1VQ5Q

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq5Q00
3CXCP 1YJ9Q 1YJWQ 3CCUQ 1VQPQ 1K8AR 3CC2Q 1K9MR 3CCSQ 3CCQQ 1W2BP 3CCJQ 1Q82R 1S72Q 3G71Q 3CPWP 3CCMQ 3CCVQ 3CMAQ 2QA4Q 1Q86R 1YIJQ 1VQKQ 1QVFP 1KD1R 3CC4Q 3I56Q 1VQOQ 1VQ5Q 2QEXQ 1KQSP 3CMEQ 1JJ2P 1VQ4Q 3G6EQ 1YITQ 1Q7YR 2OTJQ 3CCLQ 1YJNQ 1NJIR 1VQ8Q 3CCEQ 1VQLQ 1VQ9Q 1VQ6Q 3CC7Q 3CCRQ 1VQ7Q 1VQMQ 1Q81R 1M90R 1VQNQ 3OW2P 1QVGP 1K73R 1YHQQ 1N8RR 3I55Q 2OTLQ 1M1KR 3CD6Q 3G4SQ 1KC8R 1YI2Q
chains in the Genus database with same CATH superfamily
3PIPA 3VS0A 2ECZA 3KUFA 1YITA 4PFPA 3JCMJ 3PVQA 2RHYA 4X9DA 1I5LA 3JAME 2CYZB 3I56T 3I5RA 2JJ9A 3CD6A 2ABLA 1YN8A 4KGZB 3QWXX 4CC7A 4AFZC 3L2VA 1JU5C 3NFCA 6AT1B 1Y7XA 3X28B 4LDXA 3JCMc 1WA7A 5FRMA 1TUGB 3L2QA 2JTFA 1WZOA 4PJOF 2IVWA 4JZ3A 1N8RC 3BE3A 2J7IA 3CPWS 4PJOB 4ZN3A 1IZ6A 1NJIR 2E10A 1NJIU 3JSCA 5LJ5j 4F17A 1YJNT 1XTDA 1K73R 4RTYA 4DOWA 1K73U 2JMAA 1FX7A 3NTKA 1QVFA 1LNXA 1WIEA 3LH5A 3M4YA 5LJ3j 2DFUA 4IKFA 2VB6A 4HCZA 4PLIA 3S3MA 3CPWP 2XK0A 3MJXA 2GTJA 1VQKT 1VQNA 1VQ4Q 2JNGA 4XAXB 4JJBA 2JUFA 3CCLQ 2R58A 1GCPA 5GAOl 1YWPA 4C8QE 4Z89A 3CPFA 3LH0A 1HSQA 1VQ9T 1X6BA 2OTLQ 3BDUA 3WVEB 2EGCA 2P0KA 3OYEA 1NG2A 3DKMA 2BE7D 4M77D 3CC2Q 1JJ2A 4BI8B 5C6SA 4BI4A 2E12A 5GAMe 3THKA 4II1A 3GOXA 1KC8C 1NYFA 1M2OA 1O75A 1YHQA 3I55A 4OB1B 3QYGB 2QEXT 2WSFE 1M8MA 3WXMB 2J6FA 1Y96A 5CKEA 1BI3A 1KSWA 5CK9A 2XI9A 3SDZA 3QIIA 5KYYA 5FU6B 2VV5A 1YJ9T 3EGXB 1W6XA 2FVUA 4ELZC 4QKUA 3V7SA 3G71T 3META 4TVRA 3CBMA 3CMAT 5FLXE 2R5MA 1OOTA 1U3OA 1WJQA 2RD1A 2F2XA 1F1BB 2L3PA 1VQLT 2EYWA 3CCQA 3VS1A 2ZPEB 3GPLA 1VQ7T 2CUDA 2KYBA 1K9MR 1K9MU 4N0AC 9ATCB 4A63B 2P84A 3JCMW 1KD1R 1T0HA 4LDUA 3RNJA 3MCAB 4A4FA 1KD1U 2DLPA 2FB7A 3M0TA 1RABB 1UGPB 2F5KA 1O9SA 2A0FB 2SRCA 2E3IA 2JM8A 1MHNA 3TQ7P 4C0GA 2OTJT 2HQEA 4M75D 2WSEE 2OJ2A 4JRQA 3R6NA 4M75G 2E3HA 3I56A 1YJWQ 4DEXA 4Z88A 3L2RA 4PFZA 2QQBA 1SF9A 4IURA 1R8OB 2KK4A 4DBQA 3LX7A 2XICA 4HA8A 4PNOA 1QVGA 2EFIA 1K8AC 2EIFA 1M3CA 2MMPA 4PFOA 3EGDA 2SEMA 5FU7B 3WVDB 4M4ZA 1TH7A 4OP0A 3JCMe 4M78A 3V8JA 1U5SA 3NMZC 1QP2A 2NYSA 2K7AA 3LYIA 3J80E 1YJNA 5AYFA 4E6RA 1W2BS 5KH6A 2M51A 1ZUYA 4A4HA 4J9IA 1CSKA 1C6VX 3OS1A 4KUIA 2CP2A 1W1FA 2A36A 2L89A 2QG9B 4AFSC 2QDYB 2L3SA 2HSEB 3SD4A 2IG0A 1AOJA 2W10A 1UE9A 4M7AF 2DEUA 2ESWA 2VXFA 2DXBA 1W2BP 4F04B 4M7AB 3UDCA 1VQ9A 1HYOA 1PM3A 1JXMA 4FW1A 5GMKm 1QCFA 1VQ8Q 4ZGJB 1RAHB 2HD0A 1PCXA 2A37A 3JCMP 1ZSZC 1G8XA 1MGQA 3A8LB 1J3TA 3CCRT 4A4KA 3G4SQ 3QJYA 2E5QA 1G83A 2QEXA 3OBYA 3PNWC 1Q95G 3EG2A 2GCXA 2HCKA 2XG8D 1GFCA 3EHQA 1PD1A 2DXTA 3OMCA 3MO8A 3CEYA 1YJ9A 2QGGA 2KR3A 4Z02A 5I11A 3CC7T 2QXFA 4QT7A 3GBQA 3CMAA 4ZTFA 3PTAA 2RB6A 4C8QD 2F2VA 4M77C 3FC3A 1VQLA 3RKXA 1NBEB 1KQ1A 2DL5A 3CC4Q 1VQ7A 1GRIA 2WSCE 4A4GA 3M0SA 1SSFA 4OB2B 4LN2A 2LQKA 1VQMT 2XDBA 3URGA 2D8JA 2V8JA 2KBTA 5LJ5d 1M30A 2OTJA 3OB9A 3CCJQ 4KRTA 4MZTA 1ACMB 5FW9A 1GXIE 2LJ1A 1MMDA 1UUEA 1RADB 1C0MA 5LJ3d 2YXYA 3BY7A 2FRWA 2BUDA 2GGRA 1UB4A 1XJWB 3QZ9B 2YWWA 4PJLA 5GMKh 4RG2A 2AK5A 2FHDA 4DEYA 2JMCA 2FEIA 1PNJA 1KFZA 3PE0A 2KVQG 2LQ8A 3LGLA 3C12A 2RQRA 3SEMA 4D8KA 2RA2A 3OYFA 1M1FA 5KYUB 3H0IA 2RJEA 4KULA 2O01E 2P0QA 3OS0A 5D6YA 1U1SA 2M02A 2D9TA 1K76A 3OYGA 3EGUA 5CAIA 5KCOA 2LC4A 1FMWA 3SB2A 2DL4A 4BD3A 1JRIA 2EBPA 2FG0A 1PD0A 1YWOA 5A0DA 5CIUA 4RCBA 2DZCA 2NUTA 1VQPQ 4X9CA 3A8OB 4M7DF 2ENMA 2YHTA 4UC4A 2HEQA 3RR6A 1OX8A 5GMKj 4QW2A 3CCST 3CBOA 4M7DB 4MDWA 3CCRA 1YITQ 2YDLA 2K3XA 3CCUA 1M27C 4IUQA 5D6XA 1M5Q1 3M0RA 4M75A 3CD6Q 4JRPA 1I1JA 5GANh 1E6GA 3A5ZB 1KQSA 1JO8A 2COWA 1YI2T 3VS4A 2QQRA 4C92C 2HKNA 1Q7YR 3J7AF 1Q7YU 4C5IA 1BCMA 3ULRB 1FWZA 2E4HA 2NUPB 3RIRA 2DZ9A 1BIBA 3I9QA 2EPDA 1WPYA 2CSQA 1OI1A 3ZEHA 2RJFA 5HK0A 3CCMQ 1M3BA 1A0NB 2Y90A 3JCMV 3OYMA 1VQMA 1SG5A 2JTMA 3MP8A 3CCEQ 4OMLA 4M77E 2KRMA 5J3BA 1RAAB 1VQNQ 3EFOA 1PKTA 1ZUUA 4XTVA 1NJIC 5KE3A 3RKYA 1OYXA 1WHGA 1GCQA 1K73C 1TSFA 4C8QC 1RAIB 1WHLA 1KJWA 1S72T 4IUPA 3QBYA 1ARKA 2G6FX 5GAOq 5FRNA 1QW1A 1WHHA 2LTOA 1UEBA 4PJNA 1YHQQ 3I55Q 3FJ5A 3N5BB 2DD5A 5J39A 1FXXA 3QKJA 1TG0A 2XKOC 1G5VA 1AD5A 2X51A 4EMKC 3HSBA 1EIFA 3E2UA 2XD0A 1RL2A 4Y92A 3UF4A 4XTYA 2BKDN 4GY5A 2PVGB 2FRYA 2EQUA 1ZHIA 5DM7R 3H41A 3REBB 4OMMA 2KMTA 2YRVA 3X26B 3BDLA 2LP5A 3OYIA 2K9GA 4EMGA 1Q81R 2JW4A 5FWBA 2CT4A 2X4WA 1Q81U 3NTHA 5LJ3e 2Z0WA 3JB9J 3ZFJA 3A8HB 1Y96B 3CCQQ 3JB9F 1K0XA 1QLYA 3HRSA 3EHRA 3ME9A 3JRZA 1SRMA 2V1RA 3M54A 1NEBA 4OMOA 5KYYB 1HK9A 2KSSA 5GAN5 4KH1B 4L6V5 3RDVA 2FO0A 4ZNXA 2ED0A 2EYQA 3VUBA 3CCSA 4K11A 2ROLA 2COYA 3FB9A 2DO3A 1IRXA 2P4TA 3OYCA 2DRMA 8ATCB 3VUZA 3PMIA 2K5FA 2DE0X 3I56Q 3NHNA 1QWFA 4XTZA 2DX1A 1K9MC 5CKHA 4R0KA 1T0JA 2ED1A 5I2SA 3JCMd 1EZZB 4Q5WA 4ATOA 3VS5A 4C0DB 2L2PA 1KD1C 4DA4A 3QDFA 2LVMA 1VQ5A 1BI2A 2KDSA 2BZXA 2K5LA 1G3WA 1RACB 2DF6A 5HY6A 2GQIA 5CQXA 4ELYC 3M0UA 2L3QA 2NUPA 2LX7A 1YJNQ 2ZPHB 2VUBA 4ZTJA 1IHWA 1PRMC 4RKUE 5HCKA 2KAFA 4FIBA 5KE2A 3RMSA 5HK3A 2L3RA 3FEOA 1R77A 4C92E 3TSZA 3UA6A 4E7HA 4ANJA 3OQ5A 4KGVB 4M78F 2CDTA 2QQ9A 3EGDB 1KG1A 1H92A 4E7KA 1D1CA 5GAOn 4M78B 2CS7A 3QWYA 4XTXA 4O6JA 1QKWA 2QA4T 1BU1A 3VV0A 3OW2A 1AVZC 1G3TA 5GAOp 4A4EA 1VQ9Q 4QQDA 2DIQA 4XQ3A 3PIOA 3OYJA 1S72A 2DYIA 2COZA 2PNIA 3CCMA 3A8GB 3JV3A 1ZSGA 2FZGB 1BI0A 2AZSA 2HL3A 2E64A 2L8DA 3CCEA 2QEXQ 1BKBA 1BI1A 2YUNA 1AZGB 2YUPA 2FZCB 3RMQA 2DBMA 1ZLMA 3LW5E 1D1AA 2EWNA 4FYXB 4E7ZA 1AEYA 1TUDA 1WDXA 3RKWA 3EG1A 2FPEA 1YJ9Q 1N6AA 1GL5A 2DK3A 1TWBA 2B86A 2VXEA 2JXBA 3CMAQ 2V1QA 4R56A 4M77G 1QVFS 4EIKA 5A0LA 4XTWA 1UG1A 2MOXA 2LX9A 3QYHB 1VQLQ 2JM9A 3ZBDA 2YLCA 3E1SA 1AZEA 1VQ7Q 5GAN6 2KRSA 1NEGA 4MZMA 1NLOC 4BY6B 1UHFA 3OYHA 2XU8A 1W4SA 1M1GA 1QVFP 1UGSB 2VWFA 4ZGEB 4FYVB 2E70A 1U1TA 2OTJQ 4OF1A 1JJ2S 3TEEA 3RERA 5A2QE 1M8VA 3VU3C 2KQWA 2K2MA 3M9QA 5IT9E 1JXOA 5D7UA 2QI2A 4FSXA 4A54A 4F7UE 5IXBA 1PG5B 2BE9B 3TVTA 2GFAA 3CC2T 1TS9A 1M4ZA 3CCVT 1JJ2P 4KBMB 3TU4K 1PRLC 2O2OA 2MCNA 4KT0E 2LDMA 3CXCA 4WF2A 1NZ9A 2RI5A 3C95A 3VS2A 2P0PA 1OEBA 1M90R 2E6ZA 1M90U 1MUZA 2HNIA 3M55A 4JJNK 4PJOC 5GAMh 1SPKA 3Q1JA 2A08A 1OU8A 2DAQA 3H6ZA 1BIAA 4J6XA 4AT1B 1QQJA 1Q86R 3DLMA 4NL2A 1Q86U 3MKDA 2V8IA 1EFNA 2LJ0A 2A28A 2RHUA 2RI2A 2FL7A 2LRQA 3O8VA 4XK8E 1JBMA 1IREB 2DBKA 2QTXA 2YUOA 2ZPBB 3L2WA 4PLLA 1QKXA 2QA4A 1T3SA 2CP7A 1OULA 2JZ2A 2EKOA 2YSQA 5IAYA 2J05A 2X4JA 1JB0E 1PSFA 4N0AA 4LDWA 3S3NA 1D3BA 1N9SA 2V8KA 4FU6A 1VQOT 3MEAA 4P5NA 2ATCB 3CCRQ 1WHMA 2EYYA 4JRIA 4CC4B 4V2SA 4FL6A 5DY9A 2LCSA 1VQKA 1V1CA 1QVGS 3UA7A 3FIFA 2DYBA 2OX7A 3CCUQ 4C5EA 5GANg 3JCMb 5IHIA 1D09B 1YJWT 1NLPC 1SHGA 4C92D 5I21A 3MEWA 1OPLA 5GAN3 2NUTB 1B07A 2VGNA 1YIJT 4C92G 2K5IA 1H8KA 2A3LA 4JLGA 3JB9I 2NLUA 4FT2A 5FU6C 4AFUC 1QVGP 2HBWA 4M75F 2RHIA 4FYWB 1WXTA 4M75B 3GP8A 3EG3A 4OMNA 5GAOr 5GMKi 1VYUA 3OSSC 1MNEA 4PK4A 3G6ET 2QQAA 1FMVA 2MK5A 2EVRA 5LL6S 5IHKA 1VQMQ 1OZ3A 2RI3A 4N4HA 8AT1B 3G71A 5GANf 1WJSA 1Q7YC 3QXEB 3ER0A 4KUDK 2B8AA 2D6FA 5GMKe 1ZA2B 3A8MB 2F5TX 4HVUA 2AKLA 2CKKA 4C8QG 2EW3A 4FYYB 3LWIA 4X34A 1OPKA 5CQYA 4A53A 5IH2A 1N5ZA 1WFWA 2RJDA 1HXDA 4ORZA 3SWNB 1ZSZA 2XHCA 1QP3A 4DOVA 2DL3A 4IIMA 3A98A 3EAEA 2X9HA 3M0PA 2GTOA 4KGXB 3H8ZA 3OA6A 3EFOB 1PKSA 4J9BA 1VOMA 3TREA 5FU7C 4OMFB 3I5SA 3GNFB 3EG0A 2KRNA 3CMET 2QGFB 4ZGDB 3ASKA 2X35A 4IUUA 1TXQA 2C06A 2DIGA 2YRCA 2CP0A 2BZ8A 3UWNA 2RHZA 1LOJA 1X01A 1H641 4M77A 3CQTA 2E5KA 4PJOE 4JZ4A 2RN8A 4BI3A 2DETA 1X2QA 2LCLA 3INZA 4F7UG 3M59A 3HRUA 4M7AC 2RF0A 3VS7A 3EH2A 5GAN7 2ZPGB 2XMFA 1I8FA 3CCSQ 1Q81C 3H0FA 4LXCA 3LWHA 3P8DA 1IO6A 3HP9A 2RQVA 1WXBA 4O5VA 5IXFA 3MEUA 3OYKA 1YIJA 1YI2Q 4CC3A 5L8RE 4J9DA 2EQIA 3MPUB 5LJ5g 4JPBW 2CP6A 1Q82R 4LE9A 1Q82U 2GQVA 2CREA 3ZL7C 1VQ5Q 4XU2A 3X24B 1ZQ1A 2L0AA 3JCMX 4HCCA 2QDLA 1NPRA 4BDYA 4FW2A 2E6NA 2DRKA 1WI7A 2GBQA 2LT1A 2AIRB 4JS5A 2BIVA 2AT1B 2M1HA 2DXUA 4B9XA 4N4GA 3G6EA 4XU3A 4LDVA 4NOYA 1U8RA 1X69A 2H8HA 3OYNA 3CC7A 3V7CA 1SKUB 2JT4A 4WCIA 1ZX6A 2FZKB 5GMKl 4JJCA 2P4RA 3L42A 1MNDA 2W0ZA 5LJ5f 3E9GA 2EJ9A 2DILA 1R0CB 1S72Q 3C94A 2YLBA 3KBGA 1BYMA 4E7SA 1M2VA 3SWNA 3L2UA 4BDZA 1KQSS 2QYZA 1LJOA 3EG9B 2CZ6B 4C0FA 2CSIA 1OV3A 3CMEA 4OGCA 4Z8AA 1WQ7A 2KI7A 3VJPA 1KHIA 3VS6A 2PVDB 4D8DA 2LQNA 4N4IA 4C92A 1KQSP 3GNGA 3M4GA 2RQWA 3VS3A 5GAOm 5GANj 3A1PA 4RTZA 3E9FA 4QQGA 2AKKA 1WHKA 1U06A 1AWJA 4LDYA 4PL6A 1WYXA 3DB3A 2A7YA 4LD9K 1YNZA 1K9AA 4J9HA 1OX9A 2DVEA 1Y07A 2EJFA 2KT1A 1CKAA 5KCHA 2JTEA 2ROTA 3RUXA 1KQ2A 4MZPA 2H3JA 3V8KA 2HQXA 5GJWB 2DERA 4OB0B 4BE0A 4QVCA 1X2KA 1HJDA 4HCKA 4M7DC 4EMHA 1UFFA 3PVLA 3EH1A 1YCSB 3R6OA 3M56A 1VA7A 4M7AE 1KK7A 4J9GA 4C8QA 2KROA 2LNVA 2CUBA 3QO3A 5CVIA 1QCNA 3OYYA 4RTWA 4DQ2A 2V26A 2LCCA 4PJOD 1VQ6T 2PUKB 3QPHA 5GAMg 3UPUA 1YHQT 3I55T 2KXCA 3UATA 4PJOG 4RCCA 1IGQA 1NPPA 4EMKA 2CP5A 5J26A 2F1LA 3LGFA 2EYZA 1SHFA 3D7SB 1BBZA 1UGQB 2CH4A 1YFNA 3OBWA 3OSVA 3V7RA 1FYNA 4MDXA 3QUIA 1YI2A 4OMPA 4E7IA 3AT1B 2RQUA 1HD3A 3I35A 1YBYA 5LJ5h 2DL8A 2I0NA 1LVKA 1M90C 2R57A 2IIMA 3QG1A 2QA4Q 2ZPFB 2WACA 4JS4A 5LJ3h 2RMOA 4L5GA 2DTIA 4NL3A 4F7UA 1Q86C 5C0MA 5GAMf 1I4K1 4IIOA 3CPWA 1M1KR 1M3AA 1UGRB 3VKIA 1M1KU 4ESRA 1IXDA 7AT1B 2RH2A 3VRYA 3X25B 4CI0C 1VQKQ 4C5GA 1TTHB 1X43A 2D8HA 2ZZDA 2MIOA 2JS0A 4HT8A 3EG9A 4J9FA 3GF5A 4B6MA 1VIFA 1RI0A 2QTVA 3BW1A 2PUOB 3CBPA 1Z9QA 1NYGA 3VYHB 1D3BB 3HFOA 1OU9A 1GBRA 4DBFA 1UGVA 2RJCA 2O4XA 2LZ6B 2F2WA 4J6YA 4E7JA 4YTLA 2M0YA 3M0QA 3TSWA 1MMGA 1PC0A 1VIEA 2DXCA 3JCMg 4PKCC 2LQWA 5A0GA 1ZBJA 5EG2A 3OW2S 4HVVA 4GLKA 2DJZA 1YP5A 2K2VA 2J06A 5IN1A 2RM4A 3G71Q 2GFUA 1ABOA 4FSSA 2DNUA 2QASA 2QQSA 1RAEB 3H9NA 5CKBA 1QWEA 1RLQC 4IUVA 1X6GA 5CKFA 4X1VA 1E7OA 2FYKA 1K0SA 3G1JA 3MEVA 3MP1A 1Z9ZA 3OW2P 3L1AA 1WQWA 3SFMA 4AG2C 4B9WA 4EDUA 4HXJA 2DPPB 3J81E 4CC2A 3P8HA 3CCVQ 1IGUA 1MV0B 4DBHA 5GJVB 4C0DC 1VQ6A 3JCMf 4M7DE 5AT1B 2J6OA 4ME7A 1VQ4T 3CCLT 3TCJA 2RPNA 4HVWA 5GAN8 2VVKA 3QZ5B 2OTLT 1G3YA 4F16A 2K57A 3UT1A 1ZSZB 1G2BA 1WHJA 4JJDA 2PZ1A 4C5HA 2EYXA 2AZVA 5EC7A 2DD4A 2PQWA 2GNCA 4OMQA 5M9OA 2CZ0B 4OVAA 4AMCA 2KYMA 2JS2A 1Y57A 4M7AD 4RTVA 5DLOA 2C0TA 4CRIA 4M78C 1UJYA 2XIDA 4M7AG 3H0HA 3S3OA 2H3EB 5GANd 2CZ1B 2LT4A 2RNAA 2HL5C 2R5AA 3VYGA 2CP3A 4LUDA 1VQOQ 4M77F 3OYBA 2JVVA 2K4YA 3U23A 4PJJA 1SEMA 4M77B 3NPFA 2K3BA 1W2BA 2YUQA 3JB9H 1UTIA 3X20B 1QMCA 2BTTA 4J6WA 1ZA1B 3EFRA 3CXCS 1K4US 2KY9A 3FJPA 4QVDA 1B7TA 1YIJQ 1X6OA 2RQTA 2XDPA 1BCOA 1P92A 2X3XD 2KGTA 2X3WD 4J5YA 4E2FB 1CKBA 2HKQB 1BK2A 3HRTA 1N8RR 2L5QA 1N8RU 2MAMA 2ZCFB 1RUWA 3CXCP 4DBRA 4PJOA 1K1ZA 4Y91A 4XU1A 3DB4A 5GAN4 1LPLA 1RI9A 2M9UA 1NM7A 1PHTA 1SSHA 4PJMA 1YCYA 4JUVA 1D0XA 5GAMj 4BY6C 3G6EQ 2MYSA 1H3HA 5HKCA 1WXUA 1Q82C 2CGHA 3HKSA 3CC7Q 4LNPA 5DLQE 1B3QA 2NWMA 1WLPB 3T9NA 2G3RA 2LNHB 2Y4XA 3IQLA 4KH0B 1UHCA 1G3SA 1DJ7B 2OI3A 2RO0A 2RK2A 4J9EA 2F69A 3FDRA 1GBQA 2HZYA 3GIBA 3JCMh 1RLPC 2DA9A 2PVOB 2KNBB 2C0IA 2KXDA 1UJ0A 1KC8R 1OZ2A 1KC8U 1FMKA 2JOYA 2X4XA 1B34B 2OAUA 4J9CA 4JDSA 3CCUT 1VQ4A 3CCLA 2HMAA 1GFDA 1WGSA 1EX4A 5L23A 2EQKA 4L59A 4VUBA 3DLLA 3CMEQ 2VASA 1IB8A 2O31A 2OTLA 2J6KA 1D1BA 1VQ8T 3CC2A 4MMLA 1MMNA 1M2VB 3EGXA 4IUTA 2VGMA 2ZPIB 3CCVA 1WX6A 3G4ST 2IPOB 3V8LA 3PFSA 1QVPA 3FLGA 3RBBB 1X27A 3BFMA 2XDDA 3M53A 2D0NA 1S1NA 2MPXC 4BACA 4C92F 3EFSA 4HCBA 1ZUKA 2EGEA 4HKEA 3MP6A 5GAN2 4C92B 4M7DD 3GLXA 2VC8A 1XNIA 3HPWA 4ZN1A 1ABQA 1Y71A 4M7DG 2X4YA 1PSEA 3PT9A 5IHNA 3O5ZA 4M78E 1JEGA 3CC4T 5FROA 2HSPA 2K6DA 2O88A 4J8OA 3P8BB 2DL7A 4AFQC 4C0ZA 3KFVA 2O9SA 3OY9A 4RG8A 1BB9A 1VQOA 1K8AR 4HT9A 5KYWB 1K8AU 2CZ7B 3OYLA 5CCAA 3OYAA 4FM4B 2NUZA 3CCJT 5GANe 4C8QF 2Y4YA 3M57A 2DJQA 2BZYA 2M0OA 1YJWA 4C8QB 4M75C 4JLIA 2KT8A 4QQ6A 1KIKA 2LJ3A 3OYDA 2VKNA 1TOVA 2DKGA 4OB3B 3LLRA 1AWXA 5LJ3g 3C0CA 2EAYA 4EMKB 3QJ6A 4J83A 1WNLA 2AHJB 2MI6A 4RUGA 3FRNA 2MWOA 4M7AA 2M16A 2CT3A 3NGPA 1OQKA 2JN0A 2MWPA 2HDAA 1C1AA 5KYXB 3SWNC 1UECA 1PWTA 4NS5A 2HBPA 1RAGB 5FWCA 1I5OB 2MF2A 4E7LA 4JRKA 1UDLA 5D6WA 4F7UF 1W70A 3KXTA 1AWOA 1B34A 4E47A 3OS2A 2PTKA 4F7UB 1GCQC 4FCYA 4RTUA 1VQ8A 1VQPT 1ZBXA 3QHSA 4OGEA 2E1HA 5LJ3f 1M1KC 3E19A 5KYNA 3AHUA 1VQ5T 3G4SA 4RTTA 3NTIA 1V29B 1YITT 2DEQA 3HFNA 2E41A 3REAB 3JB9D 1NE8A 1TUCA 4LUEA 3CD6T 1D0ZA 3JB9G 1VYTA 2ZGWA 4FT4A 1AHJB 2D1XA 1QCOA 1D0YA 1Y0MA 2O4XB 3OS5A 2OAWA 2K3YA 4RTXA 3SHWA 2D0QB 1I07A 4GLMA 2EJGA 2PU9B 5I22A 5GAMd 3L2ZA 3CC4A 4QVZA 2EKHA 4BUGA 3HHTB 1AT1B 3QSUA 3HL8A 2DTOA 3M58A 2KEAA 1KHCA 3CCMT 2HAXA 2KE9A 1VQ6Q 1M9SA 2DTHA 2RHXA 3CCET 1E6HA 5KYWA 3CCJA 1XOVA 1TU0B 2EQJA 2DM1A 1VQNT 1VYVA 2RK1A 3MHXA 4LD6A 2LMJA 4EPCA 1IHVA 2HQHA 5LJ5e 5KYUA 1T3LA 2CH4W 1R0BG 1WJRA 2I2LA 2O9VA 5CR2A 1RAFB 4M78D 3HTRA 3OMGA 3S6WA 5I2MA 3M5AA 4XU0A 4M78G 3PMTA 1XQHA 2FPFA 1AWWA 4M75E 4J7IA 1V76A 2EGAA 3VRZA 4F14A 2YT6A 1SRLA 1N27A 2E65A 1MMAA 3QDRB 5ECAA 4BE2A 2QK0A 1JQQA 2K79A 1MV3A 4RMOA 4BB7A 3G7ZA 1I0CA 3F70A 1I81A 5KYXA 4M7DA 1LCKA 4XTUA 4J7FA 1N9RA 4BE1A 4R55A 2QAZA 2DVJA 4AG1C 4WTOB 3RESA 5CO7A 2FPDA 4D6WA 3CCQT 4GBQA 2GF7A 1H3ZA 2VYTA 4MMKA 3C4SA 5CKDA 2YRDA 2C0OA 2ZAEA 1X75C 3PGGA 3JCMQ 1VQPA 2DMOA 4Y28E 2EQMA 1VUBA
chains in the Genus database with same CATH topology
3CXCP 1YJ9Q 1YJWQ 3CCUQ 1VQPQ 1K8AR 3CC2Q 1K9MR 3CCSQ 3CCQQ 1W2BP 3CCJQ 1Q82R 1S72Q 3G71Q 3CPWP 3CCMQ 3CCVQ 3CMAQ 2QA4Q 1Q86R 1YIJQ 1VQKQ 1QVFP 1KD1R 3CC4Q 3I56Q 1VQOQ 1VQ5Q 2QEXQ 1KQSP 3CMEQ 1JJ2P 1VQ4Q 3G6EQ 1YITQ 1Q7YR 2OTJQ 3CCLQ 1YJNQ 1NJIR 1VQ8Q 3CCEQ 1VQLQ 1VQ9Q 1VQ6Q 3CC7Q 3CCRQ 1VQ7Q 1VQMQ 1Q81R 1M90R 1VQNQ 3OW2P 1QVGP 1K73R 1YHQQ 1N8RR 3I55Q 2OTLQ 1M1KR 3CD6Q 3G4SQ 1KC8R 1YI2Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC P;  1YJ9 Q;  1YJW Q;  3CCU Q;  1VQP Q;  1K8A R;  3CC2 Q;  1K9M R;  3CCS Q;  3CCQ Q;  1W2B P;  3CCJ Q;  1Q82 R;  1S72 Q;  3G71 Q;  3CPW P;  3CCM Q;  3CCV Q;  3CMA Q;  2QA4 Q;  1Q86 R;  1YIJ Q;  1VQK Q;  1QVF P;  1KD1 R;  3CC4 Q;  3I56 Q;  1VQO Q;  1VQ5 Q;  2QEX Q;  1KQS P;  3CME Q;  1JJ2 P;  1VQ4 Q;  3G6E Q;  1YIT Q;  1Q7Y R;  2OTJ Q;  3CCL Q;  1YJN Q;  1NJI R;  1VQ8 Q;  3CCE Q;  1VQL Q;  1VQ9 Q;  1VQ6 Q;  3CC7 Q;  3CCR Q;  1VQ7 Q;  1VQM Q;  1Q81 R;  1M90 R;  1VQN Q;  3OW2 P;  1QVG P;  1K73 R;  1YHQ Q;  1N8R R;  3I55 Q;  2OTL Q;  1M1K R;  3CD6 Q;  3G4S Q;  1KC8 R;  1YI2 Q; 
#chains in the Genus database with same CATH topology
 3PIP A;  3VS0 A;  2ECZ A;  3KUF A;  1YIT A;  4PFP A;  3JCM J;  3PVQ A;  2RHY A;  4X9D A;  1I5L A;  3JAM E;  2CYZ B;  3I56 T;  3I5R A;  2JJ9 A;  3CD6 A;  2ABL A;  1YN8 A;  4KGZ B;  3QWX X;  4CC7 A;  4AFZ C;  3L2V A;  1JU5 C;  3NFC A;  6AT1 B;  1Y7X A;  3X28 B;  4LDX A;  3JCM c;  1WA7 A;  5FRM A;  1TUG B;  3L2Q A;  2JTF A;  1WZO A;  4PJO F;  2IVW A;  4JZ3 A;  1N8R C;  3BE3 A;  2J7I A;  3CPW S;  4PJO B;  4ZN3 A;  1IZ6 A;  1NJI R;  2E10 A;  1NJI U;  3JSC A;  5LJ5 j;  4F17 A;  1YJN T;  1XTD A;  1K73 R;  4RTY A;  4DOW A;  1K73 U;  2JMA A;  1FX7 A;  3NTK A;  1QVF A;  1LNX A;  1WIE A;  3LH5 A;  3M4Y A;  5LJ3 j;  2DFU A;  4IKF A;  2VB6 A;  4HCZ A;  4PLI A;  3S3M A;  3CPW P;  2XK0 A;  3MJX A;  2GTJ A;  1VQK T;  1VQN A;  1VQ4 Q;  2JNG A;  4XAX B;  4JJB A;  2JUF A;  3CCL Q;  2R58 A;  1GCP A;  5GAO l;  1YWP A;  4C8Q E;  4Z89 A;  3CPF A;  3LH0 A;  1HSQ A;  1VQ9 T;  1X6B A;  2OTL Q;  3BDU A;  3WVE B;  2EGC A;  2P0K A;  3OYE A;  1NG2 A;  3DKM A;  2BE7 D;  4M77 D;  3CC2 Q;  1JJ2 A;  4BI8 B;  5C6S A;  4BI4 A;  2E12 A;  5GAM e;  3THK A;  4II1 A;  3GOX A;  1KC8 C;  1NYF A;  1M2O A;  1O75 A;  1YHQ A;  3I55 A;  4OB1 B;  3QYG B;  2QEX T;  2WSF E;  1M8M A;  3WXM B;  2J6F A;  1Y96 A;  5CKE A;  1BI3 A;  1KSW A;  5CK9 A;  2XI9 A;  3SDZ A;  3QII A;  5KYY A;  5FU6 B;  2VV5 A;  1YJ9 T;  3EGX B;  1W6X A;  2FVU A;  4ELZ C;  4QKU A;  3V7S A;  3G71 T;  3MET A;  4TVR A;  3CBM A;  3CMA T;  5FLX E;  2R5M A;  1OOT A;  1U3O A;  1WJQ A;  2RD1 A;  2F2X A;  1F1B B;  2L3P A;  1VQL T;  2EYW A;  3CCQ A;  3VS1 A;  2ZPE B;  3GPL A;  1VQ7 T;  2CUD A;  2KYB A;  1K9M R;  1K9M U;  4N0A C;  9ATC B;  4A63 B;  2P84 A;  3JCM W;  1KD1 R;  1T0H A;  4LDU A;  3RNJ A;  3MCA B;  4A4F A;  1KD1 U;  2DLP A;  2FB7 A;  3M0T A;  1RAB B;  1UGP B;  2F5K A;  1O9S A;  2A0F B;  2SRC A;  2E3I A;  2JM8 A;  1MHN A;  3TQ7 P;  4C0G A;  2OTJ T;  2HQE A;  4M75 D;  2WSE E;  2OJ2 A;  4JRQ A;  3R6N A;  4M75 G;  2E3H A;  3I56 A;  1YJW Q;  4DEX A;  4Z88 A;  3L2R A;  4PFZ A;  2QQB A;  1SF9 A;  4IUR A;  1R8O B;  2KK4 A;  4DBQ A;  3LX7 A;  2XIC A;  4HA8 A;  4PNO A;  1QVG A;  2EFI A;  1K8A C;  2EIF A;  1M3C A;  2MMP A;  4PFO A;  3EGD A;  2SEM A;  5FU7 B;  3WVD B;  4M4Z A;  1TH7 A;  4OP0 A;  3JCM e;  4M78 A;  3V8J A;  1U5S A;  3NMZ C;  1QP2 A;  2NYS A;  2K7A A;  3LYI A;  3J80 E;  1YJN A;  5AYF A;  4E6R A;  1W2B S;  5KH6 A;  2M51 A;  1ZUY A;  4A4H A;  4J9I A;  1CSK A;  1C6V X;  3OS1 A;  4KUI A;  2CP2 A;  1W1F A;  2A36 A;  2L89 A;  2QG9 B;  4AFS C;  2QDY B;  2L3S A;  2HSE B;  3SD4 A;  2IG0 A;  1AOJ A;  2W10 A;  1UE9 A;  4M7A F;  2DEU A;  2ESW A;  2VXF A;  2DXB A;  1W2B P;  4F04 B;  4M7A B;  3UDC A;  1VQ9 A;  1HYO A;  1PM3 A;  1JXM A;  4FW1 A;  5GMK m;  1QCF A;  1VQ8 Q;  4ZGJ B;  1RAH B;  2HD0 A;  1PCX A;  2A37 A;  3JCM P;  1ZSZ C;  1G8X A;  1MGQ A;  3A8L B;  1J3T A;  3CCR T;  4A4K A;  3G4S Q;  3QJY A;  2E5Q A;  1G83 A;  2QEX A;  3OBY A;  3PNW C;  1Q95 G;  3EG2 A;  2GCX A;  2HCK A;  2XG8 D;  1GFC A;  3EHQ A;  1PD1 A;  2DXT A;  3OMC A;  3MO8 A;  3CEY A;  1YJ9 A;  2QGG A;  2KR3 A;  4Z02 A;  5I11 A;  3CC7 T;  2QXF A;  4QT7 A;  3GBQ A;  3CMA A;  4ZTF A;  3PTA A;  2RB6 A;  4C8Q D;  2F2V A;  4M77 C;  3FC3 A;  1VQL A;  3RKX A;  1NBE B;  1KQ1 A;  2DL5 A;  3CC4 Q;  1VQ7 A;  1GRI A;  2WSC E;  4A4G A;  3M0S A;  1SSF A;  4OB2 B;  4LN2 A;  2LQK A;  1VQM T;  2XDB A;  3URG A;  2D8J A;  2V8J A;  2KBT A;  5LJ5 d;  1M30 A;  2OTJ A;  3OB9 A;  3CCJ Q;  4KRT A;  4MZT A;  1ACM B;  5FW9 A;  1GXI E;  2LJ1 A;  1MMD A;  1UUE A;  1RAD B;  1C0M A;  5LJ3 d;  2YXY A;  3BY7 A;  2FRW A;  2BUD A;  2GGR A;  1UB4 A;  1XJW B;  3QZ9 B;  2YWW A;  4PJL A;  5GMK h;  4RG2 A;  2AK5 A;  2FHD A;  4DEY A;  2JMC A;  2FEI A;  1PNJ A;  1KFZ A;  3PE0 A;  2KVQ G;  2LQ8 A;  3LGL A;  3C12 A;  2RQR A;  3SEM A;  4D8K A;  2RA2 A;  3OYF A;  1M1F A;  5KYU B;  3H0I A;  2RJE A;  4KUL A;  2O01 E;  2P0Q A;  3OS0 A;  5D6Y A;  1U1S A;  2M02 A;  2D9T A;  1K76 A;  3OYG A;  3EGU A;  5CAI A;  5KCO A;  2LC4 A;  1FMW A;  3SB2 A;  2DL4 A;  4BD3 A;  1JRI A;  2EBP A;  2FG0 A;  1PD0 A;  1YWO A;  5A0D A;  5CIU A;  4RCB A;  2DZC A;  2NUT A;  1VQP Q;  4X9C A;  3A8O B;  4M7D F;  2ENM A;  2YHT A;  4UC4 A;  2HEQ A;  3RR6 A;  1OX8 A;  5GMK j;  4QW2 A;  3CCS T;  3CBO A;  4M7D B;  4MDW A;  3CCR A;  1YIT Q;  2YDL A;  2K3X A;  3CCU A;  1M27 C;  4IUQ A;  5D6X A;  1M5Q 1;  3M0R A;  4M75 A;  3CD6 Q;  4JRP A;  1I1J A;  5GAN h;  1E6G A;  3A5Z B;  1KQS A;  1JO8 A;  2COW A;  1YI2 T;  3VS4 A;  2QQR A;  4C92 C;  2HKN A;  1Q7Y R;  3J7A F;  1Q7Y U;  4C5I A;  1BCM A;  3ULR B;  1FWZ A;  2E4H A;  2NUP B;  3RIR A;  2DZ9 A;  1BIB A;  3I9Q A;  2EPD A;  1WPY A;  2CSQ A;  1OI1 A;  3ZEH A;  2RJF A;  5HK0 A;  3CCM Q;  1M3B A;  1A0N B;  2Y90 A;  3JCM V;  3OYM A;  1VQM A;  1SG5 A;  2JTM A;  3MP8 A;  3CCE Q;  4OML A;  4M77 E;  2KRM A;  5J3B A;  1RAA B;  1VQN Q;  3EFO A;  1PKT A;  1ZUU A;  4XTV A;  1NJI C;  5KE3 A;  3RKY A;  1OYX A;  1WHG A;  1GCQ A;  1K73 C;  1TSF A;  4C8Q C;  1RAI B;  1WHL A;  1KJW A;  1S72 T;  4IUP A;  3QBY A;  1ARK A;  2G6F X;  5GAO q;  5FRN A;  1QW1 A;  1WHH A;  2LTO A;  1UEB A;  4PJN A;  1YHQ Q;  3I55 Q;  3FJ5 A;  3N5B B;  2DD5 A;  5J39 A;  1FXX A;  3QKJ A;  1TG0 A;  2XKO C;  1G5V A;  1AD5 A;  2X51 A;  4EMK C;  3HSB A;  1EIF A;  3E2U A;  2XD0 A;  1RL2 A;  4Y92 A;  3UF4 A;  4XTY A;  2BKD N;  4GY5 A;  2PVG B;  2FRY A;  2EQU A;  1ZHI A;  5DM7 R;  3H41 A;  3REB B;  4OMM A;  2KMT A;  2YRV A;  3X26 B;  3BDL A;  2LP5 A;  3OYI A;  2K9G A;  4EMG A;  1Q81 R;  2JW4 A;  5FWB A;  2CT4 A;  2X4W A;  1Q81 U;  3NTH A;  5LJ3 e;  2Z0W A;  3JB9 J;  3ZFJ A;  3A8H B;  1Y96 B;  3CCQ Q;  3JB9 F;  1K0X A;  1QLY A;  3HRS A;  3EHR A;  3ME9 A;  3JRZ A;  1SRM A;  2V1R A;  3M54 A;  1NEB A;  4OMO A;  5KYY B;  1HK9 A;  2KSS A;  5GAN 5;  4KH1 B;  4L6V 5;  3RDV A;  2FO0 A;  4ZNX A;  2ED0 A;  2EYQ A;  3VUB A;  3CCS A;  4K11 A;  2ROL A;  2COY A;  3FB9 A;  2DO3 A;  1IRX A;  2P4T A;  3OYC A;  2DRM A;  8ATC B;  3VUZ A;  3PMI A;  2K5F A;  2DE0 X;  3I56 Q;  3NHN A;  1QWF A;  4XTZ A;  2DX1 A;  1K9M C;  5CKH A;  4R0K A;  1T0J A;  2ED1 A;  5I2S A;  3JCM d;  1EZZ B;  4Q5W A;  4ATO A;  3VS5 A;  4C0D B;  2L2P A;  1KD1 C;  4DA4 A;  3QDF A;  2LVM A;  1VQ5 A;  1BI2 A;  2KDS A;  2BZX A;  2K5L A;  1G3W A;  1RAC B;  2DF6 A;  5HY6 A;  2GQI A;  5CQX A;  4ELY C;  3M0U A;  2L3Q A;  2NUP A;  2LX7 A;  1YJN Q;  2ZPH B;  2VUB A;  4ZTJ A;  1IHW A;  1PRM C;  4RKU E;  5HCK A;  2KAF A;  4FIB A;  5KE2 A;  3RMS A;  5HK3 A;  2L3R A;  3FEO A;  1R77 A;  4C92 E;  3TSZ A;  3UA6 A;  4E7H A;  4ANJ A;  3OQ5 A;  4KGV B;  4M78 F;  2CDT A;  2QQ9 A;  3EGD B;  1KG1 A;  1H92 A;  4E7K A;  1D1C A;  5GAO n;  4M78 B;  2CS7 A;  3QWY A;  4XTX A;  4O6J A;  1QKW A;  2QA4 T;  1BU1 A;  3VV0 A;  3OW2 A;  1AVZ C;  1G3T A;  5GAO p;  4A4E A;  1VQ9 Q;  4QQD A;  2DIQ A;  4XQ3 A;  3PIO A;  3OYJ A;  1S72 A;  2DYI A;  2COZ A;  2PNI A;  3CCM A;  3A8G B;  3JV3 A;  1ZSG A;  2FZG B;  1BI0 A;  2AZS A;  2HL3 A;  2E64 A;  2L8D A;  3CCE A;  2QEX Q;  1BKB A;  1BI1 A;  2YUN A;  1AZG B;  2YUP A;  2FZC B;  3RMQ A;  2DBM A;  1ZLM A;  3LW5 E;  1D1A A;  2EWN A;  4FYX B;  4E7Z A;  1AEY A;  1TUD A;  1WDX A;  3RKW A;  3EG1 A;  2FPE A;  1YJ9 Q;  1N6A A;  1GL5 A;  2DK3 A;  1TWB A;  2B86 A;  2VXE A;  2JXB A;  3CMA Q;  2V1Q A;  4R56 A;  4M77 G;  1QVF S;  4EIK A;  5A0L A;  4XTW A;  1UG1 A;  2MOX A;  2LX9 A;  3QYH B;  1VQL Q;  2JM9 A;  3ZBD A;  2YLC A;  3E1S A;  1AZE A;  1VQ7 Q;  5GAN 6;  2KRS A;  1NEG A;  4MZM A;  1NLO C;  4BY6 B;  1UHF A;  3OYH A;  2XU8 A;  1W4S A;  1M1G A;  1QVF P;  1UGS B;  2VWF A;  4ZGE B;  4FYV B;  2E70 A;  1U1T A;  2OTJ Q;  4OF1 A;  1JJ2 S;  3TEE A;  3RER A;  5A2Q E;  1M8V A;  3VU3 C;  2KQW A;  2K2M A;  3M9Q A;  5IT9 E;  1JXO A;  5D7U A;  2QI2 A;  4FSX A;  4A54 A;  4F7U E;  5IXB A;  1PG5 B;  2BE9 B;  3TVT A;  2GFA A;  3CC2 T;  1TS9 A;  1M4Z A;  3CCV T;  1JJ2 P;  4KBM B;  3TU4 K;  1PRL C;  2O2O A;  2MCN A;  4KT0 E;  2LDM A;  3CXC A;  4WF2 A;  1NZ9 A;  2RI5 A;  3C95 A;  3VS2 A;  2P0P A;  1OEB A;  1M90 R;  2E6Z A;  1M90 U;  1MUZ A;  2HNI A;  3M55 A;  4JJN K;  4PJO C;  5GAM h;  1SPK A;  3Q1J A;  2A08 A;  1OU8 A;  2DAQ A;  3H6Z A;  1BIA A;  4J6X A;  4AT1 B;  1QQJ A;  1Q86 R;  3DLM A;  4NL2 A;  1Q86 U;  3MKD A;  2V8I A;  1EFN A;  2LJ0 A;  2A28 A;  2RHU A;  2RI2 A;  2FL7 A;  2LRQ A;  3O8V A;  4XK8 E;  1JBM A;  1IRE B;  2DBK A;  2QTX A;  2YUO A;  2ZPB B;  3L2W A;  4PLL A;  1QKX A;  2QA4 A;  1T3S A;  2CP7 A;  1OUL A;  2JZ2 A;  2EKO A;  2YSQ A;  5IAY A;  2J05 A;  2X4J A;  1JB0 E;  1PSF A;  4N0A A;  4LDW A;  3S3N A;  1D3B A;  1N9S A;  2V8K A;  4FU6 A;  1VQO T;  3MEA A;  4P5N A;  2ATC B;  3CCR Q;  1WHM A;  2EYY A;  4JRI A;  4CC4 B;  4V2S A;  4FL6 A;  5DY9 A;  2LCS A;  1VQK A;  1V1C A;  1QVG S;  3UA7 A;  3FIF A;  2DYB A;  2OX7 A;  3CCU Q;  4C5E A;  5GAN g;  3JCM b;  5IHI A;  1D09 B;  1YJW T;  1NLP C;  1SHG A;  4C92 D;  5I21 A;  3MEW A;  1OPL A;  5GAN 3;  2NUT B;  1B07 A;  2VGN A;  1YIJ T;  4C92 G;  2K5I A;  1H8K A;  2A3L A;  4JLG A;  3JB9 I;  2NLU A;  4FT2 A;  5FU6 C;  4AFU C;  1QVG P;  2HBW A;  4M75 F;  2RHI A;  4FYW B;  1WXT A;  4M75 B;  3GP8 A;  3EG3 A;  4OMN A;  5GAO r;  5GMK i;  1VYU A;  3OSS C;  1MNE A;  4PK4 A;  3G6E T;  2QQA A;  1FMV A;  2MK5 A;  2EVR A;  5LL6 S;  5IHK A;  1VQM Q;  1OZ3 A;  2RI3 A;  4N4H A;  8AT1 B;  3G71 A;  5GAN f;  1WJS A;  1Q7Y C;  3QXE B;  3ER0 A;  4KUD K;  2B8A A;  2D6F A;  5GMK e;  1ZA2 B;  3A8M B;  2F5T X;  4HVU A;  2AKL A;  2CKK A;  4C8Q G;  2EW3 A;  4FYY B;  3LWI A;  4X34 A;  1OPK A;  5CQY A;  4A53 A;  5IH2 A;  1N5Z A;  1WFW A;  2RJD A;  1HXD A;  4ORZ A;  3SWN B;  1ZSZ A;  2XHC A;  1QP3 A;  4DOV A;  2DL3 A;  4IIM A;  3A98 A;  3EAE A;  2X9H A;  3M0P A;  2GTO A;  4KGX B;  3H8Z A;  3OA6 A;  3EFO B;  1PKS A;  4J9B A;  1VOM A;  3TRE A;  5FU7 C;  4OMF B;  3I5S A;  3GNF B;  3EG0 A;  2KRN A;  3CME T;  2QGF B;  4ZGD B;  3ASK A;  2X35 A;  4IUU A;  1TXQ A;  2C06 A;  2DIG A;  2YRC A;  2CP0 A;  2BZ8 A;  3UWN A;  2RHZ A;  1LOJ A;  1X01 A;  1H64 1;  4M77 A;  3CQT A;  2E5K A;  4PJO E;  4JZ4 A;  2RN8 A;  4BI3 A;  2DET A;  1X2Q A;  2LCL A;  3INZ A;  4F7U G;  3M59 A;  3HRU A;  4M7A C;  2RF0 A;  3VS7 A;  3EH2 A;  5GAN 7;  2ZPG B;  2XMF A;  1I8F A;  3CCS Q;  1Q81 C;  3H0F A;  4LXC A;  3LWH A;  3P8D A;  1IO6 A;  3HP9 A;  2RQV A;  1WXB A;  4O5V A;  5IXF A;  3MEU A;  3OYK A;  1YIJ A;  1YI2 Q;  4CC3 A;  5L8R E;  4J9D A;  2EQI A;  3MPU B;  5LJ5 g;  4JPB W;  2CP6 A;  1Q82 R;  4LE9 A;  1Q82 U;  2GQV A;  2CRE A;  3ZL7 C;  1VQ5 Q;  4XU2 A;  3X24 B;  1ZQ1 A;  2L0A A;  3JCM X;  4HCC A;  2QDL A;  1NPR A;  4BDY A;  4FW2 A;  2E6N A;  2DRK A;  1WI7 A;  2GBQ A;  2LT1 A;  2AIR B;  4JS5 A;  2BIV A;  2AT1 B;  2M1H A;  2DXU A;  4B9X A;  4N4G A;  3G6E A;  4XU3 A;  4LDV A;  4NOY A;  1U8R A;  1X69 A;  2H8H A;  3OYN A;  3CC7 A;  3V7C A;  1SKU B;  2JT4 A;  4WCI A;  1ZX6 A;  2FZK B;  5GMK l;  4JJC A;  2P4R A;  3L42 A;  1MND A;  2W0Z A;  5LJ5 f;  3E9G A;  2EJ9 A;  2DIL A;  1R0C B;  1S72 Q;  3C94 A;  2YLB A;  3KBG A;  1BYM A;  4E7S A;  1M2V A;  3SWN A;  3L2U A;  4BDZ A;  1KQS S;  2QYZ A;  1LJO A;  3EG9 B;  2CZ6 B;  4C0F A;  2CSI A;  1OV3 A;  3CME A;  4OGC A;  4Z8A A;  1WQ7 A;  2KI7 A;  3VJP A;  1KHI A;  3VS6 A;  2PVD B;  4D8D A;  2LQN A;  4N4I A;  4C92 A;  1KQS P;  3GNG A;  3M4G A;  2RQW A;  3VS3 A;  5GAO m;  5GAN j;  3A1P A;  4RTZ A;  3E9F A;  4QQG A;  2AKK A;  1WHK A;  1U06 A;  1AWJ A;  4LDY A;  4PL6 A;  1WYX A;  3DB3 A;  2A7Y A;  4LD9 K;  1YNZ A;  1K9A A;  4J9H A;  1OX9 A;  2DVE A;  1Y07 A;  2EJF A;  2KT1 A;  1CKA A;  5KCH A;  2JTE A;  2ROT A;  3RUX A;  1KQ2 A;  4MZP A;  2H3J A;  3V8K A;  2HQX A;  5GJW B;  2DER A;  4OB0 B;  4BE0 A;  4QVC A;  1X2K A;  1HJD A;  4HCK A;  4M7D C;  4EMH A;  1UFF A;  3PVL A;  3EH1 A;  1YCS B;  3R6O A;  3M56 A;  1VA7 A;  4M7A E;  1KK7 A;  4J9G A;  4C8Q A;  2KRO A;  2LNV A;  2CUB A;  3QO3 A;  5CVI A;  1QCN A;  3OYY A;  4RTW A;  4DQ2 A;  2V26 A;  2LCC A;  4PJO D;  1VQ6 T;  2PUK B;  3QPH A;  5GAM g;  3UPU A;  1YHQ T;  3I55 T;  2KXC A;  3UAT A;  4PJO G;  4RCC A;  1IGQ A;  1NPP A;  4EMK A;  2CP5 A;  5J26 A;  2F1L A;  3LGF A;  2EYZ A;  1SHF A;  3D7S B;  1BBZ A;  1UGQ B;  2CH4 A;  1YFN A;  3OBW A;  3OSV A;  3V7R A;  1FYN A;  4MDX A;  3QUI A;  1YI2 A;  4OMP A;  4E7I A;  3AT1 B;  2RQU A;  1HD3 A;  3I35 A;  1YBY A;  5LJ5 h;  2DL8 A;  2I0N A;  1LVK A;  1M90 C;  2R57 A;  2IIM A;  3QG1 A;  2QA4 Q;  2ZPF B;  2WAC A;  4JS4 A;  5LJ3 h;  2RMO A;  4L5G A;  2DTI A;  4NL3 A;  4F7U A;  1Q86 C;  5C0M A;  5GAM f;  1I4K 1;  4IIO A;  3CPW A;  1M1K R;  1M3A A;  1UGR B;  3VKI A;  1M1K U;  4ESR A;  1IXD A;  7AT1 B;  2RH2 A;  3VRY A;  3X25 B;  4CI0 C;  1VQK Q;  4C5G A;  1TTH B;  1X43 A;  2D8H A;  2ZZD A;  2MIO A;  2JS0 A;  4HT8 A;  3EG9 A;  4J9F A;  3GF5 A;  4B6M A;  1VIF A;  1RI0 A;  2QTV A;  3BW1 A;  2PUO B;  3CBP A;  1Z9Q A;  1NYG A;  3VYH B;  1D3B B;  3HFO A;  1OU9 A;  1GBR A;  4DBF A;  1UGV A;  2RJC A;  2O4X A;  2LZ6 B;  2F2W A;  4J6Y A;  4E7J A;  4YTL A;  2M0Y A;  3M0Q A;  3TSW A;  1MMG A;  1PC0 A;  1VIE A;  2DXC A;  3JCM g;  4PKC C;  2LQW A;  5A0G A;  1ZBJ A;  5EG2 A;  3OW2 S;  4HVV A;  4GLK A;  2DJZ A;  1YP5 A;  2K2V A;  2J06 A;  5IN1 A;  2RM4 A;  3G71 Q;  2GFU A;  1ABO A;  4FSS A;  2DNU A;  2QAS A;  2QQS A;  1RAE B;  3H9N A;  5CKB A;  1QWE A;  1RLQ C;  4IUV A;  1X6G A;  5CKF A;  4X1V A;  1E7O A;  2FYK A;  1K0S A;  3G1J A;  3MEV A;  3MP1 A;  1Z9Z A;  3OW2 P;  3L1A A;  1WQW A;  3SFM A;  4AG2 C;  4B9W A;  4EDU A;  4HXJ A;  2DPP B;  3J81 E;  4CC2 A;  3P8H A;  3CCV Q;  1IGU A;  1MV0 B;  4DBH A;  5GJV B;  4C0D C;  1VQ6 A;  3JCM f;  4M7D E;  5AT1 B;  2J6O A;  4ME7 A;  1VQ4 T;  3CCL T;  3TCJ A;  2RPN A;  4HVW A;  5GAN 8;  2VVK A;  3QZ5 B;  2OTL T;  1G3Y A;  4F16 A;  2K57 A;  3UT1 A;  1ZSZ B;  1G2B A;  1WHJ A;  4JJD A;  2PZ1 A;  4C5H A;  2EYX A;  2AZV A;  5EC7 A;  2DD4 A;  2PQW A;  2GNC A;  4OMQ A;  5M9O A;  2CZ0 B;  4OVA A;  4AMC A;  2KYM A;  2JS2 A;  1Y57 A;  4M7A D;  4RTV A;  5DLO A;  2C0T A;  4CRI A;  4M78 C;  1UJY A;  2XID A;  4M7A G;  3H0H A;  3S3O A;  2H3E B;  5GAN d;  2CZ1 B;  2LT4 A;  2RNA A;  2HL5 C;  2R5A A;  3VYG A;  2CP3 A;  4LUD A;  1VQO Q;  4M77 F;  3OYB A;  2JVV A;  2K4Y A;  3U23 A;  4PJJ A;  1SEM A;  4M77 B;  3NPF A;  2K3B A;  1W2B A;  2YUQ A;  3JB9 H;  1UTI A;  3X20 B;  1QMC A;  2BTT A;  4J6W A;  1ZA1 B;  3EFR A;  3CXC S;  1K4U S;  2KY9 A;  3FJP A;  4QVD A;  1B7T A;  1YIJ Q;  1X6O A;  2RQT A;  2XDP A;  1BCO A;  1P92 A;  2X3X D;  2KGT A;  2X3W D;  4J5Y A;  4E2F B;  1CKB A;  2HKQ B;  1BK2 A;  3HRT A;  1N8R R;  2L5Q A;  1N8R U;  2MAM A;  2ZCF B;  1RUW A;  3CXC P;  4DBR A;  4PJO A;  1K1Z A;  4Y91 A;  4XU1 A;  3DB4 A;  5GAN 4;  1LPL A;  1RI9 A;  2M9U A;  1NM7 A;  1PHT A;  1SSH A;  4PJM A;  1YCY A;  4JUV A;  1D0X A;  5GAM j;  4BY6 C;  3G6E Q;  2MYS A;  1H3H A;  5HKC A;  1WXU A;  1Q82 C;  2CGH A;  3HKS A;  3CC7 Q;  4LNP A;  5DLQ E;  1B3Q A;  2NWM A;  1WLP B;  3T9N A;  2G3R A;  2LNH B;  2Y4X A;  3IQL A;  4KH0 B;  1UHC A;  1G3S A;  1DJ7 B;  2OI3 A;  2RO0 A;  2RK2 A;  4J9E A;  2F69 A;  3FDR A;  1GBQ A;  2HZY A;  3GIB A;  3JCM h;  1RLP C;  2DA9 A;  2PVO B;  2KNB B;  2C0I A;  2KXD A;  1UJ0 A;  1KC8 R;  1OZ2 A;  1KC8 U;  1FMK A;  2JOY A;  2X4X A;  1B34 B;  2OAU A;  4J9C A;  4JDS A;  3CCU T;  1VQ4 A;  3CCL A;  2HMA A;  1GFD A;  1WGS A;  1EX4 A;  5L23 A;  2EQK A;  4L59 A;  4VUB A;  3DLL A;  3CME Q;  2VAS A;  1IB8 A;  2O31 A;  2OTL A;  2J6K A;  1D1B A;  1VQ8 T;  3CC2 A;  4MML A;  1MMN A;  1M2V B;  3EGX A;  4IUT A;  2VGM A;  2ZPI B;  3CCV A;  1WX6 A;  3G4S T;  2IPO B;  3V8L A;  3PFS A;  1QVP A;  3FLG A;  3RBB B;  1X27 A;  3BFM A;  2XDD A;  3M53 A;  2D0N A;  1S1N A;  2MPX C;  4BAC A;  4C92 F;  3EFS A;  4HCB A;  1ZUK A;  2EGE A;  4HKE A;  3MP6 A;  5GAN 2;  4C92 B;  4M7D D;  3GLX A;  2VC8 A;  1XNI A;  3HPW A;  4ZN1 A;  1ABQ A;  1Y71 A;  4M7D G;  2X4Y A;  1PSE A;  3PT9 A;  5IHN A;  3O5Z A;  4M78 E;  1JEG A;  3CC4 T;  5FRO A;  2HSP A;  2K6D A;  2O88 A;  4J8O A;  3P8B B;  2DL7 A;  4AFQ C;  4C0Z A;  3KFV A;  2O9S A;  3OY9 A;  4RG8 A;  1BB9 A;  1VQO A;  1K8A R;  4HT9 A;  5KYW B;  1K8A U;  2CZ7 B;  3OYL A;  5CCA A;  3OYA A;  4FM4 B;  2NUZ A;  3CCJ T;  5GAN e;  4C8Q F;  2Y4Y A;  3M57 A;  2DJQ A;  2BZY A;  2M0O A;  1YJW A;  4C8Q B;  4M75 C;  4JLI A;  2KT8 A;  4QQ6 A;  1KIK A;  2LJ3 A;  3OYD A;  2VKN A;  1TOV A;  2DKG A;  4OB3 B;  3LLR A;  1AWX A;  5LJ3 g;  3C0C A;  2EAY A;  4EMK B;  3QJ6 A;  4J83 A;  1WNL A;  2AHJ B;  2MI6 A;  4RUG A;  3FRN A;  2MWO A;  4M7A A;  2M16 A;  2CT3 A;  3NGP A;  1OQK A;  2JN0 A;  2MWP A;  2HDA A;  1C1A A;  5KYX B;  3SWN C;  1UEC A;  1PWT A;  4NS5 A;  2HBP A;  1RAG B;  5FWC A;  1I5O B;  2MF2 A;  4E7L A;  4JRK A;  1UDL A;  5D6W A;  4F7U F;  1W70 A;  3KXT A;  1AWO A;  1B34 A;  4E47 A;  3OS2 A;  2PTK A;  4F7U B;  1GCQ C;  4FCY A;  4RTU A;  1VQ8 A;  1VQP T;  1ZBX A;  3QHS A;  4OGE A;  2E1H A;  5LJ3 f;  1M1K C;  3E19 A;  5KYN A;  3AHU A;  1VQ5 T;  3G4S A;  4RTT A;  3NTI A;  1V29 B;  1YIT T;  2DEQ A;  3HFN A;  2E41 A;  3REA B;  3JB9 D;  1NE8 A;  1TUC A;  4LUE A;  3CD6 T;  1D0Z A;  3JB9 G;  1VYT A;  2ZGW A;  4FT4 A;  1AHJ B;  2D1X A;  1QCO A;  1D0Y A;  1Y0M A;  2O4X B;  3OS5 A;  2OAW A;  2K3Y A;  4RTX A;  3SHW A;  2D0Q B;  1I07 A;  4GLM A;  2EJG A;  2PU9 B;  5I22 A;  5GAM d;  3L2Z A;  3CC4 A;  4QVZ A;  2EKH A;  4BUG A;  3HHT B;  1AT1 B;  3QSU A;  3HL8 A;  2DTO A;  3M58 A;  2KEA A;  1KHC A;  3CCM T;  2HAX A;  2KE9 A;  1VQ6 Q;  1M9S A;  2DTH A;  2RHX A;  3CCE T;  1E6H A;  5KYW A;  3CCJ A;  1XOV A;  1TU0 B;  2EQJ A;  2DM1 A;  1VQN T;  1VYV A;  2RK1 A;  3MHX A;  4LD6 A;  2LMJ A;  4EPC A;  1IHV A;  2HQH A;  5LJ5 e;  5KYU A;  1T3L A;  2CH4 W;  1R0B G;  1WJR A;  2I2L A;  2O9V A;  5CR2 A;  1RAF B;  4M78 D;  3HTR A;  3OMG A;  3S6W A;  5I2M A;  3M5A A;  4XU0 A;  4M78 G;  3PMT A;  1XQH A;  2FPF A;  1AWW A;  4M75 E;  4J7I A;  1V76 A;  2EGA A;  3VRZ A;  4F14 A;  2YT6 A;  1SRL A;  1N27 A;  2E65 A;  1MMA A;  3QDR B;  5ECA A;  4BE2 A;  2QK0 A;  1JQQ A;  2K79 A;  1MV3 A;  4RMO A;  4BB7 A;  3G7Z A;  1I0C A;  3F70 A;  1I81 A;  5KYX A;  4M7D A;  1LCK A;  4XTU A;  4J7F A;  1N9R A;  4BE1 A;  4R55 A;  2QAZ A;  2DVJ A;  4AG1 C;  4WTO B;  3RES A;  5CO7 A;  2FPD A;  4D6W A;  3CCQ T;  4GBQ A;  2GF7 A;  1H3Z A;  2VYT A;  4MMK A;  3C4S A;  5CKD A;  2YRD A;  2C0O A;  2ZAE A;  1X75 C;  3PGG A;  3JCM Q;  1VQP A;  2DMO A;  4Y28 E;  2EQM A;  1VUB A; 
#chains in the Genus database with same CATH homology
 3CXC P;  1YJ9 Q;  1YJW Q;  3CCU Q;  1VQP Q;  1K8A R;  3CC2 Q;  1K9M R;  3CCS Q;  3CCQ Q;  1W2B P;  3CCJ Q;  1Q82 R;  1S72 Q;  3G71 Q;  3CPW P;  3CCM Q;  3CCV Q;  3CMA Q;  2QA4 Q;  1Q86 R;  1YIJ Q;  1VQK Q;  1QVF P;  1KD1 R;  3CC4 Q;  3I56 Q;  1VQO Q;  1VQ5 Q;  2QEX Q;  1KQS P;  3CME Q;  1JJ2 P;  1VQ4 Q;  3G6E Q;  1YIT Q;  1Q7Y R;  2OTJ Q;  3CCL Q;  1YJN Q;  1NJI R;  1VQ8 Q;  3CCE Q;  1VQL Q;  1VQ9 Q;  1VQ6 Q;  3CC7 Q;  3CCR Q;  1VQ7 Q;  1VQM Q;  1Q81 R;  1M90 R;  1VQN Q;  3OW2 P;  1QVG P;  1K73 R;  1YHQ Q;  1N8R R;  3I55 Q;  2OTL Q;  1M1K R;  3CD6 Q;  3G4S Q;  1KC8 R;  1YI2 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...