1VQ5Q

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq5Q00
1M90R 3CCJQ 1K9MR 1KD1R 1YJ9Q 3CD6Q 1VQMQ 1KC8R 1YHQQ 1VQKQ 1YI2Q 1Q82R 3CMEQ 3CCSQ 3CCUQ 2OTJQ 1YJWQ 3CCLQ 3OW2P 2QA4Q 3CC7Q 1VQ8Q 1YJNQ 2QEXQ 1VQOQ 1VQ9Q 1VQ7Q 1VQ6Q 3G71Q 1K8AR 3CMAQ 3I56Q 1VQ5Q 3CCEQ 3CXCP 1QVGP 1VQLQ 1Q7YR 1YIJQ 1N8RR 1NJIR 1VQPQ 3CPWP 1VQ4Q 1VQNQ 1YITQ 3CC4Q 3CCMQ 3CCQQ 1Q81R 1KQSP 3G6EQ 2OTLQ 3G4SQ 3CC2Q 3CCRQ 1Q86R 1S72Q 1K73R 3I55Q 1JJ2P 1M1KR 3CCVQ 1QVFP 1W2BP
chains in the Genus database with same CATH superfamily
2EGEA 4KH1B 4PJNA 3VV0A 2OX7A 2LJ0A 3CC2T 1QVGS 4IUQA 2KMTA 1Q7YU 4EMKA 1M4ZA 1VQPA 3M0TA 5KYNA 3LYIA 2HKNA 4C8QD 1YBYA 2KDSA 1GBQA 2K3XA 4N0AC 3GLXA 3A8OB 2RJEA 4AT1B 1TUDA 3L2RA 2EKOA 4OB3B 4C8QA 4RTWA 2DYBA 4X1VA 1TSFA 3EH2A 2WACA 3TSZA 1N8RU 3CMAT 2QQRA 3EFOA 2VYTA 2ZZDA 2CT4A 2E12A 3QDRB 4JJBA 1ZBXA 3QZ9B 3LLRA 2SRCA 3CC7Q 2BE7D 3VU3C 3TEEA 3O8VA 4C0FA 1M30A 2ESWA 3VS7A 2K3BA 2RHXA 4IUUA 1YJNA 5KYWA 3CCQQ 2VB6A 1MNEA 2RQUA 2J7IA 4JRIA 1UE9A 1TU0B 1VQLA 4LDUA 2A7YA 2WSFE 3CCEA 4E7SA 4IURA 2Y90A 1OPLA 2HL5C 3SWNB 4MDWA 2DK3A 1GCPA 1NBEB 1X01A 4ME7A 5AT1B 3EG2A 3RMQA 2HEQA 4M7DA 5HK3A 1YCSB 4DOWA 4ZTJA 4JRKA 1BIAA 2YSQA 1S72Q 4ZGDB 4M77C 1KIKA 2DIQA 4KT0E 4QVCA 4J9CA 2DVJA 2JS0A 2P4TA 4BE2A 1QVPA 2RD1A 3I56A 2P84A 1VQ5A 1NJIR 2L3QA 1OZ3A 2X4WA 2L3SA 3UA6A 2XK0A 1QP2A 1T3LA 3M5AA 3I5SA 2CSQA 3OA6A 1K4US 4XTZA 1QQJA 3CCJQ 4NL3A 1OPKA 2K2MA 3R6NA 1G83A 3MO8A 1R0BG 1UGRB 1WLPB 2JUFA 4LUDA 3OYHA 1VQ4Q 3L2ZA 1ZSZC 1G3WA 2VGMA 4OF1A 2X4YA 4C92G 2H3JA 2CH4W 1D09B 2LJ3A 1W4SA 3KFVA 3MCAB 1QCNA 4LE9A 1KC8U 2DTIA 1V29B 1ZSGA 1K0XA 2CT3A 4J9GA 3C95A 2DA9A 3CCUQ 3KUFA 4Z89A 1SKUB 4FYXB 3M0UA 3H6ZA 1JB0E 2K5FA 1XQHA 4FCYA 1X6GA 5KYXA 1M27C 1M3BA 3QDFA 2E10A 3ZFJA 5GANj 2KAFA 1VQKT 2DLPA 3CMEQ 2LQKA 3META 1IB8A 2CGHA 5IN1A 3S6WA 2KXCA 4OGEA 3TSWA 3UWNA 3OYLA 1Y71A 5LJ3d 4JS4A 4K11A 3HL8A 4FU6A 2O9VA 2KYMA 2QA4A 2DYIA 1X43A 4JS5A 5FRMA 4FM4B 1M3AA 4QVZA 4DA4A 1PM3A 2F5TX 2H3EB 1LCKA 3NMZC 4BY6C 5FU7C 2XU8A 2EIFA 2DZCA 1GL5A 3MHXA 2E5QA 2F2VA 1G8XA 3CPFA 1Y7XA 2L0AA 1FMWA 1ZQ1A 1F1BB 4JLIA 3EGDB 5D6WA 2K3YA 4M7AG 4RTVA 1I5LA 1JJ2P 3FLGA 2DNUA 3CC7T 3CMET 4EMKC 2CUDA 1MMNA 3OYBA 3QJ6A 4BUGA 2QGFB 3TU4K 4E7HA 3CC4T 2MMPA 1PSFA 2GBQA 3QHSA 5CQXA 3G71T 3CC4A 4EPCA 2JZ2A 2CZ1B 3OY9A 4OMFB 2L5QA 1KD1C 1KD1R 5FWCA 3RMSA 5GJVB 2RHIA 2GFAA 2R5AA 1CKAA 2CP2A 2M02A 2E6NA 4M78C 2A0FB 1QMCA 2JN0A 1FMVA 4N4HA 3QBYA 2QYZA 2LDMA 3NTKA 2CP0A 4FW2A 2L3RA 2EQKA 1YHQA 2J06A 2COWA 4QQDA 4E2FB 2RHYA 1BB9A 3V7CA 2IG0A 4CC3A 1D1CA 3R6OA 2VUBA 4LXCA 1HYOA 1UG1A 1KSWA 1TWBA 1O75A 1QW1A 3M4YA 1WHMA 3CCEQ 4PJOF 1QVFA 4M7AD 2KYBA 1TG0A 4RCCA 3E1SA 2XI9A 4M77A 2RNAA 5IHIA 2DO3A 5GANg 2FRYA 1GBRA 3M9QA 4A53A 3KXTA 2OJ2A 3P8HA 2FB7A 4KGVB 3HP9A 1GCQC 4BE1A 2DERA 2NUTB 4XAXB 4ELYC 1PD0A 1OI1A 4HCBA 1YNZA 4KH0B 4C8QB 5CO7A 1VQ9T 1QCFA 3CCVQ 1JRIA 4FW1A 1ZHIA 1RAIB 1RLQC 4QKUA 1QKWA 3AHUA 1OU8A 2YHTA 4XTVA 5DY9A 1IO6A 2KBTA 2EYZA 1UDLA 2YRVA 4J9EA 5FRNA 3JCMd 3HRUA 5D7UA 3GIBA 1BI3A 4P5NA 3CCMQ 5FU6C 1YFNA 5GAN3 4JJNK 3BFMA 1U1SA 4Y92A 1N6AA 5GAN8 1IGUA 3DLLA 5GANd 2I2LA 5FU6B 3JCMW 4M78G 5LJ3h 2DJQA 1NPRA 1M1KC 2O4XA 4JJCA 4OMLA 3HRTA 3PVLA 2JTMA 1G3YA 1UJ0A 3OYYA 1QVFP 1RAAB 1QWFA 2YRDA 5HY6A 4C0DC 4RG8A 1JEGA 1SHFA 3J7AF 3OS5A 1RAEB 1BYMA 3QKJA 4M77E 1WX6A 2K6DA 1VA7A 4Y28E 2E6ZA 2KK4A 2COZA 2QQAA 3Q1JA 2XG8D 1BIBA 1RAFB 2G3RA 4LD6A 3JAME 2AIRB 1VQOA 3GF5A 4F7UF 1OU9A 4Z02A 3OMGA 2GTJA 3MEUA 2DIGA 2CDTA 4KGXB 1PD1A 1M2VA 3HFNA 1M3CA 3M53A 3OW2A 1VIFA 4QQ6A 1UEBA 1YI2Q 5I22A 3INZA 1NLPC 3JCMQ 1WHKA 1FX7A 2GTOA 5CVIA 2GQIA 3G6EQ 5GAMh 3CCLA 3VYGA 1BU1A 2E70A 5FLXE 8AT1B 1X2QA 2C0OA 2DZ9A 1G3SA 2E41A 2XIDA 3VS0A 2OTJA 2M0YA 4HVWA 3OSSC 1D1AA 1MHNA 2FZCB 2GFUA 3L2VA 4BI3A 1NYFA 2MAMA 2F69A 2SEMA 2FZGB 4PK4A 4IUPA 4PLIA 2G6FX 1SRMA 1KJWA 3LGLA 1PWTA 2M16A 4LN2A 4HA8A 5CKEA 4VUBA 1K8AR 4M7DF 4Z88A 2OI3A 4ORZA 3CPWP 1YITQ 2PQWA 3CCQA 2VASA 2DETA 4J7FA 1NZ9A 4JLGA 1W2BP 3X25B 2XMFA 4DBHA 4BI4A 1XJWB 2RQRA 2MPXC 1NYGA 4XTUA 2DL7A 2O31A 1VQMT 1KHIA 3KBGA 3CCLQ 2F2XA 2AZVA 4MZTA 5LJ5f 4AFZC 2YDLA 1K8AU 5LJ5g 1VQMA 1UTIA 1D3BA 2CP7A 2KQWA 3HTRA 2DE0X 1MUZA 1RAGB 2RO0A 3ZBDA 2QGGA 2DF6A 1ZUUA 1IREB 3O5ZA 2J6KA 4LDWA 1VQ8T 2KXDA 2YXYA 1EX4A 3CCRA 1VQ8A 3SFMA 4A54A 4M77B 1VQOQ 2PTKA 1QVFS 3HPWA 3M0QA 2A3LA 4BE0A 1G3TA 3NGPA 4C8QF 3GPLA 3X24B 3CC2Q 2DILA 2O4XB 3M4GA 4ZGJB 1EZZB 4XK8E 2KR3A 3CMEA 4B6MA 1WHJA 2JNGA 1Y96A 1EFNA 1N8RC 2QK0A 3H0IA 4M77F 1AZGB 2DMOA 2B8AA 2X35A 2OTJQ 4HCKA 1FYNA 4DEXA 2V8KA 1OV3A 3NFCA 1UJYA 4DQ2A 2E1HA 3L2WA 1VQNT 4C0DB 4YTLA 4J9IA 5CCAA 1LPLA 4EMHA 4AMCA 4M78D 2PNIA 5FW9A 3CMAA 1Q7YC 3A98A 2RI5A 3CEYA 4OB0B 3TQ7P 3CCMA 2YWWA 5FROA 2KT1A 1W2BA 3A8HB 1YI2A 4PFZA 1BI1A 4C92B 1VQLQ 4HT8A 3EG9B 3VS2A 2OTLA 1Q86R 1VIEA 4C8QE 3J80E 1MMAA 3JV3A 5GMKh 3EH1A 2LP5A 1UGVA 1I5OB 4M75A 3CCUT 1VQ7A 1Y0MA 2HL3A 1W2BS 1SEMA 3GBQA 1K76A 3LW5E 2HQEA 2JT4A 5GAMd 4FYYB 4BD3A 4X9CA 2YUPA 4XTWA 4BI8B 7AT1B 3LWIA 3QO3A 1KQ1A 2KSSA 2R5MA 2DL8A 1D1BA 3M55A 3WVDB 4JRPA 3SEMA 1PRLC 4M77G 1M90R 2CSIA 2EYXA 2KROA 2J05A 5GAN5 1MMGA 3RNJA 3I5RA 2O9SA 2NUPB 1BCOA 3REBB 4PJOB 4C92D 3PT9A 2RN8A 3CCQT 5J3BA 2HDAA 4LDVA 4RUGA 3CC4Q 2AKLA 2BIVA 3I56T 1VQ5T 5IT9E 5I2SA 4A4FA 1FXXA 2JMCA 2GNCA 2LQNA 4J5YA 4ZNXA 3PNWC 4J6YA 2B86A 5ECAA 3OW2S 5KYUB 4E6RA 1YJ9Q 1WZOA 1AD5A 3M57A 4PJOD 3OYJA 1VQ8Q 4DOVA 1S72T 4ATOA 2ED1A 3G71Q 4E7JA 2ED0A 2DBKA 3DB3A 2M0OA 3G4SA 2V1RA 3OYDA 3RKYA 2MI6A 5LJ5h 4M75E 4R56A 2AHJB 3CBMA 1WHGA 2JXBA 1PC0A 3OYNA 1KQSA 3OYAA 2BZ8A 1B34B 2O88A 1WXBA 2YLCA 1WXUA 2NWMA 2HSPA 5I11A 4MMLA 1HD3A 3I56Q 5KYWB 1VQ5Q 4PLLA 1VOMA 1KC8C 4PJOE 1PCXA 1VQ6T 2W10A 3NTIA 4HXJA 3MEVA 3H0FA 4C5IA 2I0NA 5KH6A 1X2KA 2A08A 4HT9A 3EFSA 4BACA 1N27A 1MMDA 2E64A 1I4K1 1E6HA 1Q81C 3ULRB 2V8IA 2VC8A 2LJ1A 3RESA 5LJ3e 1WHHA 2QEXA 1TH7A 1W6XA 4A4EA 1TXQA 2X9HA 3OYIA 4C92A 2DRKA 4GY5A 3WVEB 1ZA1B 4FT4A 2KRSA 2QA4T 1YHQQ 2C0TA 2RJDA 5GANh 3FJ5A 4XU0A 3SDZA 1GFDA 5CKDA 2XDDA 1UB4A 4JPBW 4F7UB 2K57A 5GANf 3P8DA 3P8BB 2LCSA 1VQNQ 4Z8AA 3HFOA 5GAN2 1KQSP 4PJMA 4F17A 1VQ7T 1M5Q1 2PVOB 2OTJT 2BTTA 2M1HA 4GBQA 5KYUA 3A8MB 1PHTA 1YIJA 3A5ZB 5GAOl 1B3QA 2KRNA 2NUZA 4EIKA 3M0PA 2HCKA 2Z0WA 3THKA 1K0SA 3V8LA 2LNVA 1MV0B 3EG9A 2MF2A 3QIIA 2LNHB 1UUEA 3V7RA 2LCLA 1WHLA 1NG2A 3VS5A 3CD6Q 2QDLA 1OULA 3E19A 2J6OA 4JUVA 1U1TA 4KGZB 4AG2C 4FT2A 1AZEA 2D6FA 4J9DA 1U8RA 1K8AC 3V8KA 2VXFA 3EGXB 5A0GA 3SHWA 5GMKj 2LT1A 4FSXA 3H0HA 4F7UE 3CCSA 4OGCA 3JCMe 2AT1B 2K7AA 2KT8A 2X3WD 4M7DC 5GAN6 2ZPHB 5LJ5e 4ZTFA 5EG2A 1C6VX 4M75B 5GAMe 3CXCS 1KQ2A 1VYTA 1OEBA 4JRQA 1X69A 2EYYA 5KYXB 2FZKB 2FPEA 2ROLA 1K73C 4L59A 3JB9G 5IHNA 1JQQA 3PGGA 3VS4A 4M4ZA 3CXCA 3LWHA 1U06A 1TOVA 1H641 2RI3A 2QEXQ 3E9GA 5KCOA 2K5LA 1VQ6A 1VQPT 1H3HA 1TTHB 1R77A 4NL2A 2NUPA 1WJRA 4IKFA 2PUOB 4KUDK 3GNFB 2RMOA 2DL3A 3UF4A 1WJSA 3QYGB 1TUGB 4ELZC 1I81A 1JXOA 4HKEA 2YUNA 1M1FA 3PE0A 4A4KA 3JCMP 4PL6A 4FIBA 2FVUA 1W70A 1ARKA 3MEAA 4N4IA 1IHVA 3JCMf 1IXDA 2F5KA 1QCOA 1K9AA 1PG5B 4IIOA 3RBBB 2E3HA 2V8JA 1VYVA 2IPOB 3BE3A 1WFWA 1WXTA 2PVDB 4BB7A 5IXBA 1ZBJA 1ZA2B 4C0ZA 1N8RR 1VQ4T 4XU1A 4E7LA 1XNIA 1U5SA 3CCRQ 2MK5A 2DFUA 3I55Q 1QKXA 1YJ9A 2K2VA 3X28B 3S3MA 2EAYA 5KYYA 1BI0A 4AFUC 1LJOA 1SSFA 4M7DB 3JCMc 3EG0A 3G7ZA 1M1KU 1R8OB 2FPFA 2OAUA 5IHKA 2HAXA 1AT1B 4CRIA 4RMOA 1VQOT 3JCMb 2YUOA 4RTTA 4LDXA 3OS1A 2XDBA 3PFSA 2D0NA 1AWXA 3QZ5B 3AT1B 4J9HA 2FEIA 4C0GA 3S3OA 5IH2A 1K1ZA 3QPHA 5GANe 3OQ5A 2HZYA 3A8GB 4X34A 4CI0C 2NLUA 2EQIA 1V1CA 1BCMA 2FRWA 4PJJA 4XU3A 4OB1B 4DBFA 1JXMA 4RTUA 1GXIE 2BUDA 3CCLT 1Q82C 1ZUYA 2E3IA 4TVRA 2LTOA 2JW4A 1SRLA 1WPYA 3J81E 2VVKA 1R0CB 3DKMA 3RIRA 1PNJA 4FSSA 3L2QA 1OOTA 2QI2A 1YN8A 2RHZA 3QUIA 2LC4A 4M7AB 5CAIA 3UATA 1WGSA 2HQXA 1J3TA 3UDCA 4M7DD 3JSCA 1KK7A 2DXCA 3UT1A 3FB9A 1B34A 2Y4YA 5LJ5j 2JTFA 4CC4B 5GAN7 2DEQA 2E5KA 1T0HA 2CYZB 5DM7R 2ZPBB 3TREA 2EJ9A 2K4YA 3PIPA 3ZEHA 1AVZC 5EC7A 4M75F 1ZSZA 2DRMA 2MCNA 4DBQA 4R0KA 4N0AA 3U23A 2DD5A 4IIMA 3G6ET 2RM4A 1C1AA 5CKHA 3PTAA 2K9GA 3RKXA 5A2QE 4M78E 3PIOA 2JTEA 2LVMA 3MP6A 1D0XA 3C4SA 3VRZA 2FHDA 3NPFA 1E7OA 1YJWT 1YI2T 2QASA 4PJLA 1VYUA 4JJDA 3CCJT 1M8VA 2DXTA 3ER0A 3I55T 2KE9A 3JCMV 4OMNA 3CCRT 2DX1A 2KEAA 4EDUA 2CZ6B 4J9BA 3JB9I 1OX9A 1QP3A 4MMKA 2RHUA 1WNLA 2EFIA 2QTXA 3JB9J 4ZGEB 4ZN3A 2EGAA 1WYXA 2RB6A 2BZXA 1HK9A 4N4GA 1CSKA 3G71A 3CXCP 4D6WA 1QVGP 1YIJQ 3F70A 3H8ZA 4BY6B 5FU7B 2EYWA 2H8HA 3CBOA 3ME9A 3VRYA 2ZCFB 4J8OA 3QWYA 4J83A 1OX8A 1YP5A 1DJ7B 4MZPA 3GOXA 1UGQB 3EAEA 2F1LA 4OMMA 1X6BA 3CCMT 3LH5A 2K79A 1WQ7A 4D8KA 2EPDA 2CZ7B 5FWBA 2V1QA 5GMKm 4IUTA 4L5GA 5GAMj 1KD1U 3E9FA 3OS0A 2J6FA 1S72A 2Y4XA 1WDXA 4GLMA 5LL6S 2HBWA 1KFZA 2PZ1A 1KHCA 2CREA 4C8QC 3OYGA 3CD6A 3G4ST 3VS1A 3JCMg 1PSEA 4MDXA 2RQWA 3TVTA 1JU5C 2E65A 2FL7A 4EMGA 3QSUA 2L2PA 2ZPGB 4QQGA 3FEOA 3VS6A 1WIEA 2CZ0B 4R55A 3VYHB 1I8FA 3OW2P 1JBMA 1YJNQ 3OBWA 5J26A 3EG1A 1KG1A 1QWEA 2PUKB 3X26B 1S1NA 4C5GA 5J39A 3VKIA 2M51A 5GMKe 1WA7A 2DM1A 3EHRA 2LT4A 2QG9B 3L1AA 3NTHA 2GGRA 4JZ4A 1X6OA 1VQKA 1BI2A 3CCST 1KC8R 3CPWS 1RI9A 3JB9F 3EGUA 2RA2A 1RAHB 1W1FA 4F7UG 2JVVA 4D8DA 4KBMB 3MPUB 2GCXA 4PFOA 5IXFA 4ANJA 2E4HA 4E47A 1BBZA 1IGQA 1QLYA 2JJ9A 1I07A 1YJWA 6AT1B 5GMKl 3SWNC 4OMOA 2EJFA 2QQBA 1YWOA 3C94A 1UHCA 3FDRA 3CPWA 2FPDA 1I0CA 2EQJA 4O5VA 5DLQE 2DKGA 2VV5A 4RTZA 1NEGA 4J6WA 1VQ4A 3LX7A 3S3NA 2X51A 3OYCA 2HBPA 4Y91A 5LJ3j 1Y57A 1N9RA 2HD0A 2NYSA 1RABB 1RL2A 4J7IA 5KE3A 5D6YA 5GAOm 3CCET 3LH0A 2RK2A 3MP1A 2XD0A 1ZUKA 2C06A 3BW1A 5I21A 5GJWB 4M7AA 1N5ZA 3QWXX 3BDLA 1VQ6Q 2WSEE 2DL4A 5CKBA 5HCKA 4B9XA 3GNGA 2ZPEB 4BDZA 5D6XA 2VGNA 4OMQA 2RF0A 3VUZA 3G4SQ 4V2SA 2LRQA 5C6SA 2XHCA 4L6V5 1K73R 2QEXT 2A28A 4PJOC 1NM7A 2DEUA 2ZPFB 2EJGA 3FJPA 2KGTA 3UA7A 2COYA 2EVRA 2EW3A 4E7ZA 3ZL7C 2IVWA 2F2WA 4LUEA 3OYMA 1X27A 1HSQA 2L89A 2DXUA 4E7KA 2CP6A 1Z9ZA 2O2OA 3FRNA 3H9NA 4PNOA 2FG0A 1OYXA 2CS7A 1YJ9T 3M58A 4XU2A 4C92E 3CQTA 3REAB 4JZ3A 5KCHA 4AFSC 3OYEA 1M1GA 2DL5A 3VJPA 5C0MA 1E6GA 1YIJT 1K9MU 4M7DE 3I35A 1SG5A 1G5VA 5I2MA 1Q95G 2EQUA 1RADB 1C0MA 4XTXA 2CH4A 1XTDA 2JS2A 1M1KR 1WI7A 2GQVA 1K9MC 3ASKA 4XTYA 5CKFA 2O01E 4HCZA 1D0ZA 1MNDA 2RH2A 3CC2A 1T0JA 2QXFA 2HNIA 3UPUA 2QQ9A 3L42A 1HJDA 5A0LA 1WJQA 3MJXA 2FYKA 2KRMA 3FIFA 4M75C 5HK0A 1YITA 5GAOr 4J6XA 1ABOA 2HQHA 2ZGWA 2ROTA 2K5IA 3RR6A 1AWWA 1XOVA 2M9UA 1VQKQ 2RI2A 1SSHA 1YWPA 5CIUA 2RQTA 3G6EA 4QVDA 3MP8A 5GAOp 2LCCA 3OBYA 1A0NB 2CP3A 3M56A 1PKSA 1BK2A 4PKCC 3LGFA 1LVKA 2V26A 3JRZA 4CC2A 1UGSB 4C92C 2MIOA 5CQYA 3G1JA 4F14A 1YCYA 1ZLMA 3I55A 3I9QA 4IUVA 4M7DG 2DD4A 1M2VB 3H41A 4M7AE 4JDSA 1G2BA 3C0CA 5M9OA 2MWOA 3M59A 4M75G 3JB9D 3EFOB 2R57A 4HVUA 3JB9H 2L3PA 2YT6A 1VQPQ 3MKDA 1VQLT 3OMCA 4DEYA 1EIFA 2P4RA 2VXEA 8ATCB 3CC7A 2BKDN 1SPKA 4A4GA 4M78F 1WQWA 3PMIA 3JCMX 3IQLA 1UGPB 1NPPA 1Q82R 1HXDA 3VUBA 3CCSQ 1YJWQ 1Y96B 1AEYA 2LQ8A 2VKNA 1M2OA 5GAMf 3A8LB 4EMKB 1VUBA 3M54A 3QYHB 4QW2A 2YLBA 5L23A 2RQVA 5CK9A 2EBPA 1RI0A 3NHNA 3SB2A 1O9SA 4B9WA 4CC7A 4C5EA 2QDYB 2EWNA 4MZMA 2MYSA 4C8QG 1ABQA 3EGXA 1GRIA 1M90C 1SHGA 5GAN4 1Q81U 4HCCA 4C5HA 3OYKA 2D1XA 1NJIC 1MGQA 2KY9A 3FC3A 2DBMA 3JCMh 1B7TA 2P0KA 1I1JA 4II1A 5DLOA 2BE9B 1B07A 1YJNT 1D0YA 4WF2A 5IAYA 1K73U 1JJ2A 2ZAEA 4X9DA 1VQMQ 5GAOq 1M9SA 3CD6T 4ESRA 3X20B 4F16A 2AZSA 3EFRA 3CCUA 2YRCA 3TCJA 4BDYA 3HSBA 4FYWB 3QG1A 2LX7A 2RJFA 3RUXA 1AHJB 3JCMJ 2LX9A 2MWPA 1ZX6A 4ZN1A 2DTHA 3V7SA 2NUTA 3EG3A 5KYYB 2EQMA 4OP0A 1X75C 4UC4A 1H92A 1K9MR 4FL6A 3RDVA 2DVEA 5KE2A 3URGA 2JM8A 3CCVT 3OB9A 3OSVA 1IHWA 2CUBA 3CMAQ 2OAWA 1YITT 4DBRA 2ECZA 4PJOA 4KUIA 2D0QB 2C0IA 2RJCA 4OVAA 1Q86C 2KNBB 4Q5WA 3CBPA 4M78B 1PRMC 5L8RE 1YHQT 3PVQA 5A0DA 1NE8A 4KULA 4J9FA 1AWJA 2LMJA 5GAMg 1RLPC 5GMKi 4M7AC 4M75D 4KRTA 1Q7YR 5AYFA 4RKUE 2DPPB 3A1PA 3DB4A 1P92A 1AWOA 1MV3A 2X4XA 3HRSA 9ATCB 4M7AF 2HKQB 2HMAA 2R58A 4NS5A 1IRXA 2MOXA 1Y07A 3QXEB 1T3SA 2LQWA 4GLKA 4LDYA 3M0RA 2ATCB 1BKBA 2D8HA 4PFPA 2LZ6B 2X4JA 2EKHA 3RERA 1H8KA 2AK5A 2FO0A 2PVGB 4HVVA 4F04B 4QT7A 1KQSS 2A37A 1TS9A 2ENMA 4PJOG 1JO8A 3N5BB 1VQNA 2QQSA 4E7IA 2XICA 5GAOn 2DXBA 2ABLA 2W0ZA 4AG1C 5LJ3f 1Q82U 1UFFA 1H3ZA 4WTOB 1RUWA 4AFQC 2OTLQ 4OB2B 2JMAA 3VS3A 3RKWA 1GFCA 2CP5A 2XKOC 5LJ3g 4RTYA 3HHTB 5HKCA 2PU9B 4RCBA 3OS2A 2YUQA 3BY7A 2EYQA 1LOJA 1Z9QA 2RK1A 3GP8A 4M77D 2BZYA 3CCJA 1PKTA 3PMTA 2OTLT 1NEBA 2JM9A 1LNXA 4F7UA 2QTVA 1D3BB 3EHQA 4O6JA 2D8JA 1FMKA 1FWZA 1AOJA 1GCQA 2AKKA 3E2UA 1VQ9Q 2HSEB 2L8DA 3D7SB 2A36A 1CKBA 3M0SA 2WSCE 2P0QA 1Q81R 4OMPA 1V76A 2DTOA 4XQ3A 2KI7A 4WCIA 1Q86U 2GF7A 3CCVA 4NOYA 1TUCA 3T9NA 3MEWA 1NLOC 1NJIU 4LD9K 4RG2A 1OZ2A 1ACMB 2XDPA 3QJYA 1VQ7Q 1M90U 2CKKA 1N9SA 4FYVB 4C92F 1VQ9A 3BDUA 2DJZA 2RPNA 5LJ5d 2JOYA 1M8MA 3V8JA 2ZPIB 1RACB 4LNPA 2DAQA 3HKSA 3SWNA 1ZSZB 2P0PA 2QA4Q 3OYFA 2X3XD 3SD4A 3WXMB 4M78A 3L2UA 2QAZA 4RTXA 2VWFA 3EGDA 1UECA 3C12A 1UHFA 4A4HA 1QVGA 4A63B 5CR2A 2D9TA 1OQKA 2KVQG 2IIMA 1U3OA 1SF9A 1JJ2S 1IZ6A 2EGCA 3DLMA
chains in the Genus database with same CATH topology
1M90R 3CCJQ 1K9MR 1KD1R 1YJ9Q 3CD6Q 1VQMQ 1KC8R 1YHQQ 1VQKQ 1YI2Q 1Q82R 3CMEQ 3CCSQ 3CCUQ 2OTJQ 1YJWQ 3CCLQ 3OW2P 2QA4Q 3CC7Q 1VQ8Q 1YJNQ 2QEXQ 1VQOQ 1VQ9Q 1VQ7Q 1VQ6Q 3G71Q 1K8AR 3CMAQ 3I56Q 1VQ5Q 3CCEQ 3CXCP 1QVGP 1VQLQ 1Q7YR 1YIJQ 1N8RR 1NJIR 1VQPQ 3CPWP 1VQ4Q 1VQNQ 1YITQ 3CC4Q 3CCMQ 3CCQQ 1Q81R 1KQSP 3G6EQ 2OTLQ 3G4SQ 3CC2Q 3CCRQ 1Q86R 1S72Q 1K73R 3I55Q 1JJ2P 1M1KR 3CCVQ 1QVFP 1W2BP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 R;  3CCJ Q;  1K9M R;  1KD1 R;  1YJ9 Q;  3CD6 Q;  1VQM Q;  1KC8 R;  1YHQ Q;  1VQK Q;  1YI2 Q;  1Q82 R;  3CME Q;  3CCS Q;  3CCU Q;  2OTJ Q;  1YJW Q;  3CCL Q;  3OW2 P;  2QA4 Q;  3CC7 Q;  1VQ8 Q;  1YJN Q;  2QEX Q;  1VQO Q;  1VQ9 Q;  1VQ7 Q;  1VQ6 Q;  3G71 Q;  1K8A R;  3CMA Q;  3I56 Q;  1VQ5 Q;  3CCE Q;  3CXC P;  1QVG P;  1VQL Q;  1Q7Y R;  1YIJ Q;  1N8R R;  1NJI R;  1VQP Q;  3CPW P;  1VQ4 Q;  1VQN Q;  1YIT Q;  3CC4 Q;  3CCM Q;  3CCQ Q;  1Q81 R;  1KQS P;  3G6E Q;  2OTL Q;  3G4S Q;  3CC2 Q;  3CCR Q;  1Q86 R;  1S72 Q;  1K73 R;  3I55 Q;  1JJ2 P;  1M1K R;  3CCV Q;  1QVF P;  1W2B P; 
#chains in the Genus database with same CATH topology
 2EGE A;  4KH1 B;  4PJN A;  3VV0 A;  2OX7 A;  2LJ0 A;  3CC2 T;  1QVG S;  4IUQ A;  2KMT A;  1Q7Y U;  4EMK A;  1M4Z A;  1VQP A;  3M0T A;  5KYN A;  3LYI A;  2HKN A;  4C8Q D;  1YBY A;  2KDS A;  1GBQ A;  2K3X A;  4N0A C;  3GLX A;  3A8O B;  2RJE A;  4AT1 B;  1TUD A;  3L2R A;  2EKO A;  4OB3 B;  4C8Q A;  4RTW A;  2DYB A;  4X1V A;  1TSF A;  3EH2 A;  2WAC A;  3TSZ A;  1N8R U;  3CMA T;  2QQR A;  3EFO A;  2VYT A;  2ZZD A;  2CT4 A;  2E12 A;  3QDR B;  4JJB A;  1ZBX A;  3QZ9 B;  3LLR A;  2SRC A;  3CC7 Q;  2BE7 D;  3VU3 C;  3TEE A;  3O8V A;  4C0F A;  1M30 A;  2ESW A;  3VS7 A;  2K3B A;  2RHX A;  4IUU A;  1YJN A;  5KYW A;  3CCQ Q;  2VB6 A;  1MNE A;  2RQU A;  2J7I A;  4JRI A;  1UE9 A;  1TU0 B;  1VQL A;  4LDU A;  2A7Y A;  2WSF E;  3CCE A;  4E7S A;  4IUR A;  2Y90 A;  1OPL A;  2HL5 C;  3SWN B;  4MDW A;  2DK3 A;  1GCP A;  1NBE B;  1X01 A;  4ME7 A;  5AT1 B;  3EG2 A;  3RMQ A;  2HEQ A;  4M7D A;  5HK3 A;  1YCS B;  4DOW A;  4ZTJ A;  4JRK A;  1BIA A;  2YSQ A;  1S72 Q;  4ZGD B;  4M77 C;  1KIK A;  2DIQ A;  4KT0 E;  4QVC A;  4J9C A;  2DVJ A;  2JS0 A;  2P4T A;  4BE2 A;  1QVP A;  2RD1 A;  3I56 A;  2P84 A;  1VQ5 A;  1NJI R;  2L3Q A;  1OZ3 A;  2X4W A;  2L3S A;  3UA6 A;  2XK0 A;  1QP2 A;  1T3L A;  3M5A A;  3I5S A;  2CSQ A;  3OA6 A;  1K4U S;  4XTZ A;  1QQJ A;  3CCJ Q;  4NL3 A;  1OPK A;  2K2M A;  3R6N A;  1G83 A;  3MO8 A;  1R0B G;  1UGR B;  1WLP B;  2JUF A;  4LUD A;  3OYH A;  1VQ4 Q;  3L2Z A;  1ZSZ C;  1G3W A;  2VGM A;  4OF1 A;  2X4Y A;  4C92 G;  2H3J A;  2CH4 W;  1D09 B;  2LJ3 A;  1W4S A;  3KFV A;  3MCA B;  1QCN A;  4LE9 A;  1KC8 U;  2DTI A;  1V29 B;  1ZSG A;  1K0X A;  2CT3 A;  4J9G A;  3C95 A;  2DA9 A;  3CCU Q;  3KUF A;  4Z89 A;  1SKU B;  4FYX B;  3M0U A;  3H6Z A;  1JB0 E;  2K5F A;  1XQH A;  4FCY A;  1X6G A;  5KYX A;  1M27 C;  1M3B A;  3QDF A;  2E10 A;  3ZFJ A;  5GAN j;  2KAF A;  1VQK T;  2DLP A;  3CME Q;  2LQK A;  3MET A;  1IB8 A;  2CGH A;  5IN1 A;  3S6W A;  2KXC A;  4OGE A;  3TSW A;  3UWN A;  3OYL A;  1Y71 A;  5LJ3 d;  4JS4 A;  4K11 A;  3HL8 A;  4FU6 A;  2O9V A;  2KYM A;  2QA4 A;  2DYI A;  1X43 A;  4JS5 A;  5FRM A;  4FM4 B;  1M3A A;  4QVZ A;  4DA4 A;  1PM3 A;  2F5T X;  2H3E B;  1LCK A;  3NMZ C;  4BY6 C;  5FU7 C;  2XU8 A;  2EIF A;  2DZC A;  1GL5 A;  3MHX A;  2E5Q A;  2F2V A;  1G8X A;  3CPF A;  1Y7X A;  2L0A A;  1FMW A;  1ZQ1 A;  1F1B B;  4JLI A;  3EGD B;  5D6W A;  2K3Y A;  4M7A G;  4RTV A;  1I5L A;  1JJ2 P;  3FLG A;  2DNU A;  3CC7 T;  3CME T;  4EMK C;  2CUD A;  1MMN A;  3OYB A;  3QJ6 A;  4BUG A;  2QGF B;  3TU4 K;  4E7H A;  3CC4 T;  2MMP A;  1PSF A;  2GBQ A;  3QHS A;  5CQX A;  3G71 T;  3CC4 A;  4EPC A;  2JZ2 A;  2CZ1 B;  3OY9 A;  4OMF B;  2L5Q A;  1KD1 C;  1KD1 R;  5FWC A;  3RMS A;  5GJV B;  2RHI A;  2GFA A;  2R5A A;  1CKA A;  2CP2 A;  2M02 A;  2E6N A;  4M78 C;  2A0F B;  1QMC A;  2JN0 A;  1FMV A;  4N4H A;  3QBY A;  2QYZ A;  2LDM A;  3NTK A;  2CP0 A;  4FW2 A;  2L3R A;  2EQK A;  1YHQ A;  2J06 A;  2COW A;  4QQD A;  4E2F B;  2RHY A;  1BB9 A;  3V7C A;  2IG0 A;  4CC3 A;  1D1C A;  3R6O A;  2VUB A;  4LXC A;  1HYO A;  1UG1 A;  1KSW A;  1TWB A;  1O75 A;  1QW1 A;  3M4Y A;  1WHM A;  3CCE Q;  4PJO F;  1QVF A;  4M7A D;  2KYB A;  1TG0 A;  4RCC A;  3E1S A;  2XI9 A;  4M77 A;  2RNA A;  5IHI A;  2DO3 A;  5GAN g;  2FRY A;  1GBR A;  3M9Q A;  4A53 A;  3KXT A;  2OJ2 A;  3P8H A;  2FB7 A;  4KGV B;  3HP9 A;  1GCQ C;  4BE1 A;  2DER A;  2NUT B;  4XAX B;  4ELY C;  1PD0 A;  1OI1 A;  4HCB A;  1YNZ A;  4KH0 B;  4C8Q B;  5CO7 A;  1VQ9 T;  1QCF A;  3CCV Q;  1JRI A;  4FW1 A;  1ZHI A;  1RAI B;  1RLQ C;  4QKU A;  1QKW A;  3AHU A;  1OU8 A;  2YHT A;  4XTV A;  5DY9 A;  1IO6 A;  2KBT A;  2EYZ A;  1UDL A;  2YRV A;  4J9E A;  5FRN A;  3JCM d;  3HRU A;  5D7U A;  3GIB A;  1BI3 A;  4P5N A;  3CCM Q;  5FU6 C;  1YFN A;  5GAN 3;  4JJN K;  3BFM A;  1U1S A;  4Y92 A;  1N6A A;  5GAN 8;  1IGU A;  3DLL A;  5GAN d;  2I2L A;  5FU6 B;  3JCM W;  4M78 G;  5LJ3 h;  2DJQ A;  1NPR A;  1M1K C;  2O4X A;  4JJC A;  4OML A;  3HRT A;  3PVL A;  2JTM A;  1G3Y A;  1UJ0 A;  3OYY A;  1QVF P;  1RAA B;  1QWF A;  2YRD A;  5HY6 A;  4C0D C;  4RG8 A;  1JEG A;  1SHF A;  3J7A F;  3OS5 A;  1RAE B;  1BYM A;  3QKJ A;  4M77 E;  1WX6 A;  2K6D A;  1VA7 A;  4Y28 E;  2E6Z A;  2KK4 A;  2COZ A;  2QQA A;  3Q1J A;  2XG8 D;  1BIB A;  1RAF B;  2G3R A;  4LD6 A;  3JAM E;  2AIR B;  1VQO A;  3GF5 A;  4F7U F;  1OU9 A;  4Z02 A;  3OMG A;  2GTJ A;  3MEU A;  2DIG A;  2CDT A;  4KGX B;  1PD1 A;  1M2V A;  3HFN A;  1M3C A;  3M53 A;  3OW2 A;  1VIF A;  4QQ6 A;  1UEB A;  1YI2 Q;  5I22 A;  3INZ A;  1NLP C;  3JCM Q;  1WHK A;  1FX7 A;  2GTO A;  5CVI A;  2GQI A;  3G6E Q;  5GAM h;  3CCL A;  3VYG A;  1BU1 A;  2E70 A;  5FLX E;  8AT1 B;  1X2Q A;  2C0O A;  2DZ9 A;  1G3S A;  2E41 A;  2XID A;  3VS0 A;  2OTJ A;  2M0Y A;  4HVW A;  3OSS C;  1D1A A;  1MHN A;  2FZC B;  2GFU A;  3L2V A;  4BI3 A;  1NYF A;  2MAM A;  2F69 A;  2SEM A;  2FZG B;  4PK4 A;  4IUP A;  4PLI A;  2G6F X;  1SRM A;  1KJW A;  3LGL A;  1PWT A;  2M16 A;  4LN2 A;  4HA8 A;  5CKE A;  4VUB A;  1K8A R;  4M7D F;  4Z88 A;  2OI3 A;  4ORZ A;  3CPW P;  1YIT Q;  2PQW A;  3CCQ A;  2VAS A;  2DET A;  4J7F A;  1NZ9 A;  4JLG A;  1W2B P;  3X25 B;  2XMF A;  4DBH A;  4BI4 A;  1XJW B;  2RQR A;  2MPX C;  1NYG A;  4XTU A;  2DL7 A;  2O31 A;  1VQM T;  1KHI A;  3KBG A;  3CCL Q;  2F2X A;  2AZV A;  4MZT A;  5LJ5 f;  4AFZ C;  2YDL A;  1K8A U;  5LJ5 g;  1VQM A;  1UTI A;  1D3B A;  2CP7 A;  2KQW A;  3HTR A;  2DE0 X;  1MUZ A;  1RAG B;  2RO0 A;  3ZBD A;  2QGG A;  2DF6 A;  1ZUU A;  1IRE B;  3O5Z A;  2J6K A;  4LDW A;  1VQ8 T;  2KXD A;  2YXY A;  1EX4 A;  3CCR A;  1VQ8 A;  3SFM A;  4A54 A;  4M77 B;  1VQO Q;  2PTK A;  1QVF S;  3HPW A;  3M0Q A;  2A3L A;  4BE0 A;  1G3T A;  3NGP A;  4C8Q F;  3GPL A;  3X24 B;  3CC2 Q;  2DIL A;  2O4X B;  3M4G A;  4ZGJ B;  1EZZ B;  4XK8 E;  2KR3 A;  3CME A;  4B6M A;  1WHJ A;  2JNG A;  1Y96 A;  1EFN A;  1N8R C;  2QK0 A;  3H0I A;  4M77 F;  1AZG B;  2DMO A;  2B8A A;  2X35 A;  2OTJ Q;  4HCK A;  1FYN A;  4DEX A;  2V8K A;  1OV3 A;  3NFC A;  1UJY A;  4DQ2 A;  2E1H A;  3L2W A;  1VQN T;  4C0D B;  4YTL A;  4J9I A;  5CCA A;  1LPL A;  4EMH A;  4AMC A;  4M78 D;  2PNI A;  5FW9 A;  3CMA A;  1Q7Y C;  3A98 A;  2RI5 A;  3CEY A;  4OB0 B;  3TQ7 P;  3CCM A;  2YWW A;  5FRO A;  2KT1 A;  1W2B A;  3A8H B;  1YI2 A;  4PFZ A;  1BI1 A;  4C92 B;  1VQL Q;  4HT8 A;  3EG9 B;  3VS2 A;  2OTL A;  1Q86 R;  1VIE A;  4C8Q E;  3J80 E;  1MMA A;  3JV3 A;  5GMK h;  3EH1 A;  2LP5 A;  1UGV A;  1I5O B;  4M75 A;  3CCU T;  1VQ7 A;  1Y0M A;  2HL3 A;  1W2B S;  1SEM A;  3GBQ A;  1K76 A;  3LW5 E;  2HQE A;  2JT4 A;  5GAM d;  4FYY B;  4BD3 A;  4X9C A;  2YUP A;  4XTW A;  4BI8 B;  7AT1 B;  3LWI A;  3QO3 A;  1KQ1 A;  2KSS A;  2R5M A;  2DL8 A;  1D1B A;  3M55 A;  3WVD B;  4JRP A;  3SEM A;  1PRL C;  4M77 G;  1M90 R;  2CSI A;  2EYX A;  2KRO A;  2J05 A;  5GAN 5;  1MMG A;  3RNJ A;  3I5R A;  2O9S A;  2NUP B;  1BCO A;  3REB B;  4PJO B;  4C92 D;  3PT9 A;  2RN8 A;  3CCQ T;  5J3B A;  2HDA A;  4LDV A;  4RUG A;  3CC4 Q;  2AKL A;  2BIV A;  3I56 T;  1VQ5 T;  5IT9 E;  5I2S A;  4A4F A;  1FXX A;  2JMC A;  2GNC A;  2LQN A;  4J5Y A;  4ZNX A;  3PNW C;  4J6Y A;  2B86 A;  5ECA A;  3OW2 S;  5KYU B;  4E6R A;  1YJ9 Q;  1WZO A;  1AD5 A;  3M57 A;  4PJO D;  3OYJ A;  1VQ8 Q;  4DOV A;  1S72 T;  4ATO A;  2ED1 A;  3G71 Q;  4E7J A;  2ED0 A;  2DBK A;  3DB3 A;  2M0O A;  3G4S A;  2V1R A;  3OYD A;  3RKY A;  2MI6 A;  5LJ5 h;  4M75 E;  4R56 A;  2AHJ B;  3CBM A;  1WHG A;  2JXB A;  1PC0 A;  3OYN A;  1KQS A;  3OYA A;  2BZ8 A;  1B34 B;  2O88 A;  1WXB A;  2YLC A;  1WXU A;  2NWM A;  2HSP A;  5I11 A;  4MML A;  1HD3 A;  3I56 Q;  5KYW B;  1VQ5 Q;  4PLL A;  1VOM A;  1KC8 C;  4PJO E;  1PCX A;  1VQ6 T;  2W10 A;  3NTI A;  4HXJ A;  3MEV A;  3H0F A;  4C5I A;  2I0N A;  5KH6 A;  1X2K A;  2A08 A;  4HT9 A;  3EFS A;  4BAC A;  1N27 A;  1MMD A;  2E64 A;  1I4K 1;  1E6H A;  1Q81 C;  3ULR B;  2V8I A;  2VC8 A;  2LJ1 A;  3RES A;  5LJ3 e;  1WHH A;  2QEX A;  1TH7 A;  1W6X A;  4A4E A;  1TXQ A;  2X9H A;  3OYI A;  4C92 A;  2DRK A;  4GY5 A;  3WVE B;  1ZA1 B;  4FT4 A;  2KRS A;  2QA4 T;  1YHQ Q;  2C0T A;  2RJD A;  5GAN h;  3FJ5 A;  4XU0 A;  3SDZ A;  1GFD A;  5CKD A;  2XDD A;  1UB4 A;  4JPB W;  4F7U B;  2K57 A;  5GAN f;  3P8D A;  3P8B B;  2LCS A;  1VQN Q;  4Z8A A;  3HFO A;  5GAN 2;  1KQS P;  4PJM A;  4F17 A;  1VQ7 T;  1M5Q 1;  2PVO B;  2OTJ T;  2BTT A;  2M1H A;  4GBQ A;  5KYU A;  3A8M B;  1PHT A;  1YIJ A;  3A5Z B;  5GAO l;  1B3Q A;  2KRN A;  2NUZ A;  4EIK A;  3M0P A;  2HCK A;  2Z0W A;  3THK A;  1K0S A;  3V8L A;  2LNV A;  1MV0 B;  3EG9 A;  2MF2 A;  3QII A;  2LNH B;  1UUE A;  3V7R A;  2LCL A;  1WHL A;  1NG2 A;  3VS5 A;  3CD6 Q;  2QDL A;  1OUL A;  3E19 A;  2J6O A;  4JUV A;  1U1T A;  4KGZ B;  4AG2 C;  4FT2 A;  1AZE A;  2D6F A;  4J9D A;  1U8R A;  1K8A C;  3V8K A;  2VXF A;  3EGX B;  5A0G A;  3SHW A;  5GMK j;  2LT1 A;  4FSX A;  3H0H A;  4F7U E;  3CCS A;  4OGC A;  3JCM e;  2AT1 B;  2K7A A;  2KT8 A;  2X3W D;  4M7D C;  5GAN 6;  2ZPH B;  5LJ5 e;  4ZTF A;  5EG2 A;  1C6V X;  4M75 B;  5GAM e;  3CXC S;  1KQ2 A;  1VYT A;  1OEB A;  4JRQ A;  1X69 A;  2EYY A;  5KYX B;  2FZK B;  2FPE A;  2ROL A;  1K73 C;  4L59 A;  3JB9 G;  5IHN A;  1JQQ A;  3PGG A;  3VS4 A;  4M4Z A;  3CXC A;  3LWH A;  1U06 A;  1TOV A;  1H64 1;  2RI3 A;  2QEX Q;  3E9G A;  5KCO A;  2K5L A;  1VQ6 A;  1VQP T;  1H3H A;  1TTH B;  1R77 A;  4NL2 A;  2NUP A;  1WJR A;  4IKF A;  2PUO B;  4KUD K;  3GNF B;  2RMO A;  2DL3 A;  3UF4 A;  1WJS A;  3QYG B;  1TUG B;  4ELZ C;  1I81 A;  1JXO A;  4HKE A;  2YUN A;  1M1F A;  3PE0 A;  4A4K A;  3JCM P;  4PL6 A;  4FIB A;  2FVU A;  1W70 A;  1ARK A;  3MEA A;  4N4I A;  1IHV A;  3JCM f;  1IXD A;  2F5K A;  1QCO A;  1K9A A;  1PG5 B;  4IIO A;  3RBB B;  2E3H A;  2V8J A;  1VYV A;  2IPO B;  3BE3 A;  1WFW A;  1WXT A;  2PVD B;  4BB7 A;  5IXB A;  1ZBJ A;  1ZA2 B;  4C0Z A;  1N8R R;  1VQ4 T;  4XU1 A;  4E7L A;  1XNI A;  1U5S A;  3CCR Q;  2MK5 A;  2DFU A;  3I55 Q;  1QKX A;  1YJ9 A;  2K2V A;  3X28 B;  3S3M A;  2EAY A;  5KYY A;  1BI0 A;  4AFU C;  1LJO A;  1SSF A;  4M7D B;  3JCM c;  3EG0 A;  3G7Z A;  1M1K U;  1R8O B;  2FPF A;  2OAU A;  5IHK A;  2HAX A;  1AT1 B;  4CRI A;  4RMO A;  1VQO T;  3JCM b;  2YUO A;  4RTT A;  4LDX A;  3OS1 A;  2XDB A;  3PFS A;  2D0N A;  1AWX A;  3QZ5 B;  3AT1 B;  4J9H A;  2FEI A;  4C0G A;  3S3O A;  5IH2 A;  1K1Z A;  3QPH A;  5GAN e;  3OQ5 A;  2HZY A;  3A8G B;  4X34 A;  4CI0 C;  2NLU A;  2EQI A;  1V1C A;  1BCM A;  2FRW A;  4PJJ A;  4XU3 A;  4OB1 B;  4DBF A;  1JXM A;  4RTU A;  1GXI E;  2BUD A;  3CCL T;  1Q82 C;  1ZUY A;  2E3I A;  4TVR A;  2LTO A;  2JW4 A;  1SRL A;  1WPY A;  3J81 E;  2VVK A;  1R0C B;  3DKM A;  3RIR A;  1PNJ A;  4FSS A;  3L2Q A;  1OOT A;  2QI2 A;  1YN8 A;  2RHZ A;  3QUI A;  2LC4 A;  4M7A B;  5CAI A;  3UAT A;  1WGS A;  2HQX A;  1J3T A;  3UDC A;  4M7D D;  3JSC A;  1KK7 A;  2DXC A;  3UT1 A;  3FB9 A;  1B34 A;  2Y4Y A;  5LJ5 j;  2JTF A;  4CC4 B;  5GAN 7;  2DEQ A;  2E5K A;  1T0H A;  2CYZ B;  5DM7 R;  2ZPB B;  3TRE A;  2EJ9 A;  2K4Y A;  3PIP A;  3ZEH A;  1AVZ C;  5EC7 A;  4M75 F;  1ZSZ A;  2DRM A;  2MCN A;  4DBQ A;  4R0K A;  4N0A A;  3U23 A;  2DD5 A;  4IIM A;  3G6E T;  2RM4 A;  1C1A A;  5CKH A;  3PTA A;  2K9G A;  3RKX A;  5A2Q E;  4M78 E;  3PIO A;  2JTE A;  2LVM A;  3MP6 A;  1D0X A;  3C4S A;  3VRZ A;  2FHD A;  3NPF A;  1E7O A;  1YJW T;  1YI2 T;  2QAS A;  4PJL A;  1VYU A;  4JJD A;  3CCJ T;  1M8V A;  2DXT A;  3ER0 A;  3I55 T;  2KE9 A;  3JCM V;  4OMN A;  3CCR T;  2DX1 A;  2KEA A;  4EDU A;  2CZ6 B;  4J9B A;  3JB9 I;  1OX9 A;  1QP3 A;  4MMK A;  2RHU A;  1WNL A;  2EFI A;  2QTX A;  3JB9 J;  4ZGE B;  4ZN3 A;  2EGA A;  1WYX A;  2RB6 A;  2BZX A;  1HK9 A;  4N4G A;  1CSK A;  3G71 A;  3CXC P;  4D6W A;  1QVG P;  1YIJ Q;  3F70 A;  3H8Z A;  4BY6 B;  5FU7 B;  2EYW A;  2H8H A;  3CBO A;  3ME9 A;  3VRY A;  2ZCF B;  4J8O A;  3QWY A;  4J83 A;  1OX8 A;  1YP5 A;  1DJ7 B;  4MZP A;  3GOX A;  1UGQ B;  3EAE A;  2F1L A;  4OMM A;  1X6B A;  3CCM T;  3LH5 A;  2K79 A;  1WQ7 A;  4D8K A;  2EPD A;  2CZ7 B;  5FWB A;  2V1Q A;  5GMK m;  4IUT A;  4L5G A;  5GAM j;  1KD1 U;  3E9F A;  3OS0 A;  2J6F A;  1S72 A;  2Y4X A;  1WDX A;  4GLM A;  5LL6 S;  2HBW A;  1KFZ A;  2PZ1 A;  1KHC A;  2CRE A;  4C8Q C;  3OYG A;  3CD6 A;  3G4S T;  3VS1 A;  3JCM g;  1PSE A;  4MDX A;  2RQW A;  3TVT A;  1JU5 C;  2E65 A;  2FL7 A;  4EMG A;  3QSU A;  2L2P A;  2ZPG B;  4QQG A;  3FEO A;  3VS6 A;  1WIE A;  2CZ0 B;  4R55 A;  3VYH B;  1I8F A;  3OW2 P;  1JBM A;  1YJN Q;  3OBW A;  5J26 A;  3EG1 A;  1KG1 A;  1QWE A;  2PUK B;  3X26 B;  1S1N A;  4C5G A;  5J39 A;  3VKI A;  2M51 A;  5GMK e;  1WA7 A;  2DM1 A;  3EHR A;  2LT4 A;  2QG9 B;  3L1A A;  3NTH A;  2GGR A;  4JZ4 A;  1X6O A;  1VQK A;  1BI2 A;  3CCS T;  1KC8 R;  3CPW S;  1RI9 A;  3JB9 F;  3EGU A;  2RA2 A;  1RAH B;  1W1F A;  4F7U G;  2JVV A;  4D8D A;  4KBM B;  3MPU B;  2GCX A;  4PFO A;  5IXF A;  4ANJ A;  2E4H A;  4E47 A;  1BBZ A;  1IGQ A;  1QLY A;  2JJ9 A;  1I07 A;  1YJW A;  6AT1 B;  5GMK l;  3SWN C;  4OMO A;  2EJF A;  2QQB A;  1YWO A;  3C94 A;  1UHC A;  3FDR A;  3CPW A;  2FPD A;  1I0C A;  2EQJ A;  4O5V A;  5DLQ E;  2DKG A;  2VV5 A;  4RTZ A;  1NEG A;  4J6W A;  1VQ4 A;  3LX7 A;  3S3N A;  2X51 A;  3OYC A;  2HBP A;  4Y91 A;  5LJ3 j;  1Y57 A;  1N9R A;  2HD0 A;  2NYS A;  1RAB B;  1RL2 A;  4J7I A;  5KE3 A;  5D6Y A;  5GAO m;  3CCE T;  3LH0 A;  2RK2 A;  3MP1 A;  2XD0 A;  1ZUK A;  2C06 A;  3BW1 A;  5I21 A;  5GJW B;  4M7A A;  1N5Z A;  3QWX X;  3BDL A;  1VQ6 Q;  2WSE E;  2DL4 A;  5CKB A;  5HCK A;  4B9X A;  3GNG A;  2ZPE B;  4BDZ A;  5D6X A;  2VGN A;  4OMQ A;  2RF0 A;  3VUZ A;  3G4S Q;  4V2S A;  2LRQ A;  5C6S A;  2XHC A;  4L6V 5;  1K73 R;  2QEX T;  2A28 A;  4PJO C;  1NM7 A;  2DEU A;  2ZPF B;  2EJG A;  3FJP A;  2KGT A;  3UA7 A;  2COY A;  2EVR A;  2EW3 A;  4E7Z A;  3ZL7 C;  2IVW A;  2F2W A;  4LUE A;  3OYM A;  1X27 A;  1HSQ A;  2L89 A;  2DXU A;  4E7K A;  2CP6 A;  1Z9Z A;  2O2O A;  3FRN A;  3H9N A;  4PNO A;  2FG0 A;  1OYX A;  2CS7 A;  1YJ9 T;  3M58 A;  4XU2 A;  4C92 E;  3CQT A;  3REA B;  4JZ3 A;  5KCH A;  4AFS C;  3OYE A;  1M1G A;  2DL5 A;  3VJP A;  5C0M A;  1E6G A;  1YIJ T;  1K9M U;  4M7D E;  3I35 A;  1SG5 A;  1G5V A;  5I2M A;  1Q95 G;  2EQU A;  1RAD B;  1C0M A;  4XTX A;  2CH4 A;  1XTD A;  2JS2 A;  1M1K R;  1WI7 A;  2GQV A;  1K9M C;  3ASK A;  4XTY A;  5CKF A;  2O01 E;  4HCZ A;  1D0Z A;  1MND A;  2RH2 A;  3CC2 A;  1T0J A;  2QXF A;  2HNI A;  3UPU A;  2QQ9 A;  3L42 A;  1HJD A;  5A0L A;  1WJQ A;  3MJX A;  2FYK A;  2KRM A;  3FIF A;  4M75 C;  5HK0 A;  1YIT A;  5GAO r;  4J6X A;  1ABO A;  2HQH A;  2ZGW A;  2ROT A;  2K5I A;  3RR6 A;  1AWW A;  1XOV A;  2M9U A;  1VQK Q;  2RI2 A;  1SSH A;  1YWP A;  5CIU A;  2RQT A;  3G6E A;  4QVD A;  3MP8 A;  5GAO p;  2LCC A;  3OBY A;  1A0N B;  2CP3 A;  3M56 A;  1PKS A;  1BK2 A;  4PKC C;  3LGF A;  1LVK A;  2V26 A;  3JRZ A;  4CC2 A;  1UGS B;  4C92 C;  2MIO A;  5CQY A;  3G1J A;  4F14 A;  1YCY A;  1ZLM A;  3I55 A;  3I9Q A;  4IUV A;  4M7D G;  2DD4 A;  1M2V B;  3H41 A;  4M7A E;  4JDS A;  1G2B A;  3C0C A;  5M9O A;  2MWO A;  3M59 A;  4M75 G;  3JB9 D;  3EFO B;  2R57 A;  4HVU A;  3JB9 H;  2L3P A;  2YT6 A;  1VQP Q;  3MKD A;  1VQL T;  3OMC A;  4DEY A;  1EIF A;  2P4R A;  2VXE A;  8ATC B;  3CC7 A;  2BKD N;  1SPK A;  4A4G A;  4M78 F;  1WQW A;  3PMI A;  3JCM X;  3IQL A;  1UGP B;  1NPP A;  1Q82 R;  1HXD A;  3VUB A;  3CCS Q;  1YJW Q;  1Y96 B;  1AEY A;  2LQ8 A;  2VKN A;  1M2O A;  5GAM f;  3A8L B;  4EMK B;  1VUB A;  3M54 A;  3QYH B;  4QW2 A;  2YLB A;  5L23 A;  2RQV A;  5CK9 A;  2EBP A;  1RI0 A;  3NHN A;  3SB2 A;  1O9S A;  4B9W A;  4CC7 A;  4C5E A;  2QDY B;  2EWN A;  4MZM A;  2MYS A;  4C8Q G;  1ABQ A;  3EGX A;  1GRI A;  1M90 C;  1SHG A;  5GAN 4;  1Q81 U;  4HCC A;  4C5H A;  3OYK A;  2D1X A;  1NJI C;  1MGQ A;  2KY9 A;  3FC3 A;  2DBM A;  3JCM h;  1B7T A;  2P0K A;  1I1J A;  4II1 A;  5DLO A;  2BE9 B;  1B07 A;  1YJN T;  1D0Y A;  4WF2 A;  5IAY A;  1K73 U;  1JJ2 A;  2ZAE A;  4X9D A;  1VQM Q;  5GAO q;  1M9S A;  3CD6 T;  4ESR A;  3X20 B;  4F16 A;  2AZS A;  3EFR A;  3CCU A;  2YRC A;  3TCJ A;  4BDY A;  3HSB A;  4FYW B;  3QG1 A;  2LX7 A;  2RJF A;  3RUX A;  1AHJ B;  3JCM J;  2LX9 A;  2MWP A;  1ZX6 A;  4ZN1 A;  2DTH A;  3V7S A;  2NUT A;  3EG3 A;  5KYY B;  2EQM A;  4OP0 A;  1X75 C;  4UC4 A;  1H92 A;  1K9M R;  4FL6 A;  3RDV A;  2DVE A;  5KE2 A;  3URG A;  2JM8 A;  3CCV T;  3OB9 A;  3OSV A;  1IHW A;  2CUB A;  3CMA Q;  2OAW A;  1YIT T;  4DBR A;  2ECZ A;  4PJO A;  4KUI A;  2D0Q B;  2C0I A;  2RJC A;  4OVA A;  1Q86 C;  2KNB B;  4Q5W A;  3CBP A;  4M78 B;  1PRM C;  5L8R E;  1YHQ T;  3PVQ A;  5A0D A;  1NE8 A;  4KUL A;  4J9F A;  1AWJ A;  2LMJ A;  5GAM g;  1RLP C;  5GMK i;  4M7A C;  4M75 D;  4KRT A;  1Q7Y R;  5AYF A;  4RKU E;  2DPP B;  3A1P A;  3DB4 A;  1P92 A;  1AWO A;  1MV3 A;  2X4X A;  3HRS A;  9ATC B;  4M7A F;  2HKQ B;  2HMA A;  2R58 A;  4NS5 A;  1IRX A;  2MOX A;  1Y07 A;  3QXE B;  1T3S A;  2LQW A;  4GLK A;  4LDY A;  3M0R A;  2ATC B;  1BKB A;  2D8H A;  4PFP A;  2LZ6 B;  2X4J A;  2EKH A;  3RER A;  1H8K A;  2AK5 A;  2FO0 A;  2PVG B;  4HVV A;  4F04 B;  4QT7 A;  1KQS S;  2A37 A;  1TS9 A;  2ENM A;  4PJO G;  1JO8 A;  3N5B B;  1VQN A;  2QQS A;  4E7I A;  2XIC A;  5GAO n;  2DXB A;  2ABL A;  2W0Z A;  4AG1 C;  5LJ3 f;  1Q82 U;  1UFF A;  1H3Z A;  4WTO B;  1RUW A;  4AFQ C;  2OTL Q;  4OB2 B;  2JMA A;  3VS3 A;  3RKW A;  1GFC A;  2CP5 A;  2XKO C;  5LJ3 g;  4RTY A;  3HHT B;  5HKC A;  2PU9 B;  4RCB A;  3OS2 A;  2YUQ A;  3BY7 A;  2EYQ A;  1LOJ A;  1Z9Q A;  2RK1 A;  3GP8 A;  4M77 D;  2BZY A;  3CCJ A;  1PKT A;  3PMT A;  2OTL T;  1NEB A;  2JM9 A;  1LNX A;  4F7U A;  2QTV A;  1D3B B;  3EHQ A;  4O6J A;  2D8J A;  1FMK A;  1FWZ A;  1AOJ A;  1GCQ A;  2AKK A;  3E2U A;  1VQ9 Q;  2HSE B;  2L8D A;  3D7S B;  2A36 A;  1CKB A;  3M0S A;  2WSC E;  2P0Q A;  1Q81 R;  4OMP A;  1V76 A;  2DTO A;  4XQ3 A;  2KI7 A;  4WCI A;  1Q86 U;  2GF7 A;  3CCV A;  4NOY A;  1TUC A;  3T9N A;  3MEW A;  1NLO C;  1NJI U;  4LD9 K;  4RG2 A;  1OZ2 A;  1ACM B;  2XDP A;  3QJY A;  1VQ7 Q;  1M90 U;  2CKK A;  1N9S A;  4FYV B;  4C92 F;  1VQ9 A;  3BDU A;  2DJZ A;  2RPN A;  5LJ5 d;  2JOY A;  1M8M A;  3V8J A;  2ZPI B;  1RAC B;  4LNP A;  2DAQ A;  3HKS A;  3SWN A;  1ZSZ B;  2P0P A;  2QA4 Q;  3OYF A;  2X3X D;  3SD4 A;  3WXM B;  4M78 A;  3L2U A;  2QAZ A;  4RTX A;  2VWF A;  3EGD A;  1UEC A;  3C12 A;  1UHF A;  4A4H A;  1QVG A;  4A63 B;  5CR2 A;  2D9T A;  1OQK A;  2KVQ G;  2IIM A;  1U3O A;  1SF9 A;  1JJ2 S;  1IZ6 A;  2EGC A;  3DLM A; 
#chains in the Genus database with same CATH homology
 1M90 R;  3CCJ Q;  1K9M R;  1KD1 R;  1YJ9 Q;  3CD6 Q;  1VQM Q;  1KC8 R;  1YHQ Q;  1VQK Q;  1YI2 Q;  1Q82 R;  3CME Q;  3CCS Q;  3CCU Q;  2OTJ Q;  1YJW Q;  3CCL Q;  3OW2 P;  2QA4 Q;  3CC7 Q;  1VQ8 Q;  1YJN Q;  2QEX Q;  1VQO Q;  1VQ9 Q;  1VQ7 Q;  1VQ6 Q;  3G71 Q;  1K8A R;  3CMA Q;  3I56 Q;  1VQ5 Q;  3CCE Q;  3CXC P;  1QVG P;  1VQL Q;  1Q7Y R;  1YIJ Q;  1N8R R;  1NJI R;  1VQP Q;  3CPW P;  1VQ4 Q;  1VQN Q;  1YIT Q;  3CC4 Q;  3CCM Q;  3CCQ Q;  1Q81 R;  1KQS P;  3G6E Q;  2OTL Q;  3G4S Q;  3CC2 Q;  3CCR Q;  1Q86 R;  1S72 Q;  1K73 R;  3I55 Q;  1JJ2 P;  1M1K R;  3CCV Q;  1QVF P;  1W2B P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...