JOY A;  4M7A A;  1Q7Y U;  1KK7 A;  1TUG B;  1U5S A;  2E41 A;  2RHY A;  3MEV A;  1X75 C;  4OVA A;  1YIT A;  3LWH A;  4JRK A;  3L2V A;  1Q81 C;  3EG2 A;  1IHV A;  1VQP Q;  4BY6 B;  1YCS B;  1PSF A;  3FIF A;  2EQI A;  1R8O B;  1Y96 B;  1Y96 A;  4M78 G;  2VWF A;  1S72 T;  5LJ5 j;  2AZS A;  4M78 D;  1NPR A;  4J83 A;  1AOJ A;  4KRT A;  1K76 A;  5KE3 A;  4MML A;  2X3W D;  3CCV T;  4J7F A;  4BD3 A;  3SD4 A;  3TSW A;  4M7A G;  2KI7 A;  3CCJ T;  3AT1 B;  1WFW A;  1PRL C;  1NJI C;  3GBQ A;  2X3X D;  3JCM W;  3OBW A;  3M57 A;  2EGE A;  2GFA A;  2RK1 A;  2DTI A;  2LQ8 A;  1FX7 A;  1GBR A;  3VS4 A;  4ZNX A;  4M78 A;  3CCE Q;  2AHJ B;  2HD0 A;  4DBH A;  1VQO Q;  3JCM f;  1NLO C;  2ENM A;  1YIT T;  3S3M A;  4J9C A;  2OAU A;  3HFO A;  5GAN e;  2FZK B;  2JW4 A;  4C8Q A;  5CK9 A;  3G71 T;  3PNW C;  3G4S A;  1H92 A;  1VQ6 Q;  1K73 C;  3CBM A;  3QG1 A;  1H64 1;  1QCO A;  4KUL A;  4OMQ A;  1G2B A;  3U23 A;  2GQV A;  1K4U S;  3JB9 H;  1WJS A;  2ATC B;  3PE0 A;  4FYV B;  2K4Y A;  1YFN A;  2IVW A;  2K2M A;  3D7S B;  5LJ3 f;  4M77 D;  3GNF B;  2DAQ A;  2RD1 A;  1U06 A;  3VS7 A;  4IUP A;  2A28 A;  3QII A;  3RKW A;  2C0T A;  3EFO B;  3CCV Q;  2KQW A;  3QXE B;  3EG0 A;  3GLX A;  3UT1 A;  4C8Q E;  3A8G B;  3CPF A;  2YLC A;  3MP1 A;  1YP5 A;  4C92 C;  1Y07 A;  2AKK A;  2CZ1 B;  2DXB A;  3OQ5 A;  3VYH B;  2JJ9 A;  1BI2 A;  1NM7 A;  5LJ3 d;  2QDY B;  1WHM A;  3QZ5 B;  4KGV B;  5CR2 A;  2DJQ A;  2AIR B;  1GCQ C;  4Z88 A;  3JCM e;  3REB B;  3V7S A;  5A0D A;  1QLY A;  4R55 A;  4J5Y A;  2QGG A;  1LNX A;  1H8K A;  4LD6 A;  5FU7 C;  5FLX E;  2KXD A;  1AD5 A;  1QW1 A;  3ZL7 C;  1ZA1 B;  1WQ7 A;  2VKN A;  1MUZ A;  4OP0 A;  2VVK A;  3EFR A;  2LTO A;  3LGL A;  4Y28 E;  4KT0 E;  1VQO A;  5GAN d;  2QTV A;  3L42 A;  4PJN A;  1M90 U;  2BIV A;  4J6W A;  2X4W A;  5GAO l;  3VS1 A;  4OML A;  4RCC A;  3P8B B;  4EMH A;  4M78 E;  2RO0 A;  4A4K A;  4DOV A;  1KD1 U;  3HHT B;  1MND A;  2XI9 A;  4KH1 B;  4NS5 A;  4BI8 B;  2DYB A;  2CH4 A;  2ESW A;  2KVQ G;  1RAF B;  2CP2 A;  1SF9 A;  2JTF A;  3HRS A;  4HVV A;  1UHF A;  1ABQ A;  1M2O A;  5FWC A;  4XQ3 A;  1VQ5 Q;  1WYX A;  1JJ2 A;  2EWN A;  3DKM A;  4EMK B;  3G6E Q;  4LN2 A;  1EZZ B;  3KBG A;  1CKA A;  2QEX T;  1BCO A;  4BE2 A;  1H3Z A;  2LCC A;  2QDL A;  1RLP C;  4M77 G;  4GLM A;  3OS0 A;  3MEU A;  1M27 C;  1UG1 A;  1HJD A;  3M0Q A;  2GNC A;  2DIL A;  3TU4 K;  4BDY A;  2COY A;  1VIF A;  1VIE A;  2JUF A;  2DKG A;  2XMF A;  1PM3 A;  1WIE A;  2LC4 A;  4TVR A;  3OYL A;  1KD1 C;  1VQ4 Q;  4J6X A;  2L8D A;  1JBM A;  2LVM A;  5IHN A;  2O01 E;  2JM8 A;  1I1J A;  1WXU A;  3L2Z A;  3CCL A;  2FRY A;  1D09 B;  3NTK A;  4RG8 A;  4FSX A;  2DLP A;  3EFO A;  3X24 B;  5GMK j;  1S72 Q;  4C92 B;  1U1T A;  2LX7 A;  2DNU A;  1XJW B;  2J6F A;  1Y57 A;  1B3Q A;  3M59 A;  2M1H A;  3VU3 C;  2K6D A;  2A36 A;  1M30 A;  2DL4 A;  2E3I A;  1Q86 R;  4XTV A;  2NUP A;  3FJ5 A;  1U8R A;  3M9Q A;  4X34 A;  3OW2 S;  1TUC A;  4PFP A;  1R0C B;  4CI0 C;  1D1C A;  1KHI A;  3IQL A;  5D6X A;  1P92 A;  1NE8 A;  2XKO C;  4CC3 A;  1SKU B;  3JB9 G;  5D6Y A;  1VOM A;  5HK0 A;  4E7I A;  3I5R A;  3J80 E;  1K73 R;  1UHC A;  3M58 A;  4RTY A;  1VQM A;  2YRC A;  1CKB A;  2CP3 A;  3X25 B;  4UC4 A;  4QT7 A;  3MP8 A;  1QP2 A;  1MMD A;  4M7A C;  2VYT A;  4WCI A;  3HL8 A;  1YJN T;  4BE0 A;  3OS5 A;  1W4S A;  1HK9 A;  3EGX B;  2CKK A;  1IO6 A;  2HL3 A;  1O9S A;  2P0Q A;  3CCE A;  1KC8 C;  1NJI U;  4OB1 B;  1UGV A;  2FEI A;  2HQX A;  1OUL A;  4O6J A;  2JXB A;  2QTX A;  2OTJ T;  4RMO A;  2JVV A;  4M7D E;  3JV3 A;  5LJ5 e;  2L3R A;  3EG9 B;  2BZ8 A;  3VS3 A;  5KCO A;  1KC8 R;  5GAN j;  4X1V A;  5GAN h;  3HRU A;  1JXM A;  2CSI A;  2MF2 A;  3JCM Q;  2A3L A;  3ASK A;  3QPH A;  5KYY A;  1UDL A;  3CC2 T;  1W6X A;  1YWP A;  2WSE E;  4IUR A;  1ZLM A;  3BDL A;  1WQW A;  3I9Q A;  4PJL A;  4M75 F;  2EYQ A;  2JMA A;  1F1B B;  4C92 A;  2FL7 A;  3G6E A;  1UUE A;  3JAM E;  2E10 A;  1RUW A;  3E9G A;  1YJ9 Q;  2P84 A;  1OI1 A;  4HA8 A;  1N8R R;  3CMA Q;  4KH0 B;  1I07 A;  4HVU A;  5KH6 A;  1OU9 A;  3OYI A;  1A0N B;  1VYT A;  3VJP A;  4Y92 A;  2VV5 A;  2NWM A;  1FXX A;  3TRE A;  2COZ A;  3RUX A;  1QVG P;  1TU0 B;  4BAC A;  2OTL Q;  1Y0M A;  2XK0 A;  2Y4Y A;  2LRQ A;  2LT4 A;  4B9X A;  1Q7Y R;  3A8M B;  1E7O A;  4QVD A;  4OF1 A;  3F70 A;  3CCQ T;  1D1A A;  4N0A C;  1ZSZ A;  1U3O A;  4ELY C;  1VQ8 Q;  4HCZ A;  1UTI A;  2EBP A;  2FG0 A;  2JTM A;  4MZT A;  3T9N A;  4B9W A;  1YJ9 T;  5GAN 2;  2CP6 A;  1ABO A;  5C6S A;  3CCM Q;  3CCR T;  4C5G A;  1OU8 A;  5I2S A;  1HSQ A;  1QWE A;  3ULR B;  2K2V A;  4FYW B;  4JPB W;  1VQL Q;  4IUT A;  4Z89 A;  1V76 A;  4M7A B;  1WHJ A;  1X2K A;  2LZ6 B;  2DXC A;  3I55 T;  3QUI A;  1VQN A;  2RK2 A;  5IHI A;  2ZPI B;  2L89 A;  2J6K A;  5KYY B;  1AWX A;  2DX1 A;  3DLM A;  4A63 B;  3OS2 A;  3WXM B;  2X4X A;  1HYO A;  1D3B B;  4PJM A;  1YBY A;  5HCK A;  3VV0 A;  4M7D D;  2RQV A;  1FYN A;  4IUU A;  2BTT A;  2O9S A;  2HAX A;  1SG5 A;  3QO3 A;  4PK4 A;  1HD3 A;  3CD6 A;  2KT1 A;  1ZUY A;  3A98 A;  5GAN f;  4JRI A;  4M75 B;  1GCP A;  4R0K A;  5FU6 C;  3JCM c;  2V26 A;  3UDC A;  4JS5 A;  5GAN 7;  3CC7 Q;  1GRI A;  2VB6 A;  4IUQ A;  4JJD A;  3P8H A;  4XU0 A;  4C0D C;  2DER A;  2OTL A;  1RAE B;  4JRP A;  3QKJ A;  1QCN A;  2MK5 A;  4LE9 A;  2DXU A;  4LDX A;  2MI6 A;  3M53 A;  1DJ7 B;  2CZ0 B;  1HXD A;  2DE0 X;  1SPK A;  1IB8 A;  1ZSZ B;  5M9O A;  1VQ6 A;  2QAS A;  3JCM X;  5AT1 B;  2HQH A;  3PGG A;  5FWB A;  4ZTF A;  3CCU T;  1M1K U;  4DQ2 A;  2DBM A;  3OW2 A;  1PG5 B;  4QQD A;  1MNE A;  2V1R A;  3CME T;  4PJO E;  3OSV A;  4D8K A;  1BI1 A;  2VAS A;  1FMV A;  1JB0 E;  4J9F A;  5GMK m;  1PD1 A;  2RN8 A;  1VQM T;  1M9S A;  3M4G A;  3CC4 A;  5GAO p;  3JCM J;  1OV3 A;  2QK0 A;  2D9T A;  1I5L A;  2NUT A;  1AZG B;  2XHC A;  2L3P A;  3H0F A;  1VQP A;  5A0L A;  3M0U A;  5I11 A;  2D8J A;  3TSZ A;  4F17 A;  1VQ8 A;  1PWT A;  2DVE A;  2EYZ A;  2FRW A;  4DA4 A;  5HY6 A;  3C0C A;  1Q81 U;  3G7Z A;  2BZY A;  2M0O A;  3CXC A;  4GBQ A;  2R58 A;  1AWO A;  3CCJ Q;  1R0B G;  3E2U A;  4A4H A;  1D0Z A;  3OBY A;  3GPL A;  1YJW T;  2DMO A;  2X4Y A;  5LJ5 h;  4JJB A;  1KQ1 A;  2NUP B;  4ORZ A;  4E47 A;  1PHT A;  4M77 A;  5IAY A;  2IPO B;  2RQT A;  5A2Q E;  4MZM A;  5CKF A;  3C95 A;  1VQ9 Q;  1K0X A;  1OPK A;  2GCX A;  1NZ9 A;  3J7A F;  4MMK A;  1MMN A;  2RHI A;  4BY6 C;  1JRI A;  1PSE A;  4LNP A;  1I8F A;  2K5F A;  2LJ3 A;  4HT8 A;  2SEM A;  2CP5 A;  2GF7 A;  3A8L B;  4LUE A;  2FB7 A;  2V1Q A;  3V8K A;  4ZGD B;  1LPL A;  2EW3 A;  2DET A;  2ZZD A;  4XTU A;  1TTH B;  1QVG A;  1E6H A;  1VQ7 Q;  1PKT A;  1IGU A;  3FB9 A;  1M2V A;  3RR6 A;  3FEO A;  3OYD A;  2QXF A;  2YRV A;  4FL6 A;  3QSU A;  5CKD A;  3I56 Q;  2DL5 A;  3UAT A;  1B7T A;  1NG2 A;  8AT1 B;  1MGQ A;  2YLB A;  4DBR A;  2ZPG B;  3CMA T;  5LJ3 e;  2JM9 A;  2CH4 W;  3QWY A;  2LCS A;  2FYK A;  1BIB A;  3CXC S;  4AT1 B;  4AFQ C;  2KK4 A;  1M3B A;  1K9M R;  1K9A A;  3CCV A;  3E9F A;  3OYA A;  3VKI A;  2PVD B;  1K8A U;  3VS2 A;  1GXI E;  1X43 A;  2RI3 A;  4E7L A;  4JLI A;  2KBT A;  2CDT A;  4M75 E;  1Z9Q A;  4BDZ A;  4XU1 A;  1BIA A;  1K9M U;  2KSS A;  1IZ6 A;  4J9G A;  3A8O B;  3LLR A;  2RQU A;  1XNI A;  3MEA A;  2E5Q A;  2M02 A;  3Q1J A;  2K3Y A;  2XIC A;  1KJW A;  4N0A A;  3H6Z A;  2ED1 A;  2IG0 A;  4HKE A;  4C8Q C;  4E7H A;  2MOX A;  1GL5 A;  3BW1 A;  3BY7 A;  4PFZ A;  4VUB A;  2GQI A;  5C0M A;  3URG A;  2DD4 A;  3TEE A;  4A4G A;  3EAE A;  3PTA A;  1BK2 A;  3M0S A;  3I55 Q;  3RKY A;  5KYX B;  2RQR A;  2E3H A;  4FU6 A;  2M0Y A;  2A7Y A;  3KUF A;  1OQK A;  3CCS Q;  2KE9 A;  4FT4 A;  3NFC A;  1JU5 C;  2YUN A;  2COW A;  3JCM P;  1AT1 B;  2AZV A;  2VUB A;  2KGT A;  3L2W A;  3SHW A;  8ATC B;  5CKE A;  4FT2 A;  3LX7 A;  3M5A A;  4EMG A;  5CVI A;  5ECA A;  3CD6 Q;  1LCK A;  4KBM B;  3LWI A;  3CPW S;  1M2V B;  2O88 A;  2DEQ A;  3CCQ Q;  3L1A A;  1Y7X A;  2OI3 A;  3O5Z A;  1JJ2 P;  1OX8 A;  3OYH A;  3MKD A;  2OTJ A;  5GMK h;  4DEX A;  2G3R A;  4D8D A;  3ZEH A;  1VQ7 T;  5GAN 8;  4BI4 A;  3CCE T;  4NL2 A;  2JMC A;  5LL6 S;  5KYW B;  4IUV A;  1WXB A;  1BI3 A;  4PNO A;  4HCK A;  1G3T A;  2EQJ A;  2DK3 A;  2EAY A;  2O2O A;  4M7D A;  3VS0 A;  2MIO A;  4Z8A A;  4O5V A;  4OMP A;  4BUG A;  4ESR A;  1PRM C;  4C8Q B;  4LDV A;  3OYB A;  4C0G A;  3CC4 T;  2FVU A;  2FHD A;  5I2M A;  2DD5 A;  4DBF A;  2CP7 A;  2VXF A;  3BFM A;  5GAM j;  1WX6 A;  2JTE A;  3OYK A;  1N6A A;  2EJG A;  2L3S A;  2RJE A;  3M4Y A;  3VYG A;  2CYZ B;  4C5I A;  1YHQ Q;  1S72 A;  1T3L A;  5LJ5 g;  3RKX A;  2KR3 A;  2ROL A;  2AT1 B;  4M7D G;  2V8J A;  2K9G A;  2YT6 A;  5CQX A;  2QQB A;  1G3S A;  2K57 A;  5GAM e;  3PFS A;  3OYE A;  2ROT A;  1VQP T;  1WXT A;  3PVL A;  1MMA A;  5LJ5 f;  1M90 C;  5IXF A;  4MDX A;  4JS4 A;  3SWN A;  5CO7 A;  4FIB A;  2OX7 A;  3DB3 A;  3CCJ A;  2MPX C;  2DEU A;  2DA9 A;  1AVZ C;  4F7U A;  3HSB A;  4F7U B;  4PL6 A;  2DF6 A;  4M7D F;  3OSS C;  3ZBD A;  4M78 F;  2C0I A;  5CCA A;  5CIU A;  4J9E A;  2JT4 A;  1BCM A;  1N8R C;  3MEW A;  1NEB A;  1EFN A;  4FCY A;  4LUD A;  2P4T A;  2H8H A;  2FPD A;  2YUO A;  4PJO G;  1VQN T;  3UF4 A;  1SSH A;  1K1Z A;  1ZA2 B;  3M56 A;  4JZ3 A;  2K79 A;  2LJ0 A;  1LOJ A;  4RUG A;  3MHX A;  2FZC B;  3EH2 A;  2FPF A;  1KG1 A;  1UGQ B;  1GFC A;  1JO8 A;  3C94 A;  2Y90 A;  4GLK A;  1G5V A;  1LVK A;  3O8V A;  1TH7 A;  2EPD A;  1VYU A;  4PJO F;  1YHQ T;  2HQE A;  4ZGJ B;  3G1J A;  4EMK A;  4BB7 A;  1Y71 A;  3JB9 D;  1OX9 A;  4ZGE B;  4N4G A;  2EQM A;  1R77 A;  2KNB B;  1SRM A;  3MJX A;  2PU9 B;  2DM1 A;  1AWJ A;  4C0D B;  2GTO A;  3GNG A;  1D1B A;  1XOV A;  2MYS A;  2QA4 Q;  2PUK B;  4NL3 A;  3NMZ C;  1YIJ T;  4DBQ A;  2P0K A;  2YXY A;  4C8Q G;  4ATO A;  3CCM T;  2P4R A;  4OB0 B;  3SWN C;  2JNG A;  3HP9 A;  4PJJ A;  4EPC A;  3CCU A;  1OPL A;  1K8A C;  2HMA A;  3CCS A;  1Q82 U;  3UPU A;  4XK8 E;  3QJY A;  1QVF S;  1ZBJ A;  4M75 D;  3EHQ A;  4ANJ A;  2J6O A;  2A08 A;  3RES A;  1V29 B;  2YSQ A;  3JCM b;  1WHH A;  3MO8 A;  4BI3 A;  2PNI A;  1BYM A;  4KUD K;  4F14 A;  1YJN A;  1UGP B;  3VUB A;  1YIT Q;  2XU8 A;  3VUZ A;  4EDU A;  1WHL A;  3CME A;  2Z0W A;  3INZ A;  2GFU A;  4JJN K;  4A4F A;  1X01 A;  2DL7 A;  4P5N A;  4RTX A;  3VS6 A;  3QDR B;  1KFZ A;  2QGF B;  2QAZ A;  4CC7 A;  1I4K 1;  2K3X A;  2GGR A;  4ME7 A;  3CQT A;  1VUB A;  4FM4 B;  2DIG A;  2H3E B;  1PCX A;  4FYY B;  1ACM B;  3QHS A;  3CPW A;  4N4I A;  3VS5 A;  3EH1 A;  5CKH A;  3CCS T;  5GAN 3;  4EIK A;  4IKF A;  1QVF P;  4RTT A;  3QDF A;  5GAN 6;  3PIP A;  3PMT A;  2EJF A;  2AKL A;  1ZUU A;  4C5E A;  2LNV A;  2RJD A;  5GAN g;  1YJW Q;  3J81 E;  1MHN A;  5DLQ E;  2KXC A;  3HPW A;  1IHW A;  2F2W A;  3QZ9 B;  2QA4 A;  2E70 A;  2LQN A;  4MDW A;  3CC7 A;  5DY9 A;  1S1N A;  1B34 A;  3RNJ A;  1G3W A;  1AWW A;  2L3Q A;  1RL2 A;  4E7J A;  1U1S A;  3TVT A;  4M4Z A;  2EQU A;  1IRX A;  2PQW A;  3JCM V;  3M0T A;  1T0J A;  3I35 A;  3EG9 A;  2J7I A;  4M75 G;  3SDZ A;  1NJI R;  4HVW A;  3OYY A;  3CME Q;  3E19 A;  1I5O B;  3R6N A;  1VQ9 A;  2RQW A;  3MP6 A;  4XTY A;  4L5G A;  1YJN Q;  4JUV A;  2DXT A;  4II1 A;  2F5T X;  3C12 A;  2EVR A;  1KQ2 A;  2DFU A;  3SEM A;  1UGR B;  1PD0 A;  4F7U G;  1LJO A;  1UE9 A;  2A37 A;  4CC2 A;  3KFV A;  3JCM h;  1X6O A;  3FJP A;  2L5Q A;  2EJ9 A;  4L6V 5;  1G3Y A;  3RMS A;  4JJC A;  2HZY A;  1BB9 A;  2EYW A;  2MMP A;  4OB3 B;  1H3H A;  2YUP A;  2E5K A;  2KRS A;  5LJ3 g;  4PJO A;  2DRK A;  5GAN 5;  1PC0 A;  2RNA A;  3G71 A;  2NUT B;  4HCB A;  2QYZ A;  2EIF A;  3LYI A;  1KQS A;  1YN8 A;  3CXC P;  2CGH A;  2KDS A;  1IXD A;  4M7A E;  3FC3 A;  1SEM A;  2EGA A;  3RMQ A;  4XU2 A;  3OA6 A;  3DLL A;  1VQK A;  2YHT A;  4M77 B;  4J9H A;  1QP3 A;  2KRM A;  2RHU A;  3CC2 Q;  1KHC A;  1UFF A;  7AT1 B;  1Q82 R;  2LP5 A;  5KYN A;  3THK A;  3EGD A;  3FRN A;  2FO0 A;  5EG2 A;  3V8L A;  4ELZ C;  4KGX B;  2E1H A;  1RAB B;  3CCR Q;  1C0M A;  1PKS A;  1VYV A;  2O4X B;  1YJW A;  1W2B A;  1B34 B;  2B86 A;  4HCC A;  2R5A A;  2QEX A;  1W2B P;  1Q82 C;  1FMW A;  2QI2 A;  1EX4 A;  2F2V A;  3OMG A;  2R5M A;  3EG1 A;  5CKB A;  1N27 A;  4AMC A;  3G6E T;  4RCB A;  5GMK l;  2LCL A;  1K0S A;  5LJ5 d;  1I0C A;  4KGZ B;  2HBP A;  1VQM Q;  4LXC A;  4R56 A;  1TXQ A;  3I56 A;  3LH0 A;  4J9D A;  3H41 A;  1V1C A;  5GAO m;  5IHK A;  5IH2 A;  3EFS A;  4N4H A;  3OYC A;  4IIM A;  5CQY A;  4J7I A;  1X6G A;  1YIJ A;  3FDR A;  1TS9 A;  3CCL Q;  1O75 A;  1ARK A;  1M5Q 1;  3HTR A;  2M9U A;  2RJF A;  1SHF A;  2O9V A;  2OJ2 A;  2XID A;  1KSW A;  2QQS A;  2ZCF B;  2XG8 D;  1BI0 A;  2KRO A;  3TCJ A;  1Q81 R;  4M78 C;  1MV3 A;  1VQK T;  5GAN 4;  4M77 F;  1M3A A;  5D6W A;  2LDM A;  4F16 A;  3RER A;  1CSK A;  4Y91 A;  3CC7 T;  3AHU A;  1QQJ A;  3G4S Q;  3SWN B;  1NPP A;  2W0Z A;  3PIO A;  2RPN A;  2RHZ A;  1UEB A;  2NUZ A;  2RHX A;  1Q86 C;  1FMK A;  4J9I A;  5FW9 A;  3HRT A;  1RI9 A;  1PNJ A;  2EYY A;  5J26 A;  3OYM A;  1VQL T;  4RTW A;  2RI2 A;  3JB9 I;  4C92 E;  2LQW A;  5CAI A;  2V8K A;  2P0P A;  3I55 A;  1NYG A;  2PZ1 A;  3KXT A;  3OYN A;  3GOX A;  2RA2 A;  1TSF A;  1ZBX A;  2CRE A;  3V7C A;  3V7R A;  1J3T A;  4FW2 A;  5DM7 R;  4QVZ A;  2ZPH B;  3EGD B;  4KUI A;  2D1X A;  3NHN A; 
#chains in the Genus database with same CATH homology
 1YJN Q;  1VQ4 Q;  3CCR Q;  3CCJ Q;  1QVG P;  1YJW Q;  1K8A R;  1K9M R;  2OTL Q;  3I55 Q;  1YI2 Q;  1VQM Q;  1KC8 R;  3CC4 Q;  1VQN Q;  3CCM Q;  3CC7 Q;  1YJ9 Q;  2QEX Q;  3OW2 P;  1YIT Q;  3CCS Q;  1W2B P;  3CD6 Q;  1Q7Y R;  2OTJ Q;  3I56 Q;  1K73 R;  3CC2 Q;  1Q81 R;  1Q86 R;  3CCV Q;  1YHQ Q;  1VQ6 Q;  1YIJ Q;  1Q82 R;  1N8R R;  1KD1 R;  1M1K R;  3CMA Q;  3CCQ Q;  1VQ5 Q;  1S72 Q;  1VQL Q;  3G6E Q;  1NJI R;  2QA4 Q;  3G71 Q;  3CPW P;  1VQ8 Q;  3CXC P;  3CME Q;  1JJ2 P;  1VQK Q;  1QVF P;  1M90 R;  1KQS P;  3CCL Q;  3CCE Q;  3G4S Q;  1VQO Q;  1VQ7 Q;  1VQP Q;  1VQ9 Q;  3CCU Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...