1VQ5V

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq5V00
1YJWV 3G4SV 3CCJV 1VQMV 2QEXV 3CMEV 4WCEV 5DM6V 1S72V 1Q81W 1N8RW 1VQ4V 2OTLV 1Q86W 3G6EV 3CCQV 3CCVV 3CCLV 2QA4V 3G71V 3CC7V 1KC8W 1VQ6V 1VQNV 1M1KW 3CC4V 1VQOV 1K73W 1QVGU 1NJIW 1M90W 1VQLV 4WFBV 2OTJV 1K9MW 1KQSU 1K8AW 1W2BU 1VQ7V 3OW2U 3I55V 1R73A 1YHQV 1QVFU 1YIJV 3CCUV 1YITV 3CMAV 3I56V 3CPWU 1VQPV 1VQKV 3CC2V 3CCMV 1KD1W 1VQ8V 2D3OW 3CCEV 1YI2V 1YJNV 1Q82W 3CCSV 3CD6V 1VQ9V 4WFAV 1Q7YW 1JJ2U 1YJ9V 3CXCU 3CCRV 1VQ5V 4WF9V
chains in the Genus database with same CATH superfamily
3F7YC 2QSAA 2BCCH 5LYJA 3ASNB 5BR8O 1KB9F 1XHZA 4HNAB 2B1IA 3JARA 5L3FA 3TETA 3SYPA 1H2MA 4JASA 4ABMA 2QWQB 2A06H 1F7YA 1VF6A 1EZVH 4O4IA 3BFRA 1R6KA 1HR0O 1RPOA 2WAMA 1WA8B 1WB7A 2OCCC 3E89A 2HEPA 4RAIA 1RP3B 3RVZA 4LFBO 4XDJA 2Y4TA 3L73H 5JVDA 2P4VA 3JAMN 5L3GA 1XL6A 1I94B 4TQDA 1HNZB 5B66Z 3G4SV 3FD9A 2XAQA 4R7CA 1DLBA 5KA6A 3OM3B 1B04A 3H1HH 2VRZA 3JALA 4MVOA 1QVFU 1SQGA 1UJWB 3LDCA 2M7WA 3C90A 2EIJC 3ZMUA 5B1NA 2QR4A 2ZE8A 5FL7G 1YJWV 4LCUC 1RM1B 5CA1A 1ZTEA 4PA6A 4J80A 2W0FC 1XREA 3TK1A 3N2GA 2F1MA 3DGEA 1MOFA 2X7RB 5EIBC 2Y4UA 4BAYA 4DV7B 5A2QN 2Y0IA 3THOA 4TQFA 1GTOA 2UUAO 1XNRB 2O57A 3NR7A 1LR1A 1Y76A 2Q0OC 3SPGA 4JI6O 3WU2Z 3P30A 3CRAA 2DE0X 4JI5O 1NKDA 4DO2A 4FM0A 2JIZG 4RQFA 5L3EA 4O4HA 3CX5F 3L71H 2IH3C 5B5EZ 1BMFG 1FXVA 4Q6GA 2ZIOA 4LFCB 5CBFA 1L0LH 5CB4A 1OCZB 1QLEB 3G6BA 4AILC 3W7XA 1XNQO 4HYOA 1XOUA 3RBZA 2BTQB 4J42A 2ITDC 3K5LA 4DUZB 1VQ7V 4NXMO 2AZ0A 4YJ3A 1SQQH 1HP8A 1JJOA 4QIWF 3MHSC 2ADQB 3ABLC 3ZHVA 2UU9O 2EILC 5IJ0B 4X20A 5J9PC 1N8RW 1N32B 4E4EA 4NXNO 3CC7V 5B1AB 3ETGA 1PPJH 4DR6B 4X1YB 2EINB 1YIJV 4R8CA 4PA9A 3ABMC 3AK1A 1VEWA 2WWWA 1M56B 2UXDO 2JS3A 4X62O 2IJKA 2JJ2G 4MVUA 4FFBA 3L75H 1JR9A 4YHHB 2JGDB 3QF7A 4TV8B 3ABKC 4FLXA 3JAKA 1XMOO 4CH4A 1FXKC 3OMIB 4MVQA 1P4RA 4MTFA 4LFAB 4DR5O 3ETEA 4UFZA 4F6EA 4AQYO 4MVZA 5JQGA 2IU0A 4JYAO 1PP9H 4ICGA 4DR4B 2WLIA 4MTXA 1VQKV 3FYEB 3Q4HB 1WP7A 4JI1B 1XBLA 3ICXA 1AR1B 1GAXA 2QA4V 2PGGA 3ABUA 2R9IA 3CHXA 1J5EO 1LNQA 3LDEA 1M57C 2YI9A 1Q90D 2E3CA 2Y0PA 1IVSA 5H5NA 2RDCA 4DV0B 1NTZH 3WFVA 3IAYA 4JV5B 1PL4A 3JD2A 3CCSV 3MDSA 1NR7A 4EB6B 5CBHA 4DW1A 1K7DA 2M6YA 3DXRA 3CCJV 4FM2A 1HNXO 5KAFZ 2V1DA 4TV9A 4LH7A 4BIZA 2OTJV 3HKBB 1PKXA 1OHHG 1THZA 4O2BB 2KSDA 5K1XA 1UFIA 1P7GA 5BMVB 3QO7A 4KP4A 3CYOA 1X4TA 1Z5WA 5BR8B 3F5TA 1Y74A 2PUSA 4B3SO 2ZINA 1NR1A 5LOVB 4KFMA 2GTAA 2P6JA 3CRQA 3ZN1A 4YJ2A 4JYCA 4FLVA 2ETNA 4WFAV 4XBFA 3AG4C 3ZX6A 5LXTB 1HR0B 1JOYA 2Q4PA 3ZMVA 1OCRB 4QPKA 1VQLV 4R6ZA 5ITZB 3H1KH 4LFBB 1R73A 1X59A 4DR7O 3BA9A 3HKDB 5DEDA 2ZM6O 1YEWA 4PELA 2YIDA 2UXBO 1F23A 3UT5B 3R66A 1IBKO 2EIKB 2L6LA 4B08A 1S3JA 5A9GA 4I50A 1BCCH 3SGIA 4I0XA 3WB2A 1TUBB 5BY1A 1FXKA 2Q0AA 3OMNB 1MABG 1NI8A 5IJ9A 3HKEB 4JI3O 3ZIAG 1OCCB 2DWEC 4WBNA 3CCMV 5KHIA 3AG7A 4LF7O 4HBNA 4FFKA 1CPYA 2CTWA 4FLTA 3OTOO 5FLXN 4EFEA 1VQMV 2IJJA 3DTUB 1H2GA 2YXLA 1D5AA 1BQ0A 1Z2GA 4TT3G 4XDLA 5IJ0A 4WFBV 1FJGO 3A8TA 5GONB 3E83A 1YF2A 4WFGA 2E76B 1EM1A 4GX5A 2HLDG 2HKOA 1S5JA 4UB8Z 2EIKC 1NZ6A 3APQA 4IIJA 3CXCU 3S3WA 3BRCA 1ZAUA 3OTFA 1K4DC 4WCEV 1PNKA 1V55B 3RYIA 1VQ4V 3CCQV 2JGDA 3CWBH 3G71V 1S5LZ 1SESA 1VQOV 2WLMA 3JSNA 4DV2O 4I4TB 1H8EG 5L3DA 3H1JH 1UPGA 2KQXA 2BTOA 3ZHRA 1AI7A 4CS4A 4YY3O 1TAEA 4WFEA 3K06A 2YIBD 1H2LA 1PNMA 5HFMA 2C2AA 4MS2A 3OFNG 3BAAA 3FKSG 4FLZA 3RYFB 1GM8A 1RFYA 4NXMB 1P84F 4X8AA 3CCEV 3UO2A 1KECA 4IHJA 1N4CA 2QKCA 5EBMC 1LUWA 1ROPA 3ZRXA 1KC8W 3ZRSA 4UCRA 3KG2A 3AEIA 4LF6B 3G80A 5LMNO 3S3XA 5IYDO 4LF5O 3X2QC 4PDRA 4LR3A 4X62B 4Q20A 5B3SC 1AP6A 3SYOA 1XMOB 2P5OA 3IJ4A 1JX9A 1SQXH 3K04A 5DECA 5IY5C 4DR5B 4UCVA 2PF4E 4AQYB 4RUEA 4JTCB 1M93A 4JYAB 1XQ8A 4W4KA 1GMGA 2F95B 1GN4A 1IBLO 4RUFA 3T2MA 3UKMA 3G67A 3LNMB 3FX7A 4J7KA 4IYHA 1IXMA 1SQPH 2DQ0A 1GN2A 3SPHA 2ZXWB 1B6QA 3JASB 4LH6A 2YXYA 5C93A 3J7AU 4DV1O 4GKKB 1HWYA 1M9NA 1V54B 4P30A 2F93B 3CCUV 1QR8A 3QG5A 5FPOA 2RMKB 2P90A 3VQVA 4QE9A 5B1BB 4CS3A 2F43G 4YIPA 4X66B 3K0DA 2VQFO 2JEXA 1ZL8B 3N27A 1MSDA 3T1YB 4F6RA 2CTRA 2CUGA 3A2FA 4CH3A 3JD3A 2PI5A 2Q69A 2HJDA 1HNXB 4U3JA 4DR1B 5FPRA 4KL1A 3ZRWB 4PA3A 4DR3O 5H6QA 3ASOB 3HKCA 5B1OA 1XMQO 1EFRG 2D2CB 1SQBH 3WG7B 3HKEA 4FK5C 3OMAB 1K92A 1V9PA 4GLXA 2IJIA 2G38A 2Q8VA 1YDXA 2ZXWC 2Q7EA 3CRCA 5LGUA 4P9OA 5CMUA 1W2BU 4DV5B 5IYZA 4B3SB 1GK9A 4X64B 1YZBA 5EIBD 2F4VO 5EBLC 3VBBA 3ZRVA 1G4YB 3ETQA 3TGUH 5CBGA 2PI4A 2RN9A 3JATA 1K34A 5DM6V 4ZOLB 3JCUZ 4BW9A 1JPXA 2JRIA 3C3TA 1W59A 3OGIB 2CTPA 3ASOC 2Q7GA 3UQ8A 4GKJO 1FFXB 4DR7B 1BS3A 2ZM6B 1GRJA 4B3RO 1AJNA 4EEQA 1IBKB 1VF5B 1MNGA 3K58A 2E5LO 1U97A 4K0KB 3IC7A 4MW8A 2YSUB 2XAGA 1AR4A 3QTCA 2HVJC 4E2LA 4NTWA 2OCHA 3MHHC 4B3TO 1N0NA 3P3NA 2JK5C 5FNVB 2EZOA 1TUEB 3U0ZA 2QEXV 1Q81W 3ASNC 4PV1B 1OCOB 4R50A 1WJZA 3AG3B 4AI8A 2BSKA 2GDSA 4H13B 2DQ3A 4UCTA 1QVGU 2LGQA 3O65A 2UUBO 4H33A 1YHQV 3APOA 3D3QA 4LF9O 5EYPB 3JAWB 2WPDG 4IGGA 2W6JG 2YEVB 2AGAA 2AHYA 4WFFA 1R3IC 4LF4B 1FS0G 3WB0A 5KMGA 4DV2B 1W0KG 1O9HA 3EXAA 2HHHB 5JJNB 3I56V 4C7UA 2PZSA 3SR2C 5L3BA 2YC0A 4ZI7B 4LF8O 4JAVA 1P7BA 4NVPA 1ORQC 1JFFB 4MVMA 4CH5A 4YY3B 1R3LC 5LBQA 5IYCO 1RSOA 1G6UA 4DRXA 1NH2D 3ZJZA 1Z5VA 4JI8O 4O4LB 2JGUA 3AG3C 5GTHZ 4BIOA 3T4DA 1E1RG 1AR5A 4O2AA 2GHYA 4ZHQB 1I0HA 2YIAA 2VQEO 5BXZA 3RYHB 3OGCC 5LMUO 5GW7A 1R3JC 4JI4O 3RWRD 3K9SA 4IYIA 5CN0A 2CH7B 4OGQB 4GUNA 4J41A 5KX5B 4D7TA 1RM1C 1JQ0A 2QM8A 3RYCB 3E86A 4TUYA 1W0JG 4FVMA 1WNSA 1ZL8A 2F66C 4UCSA 2A79B 5LGTA 3L70H 4I55B 5E1AC 4LF5B 1YTFD 2V4DA 4UVAA 2GUZB 2F23A 3LSUA 2K1EA 2BE3A 1FFTB 3JSLA 2ZR3A 3FFQA 3TCUA 1VQNV 3B40A 1Y6XA 2EJ7A 3E22A 1TA8A 4GYCB 1AB3A 5LP6B 3FAVA 4JZGA 3ZEDA 2XAFA 1BGYH 4IT5A 4RQEA 1DF5A 4CZZA 1IBLB 3CEIA 1NH2B 4X1IB 5IE9A 5GTIZ 1JJ2U 1OCZC 5C8YB 1QLEC 4DUYO 2OYQA 5EZYA 3IGAC 1QHTA 4WFHA 2WLLB 3SPCA 1Q86W 2Q73A 4DR2O 1M1KW 4O4JB 4TSFG 2IW5A 1G1XB 3K3WA 4TWKA 5LGNA 2IU3A 3GWOA 4DV1B 4HNAA 1CXZB 2ZIMA 1R1BA 2X6CA 1IXBA 1I08A 1N33O 1K5SA 2ZCEA 3O9OA 2AXTZ 4BIUA 3SPIA 2VQFB 1WA8A 2KG7B 5B1AC 4UVCA 4DV3B 2N74A 3F5WC 4GX1A 2EINC 1AJPA 3H1IH 3LUTB 3NXSA 4JI0O 3CS5A 1YTFB 2QJ1A 1M56C 4MVRA 2ZE7A 4DR3B 4DK0A 2CK3G 1SC5B 3E8GA 1Q82W 4L8JA 5D5QA 2OT5A 2XAJA 3ZHQA 1S72V 2JVDA 1BZKA 4JTDB 1EN5A 4DV6O 1US6A 3PN1A 2XT9A 3T1HO 1XI1A 2ILMA 3K57A 2A0LA 1FAFA 1U96A 1BT8A 4X1KB 4F4LA 1QCEA 2F4VB 3TJTA 1SQVH 4JZ2A 4MSWC 2FL4A 2UXCO 5KHHA 4OX9O 5H9CA 4DV4O 4B3MO 1SA0B 2UXNA 5E79Z 2Y69B 3N2KB 2LFSA 3HR0A 3GVMA 3K9AA 3BPZA 3OD4A 4LBEC 1N36O 1S76D 3K5NA 1KUQA 1E1QG 2ZD9A 4UCUA 5EC2C 2XUMA 4G27B 1RPRA 4J9YB 5EC1C 1SS3A 1M5IA 4RWUA 1BHBA 2XOKG 1D2DA 4JPRA 1S77D 3LSQA 5IYBO 4G28B 4NYKA 4PI0A 4DW0A 1VQ9V 1NU1H 4K8ZA 1Q43A 2UUCO 1T5EA 5J2TB 1O9GA 5LHIA 3CJHB 3ZBHA 2IBZH 3RW0A 3UO3A 4FM1A 4DYLA 3CC4V 3LNNA 4UXNA 5LA6B 3TXQA 5DN6G 1SF9A 3OEHG 2P06A 4I7ZB 2BTQA 2GV9A 1QR9A 3JYCA 4H44B 1YI2V 4ASUG 4LF9B 3ZMZA 4I55A 4D6TH 2H3OA 1AILA 2YS8A 4PDLA 1TVKB 1XDCA 2ZE5A 4NKGB 1OCRC 2W0XA 3MD0A 4LWSB 2Z3YA 4NTXA 2EULA 1JVMA 3UM7A 5CA0B 4NR1A 4X1YA 5KA5A 2ZT9B 2B1GA 2DWDC 2UUAB 4LF8B 2ZNJA 1EN6A 4XDKA 5AG2A 1OV9A 4Z1VA 3QO8A 4UVBA 3EHBB 4JI6B 4JI8B 1I5YA 2GTSA 3A0HZ 3IFXA 1KP3A 4TV8A 4JI5B 4UV8A 5J2UB 3ZCCA 2VQEB 4O4JA 2JJ1G 1OCCC 3DSQA 5KHJA 1OZ0A 2KB1A 5LYJB 1FKAO 4ZKIA 2A7WA 3JARB 1GKFA 2LP7A 2A9HA 2FTKA 3Q4HA 2N05A 1Y66A 1XNQB 2X0LA 1WP8A 1NBMG 3K08A 4O4IB 3SYQA 2QM7A 4PDVA 2ARHA 4CC5A 5HFLA 1F4MA 4PA7A 1OJHA 3QVNA 2VWKA 3VQWA 2XASA 4BR6A 1TGOA 1V55C 2UU9B 1S0VA 5JVDB 4EB6A 2CAZC 2P4KA 5KHGA 4NXNB 2QWPB 3HB3B 2BOBC 3GB7C 4Z2WA 4FLUA 3MAQA 4B7KA 2E74B 2HR3A 4LFCO 1KYOF 2WA4A 4EKWA 5IWAO 2QWRB 2PYLA 3HKBA 3STZC 2UXDB 4O2BA 5H2FZ 2FYUH 3JALB 4FPPA 3ZHSA 3ZMTA 2ITCC 3A0RA 2HJFC 3ABTA 4LP8A 4DR2B 5BMVA 1K97A 1R3KC 1SA0A 2KKWA 2QTOA 3N2KA 4JI7O 5CA1B 3B4SA 1XILA 4MVSA 5LOVA 1BSMA 3N2GB 1VQ5V 1N33B 1F51A 1E79G 2P7TC 4X9QA 3CB2A 4DR6O 5JJEB 5LXTA 2EX3A 1M90W 2EIMB 2QE7G 1AVMA 2DYSB 5KUKA 1J5EB 4HAMA 3OW2U 4JAAA 1K5QA 2FKXA 1Y76B 1VARA 3CC2V 5ITZA 1H38A 4QGPA 4LFAO 3HKDA 1GN3A 4U7NA 4J9ZB 4J7ZA 1IBMO 3UT5A 3BY6A 4O4HB 2EZPA 2ZE6A 3E8HA 3PJSK 4DV6B 2JS5A 2DYRB 3CJHA 2GSMB 1K4CC 4JGSA 1R6TA 2MK3A 5F2VO 1YITV 5CB4B 1TUBA 1SETA 1WN7A 1FYJA 1NS1A 3ZN0A 1FPOA 1PV0A 3K59A 3TXSA 1DF4A 4QPJA 3CD6V 1HNWO 2UXCB 2OWOA 4YJ3B 4OX9B 4QE7A 1FXHA 1NQTA 2X6BA 5JJJB 4DV4B 4B3MB 4DV0O 1TVKA 2QKAA 3RVYA 1V54C 2QDOA 3C3SA 3KCYA 4X20B 2Q9LA 1WPXA 4FZ0A 2YDEA 1N36B 5JH7B 5B1BC 4YXWG 5GONA 2OCCB 3P32A 2Y48A 1XL4A 2LW1A 3A0BZ 4J11A 1QBZA 3ETDA 1IZ3A 1G8MA 1NJIW 3M7MX 4PJ0Z 4K3AA 1ZUQA 1K9MW 3VOUA 1K8AW 3KKYA 2LFRA 1HDJA 2R72A 3L72H 3L74H 3JAKB 4I4TA 3WG7C 3LDDA 2LGWA 5JQGB 2UXBB 4FMTA 4K8XA 2UUCB 2WA3A 4RO2A 1AJQA 3W7WA 2WLIB 2R9RB 3CXHF 3OAAG 3K79A 2PYJA 1MG1A 5D5PA 3AG1B 3CRRA 4PI2A 4JI3B 3CE2A 1ZX3A 2R9AA 2EIJB 2H94A 2WLHA 3RYFA 4LF7B 3VQYA 1MSWD 3OTOB 1NVPD 4FZ1A 2X6AA 2LJ2A 3B09A 3T4ZA 3SYCA 1NT2B 1FJGB 3DXRB 3ML0A 1BL8A 3U10A 1Q5OA 1ENVA 4TV9B 3B8MA 3J80N 3LSSA 1KMIZ 3E8BA 1KU9A 2WLKA 2ZQMA 3K0GA 5L3CA 3JD0A 4LC1A 5K1PA 4QJFB 2E75B 3AG1C 3FB6C 1L0NH 4MTOA 1L8DA 5IDJA 3B8NA 2DJVA 1AROP 2K9PA 2Q7HA 1IDSA 4CH6A 3OUFA 3T1CA 1Y74B 1K3EA 2OTLV 4CBCA 1OCOC 2CGOA 4MTGA 4BW5A 3FB7C 4AHCA 2Q5ZA 2YIBA 1GN6A 3BVOA 4DXWA 2HP8A 4YJ2B 1QQCA 2IH1C 4P2ZA 3B2EE 3BHPA 4GX0A 3JASA 2A3QA 4B7EA 2QWOB 3CRMA 3ABLB 2QTSA 1ZWIC 1PNLA 1NVPB 1YCIA 2EILB 4Z1MG 2QM4A 2QWNB 4IL6Z 1KKDA 3M99B 2NNUA 4MT8A 3D3IA 1WLEA 4H37A 3ABMB 5LMNB 3B77A 1YJNV 3ZRWA 4I50B 3W7UA 5KHKA 5IWAB 2N04A 2DN9A 3ABKB 4I0XB 4X65O 1FXKB 3KCXA 3CCVV 5IJ9B 2P67A 5BZBA 1EBOA 1IURA 4WBNB 2H8PC 1PM9A 1Q6UA 2ZDIC 5EK0A 2NN4A 2Z0AA 1YVWA 4JI7B 1N34O 1YJ9V 1K73W 3ZMSA 4N21A 4X88A 5JH7A 4JI2O 2HG5C 3WB1A 3SJBC 3CCLV 5LHHA 3I5DA 4LF6O 3U11A 2WSSG 3SJQC 1M57B 2R70A 4FJCC 4ZOLA 5KLVH 3OR6C 1MZFA 3SDLA 5JWPA 4P9PA 4IIJB 3CMAV 1P49A 4K35A 1DTOA 1XUQA 1IX9A 2XNDG 3RYIB 1WB8A 1QU7A 1Q8IA 3D36C 1FFXA 2EBOA 1MMMA 1D5NA 5H6RA 2RQ6A 3BA8A 4JAUA 2IJHA 2PTMA 4BWAA 2JDIG 1BE3H 1IBMB 4PD4F 2VWJA 3K5MA 3JCZA 5LP6C 3I55V 3AK3A 1L1FA 4FLYA 4ZBMA 3RFRA 4KHPO 2L35A 1BQZA 2DMXA 1MA1A 1XMQB 1Q6IA 2OIGA 4J7JA 2YI8A 4GKKO 1HNWB 5FNVA 4PDMA 3JD4A 1Y4MA 2WLJA 4QNHB 1AI4A 4IHJB 4L87A 2ZKOA 1GH6A 3BCCH 5LHGA 2RNBA 4X66O 5TISZ 2FB5A 3T1YO 1KQSU 2HFEC 5EYPA 3AG4B 4TOIA 3JAWA 3FYIB 3IC9A 4DR1O 1JMKC 2YEVA 1VF7A 3ZHTA 2NR5A 1F4NA 1DGSA 2W6IG 1VP7A 1WAZA 3DC5A 4GKJB 1QNMA 1H2SB 1J95A 1N0JA 2HVKC 1GM9A 1HW7A 1YXBA 1GO3F 1ZSPA 4B3RB 4ZI7A 4NB5A 3G6EV 4GCZA 1JFFA 3OT7A 2ODMA 1M4UA 3QO5A 4DV5O 1XEQA 4O4LA 4X64O 2E5LB 3HPLC 2Q6AA 4ZHQA 2BOCC 4UCOA 4UUJC 3RYHA 1KD1W 3KZIZ 3R65A 4H0LB 4B3TB 3E2EA 2CGNA 1LUVA 1NTKH 2ZDIA 2CH7A 3CMEV 5KX5A 2WLNA 1VQ6V 1K33A 2Y69C 4LNUB 4JTAB 3E8FA 1PL0A 4JYYA 4NTYA 3RYCA 1SZXA 3EVKA 2UUBB 3GWKC 2P22C 1SRYA 4F6RB 4OXSA 3H01A 4K0KO 2CTQA 4U3JB 5CA3A 2GUZA 3D36A 3HKCB 3P3PA 5EBWC 4GZRB 3SPJA 2RJZA 1Q6HA 1VQPV 3M8AA 1I94O 3RT3C 3D8CA 3OUSA 3STLC 2AW9A 1HNZO 5LP6A 4DK1A 1PD3A 4PA4A 4N23A 4WF9V 3ZHUA 4UB6Z 4X1IA 5IYZB 3H1LH 5C8YA 2NLJC 5JCOC 1JA8A 2CE4A 4YIOA 1VMGA 2WLLA 1I5XA 4KXRA 1MZEA 1Q3EA 5LMUB 3SYAA 3JATB 4JI4B 1CEZA 2Q68A 2AHZA 4GT1A 2XTAA 4I9WA 1KP2A 4EFBA 3CCRV 4LF4O 2YICA 2MW2B 4KUMA 2HHHO 3DC6A 3SJCC 4DV7O 1SQFA 5LL6Y 2JEUA 2KG7A 5KUMA 4I5SA 1ZLZA 1XNRO 3X2QB 2AZ2A 2PY5A 1QLNA 2EJRA 1Y67A 1BHAA 3FB8C 3BEHA 3RGBA 1AI6A 2DOSA 1WPBA 5B3SB 4CS2A 4X65B 2YUAA 5IY5B 1B06A 1XHXA 1SERA 4HZ3A 1SKVA 4U7OA 4FLWA 3CPWU 1FD9A 4MW3A 1VIBA 1JCHA 2BSKB 1EZJA 2Q67A 2LO1A 4X1KA 1N34B 3BABA 2GBOA 2IM9A 4DUYB 3UCSC 4JI2B 4DUZO 2XHBA 1VF6C 3SJAC 3CSXA 1KKCA 1S5HC 1I7FA 3E35A 1NTMH 4PHZA 3L9DA 2YXHA 1VQ8V 3K03A 1H8HG 2UXXA 3FB5C 3RN4A 1H2NA 2Z5UA 1N32O 4W4LA 4UV9A 4G2KA 5KMGB 2CDYA 2B9ZA 3AG2B 1AI5A 1H2KA 4U3FH 1SZTA 1RSOB 4DRXB 2XAHA 2D3OW 4YHHO 4JI0B 4D7SA 4GX2A 4O2AB 2DW4A 3AK2A 4KHPB 4CC6A 3J81N 4ZIBA 4A5UB 1COWG 1A32A 3OEEG 3QNEA 4I9QA 5J2TA 3VQXA 2B5UA 4FIPC 4DR4O 1URFA 2ATKC 3ZS8C 1R6NA 3T1HB 4LNUA 4JYBA 4OPAA 5LA6A 2QKSA 5JCOA 4JI1O 3W7SA 1KBHA 1EN4A 2QGNA 4TUYB 3AG2C 3F7VC 3JD1A 4DV3O 3EFFK 3W7TA 2EIMC 1CP9A 2DYSC 2ADPA 4JV5O 4J10A 2LW7A 3CP1A 4LWSA 1DK1A 1YSCA 3OR7C 3OE7G 2LQTA 2ZNIA 3E22B 5CA0A 1B3QA 2V7QG 4X89A 3FAVB 2FMLA 4OPHA 5IT9N 2DYRC 1GM7A 2ZR2A 2VS0A 4FFBB 5EZYB 5KAIZ 1AP5A 2OIEA 2RCVA 3K5OA 5J2UA 3H9VA 1Q7YW 4JF3A
chains in the Genus database with same CATH topology
2ZD9A 5EBMC 3ABKB 3F7YC 1ROPA 5EC2C 4G27B 1FXKB 1RPRA 3ASNB 3CCVV 4J9YB 5EC1C 3ZRXA 1KC8W 3ZRSA 2B1IA 2P67A 5BZBA 1EBOA 5L3FA 3TETA 3SYPA 3KG2A 2XOKG 1BHBA 2H8PC 4JASA 3AEIA 4JPRA 5IYDO 3X2QC 4PDRA 1S77D 2ZDIC 5EK0A 3LSQA 5IYBO 1R6KA 4G28B 1RPOA 2WAMA 1VQ9V 2OCCC 3E89A 1YJ9V 1K73W 3ZMSA 4N21A 5LHIA 4RAIA 4X88A 4Q20A 2HG5C 5B3SC 3SYOA 3CCLV 3RW0A 5LHHA 1JX9A 3RVZA 3K04A 4UXNA 5IY5C 4XDJA 3CC4V 2WSSG 5DN6G 4RUEA 3SJQC 1M57B 4JTCB 4FJCC 3OEHG 3OR6C 1GMGA 4P9PA 3CMAV 4RUFA 3T2MA 1QR9A 3JYCA 5L3GA 1DTOA 1XL6A 2XNDG 3LNMB 3UKMA 4ASUG 1YI2V 5B1AB 3ZMZA 1IXMA 2DQ0A 2EBOA 3G4SV 5H6RA 3SPHA 4PDLA 2XAQA 4JAUA 2ZXWB 2IJHA 4R7CA 1B6QA 1DLBA 5KA6A 2JDIG 1OCRC 3OM3B 5C93A 3MD0A 2Z3YA 1HWYA 1M9NA 3JCZA 1V54B 4MVOA 4P30A 3I55V 1QVFU 1L1FA 3CCUV 1QR8A 1JVMA 3LDCA 4ZBMA 3UM7A 1UJWB 2M7WA 2P90A 5KA5A 4QE9A 2B1GA 5B1BB 2EIJC 3ZMUA 5B1NA 2DWDC 5FL7G 2F43G 1YJWV 4LCUC 3K0DA 4XDKA 1RM1B 2JEXA 4PA6A 3QO8A 4UVBA 2W0FC 3EHBB 1I5YA 3TK1A 3DGEA 3IFXA 1KP3A 3JD3A 2PI5A 4PDMA 2Q69A 3JD4A 1Y4MA 1MOFA 2WLJA 2X7RB 4UV8A 3ZCCA 4QNHB 3ZRWB 4PA3A 1AI4A 4BAYA 4L87A 2JJ1G 5H6QA 1OCCC 3ASOB 5B1OA 5LHGA 1GTOA 1EFRG 1OZ0A 2KB1A 3WG7B 4FK5C 3OMAB 4ZKIA 1KQSU 1K92A 2HFEC 1GKFA 2IJIA 2OTLV 2LP7A 3SPGA 3AG4B 2A9HA 2ZXWC 3P30A 2FTKA 3FYIB 5LGUA 1NKDA 1Y66A 4DO2A 2X0LA 4P9OA 5CMUA 1NBMG 2JIZG 2YEVA 3K08A 4RQFA 1W2BU 1F4NA 5L3EA 3SYQA 2QM7A 2W6IG 4PDVA 1GK9A 2IH3C 1BMFG 1FXVA 5EBLC 3VBBA 3ZRVA 1G4YB 5HFLA 5CBFA 1F4MA 4PA7A 5CBGA 1J95A 2PI4A 1OCZB 1QLEB 2HVKC 2XASA 3W7XA 1GM9A 1GO3F 1K34A 1V55C 5DM6V 4HYOA 3RBZA 1S0VA 3G6EV 4GCZA 3QO5A 1JPXA 2ITDC 3HB3B 3HPLC 1VQ7V 2BOBC 3GB7C 3ASOC 2HR3A 2Q6AA 2BOCC 4QIWF 4UUJC 3MHSC 1KD1W 4EKWA 3ABLC 3R65A 3E2EA 3STZC 1AJNA 2ZDIA 2EILC 5J9PC 3CMEV 1N8RW 3CC7V 2WLNA 1VQ6V 4FPPA 3ZMTA 1K33A 2Y69C 2ITCC 3A0RA 3IC7A 2HJFC 2YSUB 3ABTA 3ETGA 4JTAB 2XAGA 4LP8A 4MW8A 1K97A 2HVJC 3E8FA 1PL0A 1R3KC 2EINB 4E2LA 1YIJV 4R8CA 4PA9A 3ABMC 2QTOA 3MHHC 2WWWA 1M56B 1SRYA 2JK5C 2IJKA 2JJ2G 4MVSA 4MVUA 4OXSA 1VQ5V 3ABKC 2EZOA 1F51A 1TUEB 2QEXV 3H01A 1Q81W 1E79G 1FXKC 3ASNC 3OMIB 4MVQA 1OCOB 1P4RA 4MTFA 2P7TC 3ETEA 4R50A 3AG3B 2DQ3A 4MVZA 5CA3A 2IU0A 3D36A 1QVGU 1M90W 2EIMB 2QE7G 2DYSB 4H33A 5KUKA 4HAMA 5EBWC 3OW2U 1YHQV 1K5QA 3SPJA 2WLIA 4MTXA 1VQPV 1VQKV 3CC2V 1H38A 2WPDG 3OUSA 3FYEB 3STLC 1PD3A 4PA4A 4N23A 4WF9V 2W6JG 2YEVB 4U7NA 4J9ZB 1AR1B 2AHYA 2QA4V 4WFFA 1R3IC 3ABUA 3BY6A 2EZPA 2R9IA 1LNQA 3E8HA 1FS0G 2NLJC 3LDEA 1M57C 3PJSK 2DYRB 2GSMB 2WLLA 1K4CC 1I5XA 4JGSA 1W0KG 2MK3A 1YITV 3I56V 3SYAA 1CEZA 5L3BA 3WFVA 2Q68A 2AHZA 1SETA 4GT1A 3JD2A 3CCSV 4JAVA 4I9WA 1P7BA 1ORQC 3ZN0A 1KP2A 1NR7A 4MVMA 3CCRV 1R3LC 5CBHA 5LBQA 5IYCO 1K7DA 1NH2D 3ZJZA 3CCJV 1VQ4V 1DF4A 4QPJA 3CD6V 3AG3C 3T4DA 1E1RG 2GHYA 4QE7A 2V1DA 1FXHA 1NQTA 2X6BA 4BIZA 4KUMA 2OTJV 3OGCC 5GW7A 1R3JC 3RVYA 1V54C 2JEUA 5KUMA 1PKXA 4I5SA 1OHHG 1THZA 3X2QB 5CN0A 1QLNA 1WPXA 2EJRA 5B1BC 4YXWG 1BHAA 3FB8C 2OCCB 3P32A 2Y48A 1XL4A 1RM1C 3BEHA 3QO7A 4KP4A 1AI6A 1JQ0A 2QM8A 3CYOA 1QBZA 3ETDA 5B3SB 3E86A 1G8MA 5IY5B 1W0JG 1NJIW 1K9MW 3VOUA 1K8AW 1SERA 4HZ3A 2A79B 1NR1A 4U7OA 5LGTA 4KFMA 2LFRA 3CPWU 5E1AC 2P6JA 3ZN1A 3WG7C 4JYCA 1YTFD 3LDDA 4MW3A 4UVAA 4WFAV 1JCHA 1EZJA 4XBFA 2Q67A 3AG4C 4FMTA 2K1EA 1JOYA 1FFTB 4RO2A 1AJQA 2ZR3A 3W7WA 3TCUA 2WLIB 1VQNV 2R9RB 3OAAG 3ZMVA 1OCRB 3K79A 4QPKA 1VQLV 4R6ZA 1S5HC 3E35A 1MG1A 1R73A 3AG1B 2XAFA 4PELA 4RQEA 1DF5A 4CZZA 1VQ8V 3K03A 1H8HG 1F23A 2UXXA 3FB5C 1NH2B 1JJ2U 2EIJB 1OCZC 1QLEC 2H94A 2WLHA 2Z5UA 2EIKB 3IGAC 4UV9A 4G2KA 4WFHA 2WLLB 1S3JA 3SPCA 1MSWD 1Q86W 1NVPD 3AG2B 1M1KW 4TSFG 2IW5A 2X6AA 1AI5A 3K3WA 4TWKA 1FXKA 5LGNA 3OMNB 2IU3A 1MABG 3GWOA 3T4ZA 3ZIAG 3SYCA 1SZTA 1OCCB 2DWEC 2X6CA 2XAHA 3CCMV 3ML0A 2D3OW 1BL8A 4GX2A 1CPYA 1K5SA 2DW4A 1ENVA 3B8MA 1COWG 4BIUA 2IJJA 3DTUB 1VQMV 1H2GA 3LSSA 3OEEG 3SPIA 3QNEA 4TT3G 5B1AC 3E8BA 2WLKA 2ZQMA 4XDLA 3K0GA 4UVCA 5L3CA 4WFBV 3JD0A 4LC1A 2B5UA 4FIPC 3F5WC 4GX1A 2ATKC 4QJFB 2EINC 1R6NA 1AJPA 3AG1C 3FB6C 3LUTB 3NXSA 4MTOA 1S72V 5IDJA 3E83A 4JYBA 1YTFB 3B8NA 2QKSA 1M56C 4WFGA 4MVRA 2CK3G 4GX5A 2HLDG 2HKOA 1AROP 3E8GA 3W7SA 1Q82W 2EIKC 3CXCU 2OT5A 2XAJA 3OUFA 3T1CA 1K3EA 1K4DC 4WCEV 3AG2C 1PNKA 1OCOC 1V55B 3F7VC 3JD1A 4MTGA 4BW5A 4JTDB 4CBCA 3FB7C 3CCQV 3G71V 3EFFK 1SESA 3W7TA 1VQOV 4DXWA 2WLMA 2EIMC 1CP9A 2DYSC 1H8EG 5L3DA 2IH1C 2A0LA 4P2ZA 1AI7A 4GX0A 3CP1A 4F4LA 1QCEA 3ABLB 1YSCA 3OR7C 3OE7G 4WFEA 1ZWIC 1PNLA 4MSWC 1NVPB 3K06A 2EILB 2V7QG 4X89A 4Z1MG 5H9CA 1PNMA 5HFMA 2C2AA 2UXNA 2Y69B 1KKDA 2DYRC 4MS2A 3OFNG 2LFSA 1GM7A 3K9AA 2NNUA 3M99B 4MT8A 3D3IA 2ZR2A 3FKSG 1WLEA 1GM8A 4H37A 3ABMB 4X8AA 4LBEC 1S76D 3B77A 3CCEV 1KECA 1YJNV 3ZRWA 3W7UA 1Q7YW 4JF3A 1E1QG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW V;  3G4S V;  3CCJ V;  1VQM V;  2QEX V;  3CME V;  4WCE V;  5DM6 V;  1S72 V;  1Q81 W;  1N8R W;  1VQ4 V;  2OTL V;  1Q86 W;  3G6E V;  3CCQ V;  3CCV V;  3CCL V;  2QA4 V;  3G71 V;  3CC7 V;  1KC8 W;  1VQ6 V;  1VQN V;  1M1K W;  3CC4 V;  1VQO V;  1K73 W;  1QVG U;  1NJI W;  1M90 W;  1VQL V;  4WFB V;  2OTJ V;  1K9M W;  1KQS U;  1K8A W;  1W2B U;  1VQ7 V;  3OW2 U;  3I55 V;  1R73 A;  1YHQ V;  1QVF U;  1YIJ V;  3CCU V;  1YIT V;  3CMA V;  3I56 V;  3CPW U;  1VQP V;  1VQK V;  3CC2 V;  3CCM V;  1KD1 W;  1VQ8 V;  2D3O W;  3CCE V;  1YI2 V;  1YJN V;  1Q82 W;  3CCS V;  3CD6 V;  1VQ9 V;  4WFA V;  1Q7Y W;  1JJ2 U;  1YJ9 V;  3CXC U;  3CCR V;  1VQ5 V;  4WF9 V; 
#chains in the Genus database with same CATH topology
 3F7Y C;  2QSA A;  2BCC H;  5LYJ A;  3ASN B;  5BR8 O;  1KB9 F;  1XHZ A;  4HNA B;  2B1I A;  3JAR A;  5L3F A;  3TET A;  3SYP A;  1H2M A;  4JAS A;  4ABM A;  2QWQ B;  2A06 H;  1F7Y A;  1VF6 A;  1EZV H;  4O4I A;  3BFR A;  1R6K A;  1HR0 O;  1RPO A;  2WAM A;  1WA8 B;  1WB7 A;  2OCC C;  3E89 A;  2HEP A;  4RAI A;  1RP3 B;  3RVZ A;  4LFB O;  4XDJ A;  2Y4T A;  3L73 H;  5JVD A;  2P4V A;  3JAM N;  5L3G A;  1XL6 A;  1I94 B;  4TQD A;  1HNZ B;  5B66 Z;  3G4S V;  3FD9 A;  2XAQ A;  4R7C A;  1DLB A;  5KA6 A;  3OM3 B;  1B04 A;  3H1H H;  2VRZ A;  3JAL A;  4MVO A;  1QVF U;  1SQG A;  1UJW B;  3LDC A;  2M7W A;  3C90 A;  2EIJ C;  3ZMU A;  5B1N A;  2QR4 A;  2ZE8 A;  5FL7 G;  1YJW V;  4LCU C;  1RM1 B;  5CA1 A;  1ZTE A;  4PA6 A;  4J80 A;  2W0F C;  1XRE A;  3TK1 A;  3N2G A;  2F1M A;  3DGE A;  1MOF A;  2X7R B;  5EIB C;  2Y4U A;  4BAY A;  4DV7 B;  5A2Q N;  2Y0I A;  3THO A;  4TQF A;  1GTO A;  2UUA O;  1XNR B;  2O57 A;  3NR7 A;  1LR1 A;  1Y76 A;  2Q0O C;  3SPG A;  4JI6 O;  3WU2 Z;  3P30 A;  3CRA A;  2DE0 X;  4JI5 O;  1NKD A;  4DO2 A;  4FM0 A;  2JIZ G;  4RQF A;  5L3E A;  4O4H A;  3CX5 F;  3L71 H;  2IH3 C;  5B5E Z;  1BMF G;  1FXV A;  4Q6G A;  2ZIO A;  4LFC B;  5CBF A;  1L0L H;  5CB4 A;  1OCZ B;  1QLE B;  3G6B A;  4AIL C;  3W7X A;  1XNQ O;  4HYO A;  1XOU A;  3RBZ A;  2BTQ B;  4J42 A;  2ITD C;  3K5L A;  4DUZ B;  1VQ7 V;  4NXM O;  2AZ0 A;  4YJ3 A;  1SQQ H;  1HP8 A;  1JJO A;  4QIW F;  3MHS C;  2ADQ B;  3ABL C;  3ZHV A;  2UU9 O;  2EIL C;  5IJ0 B;  4X20 A;  5J9P C;  1N8R W;  1N32 B;  4E4E A;  4NXN O;  3CC7 V;  5B1A B;  3ETG A;  1PPJ H;  4DR6 B;  4X1Y B;  2EIN B;  1YIJ V;  4R8C A;  4PA9 A;  3ABM C;  3AK1 A;  1VEW A;  2WWW A;  1M56 B;  2UXD O;  2JS3 A;  4X62 O;  2IJK A;  2JJ2 G;  4MVU A;  4FFB A;  3L75 H;  1JR9 A;  4YHH B;  2JGD B;  3QF7 A;  4TV8 B;  3ABK C;  4FLX A;  3JAK A;  1XMO O;  4CH4 A;  1FXK C;  3OMI B;  4MVQ A;  1P4R A;  4MTF A;  4LFA B;  4DR5 O;  3ETE A;  4UFZ A;  4F6E A;  4AQY O;  4MVZ A;  5JQG A;  2IU0 A;  4JYA O;  1PP9 H;  4ICG A;  4DR4 B;  2WLI A;  4MTX A;  1VQK V;  3FYE B;  3Q4H B;  1WP7 A;  4JI1 B;  1XBL A;  3ICX A;  1AR1 B;  1GAX A;  2QA4 V;  2PGG A;  3ABU A;  2R9I A;  3CHX A;  1J5E O;  1LNQ A;  3LDE A;  1M57 C;  2YI9 A;  1Q90 D;  2E3C A;  2Y0P A;  1IVS A;  5H5N A;  2RDC A;  4DV0 B;  1NTZ H;  3WFV A;  3IAY A;  4JV5 B;  1PL4 A;  3JD2 A;  3CCS V;  3MDS A;  1NR7 A;  4EB6 B;  5CBH A;  4DW1 A;  1K7D A;  2M6Y A;  3DXR A;  3CCJ V;  4FM2 A;  1HNX O;  5KAF Z;  2V1D A;  4TV9 A;  4LH7 A;  4BIZ A;  2OTJ V;  3HKB B;  1PKX A;  1OHH G;  1THZ A;  4O2B B;  2KSD A;  5K1X A;  1UFI A;  1P7G A;  5BMV B;  3QO7 A;  4KP4 A;  3CYO A;  1X4T A;  1Z5W A;  5BR8 B;  3F5T A;  1Y74 A;  2PUS A;  4B3S O;  2ZIN A;  1NR1 A;  5LOV B;  4KFM A;  2GTA A;  2P6J A;  3CRQ A;  3ZN1 A;  4YJ2 A;  4JYC A;  4FLV A;  2ETN A;  4WFA V;  4XBF A;  3AG4 C;  3ZX6 A;  5LXT B;  1HR0 B;  1JOY A;  2Q4P A;  3ZMV A;  1OCR B;  4QPK A;  1VQL V;  4R6Z A;  5ITZ B;  3H1K H;  4LFB B;  1R73 A;  1X59 A;  4DR7 O;  3BA9 A;  3HKD B;  5DED A;  2ZM6 O;  1YEW A;  4PEL A;  2YID A;  2UXB O;  1F23 A;  3UT5 B;  3R66 A;  1IBK O;  2EIK B;  2L6L A;  4B08 A;  1S3J A;  5A9G A;  4I50 A;  1BCC H;  3SGI A;  4I0X A;  3WB2 A;  1TUB B;  5BY1 A;  1FXK A;  2Q0A A;  3OMN B;  1MAB G;  1NI8 A;  5IJ9 A;  3HKE B;  4JI3 O;  3ZIA G;  1OCC B;  2DWE C;  4WBN A;  3CCM V;  5KHI A;  3AG7 A;  4LF7 O;  4HBN A;  4FFK A;  1CPY A;  2CTW A;  4FLT A;  3OTO O;  5FLX N;  4EFE A;  1VQM V;  2IJJ A;  3DTU B;  1H2G A;  2YXL A;  1D5A A;  1BQ0 A;  1Z2G A;  4TT3 G;  4XDL A;  5IJ0 A;  4WFB V;  1FJG O;  3A8T A;  5GON B;  3E83 A;  1YF2 A;  4WFG A;  2E76 B;  1EM1 A;  4GX5 A;  2HLD G;  2HKO A;  1S5J A;  4UB8 Z;  2EIK C;  1NZ6 A;  3APQ A;  4IIJ A;  3CXC U;  3S3W A;  3BRC A;  1ZAU A;  3OTF A;  1K4D C;  4WCE V;  1PNK A;  1V55 B;  3RYI A;  1VQ4 V;  3CCQ V;  2JGD A;  3CWB H;  3G71 V;  1S5L Z;  1SES A;  1VQO V;  2WLM A;  3JSN A;  4DV2 O;  4I4T B;  1H8E G;  5L3D A;  3H1J H;  1UPG A;  2KQX A;  2BTO A;  3ZHR A;  1AI7 A;  4CS4 A;  4YY3 O;  1TAE A;  4WFE A;  3K06 A;  2YIB D;  1H2L A;  1PNM A;  5HFM A;  2C2A A;  4MS2 A;  3OFN G;  3BAA A;  3FKS G;  4FLZ A;  3RYF B;  1GM8 A;  1RFY A;  4NXM B;  1P84 F;  4X8A A;  3CCE V;  3UO2 A;  1KEC A;  4IHJ A;  1N4C A;  2QKC A;  5EBM C;  1LUW A;  1ROP A;  3ZRX A;  1KC8 W;  3ZRS A;  4UCR A;  3KG2 A;  3AEI A;  4LF6 B;  3G80 A;  5LMN O;  3S3X A;  5IYD O;  4LF5 O;  3X2Q C;  4PDR A;  4LR3 A;  4X62 B;  4Q20 A;  5B3S C;  1AP6 A;  3SYO A;  1XMO B;  2P5O A;  3IJ4 A;  1JX9 A;  1SQX H;  3K04 A;  5DEC A;  5IY5 C;  4DR5 B;  4UCV A;  2PF4 E;  4AQY B;  4RUE A;  4JTC B;  1M93 A;  4JYA B;  1XQ8 A;  4W4K A;  1GMG A;  2F95 B;  1GN4 A;  1IBL O;  4RUF A;  3T2M A;  3UKM A;  3G67 A;  3LNM B;  3FX7 A;  4J7K A;  4IYH A;  1IXM A;  1SQP H;  2DQ0 A;  1GN2 A;  3SPH A;  2ZXW B;  1B6Q A;  3JAS B;  4LH6 A;  2YXY A;  5C93 A;  3J7A U;  4DV1 O;  4GKK B;  1HWY A;  1M9N A;  1V54 B;  4P30 A;  2F93 B;  3CCU V;  1QR8 A;  3QG5 A;  5FPO A;  2RMK B;  2P90 A;  3VQV A;  4QE9 A;  5B1B B;  4CS3 A;  2F43 G;  4YIP A;  4X66 B;  3K0D A;  2VQF O;  2JEX A;  1ZL8 B;  3N27 A;  1MSD A;  3T1Y B;  4F6R A;  2CTR A;  2CUG A;  3A2F A;  4CH3 A;  3JD3 A;  2PI5 A;  2Q69 A;  2HJD A;  1HNX B;  4U3J A;  4DR1 B;  5FPR A;  4KL1 A;  3ZRW B;  4PA3 A;  4DR3 O;  5H6Q A;  3ASO B;  3HKC A;  5B1O A;  1XMQ O;  1EFR G;  2D2C B;  1SQB H;  3WG7 B;  3HKE A;  4FK5 C;  3OMA B;  1K92 A;  1V9P A;  4GLX A;  2IJI A;  2G38 A;  2Q8V A;  1YDX A;  2ZXW C;  2Q7E A;  3CRC A;  5LGU A;  4P9O A;  5CMU A;  1W2B U;  4DV5 B;  5IYZ A;  4B3S B;  1GK9 A;  4X64 B;  1YZB A;  5EIB D;  2F4V O;  5EBL C;  3VBB A;  3ZRV A;  1G4Y B;  3ETQ A;  3TGU H;  5CBG A;  2PI4 A;  2RN9 A;  3JAT A;  1K34 A;  5DM6 V;  4ZOL B;  3JCU Z;  4BW9 A;  1JPX A;  2JRI A;  3C3T A;  1W59 A;  3OGI B;  2CTP A;  3ASO C;  2Q7G A;  3UQ8 A;  4GKJ O;  1FFX B;  4DR7 B;  1BS3 A;  2ZM6 B;  1GRJ A;  4B3R O;  1AJN A;  4EEQ A;  1IBK B;  1VF5 B;  1MNG A;  3K58 A;  2E5L O;  1U97 A;  4K0K B;  3IC7 A;  4MW8 A;  2YSU B;  2XAG A;  1AR4 A;  3QTC A;  2HVJ C;  4E2L A;  4NTW A;  2OCH A;  3MHH C;  4B3T O;  1N0N A;  3P3N A;  2JK5 C;  5FNV B;  2EZO A;  1TUE B;  3U0Z A;  2QEX V;  1Q81 W;  3ASN C;  4PV1 B;  1OCO B;  4R50 A;  1WJZ A;  3AG3 B;  4AI8 A;  2BSK A;  2GDS A;  4H13 B;  2DQ3 A;  4UCT A;  1QVG U;  2LGQ A;  3O65 A;  2UUB O;  4H33 A;  1YHQ V;  3APO A;  3D3Q A;  4LF9 O;  5EYP B;  3JAW B;  2WPD G;  4IGG A;  2W6J G;  2YEV B;  2AGA A;  2AHY A;  4WFF A;  1R3I C;  4LF4 B;  1FS0 G;  3WB0 A;  5KMG A;  4DV2 B;  1W0K G;  1O9H A;  3EXA A;  2HHH B;  5JJN B;  3I56 V;  4C7U A;  2PZS A;  3SR2 C;  5L3B A;  2YC0 A;  4ZI7 B;  4LF8 O;  4JAV A;  1P7B A;  4NVP A;  1ORQ C;  1JFF B;  4MVM A;  4CH5 A;  4YY3 B;  1R3L C;  5LBQ A;  5IYC O;  1RSO A;  1G6U A;  4DRX A;  1NH2 D;  3ZJZ A;  1Z5V A;  4JI8 O;  4O4L B;  2JGU A;  3AG3 C;  5GTH Z;  4BIO A;  3T4D A;  1E1R G;  1AR5 A;  4O2A A;  2GHY A;  4ZHQ B;  1I0H A;  2YIA A;  2VQE O;  5BXZ A;  3RYH B;  3OGC C;  5LMU O;  5GW7 A;  1R3J C;  4JI4 O;  3RWR D;  3K9S A;  4IYI A;  5CN0 A;  2CH7 B;  4OGQ B;  4GUN A;  4J41 A;  5KX5 B;  4D7T A;  1RM1 C;  1JQ0 A;  2QM8 A;  3RYC B;  3E86 A;  4TUY A;  1W0J G;  4FVM A;  1WNS A;  1ZL8 A;  2F66 C;  4UCS A;  2A79 B;  5LGT A;  3L70 H;  4I55 B;  5E1A C;  4LF5 B;  1YTF D;  2V4D A;  4UVA A;  2GUZ B;  2F23 A;  3LSU A;  2K1E A;  2BE3 A;  1FFT B;  3JSL A;  2ZR3 A;  3FFQ A;  3TCU A;  1VQN V;  3B40 A;  1Y6X A;  2EJ7 A;  3E22 A;  1TA8 A;  4GYC B;  1AB3 A;  5LP6 B;  3FAV A;  4JZG A;  3ZED A;  2XAF A;  1BGY H;  4IT5 A;  4RQE A;  1DF5 A;  4CZZ A;  1IBL B;  3CEI A;  1NH2 B;  4X1I B;  5IE9 A;  5GTI Z;  1JJ2 U;  1OCZ C;  5C8Y B;  1QLE C;  4DUY O;  2OYQ A;  5EZY A;  3IGA C;  1QHT A;  4WFH A;  2WLL B;  3SPC A;  1Q86 W;  2Q73 A;  4DR2 O;  1M1K W;  4O4J B;  4TSF G;  2IW5 A;  1G1X B;  3K3W A;  4TWK A;  5LGN A;  2IU3 A;  3GWO A;  4DV1 B;  4HNA A;  1CXZ B;  2ZIM A;  1R1B A;  2X6C A;  1IXB A;  1I08 A;  1N33 O;  1K5S A;  2ZCE A;  3O9O A;  2AXT Z;  4BIU A;  3SPI A;  2VQF B;  1WA8 A;  2KG7 B;  5B1A C;  4UVC A;  4DV3 B;  2N74 A;  3F5W C;  4GX1 A;  2EIN C;  1AJP A;  3H1I H;  3LUT B;  3NXS A;  4JI0 O;  3CS5 A;  1YTF B;  2QJ1 A;  1M56 C;  4MVR A;  2ZE7 A;  4DR3 B;  4DK0 A;  2CK3 G;  1SC5 B;  3E8G A;  1Q82 W;  4L8J A;  5D5Q A;  2OT5 A;  2XAJ A;  3ZHQ A;  1S72 V;  2JVD A;  1BZK A;  4JTD B;  1EN5 A;  4DV6 O;  1US6 A;  3PN1 A;  2XT9 A;  3T1H O;  1XI1 A;  2ILM A;  3K57 A;  2A0L A;  1FAF A;  1U96 A;  1BT8 A;  4X1K B;  4F4L A;  1QCE A;  2F4V B;  3TJT A;  1SQV H;  4JZ2 A;  4MSW C;  2FL4 A;  2UXC O;  5KHH A;  4OX9 O;  5H9C A;  4DV4 O;  4B3M O;  1SA0 B;  2UXN A;  5E79 Z;  2Y69 B;  3N2K B;  2LFS A;  3HR0 A;  3GVM A;  3K9A A;  3BPZ A;  3OD4 A;  4LBE C;  1N36 O;  1S76 D;  3K5N A;  1KUQ A;  1E1Q G;  2ZD9 A;  4UCU A;  5EC2 C;  2XUM A;  4G27 B;  1RPR A;  4J9Y B;  5EC1 C;  1SS3 A;  1M5I A;  4RWU A;  1BHB A;  2XOK G;  1D2D A;  4JPR A;  1S77 D;  3LSQ A;  5IYB O;  4G28 B;  4NYK A;  4PI0 A;  4DW0 A;  1VQ9 V;  1NU1 H;  4K8Z A;  1Q43 A;  2UUC O;  1T5E A;  5J2T B;  1O9G A;  5LHI A;  3CJH B;  3ZBH A;  2IBZ H;  3RW0 A;  3UO3 A;  4FM1 A;  4DYL A;  3CC4 V;  3LNN A;  4UXN A;  5LA6 B;  3TXQ A;  5DN6 G;  1SF9 A;  3OEH G;  2P06 A;  4I7Z B;  2BTQ A;  2GV9 A;  1QR9 A;  3JYC A;  4H44 B;  1YI2 V;  4ASU G;  4LF9 B;  3ZMZ A;  4I55 A;  4D6T H;  2H3O A;  1AIL A;  2YS8 A;  4PDL A;  1TVK B;  1XDC A;  2ZE5 A;  4NKG B;  1OCR C;  2W0X A;  3MD0 A;  4LWS B;  2Z3Y A;  4NTX A;  2EUL A;  1JVM A;  3UM7 A;  5CA0 B;  4NR1 A;  4X1Y A;  5KA5 A;  2ZT9 B;  2B1G A;  2DWD C;  2UUA B;  4LF8 B;  2ZNJ A;  1EN6 A;  4XDK A;  5AG2 A;  1OV9 A;  4Z1V A;  3QO8 A;  4UVB A;  3EHB B;  4JI6 B;  4JI8 B;  1I5Y A;  2GTS A;  3A0H Z;  3IFX A;  1KP3 A;  4TV8 A;  4JI5 B;  4UV8 A;  5J2U B;  3ZCC A;  2VQE B;  4O4J A;  2JJ1 G;  1OCC C;  3DSQ A;  5KHJ A;  1OZ0 A;  2KB1 A;  5LYJ B;  1FKA O;  4ZKI A;  2A7W A;  3JAR B;  1GKF A;  2LP7 A;  2A9H A;  2FTK A;  3Q4H A;  2N05 A;  1Y66 A;  1XNQ B;  2X0L A;  1WP8 A;  1NBM G;  3K08 A;  4O4I B;  3SYQ A;  2QM7 A;  4PDV A;  2ARH A;  4CC5 A;  5HFL A;  1F4M A;  4PA7 A;  1OJH A;  3QVN A;  2VWK A;  3VQW A;  2XAS A;  4BR6 A;  1TGO A;  1V55 C;  2UU9 B;  1S0V A;  5JVD B;  4EB6 A;  2CAZ C;  2P4K A;  5KHG A;  4NXN B;  2QWP B;  3HB3 B;  2BOB C;  3GB7 C;  4Z2W A;  4FLU A;  3MAQ A;  4B7K A;  2E74 B;  2HR3 A;  4LFC O;  1KYO F;  2WA4 A;  4EKW A;  5IWA O;  2QWR B;  2PYL A;  3HKB A;  3STZ C;  2UXD B;  4O2B A;  5H2F Z;  2FYU H;  3JAL B;  4FPP A;  3ZHS A;  3ZMT A;  2ITC C;  3A0R A;  2HJF C;  3ABT A;  4LP8 A;  4DR2 B;  5BMV A;  1K97 A;  1R3K C;  1SA0 A;  2KKW A;  2QTO A;  3N2K A;  4JI7 O;  5CA1 B;  3B4S A;  1XIL A;  4MVS A;  5LOV A;  1BSM A;  3N2G B;  1VQ5 V;  1N33 B;  1F51 A;  1E79 G;  2P7T C;  4X9Q A;  3CB2 A;  4DR6 O;  5JJE B;  5LXT A;  2EX3 A;  1M90 W;  2EIM B;  2QE7 G;  1AVM A;  2DYS B;  5KUK A;  1J5E B;  4HAM A;  3OW2 U;  4JAA A;  1K5Q A;  2FKX A;  1Y76 B;  1VAR A;  3CC2 V;  5ITZ A;  1H38 A;  4QGP A;  4LFA O;  3HKD A;  1GN3 A;  4U7N A;  4J9Z B;  4J7Z A;  1IBM O;  3UT5 A;  3BY6 A;  4O4H B;  2EZP A;  2ZE6 A;  3E8H A;  3PJS K;  4DV6 B;  2JS5 A;  2DYR B;  3CJH A;  2GSM B;  1K4C C;  4JGS A;  1R6T A;  2MK3 A;  5F2V O;  1YIT V;  5CB4 B;  1TUB A;  1SET A;  1WN7 A;  1FYJ A;  1NS1 A;  3ZN0 A;  1FPO A;  1PV0 A;  3K59 A;  3TXS A;  1DF4 A;  4QPJ A;  3CD6 V;  1HNW O;  2UXC B;  2OWO A;  4YJ3 B;  4OX9 B;  4QE7 A;  1FXH A;  1NQT A;  2X6B A;  5JJJ B;  4DV4 B;  4B3M B;  4DV0 O;  1TVK A;  2QKA A;  3RVY A;  1V54 C;  2QDO A;  3C3S A;  3KCY A;  4X20 B;  2Q9L A;  1WPX A;  4FZ0 A;  2YDE A;  1N36 B;  5JH7 B;  5B1B C;  4YXW G;  5GON A;  2OCC B;  3P32 A;  2Y48 A;  1XL4 A;  2LW1 A;  3A0B Z;  4J11 A;  1QBZ A;  3ETD A;  1IZ3 A;  1G8M A;  1NJI W;  3M7M X;  4PJ0 Z;  4K3A A;  1ZUQ A;  1K9M W;  3VOU A;  1K8A W;  3KKY A;  2LFR A;  1HDJ A;  2R72 A;  3L72 H;  3L74 H;  3JAK B;  4I4T A;  3WG7 C;  3LDD A;  2LGW A;  5JQG B;  2UXB B;  4FMT A;  4K8X A;  2UUC B;  2WA3 A;  4RO2 A;  1AJQ A;  3W7W A;  2WLI B;  2R9R B;  3CXH F;  3OAA G;  3K79 A;  2PYJ A;  1MG1 A;  5D5P A;  3AG1 B;  3CRR A;  4PI2 A;  4JI3 B;  3CE2 A;  1ZX3 A;  2R9A A;  2EIJ B;  2H94 A;  2WLH A;  3RYF A;  4LF7 B;  3VQY A;  1MSW D;  3OTO B;  1NVP D;  4FZ1 A;  2X6A A;  2LJ2 A;  3B09 A;  3T4Z A;  3SYC A;  1NT2 B;  1FJG B;  3DXR B;  3ML0 A;  1BL8 A;  3U10 A;  1Q5O A;  1ENV A;  4TV9 B;  3B8M A;  3J80 N;  3LSS A;  1KMI Z;  3E8B A;  1KU9 A;  2WLK A;  2ZQM A;  3K0G A;  5L3C A;  3JD0 A;  4LC1 A;  5K1P A;  4QJF B;  2E75 B;  3AG1 C;  3FB6 C;  1L0N H;  4MTO A;  1L8D A;  5IDJ A;  3B8N A;  2DJV A;  1ARO P;  2K9P A;  2Q7H A;  1IDS A;  4CH6 A;  3OUF A;  3T1C A;  1Y74 B;  1K3E A;  2OTL V;  4CBC A;  1OCO C;  2CGO A;  4MTG A;  4BW5 A;  3FB7 C;  4AHC A;  2Q5Z A;  2YIB A;  1GN6 A;  3BVO A;  4DXW A;  2HP8 A;  4YJ2 B;  1QQC A;  2IH1 C;  4P2Z A;  3B2E E;  3BHP A;  4GX0 A;  3JAS A;  2A3Q A;  4B7E A;  2QWO B;  3CRM A;  3ABL B;  2QTS A;  1ZWI C;  1PNL A;  1NVP B;  1YCI A;  2EIL B;  4Z1M G;  2QM4 A;  2QWN B;  4IL6 Z;  1KKD A;  3M99 B;  2NNU A;  4MT8 A;  3D3I A;  1WLE A;  4H37 A;  3ABM B;  5LMN B;  3B77 A;  1YJN V;  3ZRW A;  4I50 B;  3W7U A;  5KHK A;  5IWA B;  2N04 A;  2DN9 A;  3ABK B;  4I0X B;  4X65 O;  1FXK B;  3KCX A;  3CCV V;  5IJ9 B;  2P67 A;  5BZB A;  1EBO A;  1IUR A;  4WBN B;  2H8P C;  1PM9 A;  1Q6U A;  2ZDI C;  5EK0 A;  2NN4 A;  2Z0A A;  1YVW A;  4JI7 B;  1N34 O;  1YJ9 V;  1K73 W;  3ZMS A;  4N21 A;  4X88 A;  5JH7 A;  4JI2 O;  2HG5 C;  3WB1 A;  3SJB C;  3CCL V;  5LHH A;  3I5D A;  4LF6 O;  3U11 A;  2WSS G;  3SJQ C;  1M57 B;  2R70 A;  4FJC C;  4ZOL A;  5KLV H;  3OR6 C;  1MZF A;  3SDL A;  5JWP A;  4P9P A;  4IIJ B;  3CMA V;  1P49 A;  4K35 A;  1DTO A;  1XUQ A;  1IX9 A;  2XND G;  3RYI B;  1WB8 A;  1QU7 A;  1Q8I A;  3D36 C;  1FFX A;  2EBO A;  1MMM A;  1D5N A;  5H6R A;  2RQ6 A;  3BA8 A;  4JAU A;  2IJH A;  2PTM A;  4BWA A;  2JDI G;  1BE3 H;  1IBM B;  4PD4 F;  2VWJ A;  3K5M A;  3JCZ A;  5LP6 C;  3I55 V;  3AK3 A;  1L1F A;  4FLY A;  4ZBM A;  3RFR A;  4KHP O;  2L35 A;  1BQZ A;  2DMX A;  1MA1 A;  1XMQ B;  1Q6I A;  2OIG A;  4J7J A;  2YI8 A;  4GKK O;  1HNW B;  5FNV A;  4PDM A;  3JD4 A;  1Y4M A;  2WLJ A;  4QNH B;  1AI4 A;  4IHJ B;  4L87 A;  2ZKO A;  1GH6 A;  3BCC H;  5LHG A;  2RNB A;  4X66 O;  5TIS Z;  2FB5 A;  3T1Y O;  1KQS U;  2HFE C;  5EYP A;  3AG4 B;  4TOI A;  3JAW A;  3FYI B;  3IC9 A;  4DR1 O;  1JMK C;  2YEV A;  1VF7 A;  3ZHT A;  2NR5 A;  1F4N A;  1DGS A;  2W6I G;  1VP7 A;  1WAZ A;  3DC5 A;  4GKJ B;  1QNM A;  1H2S B;  1J95 A;  1N0J A;  2HVK C;  1GM9 A;  1HW7 A;  1YXB A;  1GO3 F;  1ZSP A;  4B3R B;  4ZI7 A;  4NB5 A;  3G6E V;  4GCZ A;  1JFF A;  3OT7 A;  2ODM A;  1M4U A;  3QO5 A;  4DV5 O;  1XEQ A;  4O4L A;  4X64 O;  2E5L B;  3HPL C;  2Q6A A;  4ZHQ A;  2BOC C;  4UCO A;  4UUJ C;  3RYH A;  1KD1 W;  3KZI Z;  3R65 A;  4H0L B;  4B3T B;  3E2E A;  2CGN A;  1LUV A;  1NTK H;  2ZDI A;  2CH7 A;  3CME V;  5KX5 A;  2WLN A;  1VQ6 V;  1K33 A;  2Y69 C;  4LNU B;  4JTA B;  3E8F A;  1PL0 A;  4JYY A;  4NTY A;  3RYC A;  1SZX A;  3EVK A;  2UUB B;  3GWK C;  2P22 C;  1SRY A;  4F6R B;  4OXS A;  3H01 A;  4K0K O;  2CTQ A;  4U3J B;  5CA3 A;  2GUZ A;  3D36 A;  3HKC B;  3P3P A;  5EBW C;  4GZR B;  3SPJ A;  2RJZ A;  1Q6H A;  1VQP V;  3M8A A;  1I94 O;  3RT3 C;  3D8C A;  3OUS A;  3STL C;  2AW9 A;  1HNZ O;  5LP6 A;  4DK1 A;  1PD3 A;  4PA4 A;  4N23 A;  4WF9 V;  3ZHU A;  4UB6 Z;  4X1I A;  5IYZ B;  3H1L H;  5C8Y A;  2NLJ C;  5JCO C;  1JA8 A;  2CE4 A;  4YIO A;  1VMG A;  2WLL A;  1I5X A;  4KXR A;  1MZE A;  1Q3E A;  5LMU B;  3SYA A;  3JAT B;  4JI4 B;  1CEZ A;  2Q68 A;  2AHZ A;  4GT1 A;  2XTA A;  4I9W A;  1KP2 A;  4EFB A;  3CCR V;  4LF4 O;  2YIC A;  2MW2 B;  4KUM A;  2HHH O;  3DC6 A;  3SJC C;  4DV7 O;  1SQF A;  5LL6 Y;  2JEU A;  2KG7 A;  5KUM A;  4I5S A;  1ZLZ A;  1XNR O;  3X2Q B;  2AZ2 A;  2PY5 A;  1QLN A;  2EJR A;  1Y67 A;  1BHA A;  3FB8 C;  3BEH A;  3RGB A;  1AI6 A;  2DOS A;  1WPB A;  5B3S B;  4CS2 A;  4X65 B;  2YUA A;  5IY5 B;  1B06 A;  1XHX A;  1SER A;  4HZ3 A;  1SKV A;  4U7O A;  4FLW A;  3CPW U;  1FD9 A;  4MW3 A;  1VIB A;  1JCH A;  2BSK B;  1EZJ A;  2Q67 A;  2LO1 A;  4X1K A;  1N34 B;  3BAB A;  2GBO A;  2IM9 A;  4DUY B;  3UCS C;  4JI2 B;  4DUZ O;  2XHB A;  1VF6 C;  3SJA C;  3CSX A;  1KKC A;  1S5H C;  1I7F A;  3E35 A;  1NTM H;  4PHZ A;  3L9D A;  2YXH A;  1VQ8 V;  3K03 A;  1H8H G;  2UXX A;  3FB5 C;  3RN4 A;  1H2N A;  2Z5U A;  1N32 O;  4W4L A;  4UV9 A;  4G2K A;  5KMG B;  2CDY A;  2B9Z A;  3AG2 B;  1AI5 A;  1H2K A;  4U3F H;  1SZT A;  1RSO B;  4DRX B;  2XAH A;  2D3O W;  4YHH O;  4JI0 B;  4D7S A;  4GX2 A;  4O2A B;  2DW4 A;  3AK2 A;  4KHP B;  4CC6 A;  3J81 N;  4ZIB A;  4A5U B;  1COW G;  1A32 A;  3OEE G;  3QNE A;  4I9Q A;  5J2T A;  3VQX A;  2B5U A;  4FIP C;  4DR4 O;  1URF A;  2ATK C;  3ZS8 C;  1R6N A;  3T1H B;  4LNU A;  4JYB A;  4OPA A;  5LA6 A;  2QKS A;  5JCO A;  4JI1 O;  3W7S A;  1KBH A;  1EN4 A;  2QGN A;  4TUY B;  3AG2 C;  3F7V C;  3JD1 A;  4DV3 O;  3EFF K;  3W7T A;  2EIM C;  1CP9 A;  2DYS C;  2ADP A;  4JV5 O;  4J10 A;  2LW7 A;  3CP1 A;  4LWS A;  1DK1 A;  1YSC A;  3OR7 C;  3OE7 G;  2LQT A;  2ZNI A;  3E22 B;  5CA0 A;  1B3Q A;  2V7Q G;  4X89 A;  3FAV B;  2FML A;  4OPH A;  5IT9 N;  2DYR C;  1GM7 A;  2ZR2 A;  2VS0 A;  4FFB B;  5EZY B;  5KAI Z;  1AP5 A;  2OIE A;  2RCV A;  3K5O A;  5J2U A;  3H9V A;  1Q7Y W;  4JF3 A; 
#chains in the Genus database with same CATH homology
 2ZD9 A;  5EBM C;  3ABK B;  3F7Y C;  1ROP A;  5EC2 C;  4G27 B;  1FXK B;  1RPR A;  3ASN B;  3CCV V;  4J9Y B;  5EC1 C;  3ZRX A;  1KC8 W;  3ZRS A;  2B1I A;  2P67 A;  5BZB A;  1EBO A;  5L3F A;  3TET A;  3SYP A;  3KG2 A;  2XOK G;  1BHB A;  2H8P C;  4JAS A;  3AEI A;  4JPR A;  5IYD O;  3X2Q C;  4PDR A;  1S77 D;  2ZDI C;  5EK0 A;  3LSQ A;  5IYB O;  1R6K A;  4G28 B;  1RPO A;  2WAM A;  1VQ9 V;  2OCC C;  3E89 A;  1YJ9 V;  1K73 W;  3ZMS A;  4N21 A;  5LHI A;  4RAI A;  4X88 A;  4Q20 A;  2HG5 C;  5B3S C;  3SYO A;  3CCL V;  3RW0 A;  5LHH A;  1JX9 A;  3RVZ A;  3K04 A;  4UXN A;  5IY5 C;  4XDJ A;  3CC4 V;  2WSS G;  5DN6 G;  4RUE A;  3SJQ C;  1M57 B;  4JTC B;  4FJC C;  3OEH G;  3OR6 C;  1GMG A;  4P9P A;  3CMA V;  4RUF A;  3T2M A;  1QR9 A;  3JYC A;  5L3G A;  1DTO A;  1XL6 A;  2XND G;  3LNM B;  3UKM A;  4ASU G;  1YI2 V;  5B1A B;  3ZMZ A;  1IXM A;  2DQ0 A;  2EBO A;  3G4S V;  5H6R A;  3SPH A;  4PDL A;  2XAQ A;  4JAU A;  2ZXW B;  2IJH A;  4R7C A;  1B6Q A;  1DLB A;  5KA6 A;  2JDI G;  1OCR C;  3OM3 B;  5C93 A;  3MD0 A;  2Z3Y A;  1HWY A;  1M9N A;  3JCZ A;  1V54 B;  4MVO A;  4P30 A;  3I55 V;  1QVF U;  1L1F A;  3CCU V;  1QR8 A;  1JVM A;  3LDC A;  4ZBM A;  3UM7 A;  1UJW B;  2M7W A;  2P90 A;  5KA5 A;  4QE9 A;  2B1G A;  5B1B B;  2EIJ C;  3ZMU A;  5B1N A;  2DWD C;  5FL7 G;  2F43 G;  1YJW V;  4LCU C;  3K0D A;  4XDK A;  1RM1 B;  2JEX A;  4PA6 A;  3QO8 A;  4UVB A;  2W0F C;  3EHB B;  1I5Y A;  3TK1 A;  3DGE A;  3IFX A;  1KP3 A;  3JD3 A;  2PI5 A;  4PDM A;  2Q69 A;  3JD4 A;  1Y4M A;  1MOF A;  2WLJ A;  2X7R B;  4UV8 A;  3ZCC A;  4QNH B;  3ZRW B;  4PA3 A;  1AI4 A;  4BAY A;  4L87 A;  2JJ1 G;  5H6Q A;  1OCC C;  3ASO B;  5B1O A;  5LHG A;  1GTO A;  1EFR G;  1OZ0 A;  2KB1 A;  3WG7 B;  4FK5 C;  3OMA B;  4ZKI A;  1KQS U;  1K92 A;  2HFE C;  1GKF A;  2IJI A;  2OTL V;  2LP7 A;  3SPG A;  3AG4 B;  2A9H A;  2ZXW C;  3P30 A;  2FTK A;  3FYI B;  5LGU A;  1NKD A;  1Y66 A;  4DO2 A;  2X0L A;  4P9O A;  5CMU A;  1NBM G;  2JIZ G;  2YEV A;  3K08 A;  4RQF A;  1W2B U;  1F4N A;  5L3E A;  3SYQ A;  2QM7 A;  2W6I G;  4PDV A;  1GK9 A;  2IH3 C;  1BMF G;  1FXV A;  5EBL C;  3VBB A;  3ZRV A;  1G4Y B;  5HFL A;  5CBF A;  1F4M A;  4PA7 A;  5CBG A;  1J95 A;  2PI4 A;  1OCZ B;  1QLE B;  2HVK C;  2XAS A;  3W7X A;  1GM9 A;  1GO3 F;  1K34 A;  1V55 C;  5DM6 V;  4HYO A;  3RBZ A;  1S0V A;  3G6E V;  4GCZ A;  3QO5 A;  1JPX A;  2ITD C;  3HB3 B;  3HPL C;  1VQ7 V;  2BOB C;  3GB7 C;  3ASO C;  2HR3 A;  2Q6A A;  2BOC C;  4QIW F;  4UUJ C;  3MHS C;  1KD1 W;  4EKW A;  3ABL C;  3R65 A;  3E2E A;  3STZ C;  1AJN A;  2ZDI A;  2EIL C;  5J9P C;  3CME V;  1N8R W;  3CC7 V;  2WLN A;  1VQ6 V;  4FPP A;  3ZMT A;  1K33 A;  2Y69 C;  2ITC C;  3A0R A;  3IC7 A;  2HJF C;  2YSU B;  3ABT A;  3ETG A;  4JTA B;  2XAG A;  4LP8 A;  4MW8 A;  1K97 A;  2HVJ C;  3E8F A;  1PL0 A;  1R3K C;  2EIN B;  4E2L A;  1YIJ V;  4R8C A;  4PA9 A;  3ABM C;  2QTO A;  3MHH C;  2WWW A;  1M56 B;  1SRY A;  2JK5 C;  2IJK A;  2JJ2 G;  4MVS A;  4MVU A;  4OXS A;  1VQ5 V;  3ABK C;  2EZO A;  1F51 A;  1TUE B;  2QEX V;  3H01 A;  1Q81 W;  1E79 G;  1FXK C;  3ASN C;  3OMI B;  4MVQ A;  1OCO B;  1P4R A;  4MTF A;  2P7T C;  3ETE A;  4R50 A;  3AG3 B;  2DQ3 A;  4MVZ A;  5CA3 A;  2IU0 A;  3D36 A;  1QVG U;  1M90 W;  2EIM B;  2QE7 G;  2DYS B;  4H33 A;  5KUK A;  4HAM A;  5EBW C;  3OW2 U;  1YHQ V;  1K5Q A;  3SPJ A;  2WLI A;  4MTX A;  1VQP V;  1VQK V;  3CC2 V;  1H38 A;  2WPD G;  3OUS A;  3FYE B;  3STL C;  1PD3 A;  4PA4 A;  4N23 A;  4WF9 V;  2W6J G;  2YEV B;  4U7N A;  4J9Z B;  1AR1 B;  2AHY A;  2QA4 V;  4WFF A;  1R3I C;  3ABU A;  3BY6 A;  2EZP A;  2R9I A;  1LNQ A;  3E8H A;  1FS0 G;  2NLJ C;  3LDE A;  1M57 C;  3PJS K;  2DYR B;  2GSM B;  2WLL A;  1K4C C;  1I5X A;  4JGS A;  1W0K G;  2MK3 A;  1YIT V;  3I56 V;  3SYA A;  1CEZ A;  5L3B A;  3WFV A;  2Q68 A;  2AHZ A;  1SET A;  4GT1 A;  3JD2 A;  3CCS V;  4JAV A;  4I9W A;  1P7B A;  1ORQ C;  3ZN0 A;  1KP2 A;  1NR7 A;  4MVM A;  3CCR V;  1R3L C;  5CBH A;  5LBQ A;  5IYC O;  1K7D A;  1NH2 D;  3ZJZ A;  3CCJ V;  1VQ4 V;  1DF4 A;  4QPJ A;  3CD6 V;  3AG3 C;  3T4D A;  1E1R G;  2GHY A;  4QE7 A;  2V1D A;  1FXH A;  1NQT A;  2X6B A;  4BIZ A;  4KUM A;  2OTJ V;  3OGC C;  5GW7 A;  1R3J C;  3RVY A;  1V54 C;  2JEU A;  5KUM A;  1PKX A;  4I5S A;  1OHH G;  1THZ A;  3X2Q B;  5CN0 A;  1QLN A;  1WPX A;  2EJR A;  5B1B C;  4YXW G;  1BHA A;  3FB8 C;  2OCC B;  3P32 A;  2Y48 A;  1XL4 A;  1RM1 C;  3BEH A;  3QO7 A;  4KP4 A;  1AI6 A;  1JQ0 A;  2QM8 A;  3CYO A;  1QBZ A;  3ETD A;  5B3S B;  3E86 A;  1G8M A;  5IY5 B;  1W0J G;  1NJI W;  1K9M W;  3VOU A;  1K8A W;  1SER A;  4HZ3 A;  2A79 B;  1NR1 A;  4U7O A;  5LGT A;  4KFM A;  2LFR A;  3CPW U;  5E1A C;  2P6J A;  3ZN1 A;  3WG7 C;  4JYC A;  1YTF D;  3LDD A;  4MW3 A;  4UVA A;  4WFA V;  1JCH A;  1EZJ A;  4XBF A;  2Q67 A;  3AG4 C;  4FMT A;  2K1E A;  1JOY A;  1FFT B;  4RO2 A;  1AJQ A;  2ZR3 A;  3W7W A;  3TCU A;  2WLI B;  1VQN V;  2R9R B;  3OAA G;  3ZMV A;  1OCR B;  3K79 A;  4QPK A;  1VQL V;  4R6Z A;  1S5H C;  3E35 A;  1MG1 A;  1R73 A;  3AG1 B;  2XAF A;  4PEL A;  4RQE A;  1DF5 A;  4CZZ A;  1VQ8 V;  3K03 A;  1H8H G;  1F23 A;  2UXX A;  3FB5 C;  1NH2 B;  1JJ2 U;  2EIJ B;  1OCZ C;  1QLE C;  2H94 A;  2WLH A;  2Z5U A;  2EIK B;  3IGA C;  4UV9 A;  4G2K A;  4WFH A;  2WLL B;  1S3J A;  3SPC A;  1MSW D;  1Q86 W;  1NVP D;  3AG2 B;  1M1K W;  4TSF G;  2IW5 A;  2X6A A;  1AI5 A;  3K3W A;  4TWK A;  1FXK A;  5LGN A;  3OMN B;  2IU3 A;  1MAB G;  3GWO A;  3T4Z A;  3ZIA G;  3SYC A;  1SZT A;  1OCC B;  2DWE C;  2X6C A;  2XAH A;  3CCM V;  3ML0 A;  2D3O W;  1BL8 A;  4GX2 A;  1CPY A;  1K5S A;  2DW4 A;  1ENV A;  3B8M A;  1COW G;  4BIU A;  2IJJ A;  3DTU B;  1VQM V;  1H2G A;  3LSS A;  3OEE G;  3SPI A;  3QNE A;  4TT3 G;  5B1A C;  3E8B A;  2WLK A;  2ZQM A;  4XDL A;  3K0G A;  4UVC A;  5L3C A;  4WFB V;  3JD0 A;  4LC1 A;  2B5U A;  4FIP C;  3F5W C;  4GX1 A;  2ATK C;  4QJF B;  2EIN C;  1R6N A;  1AJP A;  3AG1 C;  3FB6 C;  3LUT B;  3NXS A;  4MTO A;  1S72 V;  5IDJ A;  3E83 A;  4JYB A;  1YTF B;  3B8N A;  2QKS A;  1M56 C;  4WFG A;  4MVR A;  2CK3 G;  4GX5 A;  2HLD G;  2HKO A;  1ARO P;  3E8G A;  3W7S A;  1Q82 W;  2EIK C;  3CXC U;  2OT5 A;  2XAJ A;  3OUF A;  3T1C A;  1K3E A;  1K4D C;  4WCE V;  3AG2 C;  1PNK A;  1OCO C;  1V55 B;  3F7V C;  3JD1 A;  4MTG A;  4BW5 A;  4JTD B;  4CBC A;  3FB7 C;  3CCQ V;  3G71 V;  3EFF K;  1SES A;  3W7T A;  1VQO V;  4DXW A;  2WLM A;  2EIM C;  1CP9 A;  2DYS C;  1H8E G;  5L3D A;  2IH1 C;  2A0L A;  4P2Z A;  1AI7 A;  4GX0 A;  3CP1 A;  4F4L A;  1QCE A;  3ABL B;  1YSC A;  3OR7 C;  3OE7 G;  4WFE A;  1ZWI C;  1PNL A;  4MSW C;  1NVP B;  3K06 A;  2EIL B;  2V7Q G;  4X89 A;  4Z1M G;  5H9C A;  1PNM A;  5HFM A;  2C2A A;  2UXN A;  2Y69 B;  1KKD A;  2DYR C;  4MS2 A;  3OFN G;  2LFS A;  1GM7 A;  3K9A A;  2NNU A;  3M99 B;  4MT8 A;  3D3I A;  2ZR2 A;  3FKS G;  1WLE A;  1GM8 A;  4H37 A;  3ABM B;  4X8A A;  4LBE C;  1S76 D;  3B77 A;  3CCE V;  1KEC A;  1YJN V;  3ZRW A;  3W7U A;  1Q7Y W;  4JF3 A;  1E1Q G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...