1VQ5V

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq5V00
3CC4V 3G6EV 1VQMV 3CXCU 1KD1W 3CCEV 1VQPV 1YJNV 2QA4V 3CCMV 1QVGU 1VQ8V 1Q7YW 3CCRV 4WFAV 1Q81W 3CCQV 1QVFU 1NJIW 1KC8W 3I55V 1R73A 3I56V 3CC7V 3OW2U 1K9MW 1VQ4V 1M1KW 1JJ2U 3G71V 3CCSV 3CCUV 2OTLV 1VQ5V 3CD6V 1VQ9V 3CMAV 4WFBV 1VQ7V 4WCEV 1YJ9V 1YJWV 1YITV 1YHQV 1VQKV 1Q82W 4WF9V 3CCLV 1VQLV 3CMEV 1N8RW 1K8AW 3CPWU 1S72V 3CC2V 1VQOV 2OTJV 1W2BU 1Q86W 2QEXV 5DM6V 3CCVV 1YI2V 1KQSU 1YIJV 1M90W 1K73W 1VQ6V 3CCJV 3G4SV 2D3OW 1VQNV
chains in the Genus database with same CATH superfamily
1KD1W 3SYAA 4HBNA 1L0NH 2GTAA 2IM9A 4WFAV 2IH1C 1H2GA 4AILC 1P4RA 3RGBA 5IJ0B 3AG1C 5L3CA 3DC6A 4MSWC 1KKCA 2RCVA 1K3EA 5JVDB 2PUSA 2QTOA 3G4SV 1FS0G 5EYPA 1FXVA 2IW5A 1HNWB 4RAIA 4TUYA 1Y74A 4AI8A 4O2BA 4UVBA 3WB2A 1CP9A 3ETDA 1AI7A 1F4MA 5EYPB 2LGWA 4ZHQB 4K0KO 3PN1A 1RSOB 3CX5F 2ADPA 4XDLA 3STLC 1XDCA 1N32B 1BHBA 1THZA 3CCEV 4JI0B 1K92A 1TVKA 3P3NA 3BHPA 3CJHB 3UT5A 1Q7YW 1Q6IA 1SETA 1K33A 2PY5A 3CEIA 3CCUV 2ZNJA 3P3PA 1AJPA 2MK3A 3RYIA 1XREA 2DN9A 4PA9A 2KG7B 4UCSA 4X62O 1M90W 4LNUA 1JJOA 1SF9A 4DV0O 4DRXB 1XHXA 2G38A 1M5IA 2ZDIC 3E8HA 4FLXA 4FMTA 4LF6B 3O65A 3SYOA 2BTQA 3E2EA 4DV6B 5B1BB 1KMIZ 3CCLV 3VQWA 1SQXH 2DYSC 1N32O 2LFSA 2QGNA 1FFTB 3ZCCA 3HKEB 4X64B 1L1FA 2PI4A 4DV1B 3L75H 1PPJH 1QHTA 3BVOA 3HPLC 2D2CB 4XDKA 4ZOLB 1YITV 1XBLA 1NBMG 3L74H 5B66Z 5LYJB 4EB6B 2XAQA 3OUFA 3TK1A 4G27B 3AG4B 5H5NA 2WA3A 2LO1A 3Q4HB 1ROPA 1PL0A 4I4TA 5FPRA 5IWAB 4BWAA 3OR7C 3JD2A 3MHHC 1M1KW 4DW0A 4U3JB 2V4DA 1XMQO 4RQFA 1OHHG 3A2FA 4RQEA 3HKDA 1K5SA 3JSNA 2P5OA 3JAMN 1UPGA 4KHPB 4ZIBA 1TGOA 4MVOA 2EX3A 3TCUA 3H1HH 1N0JA 2F23A 1W0JG 4GX0A 2P22C 1R6KA 4FJCC 3P32A 2QKSA 4X1YB 1ENVA 2Q5ZA 3FX7A 4AQYB 5EK0A 2E3CA 1IZ3A 1VQ7V 5IJ9A 4J7ZA 5GTIZ 4FLZA 1WNSA 2AHYA 2CH7A 4OX9O 3TXSA 2GSMB 4JZGA 2CGOA 2GDSA 1AP5A 4MS2A 1H8HG 4CS2A 2GHYA 5CBFA 1WPBA 2DE0X 5LA6A 4FVMA 4MVSA 5EC2C 1RSOA 4UCOA 2IBZH 1N34O 1ZLZA 3L9DA 1FXKB 5LOVB 4JV5B 3FB7C 4N23A 1YTFB 1PKXA 2Q68A 3OGIB 1JR9A 3QTCA 2P67A 1GN3A 3M7MX 1EFRG 1E79G 2CUGA 4PA4A 1QVFU 1VQ4V 2DYRB 3ASOB 4MVQA 4LNUB 2ZXWC 3K9SA 2N05A 2QJ1A 5FNVB 1O9GA 4BAYA 4J9YB 4FZ0A 1BQ0A 5J9PC 2NR5A 2AZ2A 2VRZA 4JI5O 4JI3B 4DR2O 2P6JA 4B3MB 4YJ3B 2YUAA 2FMLA 4YHHB 1P7GA 4UB6Z 1KECA 3OGCC 4B7KA 3R65A 3ETGA 1Q82W 1AB3A 3U11A 3UO2A 1ZSPA 3OTOO 4I5SA 4PA6A 2PYLA 1HDJA 4O2BB 3RYHB 3LDCA 1SC5B 3BCCH 4O4HA 4LWSA 3UO3A 1XNQO 2OIGA 3E83A 3EHBB 2HHHB 3E35A 2EINC 3A0RA 3ABMC 5JQGB 5CA0B 1FD9A 4JYAB 3K59A 4X64O 4UB8Z 4MVRA 3K57A 1WN7A 4DK0A 2PZSA 1WP7A 2DJVA 5LL6Y 3CCRV 4RUEA 4DXWA 1OCZB 2QSAA 2CTQA 5EIBC 4DR1O 1IURA 4IYIA 2YSUB 1K4CC 1Q3EA 2HFEC 2XT9A 2WAMA 2E5LO 1IVSA 1K8AW 3OUSA 5CB4B 3MDSA 3CCVV 1SQVH 2P06A 2W0FC 2RQ6A 2VQEB 1BS3A 4JI7O 2Y4TA 5LYJA 4I0XA 4FK5C 5L3GA 2XUMA 1OCOB 3HKEA 4DV1O 3PJSK 3AG2B 1AJQA 3Q4HA 2CDYA 4JI4O 2WLLA 1A32A 5H6RA 1FFXB 3K3WA 1TVKB 4GYCB 2HJDA 2UXDO 1XQ8A 3M8AA 1WJZA 1R3KC 4MW8A 2A7WA 1OCRC 2RJZA 4IT5A 3JALB 3SPCA 4X62B 5KAIZ 3OR6C 2A06H 2LW1A 3LUTB 4LCUC 3HR0A 2RDCA 3RBZA 3SPIA 3CRRA 1EZJA 3QO7A 3AK2A 1YF2A 1H2KA 1MABG 4JI2B 3U0ZA 2A3QA 5IYDO 3G67A 3BABA 3KKYA 4F6RA 2JGDA 4I50B 3K5MA 2Y69C 3GVMA 3AG1B 4X1KB 2Q6AA 5LBQA 3CHXA 4NB5A 5KMGA 5GTHZ 2LW7A 3JATB 3CMAV 2Q0AA 1RM1B 1HR0B 4DV7B 2R9IA 1Y74B 5D5PA 2F1MA 2X0LA 5L3FA 1EN6A 4HNAA 2YEVA 5LHGA 4J7JA 3MHSC 2CK3G 3ZN0A 3RFRA 4F4LA 2OTJV 1D5AA 2BOCC 2YIBD 1R6NA 3CRAA 4N21A 4G2KA 1HNWO 1LR1A 2ZKOA 1H2LA 3IGAC 3DGEA 2RNBA 4JI2O 1V54C 5CMUA 1MOFA 1URFA 3CRMA 2BSKB 1COWG 5E1AC 2YI8A 1M9NA 2IJIA 5JJNB 2JJ2G 5B1AC 3W7SA 4FPPA 1PNKA 1V55B 4X1KA 1L8DA 2FKXA 1KUQA 3JATA 2WLKA 2YXLA 4YHHO 4RUFA 2Q4PA 3ASNB 4H44B 1I5XA 4L8JA 3JD3A 1B06A 5D5QA 1D5NA 1GMGA 1RFYA 4UVAA 5EBLC 2EBOA 3O9OA 2CE4A 4GT1A 4BW5A 2CAZC 1NU1H 2KQXA 2N04A 1HNXO 4J9ZB 3KZIZ 2QWNB 1K73W 2E5LB 3CXHF 4J10A 1EN5A 1M56C 3OTFA 5GW7A 3TGUH 5B5EZ 4DR1B 1Q81W 2B1GA 1FPOA 2Y0IA 1AP6A 2UUBB 3QNEA 4Q6GA 5LGTA 3AG4C 2XTAA 4EKWA 3OFNG 3JD1A 1QLNA 2BSKA 3CMEV 5CA3A 1GM7A 2XASA 5EBWC 1G1XB 1E1RG 1NQTA 2FYUH 5KUKA 1J95A 4DR5B 1BCCH 2AGAA 2ZINA 1I0HA 3SYPA 2ZDIA 2WLNA 2UXXA 2PF4E 3JASB 3VBBA 4B3TO 4DV5O 1YXBA 1TAEA 2OCCB 5EZYB 4X65B 3SJAC 1Q43A 2BE3A 2DMXA 3B77A 4WBNB 2ZE5A 3OMNB 4B3SB 3CYOA 1B04A 4MTGA 3SYQA 1UJWB 1B3QA 1YZBA 5KUMA 5KA5A 1K4DC 3ZRSA 1RPOA 1DTOA 1SKVA 3K0GA 4YXWG 1YJ9V 1NTKH 1TUEB 1K97A 4FLUA 3IC7A 3W7WA 2XAJA 4TWKA 4K8ZA 4PA3A 2CTWA 1KBHA 1QCEA 2QWQB 4OPAA 1XMOB 2M6YA 1FXKC 4B3TB 3ZBHA 2IJHA 3D36A 2ZM6B 2OTLV 1M93A 4RO2A 4NR1A 1VQKV 4GKJB 1MZFA 4WFGA 1N8RW 3L71H 3A8TA 4NXMB 1BZKA 1RP3B 1JOYA 2DYRC 1VMGA 1BQZA 2JS5A 4TT3G 3G6EV 2UXCO 1YCIA 2K9PA 3SJBC 2YDEA 5EIBD 5H2FZ 2EILB 4JI0O 1VQ5V 2Z3YA 3LDDA 4BW9A 2IH3C 3RVYA 3MAQA 4PI0A 1VEWA 1P84F 1P49A 1QU7A 2IJKA 1XNRB 2EIJC 2X6CA 2QWRB 1G8MA 5CBGA 2HLDG 5A9GA 1QNMA 2E75B 4C7UA 4PA7A 4GKJO 3ZMVA 3E89A 4B08A 2JEXA 5CA1B 3OM3B 1XEQA 4BIUA 5B1OA 4FM0A 4P9OA 1VQLV 1Y4MA 3AG3B 1IBKB 3J7AU 1XMOO 3UKMA 3K06A 4IL6Z 1OCCC 4MT8A 2HHHO 1DLBA 2BCCH 5K1PA 3ZJZA 4LC1A 3OW2U 1IXBA 2YI9A 1JJ2U 3G71V 1BT8A 2H94A 1ZL8B 4I50A 2QWOB 4R7CA 2LP7A 5J2TB 4LF4B 5J2UB 4CH4A 3OAAG 3N27A 1PM9A 2R9RB 3C3SA 3UCSC 4JAVA 4FLVA 4B3MO 4P9PA 4LF8O 2EJRA 3ZRXA 3UQ8A 3F5WC 4DR6B 4IHJB 1YJWV 5LGUA 3GWOA 3ZMZA 3T4DA 2AW9A 3CRCA 1K34A 5DM6V 5IYBO 4X8AA 1XNQB 1VQMV 2F66C 2Q0OC 1PL4A 1SA0A 3CCQV 4UCVA 4J7KA 4X66O 5JJEB 4YJ2A 4JAUA 1OCRB 3JALA 2F93B 1GN4A 4I9WA 2CGNA 3LNMB 1YIJV 1P7BA 4LF5O 4QJFB 5JWPA 1JFFA 5KHJA 3VQYA 3HKDB 5J2TA 3EXAA 2JIZG 1GM9A 1NR1A 5BMVB 4F6RB 3OMIB 1HP8A 3S3XA 2Q7GA 1BGYH 3T1HO 2Y69B 3ZMTA 3H1IH 1S72V 4DV0B 1Q86W 2JK5C 2R70A 3ZHVA 4FZ1A 4LF7B 4IHJA 5DEDA 4PDRA 1FFXA 2IJJA 1YJNV 3QG5A 2EULA 5B3SC 2XAGA 2WLHA 5CN0A 1IX9A 4WBNA 4CH5A 2L35A 5KHIA 4TV8B 3X2QB 4KHPO 1YHQV 1Y76A 3B8NA 1PV0A 4DUYO 1MNGA 1YI2V 4XBFA 4D7TA 2O57A 1F7YA 2B5UA 3N2KA 4OPHA 5F2VO 3RYFA 1R3JC 5IT9N 3BA9A 1K5QA 4J41A 2F4VB 1X59A 4DV2B 4MTFA 1NH2B 3E8GA 3OTOB 2OCHA 1HWYA 4Q20A 3TXQA 2ZE6A 4Z1MG 1CXZB 1CEZA 3MD0A 3OEHG 4JYAO 4YY3B 4F6EA 4J11A 4DR3O 3ZIAG 1V55C 1KC8W 2X6BA 2ZR2A 3ZX6A 1X4TA 2VWJA 4WFBV 2BTOA 4O4IB 1GKFA 4JTCB 5TISZ 1F23A 2DQ3A 4GX1A 1SZXA 3FB8C 4JI8O 1F51A 4X65O 4QNHB 1EM1A 1IBKO 2HVKC 2P4KA 4LF7O 3H1KH 3FFQA 4EB6A 4NTXA 3RYHA 3CS5A 5BXZA 4O4JA 5L3BA 2C2AA 5GONB 2ITCC 1BE3H 1SA0B 5JH7A 3ASOC 4JI1O 4DO2A 2A0LA 2HEPA 4GX5A 2JDIG 4BIOA 2QTSA 5LOVA 1TUBB 3RW0A 2ETNA 4JI4B 2Q8VA 5IDJA 1N33O 4JF3A 4DRXA 3UM7A 4RWUA 2DOSA 1G4YB 3K5LA 2VQEO 3HB3B 4JYBA 3W7UA 1FYJA 4WFHA 5A2QN 3JCZA 5IYZA 2OCCC 1QBZA 4ZHQA 4JZ2A 1ORQC 3LSUA 5FNVA 3RYCB 2QKCA 1S0VA 2M7WA 1WB7A 2Y0PA 4O4HB 5IY5C 2QR4A 5KX5B 4YJ3A 1SQFA 3J80N 2EINB 1JVMA 3ABMB 3ZMUA 3SJCC 4IYHA 3D3IA 2XNDG 4PV1B 4JASA 4PELA 3IC9A 5GONA 4FLTA 4MVMA 1O9HA 5CA0A 1WLEA 4LF9B 3K9AA 3QF7A 4D7SA 4NKGB 4MTXA 4LP8A 2ZM6O 4LWSB 3VQXA 2ZQMA 1WB8A 2QEXV 1E1QG 2B1IA 3ML0A 4CC6A 1QQCA 1XOUA 5J2UA 1XMQB 4U7OA 4JI6B 3L73H 4EEQA 3K5OA 1Q8IA 3I55V 3STZC 1GM8A 1BHAA 1SQGA 5C8YB 2DWDC 2UU9O 4O4LB 2ZE7A 5LXTA 1N36B 3E22A 2P90A 4NXNO 1JPXA 4I0XB 5DECA 4LF8B 4PDMA 3K04A 5L3DA 3DTUB 2CTPA 4G28B 2Y48A 4A5UB 3ZEDA 2EIJB 4DUZO 2JVDA 2Y4UA 4IGGA 3WG7C 4EFBA 3ABLC 3JSLA 4LFAB 4LFCO 1SQQH 2JGUA 1TA8A 3T1HB 2OIEA 4JI3O 1M57B 5E79Z 4FLYA 1PNLA 2VWKA 3K0DA 3JAKA 4O4JB 4JI7B 2FTKA 1WP8A 3ABUA 4JI1B 3I5DA 3RYIB 4CH3A 1N33B 2LJ2A 3AG3C 3CB2A 1EBOA 1JFFB 3TJTA 4I7ZB 3OMAB 3RYFB 2N74A 3BPZA 2F43G 4ABMA 1RM1C 2VQFB 3W7XA 3JAWA 2R9AA 3ZRWA 5IJ0A 4JI8B 2QDOA 4EFEA 2Q73A 1SQPH 2HG5C 5JCOC 1S76D 2A79B 3GWKC 4LFAO 2JEUA 3JAWB 3ZRWB 3K79A 4YIOA 2YS8A 5KLVH 4DV3O 1YEWA 3C3TA 5LA6B 1NR7A 2UXNA 1XI1A 3A0BZ 3N2GB 3THOA 3SYCA 1GN2A 1Y67A 4CC5A 2WPDG 3CCJV 4X20A 2AZ0A 3D8CA 2EIKB 4O4IA 5KHGA 1DK1A 4K3AA 4TV9A 4FLWA 5KX5A 1VQ8V 2CH7B 4UXNA 4PHZA 4DV2O 1V54B 2R72A 3ZN1A 1W0KG 3JAKB 1IBMO 1K7DA 3LNNA 4PJ0Z 4I4TB 3FD9A 1VIBA 3AK1A 4NVPA 5B1AB 3SR2C 1XHZA 4DK1A 1I94O 4NTWA 4HZ3A 5LMNB 2QA4V 4ZBMA 4FM2A 2YC0A 3OD4A 4LBEC 2QM4A 1IBLB 2EIMC 3ABKC 4JPRA 5KHHA 2HKOA 2Q67A 3IJ4A 4X1YA 1ZWIC 1AI6A 3JARB 3IAYA 4LF9O 3CE2A 5C8YA 2LGQA 4CH6A 4B3RO 2VS0A 1NJIW 4JI5B 1M56B 3K58A 4R6ZA 4X20B 1US6A 2WA4A 1FJGO 2QKAA 4K35A 3ETQA 5B3SB 3CPWU 3RVZA 5LGNA 4WFEA 2HP8A 4PDLA 3SDLA 1KQSU 3T4ZA 1S77D 3R66A 1UFIA 4Z1VA 2UXDB 3ZS8C 3H1JH 4DUYB 2WLLB 3X2QC 4GKKB 1I08A 1I5YA 3ABTA 1F4NA 5EC1C 4UCTA 1VP7A 3APOA 2PTMA 3LSQA 3BY6A 3M99B 1QLEB 2UUBO 3SPJA 4LF5B 5HFMA 5BMVA 3JD0A 1Q5OA 4JV5O 2BOBC 1H2MA 1WA8A 5H9CA 2DWEC 2LFRA 1LNQA 5EZYA 3FYIB 4O4LA 4L87A 2GTSA 3C90A 4ICGA 1NS1A 4D6TH 1AJNA 3J81N 4JYYA 1GTOA 1WA8B 3T2MA 4DYLA 4JI6O 1SS3A 2ILMA 2H8PC 1D2DA 4X66B 4KP4A 1I7FA 1V9PA 4UCUA 3DXRB 3WB1A 1SRYA 4DUZB 1U96A 1JQ0A 5B1BC 1J5EB 4DV4O 4DR3B 3HKCB 2W0XA 4DV7O 2YIAA 1JA8A 1H38A 2JJ1G 4K8XA 2ZIMA 1PNMA 2ODMA 3BA8A 4DR7O 4KXRA 2W6JG 2FB5A 3HKCA 1G6UA 1S5LZ 1H8EG 3OT7A 2HR3A 3G6BA 2HJFC 1MA1A 3F5TA 1M4UA 2XAFA 1XL4A 2IU3A 2JGDB 1PD3A 3CWBH 4DR2B 4WCEV 1Q6HA 2ZCEA 4QPKA 1BMFG 1KU9A 1LUWA 2EILC 4GX2A 4DV6O 1NKDA 2ARHA 3CC2V 3ETEA 2X7RB 4MVZA 2GBOA 2A9HA 1VF6C 5IWAO 4R8CA 5K1XA 2ZE8A 3ZHTA 4MTOA 2Z5UA 5FLXN 4UUJC 5CB4A 5LP6B 2HVJC 1LUVA 3DXRA 4UCRA 2YIDA 4ZI7B 4OGQB 4X1IB 1FAFA 1HNXB 2YXHA 5B1NA 5DN6G 2UXCB 3H1LH 1JCHA 1SQBH 3FAVB 3L72H 4JTAB 2VQFO 1S5JA 4LFBO 2V1DA 1OCCB 2NNUA 4X89A 1VQ6V 5IE9A 4FFBA 3CCSV 1KYOF 2XOKG 1IXMA 2NN4A 3OEEG 1Y6XA 1H2NA 3KCXA 1S3JA 4W4KA 1W2BU 2B9ZA 1NZ6A 4KUMA 4LR3A 3CCMV 5JCOA 2YIBA 4TSFG 1R73A 4GKKO 1B6QA 1JMKC 1AR4A 1AI4A 5ITZA 1AR1B 2AXTZ 3F7VC 3DC5A 3WU2Z 4X88A 4WFFA 1AR5A 2K1EA 4B3SO 2JS3A 4DR7B 1IBLO 4ZI7A 4JAAA 2KSDA 3ZHRA 1XUQA 1Z5WA 2WLJA 3E22B 3JARA 2ZXWB 1AI5A 5LMUO 4K0KB 1DGSA 3RN4A 4DW1A 2WLIA 2JRIA 4DR6O 2UUCB 2Q9LA 4FFBB 4DV3B 2GUZB 5EBMC 2ZNIA 2D3OW 4QIWF 4ZOLA 1W59A 3CXCU 2ADQB 3SGIA 5KA6A 1OZ0A 3ABLB 4H13B 1R3IC 5BZBA 1ZUQA 2W6IG 5LMNO 3CC7V 1QR9A 1M57C 5IYCO 3B8MA 3T1CA 2OYQA 4J80A 4X9QA 1OJHA 4MVUA 2EZPA 3CJHA 3UT5B 1GAXA 3D3QA 5FPOA 3B09A 4U7NA 5ITZB 3LSSA 2QE7G 4MW3A 4FIPC 2F4VO 5L3EA 2H3OA 1MMMA 2WSSG 5JVDA 4LF6O 3ZHUA 4E2LA 4NTYA 2LQTA 1NVPB 1WAZA 1MSDA 4TUYB 2DQ0A 3RYCA 4FM1A 4QE7A 1NVPD 3CC4V 1EN4A 2ZIOA 1SESA 4YIPA 1N4CA 5LXTB 3JCUZ 3HKBA 4H37A 1VARA 4LH7A 2PGGA 2Q7EA 2UUAO 4IIJA 3FB6C 2EIKC 4QPJA 1HW7A 5KHKA 4R50A 1GRJA 4GZRB 3JYCA 3EVKA 2UXBB 1VQNV 5CA1A 5CBHA 4PI2A 1DF4A 3OE7G 3W7TA 1OCOC 1Y76B 2XAHA 4QGPA 3RT3C 4QE9A 4J42A 3CD6V 3K08A 1N36O 5HFLA 4ZKIA 4I55A 3CSXA 3NR7A 1N34B 5BY1A 4JGSA 3DSQA 5LP6A 4U3JA 1BSMA 1OV9A 3K03A 4ASUG 4DV4B 4UFZA 2DYSB 1QVGU 3ZRVA 2Q7HA 4FFKA 4LH6A 4B7EA 5LHHA 2WLMA 4DR4O 2FL4A 1KKDA 4HNAB 3CP1A 2XHBA 1YVWA 5FL7G 2Z0AA 1IDSA 3P30A 3FYEB 1R3LC 3HKBB 4TQDA 2UU9B 3TETA 1SZTA 1H2SB 3H01A 1FXKA 4BR6A 5JJJB 2E76B 3RWRD 1AILA 3FKSG 4UV8A 3SJQC 1IBMB 1S5HC 1QR8A 1NI8A 2ATKC 2NLJC 2Q69A 1HR0O 3FAVA 2QM7A 3NXSA 4O2AB 2CTRA 4WF9V 3VQVA 4DR4B 4TV9B 4H0LB 2KKWA 4CZZA 4NYKA 2ITDC 1ZX3A 4TQFA 3VOUA 2RMKB 5JQGA 1QLEC 2L6LA 5JH7B 1Q90D 1KP2A 3G80A 4P30A 3F7YC 4Z2WA 2OWOA 2DW4A 4I9QA 2PI5A 3U10A 3LDEA 1VQOV 2ZD9A 4JTDB 2BTQB 1VF7A 5IY5B 3QO8A 3AG7A 3SPHA 2UXBO 3APQA 4BIZA 1NT2B 5KAFZ 4U3FH 1FXHA 4E4EA 4LFBB 3B2EE 1XL6A 1DF5A 1GN6A 3ASNC 2MW2B 3A0HZ 1YSCA 4OXSA 3ZHQA 1Z5VA 3KCYA 4TOIA 4LFCB 4NXMO 1RPRA 1NH2D 1EZVH 1ZTEA 1WPXA 3I56V 5BR8B 3T1YO 1U97A 3E8FA 3SPGA 3JD4A 1R6TA 4AHCA 4W4LA 3BFRA 3B40A 3IFXA 3ICXA 3JASA 3BRCA 3ZHSA 1FKAO 2QWPB 4XDJA 1VF6A 4NXNB 2UUCO 2KG7A 2P4VA 1NTZH 1YDXA 4CS4A 1HNZB 1VQ9V 1YTFD 2YXYA 5H6QA 4H33A 5IYZB 1JX9A 3AEIA 2IU0A 2E74B 1GH6A 4P2ZA 5LHIA 4PD4F 1T5EA 5KMGB 5LP6C 1R1BA 1Z2GA 3WG7B 1XILA 1SERA 4TV8A 1MSWD 1PP9H 4UVCA 1VQPV 3GB7C 1N0NA 4GLXA 2WLIB 3E86A 1I94B 4DV5B 1J5EO 2QM8A 1KP3A 2V7QG 2EZOA 1KB9F 3KG2A 1MZEA 3E8BA 2PYJA 2UUAB 1AVMA 4DR5O 3CRQA 3QVNA 2ZR3A 4IIJB 2ZT9B 4I55B 2GV9A 3B4SA 1ZAUA 5C93A 3D36C 4JYCA 1Q6UA 5BR8O 3T1YB 1TUBA 2F95B 4GCZA 3AK3A 4KL1A 1OCZC 1FJGB 3BAAA 1ZL8A 4X1IA 4OX9B 2RN9A 1XNRO 3FB5C 3N2GA 4B3RB 2YICA 4CS3A 3H9VA 2YEVB 1BL8A 3WB0A 2AHZA 3QO5A 1VF5B 2X6AA 3AG2C 3L70H 1AROP 5IJ9B 4O2AA 4CBCA 1MG1A 1Y66A 3WFVA 5AG2A 2EJ7A 4HYOA 4GUNA 3K5NA 1K9MW 1GO3F 2GUZA 1L0LH 3BEHA 4KFMA 3S3WA 2OT5A 3N2KB 2KB1A 4AQYO 4YY3O 1NTMH 1HNZO 3ZMSA 5LMUB 2EIMB 3ABKB 2WWWA 4HAMA 1GK9A 4LF4O 4PDVA 4YJ2B 1CPYA 4UV9A 3EFFK 2P7TC
chains in the Genus database with same CATH topology
1KD1W 1MOFA 3RW0A 3SYAA 3CCMV 1COWG 4WFAV 4TSFG 5E1AC 1R73A 1M9NA 2IJIA 2IH1C 1H2GA 5IDJA 1B6QA 2JJ2G 1P4RA 5B1AC 3W7SA 4JF3A 1AI4A 1AR1B 3UM7A 3F7VC 3AG1C 1PNKA 4FPPA 4X88A 5L3CA 1V55B 4WFFA 2K1EA 4MSWC 1G4YB 1K3EA 3HB3B 4JYBA 3W7UA 2QTOA 3G4SV 4WFHA 1FS0G 2WLKA 1FXVA 3JCZA 2IW5A 2OCCC 4RUFA 1QBZA 4RAIA 3ASNB 1ORQC 2WLJA 1I5XA 1S0VA 2ZXWB 3JD3A 4UVBA 2M7WA 1CP9A 1AI5A 1GMGA 4UVAA 5EBLC 2EBOA 3ETDA 1AI7A 1F4MA 5IY5C 4GT1A 4BW5A 2WLIA 2EINB 4XDLA 1JVMA 3ABMB 4J9ZB 3STLC 3ZMUA 5EBMC 1K73W 3D3IA 2XNDG 2D3OW 1M56C 4JASA 4QIWF 1BHBA 4PELA 1THZA 5GW7A 3CXCU 3CCEV 4MVMA 1K92A 5KA6A 1OZ0A 1WLEA 3ABLB 1R3IC 5BZBA 1Q7YW 1Q81W 2B1GA 3K9AA 2W6IG 3CC7V 1QR9A 1SETA 1K33A 3CCUV 3QNEA 5LGTA 1M57C 3AG4C 4MTXA 5IYCO 4LP8A 3B8MA 4EKWA 1AJPA 2MK3A 3T1CA 3OFNG 3JD1A 4PA9A 1QLNA 4MVUA 2EZPA 2ZQMA 5CA3A 3CMEV 1GM7A 2XASA 2QEXV 1E1QG 2B1IA 5EBWC 3ML0A 1M90W 1E1RG 1NQTA 5KUKA 4U7NA 1J95A 3LSSA 2QE7G 4MW3A 4FIPC 4U7OA 2ZDIC 3E8HA 3SYPA 4FMTA 2ZDIA 2WLNA 5L3EA 3SYOA 3I55V 2UXXA 3STZC 1GM8A 2WSSG 1BHAA 3E2EA 3VBBA 4E2LA 1NVPB 5B1BB 2OCCB 2DWDC 3CCLV 2DYSC 2DQ0A 2P90A 2LFSA 1JPXA 3B77A 4QE7A 1FFTB 4PDMA 3ZCCA 3K04A 5L3DA 1NVPD 3DTUB 3OMNB 4G28B 3CC4V 3CYOA 2Y48A 1L1FA 1SESA 2PI4A 4MTGA 3SYQA 1UJWB 5KUMA 5KA5A 1K4DC 3ZRSA 4H37A 3HPLC 1RPOA 1DTOA 2EIJB 3K0GA 4YXWG 1YJ9V 4XDKA 3FB6C 2EIKC 4QPJA 1YITV 1TUEB 1K97A 3WG7C 3ABLC 4R50A 1NBMG 3IC7A 3W7WA 3JYCA 2XAJA 4TWKA 4PA3A 2XAQA 3OUFA 1M57B 3TK1A 1QCEA 4G27B 3AG4B 1PNLA 1VQNV 3K0DA 5CBHA 1DF4A 3OE7G 2FTKA 1ROPA 3W7TA 1OCOC 3ABUA 1PL0A 1FXKC 2XAHA 2IJHA 3OR7C 3AG3C 3D36A 3JD2A 3MHHC 2OTLV 1M1KW 4RO2A 1EBOA 4QE9A 3CD6V 3K08A 4RQFA 3OMAB 1OHHG 5HFLA 4ZKIA 4RQEA 1K5SA 1VQKV 4JGSA 2F43G 4WFGA 1N8RW 4MVOA 1RM1C 3TCUA 1JOYA 2DYRC 3W7XA 3ZRWA 4TT3G 1W0JG 4GX0A 3K03A 4ASUG 3G6EV 1R6KA 2DYSB 3P32A 4FJCC 1QVGU 3ZRVA 2QKSA 1ENVA 5LHHA 2HG5C 2WLMA 1S76D 2EILB 2A79B 1VQ5V 2JEUA 3ZRWB 5EK0A 3K79A 2Z3YA 1VQ7V 1KKDA 3CP1A 5FL7G 3LDDA 3P30A 3FYEB 2IH3C 3RVYA 1R3LC 2AHYA 1NR7A 2UXNA 2IJKA 2GSMB 3TETA 3SYCA 1SZTA 2EIJC 2X6CA 2WPDG 4MS2A 3CCJV 3H01A 1G8MA 1H8HG 2EIKB 1FXKA 2GHYA 5CBFA 5CBGA 2HLDG 1VQ8V 4MVSA 4UXNA 5EC2C 3FKSG 4UV8A 3SJQC 4PA7A 1S5HC 1V54B 1QR8A 3ZN1A 3ZMVA 3E89A 1W0KG 2JEXA 2ATKC 2NLJC 2Q69A 3OM3B 2QM7A 3NXSA 4BIUA 1FXKB 5B1OA 1K7DA 4WF9V 3FB7C 4P9OA 4N23A 1VQLV 1YTFB 1Y4MA 1PKXA 2Q68A 3AG3B 5B1AB 3UKMA 4CZZA 3K06A 1OCCC 2ITDC 4MT8A 4HZ3A 2P67A 3VOUA 1DLBA 2QA4V 4ZBMA 1QLEC 4LBEC 1EFRG 3ZJZA 1E79G 4PA4A 1QVFU 4LC1A 3OW2U 1VQ4V 1JJ2U 2DYRB 3G71V 3ASOB 2EIMC 1KP2A 2H94A 3ABKC 4MVQA 4P30A 4JPRA 3F7YC 4R7CA 2LP7A 2HKOA 2Q67A 2DW4A 3OAAG 2PI5A 3LDEA 2ZXWC 1ZWIC 1AI6A 1VQOV 2R9RB 2ZD9A 4BAYA 4JAVA 4J9YB 4JTDB 5IY5B 3QO8A 4P9PA 5J9PC 3SPHA 2EJRA 4BIZA 2P6JA 1NJIW 1M56B 1FXHA 3ZRXA 4R6ZA 1KECA 3F5WC 3OGCC 3R65A 1YJWV 5LGUA 3ETGA 1XL6A 1Q82W 3GWOA 3ZMZA 3T4DA 1DF5A 5B3SB 3CPWU 1K34A 3RVZA 5LGNA 4WFEA 4I5SA 3ASNC 4PA6A 4PDLA 5DM6V 1KQSU 3T4ZA 5IYBO 4X8AA 1S77D 1YSCA 4OXSA 3LDCA 2WLLB 1VQMV 3X2QC 1RPRA 1NH2D 1I5YA 1WPXA 3ABTA 3E83A 1F4NA 5EC1C 3EHBB 3CCQV 3I56V 1V54C 3E8FA 3SPGA 3E35A 2EINC 3A0RA 1OCRB 4JAUA 3ABMC 3JD4A 3LSQA 3BY6A 3M99B 1QLEB 3SPJA 4I9WA 5HFMA 4MVRA 3JD0A 3IFXA 2BOBC 3LNMB 1YIJV 1P7BA 4XDJA 4QJFB 5H9CA 2DWEC 2LFRA 1LNQA 3FYIB 4L87A 2JIZG 3CCRV 4RUEA 1GM9A 1NR1A 4DXWA 1AJNA 1OCZB 1GTOA 3OMIB 3T2MA 1VQ9V 2YSUB 1YTFD 1K4CC 5H6QA 4H33A 2HFEC 2H8PC 2WAMA 2Y69B 3ZMTA 1JX9A 4KP4A 3AEIA 2IU0A 1K8AW 4P2ZA 1S72V 3OUSA 1Q86W 5LHIA 3CCVV 2JK5C 3WG7B 2W0FC 1SERA 4PDRA 1MSWD 2IJJA 4UVCA 1YJNV 1VQPV 3GB7C 1SRYA 5B1BC 1JQ0A 5B3SC 2WLIB 3E86A 2XAGA 2WLHA 5CN0A 4FK5C 1H38A 5L3GA 1OCOB 2JJ1G 3PJSK 2QM8A 3AG2B 1AJQA 1PNMA 1KP3A 2WLLA 3X2QB 1YHQV 2V7QG 5H6RA 3B8NA 2EZOA 3K3WA 3KG2A 3E8BA 2W6JG 1R3KC 4MW8A 1YI2V 4XBFA 1OCRC 2ZR3A 3SPCA 2B5UA 1H8EG 3OR6C 1R3JC 3LUTB 5C93A 2HR3A 4LCUC 2HJFC 3RBZA 1K5QA 3SPIA 2XAFA 1XL4A 1EZJA 2IU3A 3QO7A 1PD3A 4JYCA 4WCEV 4MTFA 1NH2B 3E8GA 4QPKA 1MABG 1BMFG 4GCZA 1HWYA 2EILC 4GX2A 4Q20A 1NKDA 4Z1MG 5IYDO 3CC2V 3ETEA 1CEZA 2X7RB 1OCZC 4MVZA 3MD0A 2A9HA 3OEHG 4R8CA 4MTOA 3ZIAG 2Z5UA 2Y69C 3AG1B 1V55C 2Q6AA 1KC8W 5LBQA 4UUJC 3FB5C 2X6BA 2ZR2A 2HVJC 4WFBV 3CMAV 1RM1B 1GKFA 2YEVB 4JTCB 1BL8A 1F23A 2DQ3A 4GX1A 2AHZA 3QO5A 2R9IA 5B1NA 5DN6G 3FB8C 2X0LA 1F51A 4QNHB 5L3FA 2X6AA 3AG2C 1AROP 1JCHA 2HVKC 2YEVA 4CBCA 4JTAB 1MG1A 1Y66A 5LHGA 3WFVA 3MHSC 2CK3G 3ZN0A 4HYOA 4F4LA 2V1DA 1OCCB 2NNUA 4X89A 2OTJV 2BOCC 1VQ6V 1K9MW 1GO3F 3CCSV 1R6NA 3BEHA 4N21A 4G2KA 4KFMA 5L3BA 2XOKG 2C2AA 1IXMA 3OEEG 2OT5A 2KB1A 2ITCC 3IGAC 1S3JA 3DGEA 3ZMSA 2EIMB 3ABKB 3ASOC 4DO2A 1W2BU 2WWWA 4HAMA 1GK9A 2A0LA 4PDVA 4GX5A 1CPYA 4UV9A 2JDIG 3EFFK 2P7TC 4KUMA 5CMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 V;  3G6E V;  1VQM V;  3CXC U;  1KD1 W;  3CCE V;  1VQP V;  1YJN V;  2QA4 V;  3CCM V;  1QVG U;  1VQ8 V;  1Q7Y W;  3CCR V;  4WFA V;  1Q81 W;  3CCQ V;  1QVF U;  1NJI W;  1KC8 W;  3I55 V;  1R73 A;  3I56 V;  3CC7 V;  3OW2 U;  1K9M W;  1VQ4 V;  1M1K W;  1JJ2 U;  3G71 V;  3CCS V;  3CCU V;  2OTL V;  1VQ5 V;  3CD6 V;  1VQ9 V;  3CMA V;  4WFB V;  1VQ7 V;  4WCE V;  1YJ9 V;  1YJW V;  1YIT V;  1YHQ V;  1VQK V;  1Q82 W;  4WF9 V;  3CCL V;  1VQL V;  3CME V;  1N8R W;  1K8A W;  3CPW U;  1S72 V;  3CC2 V;  1VQO V;  2OTJ V;  1W2B U;  1Q86 W;  2QEX V;  5DM6 V;  3CCV V;  1YI2 V;  1KQS U;  1YIJ V;  1M90 W;  1K73 W;  1VQ6 V;  3CCJ V;  3G4S V;  2D3O W;  1VQN V; 
#chains in the Genus database with same CATH topology
 1KD1 W;  3SYA A;  4HBN A;  1L0N H;  2GTA A;  2IM9 A;  4WFA V;  2IH1 C;  1H2G A;  4AIL C;  1P4R A;  3RGB A;  5IJ0 B;  3AG1 C;  5L3C A;  3DC6 A;  4MSW C;  1KKC A;  2RCV A;  1K3E A;  5JVD B;  2PUS A;  2QTO A;  3G4S V;  1FS0 G;  5EYP A;  1FXV A;  2IW5 A;  1HNW B;  4RAI A;  4TUY A;  1Y74 A;  4AI8 A;  4O2B A;  4UVB A;  3WB2 A;  1CP9 A;  3ETD A;  1AI7 A;  1F4M A;  5EYP B;  2LGW A;  4ZHQ B;  4K0K O;  3PN1 A;  1RSO B;  3CX5 F;  2ADP A;  4XDL A;  3STL C;  1XDC A;  1N32 B;  1BHB A;  1THZ A;  3CCE V;  4JI0 B;  1K92 A;  1TVK A;  3P3N A;  3BHP A;  3CJH B;  3UT5 A;  1Q7Y W;  1Q6I A;  1SET A;  1K33 A;  2PY5 A;  3CEI A;  3CCU V;  2ZNJ A;  3P3P A;  1AJP A;  2MK3 A;  3RYI A;  1XRE A;  2DN9 A;  4PA9 A;  2KG7 B;  4UCS A;  4X62 O;  1M90 W;  4LNU A;  1JJO A;  1SF9 A;  4DV0 O;  4DRX B;  1XHX A;  2G38 A;  1M5I A;  2ZDI C;  3E8H A;  4FLX A;  4FMT A;  4LF6 B;  3O65 A;  3SYO A;  2BTQ A;  3E2E A;  4DV6 B;  5B1B B;  1KMI Z;  3CCL V;  3VQW A;  1SQX H;  2DYS C;  1N32 O;  2LFS A;  2QGN A;  1FFT B;  3ZCC A;  3HKE B;  4X64 B;  1L1F A;  2PI4 A;  4DV1 B;  3L75 H;  1PPJ H;  1QHT A;  3BVO A;  3HPL C;  2D2C B;  4XDK A;  4ZOL B;  1YIT V;  1XBL A;  1NBM G;  3L74 H;  5B66 Z;  5LYJ B;  4EB6 B;  2XAQ A;  3OUF A;  3TK1 A;  4G27 B;  3AG4 B;  5H5N A;  2WA3 A;  2LO1 A;  3Q4H B;  1ROP A;  1PL0 A;  4I4T A;  5FPR A;  5IWA B;  4BWA A;  3OR7 C;  3JD2 A;  3MHH C;  1M1K W;  4DW0 A;  4U3J B;  2V4D A;  1XMQ O;  4RQF A;  1OHH G;  3A2F A;  4RQE A;  3HKD A;  1K5S A;  3JSN A;  2P5O A;  3JAM N;  1UPG A;  4KHP B;  4ZIB A;  1TGO A;  4MVO A;  2EX3 A;  3TCU A;  3H1H H;  1N0J A;  2F23 A;  1W0J G;  4GX0 A;  2P22 C;  1R6K A;  4FJC C;  3P32 A;  2QKS A;  4X1Y B;  1ENV A;  2Q5Z A;  3FX7 A;  4AQY B;  5EK0 A;  2E3C A;  1IZ3 A;  1VQ7 V;  5IJ9 A;  4J7Z A;  5GTI Z;  4FLZ A;  1WNS A;  2AHY A;  2CH7 A;  4OX9 O;  3TXS A;  2GSM B;  4JZG A;  2CGO A;  2GDS A;  1AP5 A;  4MS2 A;  1H8H G;  4CS2 A;  2GHY A;  5CBF A;  1WPB A;  2DE0 X;  5LA6 A;  4FVM A;  4MVS A;  5EC2 C;  1RSO A;  4UCO A;  2IBZ H;  1N34 O;  1ZLZ A;  3L9D A;  1FXK B;  5LOV B;  4JV5 B;  3FB7 C;  4N23 A;  1YTF B;  1PKX A;  2Q68 A;  3OGI B;  1JR9 A;  3QTC A;  2P67 A;  1GN3 A;  3M7M X;  1EFR G;  1E79 G;  2CUG A;  4PA4 A;  1QVF U;  1VQ4 V;  2DYR B;  3ASO B;  4MVQ A;  4LNU B;  2ZXW C;  3K9S A;  2N05 A;  2QJ1 A;  5FNV B;  1O9G A;  4BAY A;  4J9Y B;  4FZ0 A;  1BQ0 A;  5J9P C;  2NR5 A;  2AZ2 A;  2VRZ A;  4JI5 O;  4JI3 B;  4DR2 O;  2P6J A;  4B3M B;  4YJ3 B;  2YUA A;  2FML A;  4YHH B;  1P7G A;  4UB6 Z;  1KEC A;  3OGC C;  4B7K A;  3R65 A;  3ETG A;  1Q82 W;  1AB3 A;  3U11 A;  3UO2 A;  1ZSP A;  3OTO O;  4I5S A;  4PA6 A;  2PYL A;  1HDJ A;  4O2B B;  3RYH B;  3LDC A;  1SC5 B;  3BCC H;  4O4H A;  4LWS A;  3UO3 A;  1XNQ O;  2OIG A;  3E83 A;  3EHB B;  2HHH B;  3E35 A;  2EIN C;  3A0R A;  3ABM C;  5JQG B;  5CA0 B;  1FD9 A;  4JYA B;  3K59 A;  4X64 O;  4UB8 Z;  4MVR A;  3K57 A;  1WN7 A;  4DK0 A;  2PZS A;  1WP7 A;  2DJV A;  5LL6 Y;  3CCR V;  4RUE A;  4DXW A;  1OCZ B;  2QSA A;  2CTQ A;  5EIB C;  4DR1 O;  1IUR A;  4IYI A;  2YSU B;  1K4C C;  1Q3E A;  2HFE C;  2XT9 A;  2WAM A;  2E5L O;  1IVS A;  1K8A W;  3OUS A;  5CB4 B;  3MDS A;  3CCV V;  1SQV H;  2P06 A;  2W0F C;  2RQ6 A;  2VQE B;  1BS3 A;  4JI7 O;  2Y4T A;  5LYJ A;  4I0X A;  4FK5 C;  5L3G A;  2XUM A;  1OCO B;  3HKE A;  4DV1 O;  3PJS K;  3AG2 B;  1AJQ A;  3Q4H A;  2CDY A;  4JI4 O;  2WLL A;  1A32 A;  5H6R A;  1FFX B;  3K3W A;  1TVK B;  4GYC B;  2HJD A;  2UXD O;  1XQ8 A;  3M8A A;  1WJZ A;  1R3K C;  4MW8 A;  2A7W A;  1OCR C;  2RJZ A;  4IT5 A;  3JAL B;  3SPC A;  4X62 B;  5KAI Z;  3OR6 C;  2A06 H;  2LW1 A;  3LUT B;  4LCU C;  3HR0 A;  2RDC A;  3RBZ A;  3SPI A;  3CRR A;  1EZJ A;  3QO7 A;  3AK2 A;  1YF2 A;  1H2K A;  1MAB G;  4JI2 B;  3U0Z A;  2A3Q A;  5IYD O;  3G67 A;  3BAB A;  3KKY A;  4F6R A;  2JGD A;  4I50 B;  3K5M A;  2Y69 C;  3GVM A;  3AG1 B;  4X1K B;  2Q6A A;  5LBQ A;  3CHX A;  4NB5 A;  5KMG A;  5GTH Z;  2LW7 A;  3JAT B;  3CMA V;  2Q0A A;  1RM1 B;  1HR0 B;  4DV7 B;  2R9I A;  1Y74 B;  5D5P A;  2F1M A;  2X0L A;  5L3F A;  1EN6 A;  4HNA A;  2YEV A;  5LHG A;  4J7J A;  3MHS C;  2CK3 G;  3ZN0 A;  3RFR A;  4F4L A;  2OTJ V;  1D5A A;  2BOC C;  2YIB D;  1R6N A;  3CRA A;  4N21 A;  4G2K A;  1HNW O;  1LR1 A;  2ZKO A;  1H2L A;  3IGA C;  3DGE A;  2RNB A;  4JI2 O;  1V54 C;  5CMU A;  1MOF A;  1URF A;  3CRM A;  2BSK B;  1COW G;  5E1A C;  2YI8 A;  1M9N A;  2IJI A;  5JJN B;  2JJ2 G;  5B1A C;  3W7S A;  4FPP A;  1PNK A;  1V55 B;  4X1K A;  1L8D A;  2FKX A;  1KUQ A;  3JAT A;  2WLK A;  2YXL A;  4YHH O;  4RUF A;  2Q4P A;  3ASN B;  4H44 B;  1I5X A;  4L8J A;  3JD3 A;  1B06 A;  5D5Q A;  1D5N A;  1GMG A;  1RFY A;  4UVA A;  5EBL C;  2EBO A;  3O9O A;  2CE4 A;  4GT1 A;  4BW5 A;  2CAZ C;  1NU1 H;  2KQX A;  2N04 A;  1HNX O;  4J9Z B;  3KZI Z;  2QWN B;  1K73 W;  2E5L B;  3CXH F;  4J10 A;  1EN5 A;  1M56 C;  3OTF A;  5GW7 A;  3TGU H;  5B5E Z;  4DR1 B;  1Q81 W;  2B1G A;  1FPO A;  2Y0I A;  1AP6 A;  2UUB B;  3QNE A;  4Q6G A;  5LGT A;  3AG4 C;  2XTA A;  4EKW A;  3OFN G;  3JD1 A;  1QLN A;  2BSK A;  3CME V;  5CA3 A;  1GM7 A;  2XAS A;  5EBW C;  1G1X B;  1E1R G;  1NQT A;  2FYU H;  5KUK A;  1J95 A;  4DR5 B;  1BCC H;  2AGA A;  2ZIN A;  1I0H A;  3SYP A;  2ZDI A;  2WLN A;  2UXX A;  2PF4 E;  3JAS B;  3VBB A;  4B3T O;  4DV5 O;  1YXB A;  1TAE A;  2OCC B;  5EZY B;  4X65 B;  3SJA C;  1Q43 A;  2BE3 A;  2DMX A;  3B77 A;  4WBN B;  2ZE5 A;  3OMN B;  4B3S B;  3CYO A;  1B04 A;  4MTG A;  3SYQ A;  1UJW B;  1B3Q A;  1YZB A;  5KUM A;  5KA5 A;  1K4D C;  3ZRS A;  1RPO A;  1DTO A;  1SKV A;  3K0G A;  4YXW G;  1YJ9 V;  1NTK H;  1TUE B;  1K97 A;  4FLU A;  3IC7 A;  3W7W A;  2XAJ A;  4TWK A;  4K8Z A;  4PA3 A;  2CTW A;  1KBH A;  1QCE A;  2QWQ B;  4OPA A;  1XMO B;  2M6Y A;  1FXK C;  4B3T B;  3ZBH A;  2IJH A;  3D36 A;  2ZM6 B;  2OTL V;  1M93 A;  4RO2 A;  4NR1 A;  1VQK V;  4GKJ B;  1MZF A;  4WFG A;  1N8R W;  3L71 H;  3A8T A;  4NXM B;  1BZK A;  1RP3 B;  1JOY A;  2DYR C;  1VMG A;  1BQZ A;  2JS5 A;  4TT3 G;  3G6E V;  2UXC O;  1YCI A;  2K9P A;  3SJB C;  2YDE A;  5EIB D;  5H2F Z;  2EIL B;  4JI0 O;  1VQ5 V;  2Z3Y A;  3LDD A;  4BW9 A;  2IH3 C;  3RVY A;  3MAQ A;  4PI0 A;  1VEW A;  1P84 F;  1P49 A;  1QU7 A;  2IJK A;  1XNR B;  2EIJ C;  2X6C A;  2QWR B;  1G8M A;  5CBG A;  2HLD G;  5A9G A;  1QNM A;  2E75 B;  4C7U A;  4PA7 A;  4GKJ O;  3ZMV A;  3E89 A;  4B08 A;  2JEX A;  5CA1 B;  3OM3 B;  1XEQ A;  4BIU A;  5B1O A;  4FM0 A;  4P9O A;  1VQL V;  1Y4M A;  3AG3 B;  1IBK B;  3J7A U;  1XMO O;  3UKM A;  3K06 A;  4IL6 Z;  1OCC C;  4MT8 A;  2HHH O;  1DLB A;  2BCC H;  5K1P A;  3ZJZ A;  4LC1 A;  3OW2 U;  1IXB A;  2YI9 A;  1JJ2 U;  3G71 V;  1BT8 A;  2H94 A;  1ZL8 B;  4I50 A;  2QWO B;  4R7C A;  2LP7 A;  5J2T B;  4LF4 B;  5J2U B;  4CH4 A;  3OAA G;  3N27 A;  1PM9 A;  2R9R B;  3C3S A;  3UCS C;  4JAV A;  4FLV A;  4B3M O;  4P9P A;  4LF8 O;  2EJR A;  3ZRX A;  3UQ8 A;  3F5W C;  4DR6 B;  4IHJ B;  1YJW V;  5LGU A;  3GWO A;  3ZMZ A;  3T4D A;  2AW9 A;  3CRC A;  1K34 A;  5DM6 V;  5IYB O;  4X8A A;  1XNQ B;  1VQM V;  2F66 C;  2Q0O C;  1PL4 A;  1SA0 A;  3CCQ V;  4UCV A;  4J7K A;  4X66 O;  5JJE B;  4YJ2 A;  4JAU A;  1OCR B;  3JAL A;  2F93 B;  1GN4 A;  4I9W A;  2CGN A;  3LNM B;  1YIJ V;  1P7B A;  4LF5 O;  4QJF B;  5JWP A;  1JFF A;  5KHJ A;  3VQY A;  3HKD B;  5J2T A;  3EXA A;  2JIZ G;  1GM9 A;  1NR1 A;  5BMV B;  4F6R B;  3OMI B;  1HP8 A;  3S3X A;  2Q7G A;  1BGY H;  3T1H O;  2Y69 B;  3ZMT A;  3H1I H;  1S72 V;  4DV0 B;  1Q86 W;  2JK5 C;  2R70 A;  3ZHV A;  4FZ1 A;  4LF7 B;  4IHJ A;  5DED A;  4PDR A;  1FFX A;  2IJJ A;  1YJN V;  3QG5 A;  2EUL A;  5B3S C;  2XAG A;  2WLH A;  5CN0 A;  1IX9 A;  4WBN A;  4CH5 A;  2L35 A;  5KHI A;  4TV8 B;  3X2Q B;  4KHP O;  1YHQ V;  1Y76 A;  3B8N A;  1PV0 A;  4DUY O;  1MNG A;  1YI2 V;  4XBF A;  4D7T A;  2O57 A;  1F7Y A;  2B5U A;  3N2K A;  4OPH A;  5F2V O;  3RYF A;  1R3J C;  5IT9 N;  3BA9 A;  1K5Q A;  4J41 A;  2F4V B;  1X59 A;  4DV2 B;  4MTF A;  1NH2 B;  3E8G A;  3OTO B;  2OCH A;  1HWY A;  4Q20 A;  3TXQ A;  2ZE6 A;  4Z1M G;  1CXZ B;  1CEZ A;  3MD0 A;  3OEH G;  4JYA O;  4YY3 B;  4F6E A;  4J11 A;  4DR3 O;  3ZIA G;  1V55 C;  1KC8 W;  2X6B A;  2ZR2 A;  3ZX6 A;  1X4T A;  2VWJ A;  4WFB V;  2BTO A;  4O4I B;  1GKF A;  4JTC B;  5TIS Z;  1F23 A;  2DQ3 A;  4GX1 A;  1SZX A;  3FB8 C;  4JI8 O;  1F51 A;  4X65 O;  4QNH B;  1EM1 A;  1IBK O;  2HVK C;  2P4K A;  4LF7 O;  3H1K H;  3FFQ A;  4EB6 A;  4NTX A;  3RYH A;  3CS5 A;  5BXZ A;  4O4J A;  5L3B A;  2C2A A;  5GON B;  2ITC C;  1BE3 H;  1SA0 B;  5JH7 A;  3ASO C;  4JI1 O;  4DO2 A;  2A0L A;  2HEP A;  4GX5 A;  2JDI G;  4BIO A;  2QTS A;  5LOV A;  1TUB B;  3RW0 A;  2ETN A;  4JI4 B;  2Q8V A;  5IDJ A;  1N33 O;  4JF3 A;  4DRX A;  3UM7 A;  4RWU A;  2DOS A;  1G4Y B;  3K5L A;  2VQE O;  3HB3 B;  4JYB A;  3W7U A;  1FYJ A;  4WFH A;  5A2Q N;  3JCZ A;  5IYZ A;  2OCC C;  1QBZ A;  4ZHQ A;  4JZ2 A;  1ORQ C;  3LSU A;  5FNV A;  3RYC B;  2QKC A;  1S0V A;  2M7W A;  1WB7 A;  2Y0P A;  4O4H B;  5IY5 C;  2QR4 A;  5KX5 B;  4YJ3 A;  1SQF A;  3J80 N;  2EIN B;  1JVM A;  3ABM B;  3ZMU A;  3SJC C;  4IYH A;  3D3I A;  2XND G;  4PV1 B;  4JAS A;  4PEL A;  3IC9 A;  5GON A;  4FLT A;  4MVM A;  1O9H A;  5CA0 A;  1WLE A;  4LF9 B;  3K9A A;  3QF7 A;  4D7S A;  4NKG B;  4MTX A;  4LP8 A;  2ZM6 O;  4LWS B;  3VQX A;  2ZQM A;  1WB8 A;  2QEX V;  1E1Q G;  2B1I A;  3ML0 A;  4CC6 A;  1QQC A;  1XOU A;  5J2U A;  1XMQ B;  4U7O A;  4JI6 B;  3L73 H;  4EEQ A;  3K5O A;  1Q8I A;  3I55 V;  3STZ C;  1GM8 A;  1BHA A;  1SQG A;  5C8Y B;  2DWD C;  2UU9 O;  4O4L B;  2ZE7 A;  5LXT A;  1N36 B;  3E22 A;  2P90 A;  4NXN O;  1JPX A;  4I0X B;  5DEC A;  4LF8 B;  4PDM A;  3K04 A;  5L3D A;  3DTU B;  2CTP A;  4G28 B;  2Y48 A;  4A5U B;  3ZED A;  2EIJ B;  4DUZ O;  2JVD A;  2Y4U A;  4IGG A;  3WG7 C;  4EFB A;  3ABL C;  3JSL A;  4LFA B;  4LFC O;  1SQQ H;  2JGU A;  1TA8 A;  3T1H B;  2OIE A;  4JI3 O;  1M57 B;  5E79 Z;  4FLY A;  1PNL A;  2VWK A;  3K0D A;  3JAK A;  4O4J B;  4JI7 B;  2FTK A;  1WP8 A;  3ABU A;  4JI1 B;  3I5D A;  3RYI B;  4CH3 A;  1N33 B;  2LJ2 A;  3AG3 C;  3CB2 A;  1EBO A;  1JFF B;  3TJT A;  4I7Z B;  3OMA B;  3RYF B;  2N74 A;  3BPZ A;  2F43 G;  4ABM A;  1RM1 C;  2VQF B;  3W7X A;  3JAW A;  2R9A A;  3ZRW A;  5IJ0 A;  4JI8 B;  2QDO A;  4EFE A;  2Q73 A;  1SQP H;  2HG5 C;  5JCO C;  1S76 D;  2A79 B;  3GWK C;  4LFA O;  2JEU A;  3JAW B;  3ZRW B;  3K79 A;  4YIO A;  2YS8 A;  5KLV H;  4DV3 O;  1YEW A;  3C3T A;  5LA6 B;  1NR7 A;  2UXN A;  1XI1 A;  3A0B Z;  3N2G B;  3THO A;  3SYC A;  1GN2 A;  1Y67 A;  4CC5 A;  2WPD G;  3CCJ V;  4X20 A;  2AZ0 A;  3D8C A;  2EIK B;  4O4I A;  5KHG A;  1DK1 A;  4K3A A;  4TV9 A;  4FLW A;  5KX5 A;  1VQ8 V;  2CH7 B;  4UXN A;  4PHZ A;  4DV2 O;  1V54 B;  2R72 A;  3ZN1 A;  1W0K G;  3JAK B;  1IBM O;  1K7D A;  3LNN A;  4PJ0 Z;  4I4T B;  3FD9 A;  1VIB A;  3AK1 A;  4NVP A;  5B1A B;  3SR2 C;  1XHZ A;  4DK1 A;  1I94 O;  4NTW A;  4HZ3 A;  5LMN B;  2QA4 V;  4ZBM A;  4FM2 A;  2YC0 A;  3OD4 A;  4LBE C;  2QM4 A;  1IBL B;  2EIM C;  3ABK C;  4JPR A;  5KHH A;  2HKO A;  2Q67 A;  3IJ4 A;  4X1Y A;  1ZWI C;  1AI6 A;  3JAR B;  3IAY A;  4LF9 O;  3CE2 A;  5C8Y A;  2LGQ A;  4CH6 A;  4B3R O;  2VS0 A;  1NJI W;  4JI5 B;  1M56 B;  3K58 A;  4R6Z A;  4X20 B;  1US6 A;  2WA4 A;  1FJG O;  2QKA A;  4K35 A;  3ETQ A;  5B3S B;  3CPW U;  3RVZ A;  5LGN A;  4WFE A;  2HP8 A;  4PDL A;  3SDL A;  1KQS U;  3T4Z A;  1S77 D;  3R66 A;  1UFI A;  4Z1V A;  2UXD B;  3ZS8 C;  3H1J H;  4DUY B;  2WLL B;  3X2Q C;  4GKK B;  1I08 A;  1I5Y A;  3ABT A;  1F4N A;  5EC1 C;  4UCT A;  1VP7 A;  3APO A;  2PTM A;  3LSQ A;  3BY6 A;  3M99 B;  1QLE B;  2UUB O;  3SPJ A;  4LF5 B;  5HFM A;  5BMV A;  3JD0 A;  1Q5O A;  4JV5 O;  2BOB C;  1H2M A;  1WA8 A;  5H9C A;  2DWE C;  2LFR A;  1LNQ A;  5EZY A;  3FYI B;  4O4L A;  4L87 A;  2GTS A;  3C90 A;  4ICG A;  1NS1 A;  4D6T H;  1AJN A;  3J81 N;  4JYY A;  1GTO A;  1WA8 B;  3T2M A;  4DYL A;  4JI6 O;  1SS3 A;  2ILM A;  2H8P C;  1D2D A;  4X66 B;  4KP4 A;  1I7F A;  1V9P A;  4UCU A;  3DXR B;  3WB1 A;  1SRY A;  4DUZ B;  1U96 A;  1JQ0 A;  5B1B C;  1J5E B;  4DV4 O;  4DR3 B;  3HKC B;  2W0X A;  4DV7 O;  2YIA A;  1JA8 A;  1H38 A;  2JJ1 G;  4K8X A;  2ZIM A;  1PNM A;  2ODM A;  3BA8 A;  4DR7 O;  4KXR A;  2W6J G;  2FB5 A;  3HKC A;  1G6U A;  1S5L Z;  1H8E G;  3OT7 A;  2HR3 A;  3G6B A;  2HJF C;  1MA1 A;  3F5T A;  1M4U A;  2XAF A;  1XL4 A;  2IU3 A;  2JGD B;  1PD3 A;  3CWB H;  4DR2 B;  4WCE V;  1Q6H A;  2ZCE A;  4QPK A;  1BMF G;  1KU9 A;  1LUW A;  2EIL C;  4GX2 A;  4DV6 O;  1NKD A;  2ARH A;  3CC2 V;  3ETE A;  2X7R B;  4MVZ A;  2GBO A;  2A9H A;  1VF6 C;  5IWA O;  4R8C A;  5K1X A;  2ZE8 A;  3ZHT A;  4MTO A;  2Z5U A;  5FLX N;  4UUJ C;  5CB4 A;  5LP6 B;  2HVJ C;  1LUV A;  3DXR A;  4UCR A;  2YID A;  4ZI7 B;  4OGQ B;  4X1I B;  1FAF A;  1HNX B;  2YXH A;  5B1N A;  5DN6 G;  2UXC B;  3H1L H;  1JCH A;  1SQB H;  3FAV B;  3L72 H;  4JTA B;  2VQF O;  1S5J A;  4LFB O;  2V1D A;  1OCC B;  2NNU A;  4X89 A;  1VQ6 V;  5IE9 A;  4FFB A;  3CCS V;  1KYO F;  2XOK G;  1IXM A;  2NN4 A;  3OEE G;  1Y6X A;  1H2N A;  3KCX A;  1S3J A;  4W4K A;  1W2B U;  2B9Z A;  1NZ6 A;  4KUM A;  4LR3 A;  3CCM V;  5JCO A;  2YIB A;  4TSF G;  1R73 A;  4GKK O;  1B6Q A;  1JMK C;  1AR4 A;  1AI4 A;  5ITZ A;  1AR1 B;  2AXT Z;  3F7V C;  3DC5 A;  3WU2 Z;  4X88 A;  4WFF A;  1AR5 A;  2K1E A;  4B3S O;  2JS3 A;  4DR7 B;  1IBL O;  4ZI7 A;  4JAA A;  2KSD A;  3ZHR A;  1XUQ A;  1Z5W A;  2WLJ A;  3E22 B;  3JAR A;  2ZXW B;  1AI5 A;  5LMU O;  4K0K B;  1DGS A;  3RN4 A;  4DW1 A;  2WLI A;  2JRI A;  4DR6 O;  2UUC B;  2Q9L A;  4FFB B;  4DV3 B;  2GUZ B;  5EBM C;  2ZNI A;  2D3O W;  4QIW F;  4ZOL A;  1W59 A;  3CXC U;  2ADQ B;  3SGI A;  5KA6 A;  1OZ0 A;  3ABL B;  4H13 B;  1R3I C;  5BZB A;  1ZUQ A;  2W6I G;  5LMN O;  3CC7 V;  1QR9 A;  1M57 C;  5IYC O;  3B8M A;  3T1C A;  2OYQ A;  4J80 A;  4X9Q A;  1OJH A;  4MVU A;  2EZP A;  3CJH A;  3UT5 B;  1GAX A;  3D3Q A;  5FPO A;  3B09 A;  4U7N A;  5ITZ B;  3LSS A;  2QE7 G;  4MW3 A;  4FIP C;  2F4V O;  5L3E A;  2H3O A;  1MMM A;  2WSS G;  5JVD A;  4LF6 O;  3ZHU A;  4E2L A;  4NTY A;  2LQT A;  1NVP B;  1WAZ A;  1MSD A;  4TUY B;  2DQ0 A;  3RYC A;  4FM1 A;  4QE7 A;  1NVP D;  3CC4 V;  1EN4 A;  2ZIO A;  1SES A;  4YIP A;  1N4C A;  5LXT B;  3JCU Z;  3HKB A;  4H37 A;  1VAR A;  4LH7 A;  2PGG A;  2Q7E A;  2UUA O;  4IIJ A;  3FB6 C;  2EIK C;  4QPJ A;  1HW7 A;  5KHK A;  4R50 A;  1GRJ A;  4GZR B;  3JYC A;  3EVK A;  2UXB B;  1VQN V;  5CA1 A;  5CBH A;  4PI2 A;  1DF4 A;  3OE7 G;  3W7T A;  1OCO C;  1Y76 B;  2XAH A;  4QGP A;  3RT3 C;  4QE9 A;  4J42 A;  3CD6 V;  3K08 A;  1N36 O;  5HFL A;  4ZKI A;  4I55 A;  3CSX A;  3NR7 A;  1N34 B;  5BY1 A;  4JGS A;  3DSQ A;  5LP6 A;  4U3J A;  1BSM A;  1OV9 A;  3K03 A;  4ASU G;  4DV4 B;  4UFZ A;  2DYS B;  1QVG U;  3ZRV A;  2Q7H A;  4FFK A;  4LH6 A;  4B7E A;  5LHH A;  2WLM A;  4DR4 O;  2FL4 A;  1KKD A;  4HNA B;  3CP1 A;  2XHB A;  1YVW A;  5FL7 G;  2Z0A A;  1IDS A;  3P30 A;  3FYE B;  1R3L C;  3HKB B;  4TQD A;  2UU9 B;  3TET A;  1SZT A;  1H2S B;  3H01 A;  1FXK A;  4BR6 A;  5JJJ B;  2E76 B;  3RWR D;  1AIL A;  3FKS G;  4UV8 A;  3SJQ C;  1IBM B;  1S5H C;  1QR8 A;  1NI8 A;  2ATK C;  2NLJ C;  2Q69 A;  1HR0 O;  3FAV A;  2QM7 A;  3NXS A;  4O2A B;  2CTR A;  4WF9 V;  3VQV A;  4DR4 B;  4TV9 B;  4H0L B;  2KKW A;  4CZZ A;  4NYK A;  2ITD C;  1ZX3 A;  4TQF A;  3VOU A;  2RMK B;  5JQG A;  1QLE C;  2L6L A;  5JH7 B;  1Q90 D;  1KP2 A;  3G80 A;  4P30 A;  3F7Y C;  4Z2W A;  2OWO A;  2DW4 A;  4I9Q A;  2PI5 A;  3U10 A;  3LDE A;  1VQO V;  2ZD9 A;  4JTD B;  2BTQ B;  1VF7 A;  5IY5 B;  3QO8 A;  3AG7 A;  3SPH A;  2UXB O;  3APQ A;  4BIZ A;  1NT2 B;  5KAF Z;  4U3F H;  1FXH A;  4E4E A;  4LFB B;  3B2E E;  1XL6 A;  1DF5 A;  1GN6 A;  3ASN C;  2MW2 B;  3A0H Z;  1YSC A;  4OXS A;  3ZHQ A;  1Z5V A;  3KCY A;  4TOI A;  4LFC B;  4NXM O;  1RPR A;  1NH2 D;  1EZV H;  1ZTE A;  1WPX A;  3I56 V;  5BR8 B;  3T1Y O;  1U97 A;  3E8F A;  3SPG A;  3JD4 A;  1R6T A;  4AHC A;  4W4L A;  3BFR A;  3B40 A;  3IFX A;  3ICX A;  3JAS A;  3BRC A;  3ZHS A;  1FKA O;  2QWP B;  4XDJ A;  1VF6 A;  4NXN B;  2UUC O;  2KG7 A;  2P4V A;  1NTZ H;  1YDX A;  4CS4 A;  1HNZ B;  1VQ9 V;  1YTF D;  2YXY A;  5H6Q A;  4H33 A;  5IYZ B;  1JX9 A;  3AEI A;  2IU0 A;  2E74 B;  1GH6 A;  4P2Z A;  5LHI A;  4PD4 F;  1T5E A;  5KMG B;  5LP6 C;  1R1B A;  1Z2G A;  3WG7 B;  1XIL A;  1SER A;  4TV8 A;  1MSW D;  1PP9 H;  4UVC A;  1VQP V;  3GB7 C;  1N0N A;  4GLX A;  2WLI B;  3E86 A;  1I94 B;  4DV5 B;  1J5E O;  2QM8 A;  1KP3 A;  2V7Q G;  2EZO A;  1KB9 F;  3KG2 A;  1MZE A;  3E8B A;  2PYJ A;  2UUA B;  1AVM A;  4DR5 O;  3CRQ A;  3QVN A;  2ZR3 A;  4IIJ B;  2ZT9 B;  4I55 B;  2GV9 A;  3B4S A;  1ZAU A;  5C93 A;  3D36 C;  4JYC A;  1Q6U A;  5BR8 O;  3T1Y B;  1TUB A;  2F95 B;  4GCZ A;  3AK3 A;  4KL1 A;  1OCZ C;  1FJG B;  3BAA A;  1ZL8 A;  4X1I A;  4OX9 B;  2RN9 A;  1XNR O;  3FB5 C;  3N2G A;  4B3R B;  2YIC A;  4CS3 A;  3H9V A;  2YEV B;  1BL8 A;  3WB0 A;  2AHZ A;  3QO5 A;  1VF5 B;  2X6A A;  3AG2 C;  3L70 H;  1ARO P;  5IJ9 B;  4O2A A;  4CBC A;  1MG1 A;  1Y66 A;  3WFV A;  5AG2 A;  2EJ7 A;  4HYO A;  4GUN A;  3K5N A;  1K9M W;  1GO3 F;  2GUZ A;  1L0L H;  3BEH A;  4KFM A;  3S3W A;  2OT5 A;  3N2K B;  2KB1 A;  4AQY O;  4YY3 O;  1NTM H;  1HNZ O;  3ZMS A;  5LMU B;  2EIM B;  3ABK B;  2WWW A;  4HAM A;  1GK9 A;  4LF4 O;  4PDV A;  4YJ2 B;  1CPY A;  4UV9 A;  3EFF K;  2P7T C; 
#chains in the Genus database with same CATH homology
 1KD1 W;  1MOF A;  3RW0 A;  3SYA A;  3CCM V;  1COW G;  4WFA V;  4TSF G;  5E1A C;  1R73 A;  1M9N A;  2IJI A;  2IH1 C;  1H2G A;  5IDJ A;  1B6Q A;  2JJ2 G;  1P4R A;  5B1A C;  3W7S A;  4JF3 A;  1AI4 A;  1AR1 B;  3UM7 A;  3F7V C;  3AG1 C;  1PNK A;  4FPP A;  4X88 A;  5L3C A;  1V55 B;  4WFF A;  2K1E A;  4MSW C;  1G4Y B;  1K3E A;  3HB3 B;  4JYB A;  3W7U A;  2QTO A;  3G4S V;  4WFH A;  1FS0 G;  2WLK A;  1FXV A;  3JCZ A;  2IW5 A;  2OCC C;  4RUF A;  1QBZ A;  4RAI A;  3ASN B;  1ORQ C;  2WLJ A;  1I5X A;  1S0V A;  2ZXW B;  3JD3 A;  4UVB A;  2M7W A;  1CP9 A;  1AI5 A;  1GMG A;  4UVA A;  5EBL C;  2EBO A;  3ETD A;  1AI7 A;  1F4M A;  5IY5 C;  4GT1 A;  4BW5 A;  2WLI A;  2EIN B;  4XDL A;  1JVM A;  3ABM B;  4J9Z B;  3STL C;  3ZMU A;  5EBM C;  1K73 W;  3D3I A;  2XND G;  2D3O W;  1M56 C;  4JAS A;  4QIW F;  1BHB A;  4PEL A;  1THZ A;  5GW7 A;  3CXC U;  3CCE V;  4MVM A;  1K92 A;  5KA6 A;  1OZ0 A;  1WLE A;  3ABL B;  1R3I C;  5BZB A;  1Q7Y W;  1Q81 W;  2B1G A;  3K9A A;  2W6I G;  3CC7 V;  1QR9 A;  1SET A;  1K33 A;  3CCU V;  3QNE A;  5LGT A;  1M57 C;  3AG4 C;  4MTX A;  5IYC O;  4LP8 A;  3B8M A;  4EKW A;  1AJP A;  2MK3 A;  3T1C A;  3OFN G;  3JD1 A;  4PA9 A;  1QLN A;  4MVU A;  2EZP A;  2ZQM A;  5CA3 A;  3CME V;  1GM7 A;  2XAS A;  2QEX V;  1E1Q G;  2B1I A;  5EBW C;  3ML0 A;  1M90 W;  1E1R G;  1NQT A;  5KUK A;  4U7N A;  1J95 A;  3LSS A;  2QE7 G;  4MW3 A;  4FIP C;  4U7O A;  2ZDI C;  3E8H A;  3SYP A;  4FMT A;  2ZDI A;  2WLN A;  5L3E A;  3SYO A;  3I55 V;  2UXX A;  3STZ C;  1GM8 A;  2WSS G;  1BHA A;  3E2E A;  3VBB A;  4E2L A;  1NVP B;  5B1B B;  2OCC B;  2DWD C;  3CCL V;  2DYS C;  2DQ0 A;  2P90 A;  2LFS A;  1JPX A;  3B77 A;  4QE7 A;  1FFT B;  4PDM A;  3ZCC A;  3K04 A;  5L3D A;  1NVP D;  3DTU B;  3OMN B;  4G28 B;  3CC4 V;  3CYO A;  2Y48 A;  1L1F A;  1SES A;  2PI4 A;  4MTG A;  3SYQ A;  1UJW B;  5KUM A;  5KA5 A;  1K4D C;  3ZRS A;  4H37 A;  3HPL C;  1RPO A;  1DTO A;  2EIJ B;  3K0G A;  4YXW G;  1YJ9 V;  4XDK A;  3FB6 C;  2EIK C;  4QPJ A;  1YIT V;  1TUE B;  1K97 A;  3WG7 C;  3ABL C;  4R50 A;  1NBM G;  3IC7 A;  3W7W A;  3JYC A;  2XAJ A;  4TWK A;  4PA3 A;  2XAQ A;  3OUF A;  1M57 B;  3TK1 A;  1QCE A;  4G27 B;  3AG4 B;  1PNL A;  1VQN V;  3K0D A;  5CBH A;  1DF4 A;  3OE7 G;  2FTK A;  1ROP A;  3W7T A;  1OCO C;  3ABU A;  1PL0 A;  1FXK C;  2XAH A;  2IJH A;  3OR7 C;  3AG3 C;  3D36 A;  3JD2 A;  3MHH C;  2OTL V;  1M1K W;  4RO2 A;  1EBO A;  4QE9 A;  3CD6 V;  3K08 A;  4RQF A;  3OMA B;  1OHH G;  5HFL A;  4ZKI A;  4RQE A;  1K5S A;  1VQK V;  4JGS A;  2F43 G;  4WFG A;  1N8R W;  4MVO A;  1RM1 C;  3TCU A;  1JOY A;  2DYR C;  3W7X A;  3ZRW A;  4TT3 G;  1W0J G;  4GX0 A;  3K03 A;  4ASU G;  3G6E V;  1R6K A;  2DYS B;  3P32 A;  4FJC C;  1QVG U;  3ZRV A;  2QKS A;  1ENV A;  5LHH A;  2HG5 C;  2WLM A;  1S76 D;  2EIL B;  2A79 B;  1VQ5 V;  2JEU A;  3ZRW B;  5EK0 A;  3K79 A;  2Z3Y A;  1VQ7 V;  1KKD A;  3CP1 A;  5FL7 G;  3LDD A;  3P30 A;  3FYE B;  2IH3 C;  3RVY A;  1R3L C;  2AHY A;  1NR7 A;  2UXN A;  2IJK A;  2GSM B;  3TET A;  3SYC A;  1SZT A;  2EIJ C;  2X6C A;  2WPD G;  4MS2 A;  3CCJ V;  3H01 A;  1G8M A;  1H8H G;  2EIK B;  1FXK A;  2GHY A;  5CBF A;  5CBG A;  2HLD G;  1VQ8 V;  4MVS A;  4UXN A;  5EC2 C;  3FKS G;  4UV8 A;  3SJQ C;  4PA7 A;  1S5H C;  1V54 B;  1QR8 A;  3ZN1 A;  3ZMV A;  3E89 A;  1W0K G;  2JEX A;  2ATK C;  2NLJ C;  2Q69 A;  3OM3 B;  2QM7 A;  3NXS A;  4BIU A;  1FXK B;  5B1O A;  1K7D A;  4WF9 V;  3FB7 C;  4P9O A;  4N23 A;  1VQL V;  1YTF B;  1Y4M A;  1PKX A;  2Q68 A;  3AG3 B;  5B1A B;  3UKM A;  4CZZ A;  3K06 A;  1OCC C;  2ITD C;  4MT8 A;  4HZ3 A;  2P67 A;  3VOU A;  1DLB A;  2QA4 V;  4ZBM A;  1QLE C;  4LBE C;  1EFR G;  3ZJZ A;  1E79 G;  4PA4 A;  1QVF U;  4LC1 A;  3OW2 U;  1VQ4 V;  1JJ2 U;  2DYR B;  3G71 V;  3ASO B;  2EIM C;  1KP2 A;  2H94 A;  3ABK C;  4MVQ A;  4P30 A;  4JPR A;  3F7Y C;  4R7C A;  2LP7 A;  2HKO A;  2Q67 A;  2DW4 A;  3OAA G;  2PI5 A;  3LDE A;  2ZXW C;  1ZWI C;  1AI6 A;  1VQO V;  2R9R B;  2ZD9 A;  4BAY A;  4JAV A;  4J9Y B;  4JTD B;  5IY5 B;  3QO8 A;  4P9P A;  5J9P C;  3SPH A;  2EJR A;  4BIZ A;  2P6J A;  1NJI W;  1M56 B;  1FXH A;  3ZRX A;  4R6Z A;  1KEC A;  3F5W C;  3OGC C;  3R65 A;  1YJW V;  5LGU A;  3ETG A;  1XL6 A;  1Q82 W;  3GWO A;  3ZMZ A;  3T4D A;  1DF5 A;  5B3S B;  3CPW U;  1K34 A;  3RVZ A;  5LGN A;  4WFE A;  4I5S A;  3ASN C;  4PA6 A;  4PDL A;  5DM6 V;  1KQS U;  3T4Z A;  5IYB O;  4X8A A;  1S77 D;  1YSC A;  4OXS A;  3LDC A;  2WLL B;  1VQM V;  3X2Q C;  1RPR A;  1NH2 D;  1I5Y A;  1WPX A;  3ABT A;  3E83 A;  1F4N A;  5EC1 C;  3EHB B;  3CCQ V;  3I56 V;  1V54 C;  3E8F A;  3SPG A;  3E35 A;  2EIN C;  3A0R A;  1OCR B;  4JAU A;  3ABM C;  3JD4 A;  3LSQ A;  3BY6 A;  3M99 B;  1QLE B;  3SPJ A;  4I9W A;  5HFM A;  4MVR A;  3JD0 A;  3IFX A;  2BOB C;  3LNM B;  1YIJ V;  1P7B A;  4XDJ A;  4QJF B;  5H9C A;  2DWE C;  2LFR A;  1LNQ A;  3FYI B;  4L87 A;  2JIZ G;  3CCR V;  4RUE A;  1GM9 A;  1NR1 A;  4DXW A;  1AJN A;  1OCZ B;  1GTO A;  3OMI B;  3T2M A;  1VQ9 V;  2YSU B;  1YTF D;  1K4C C;  5H6Q A;  4H33 A;  2HFE C;  2H8P C;  2WAM A;  2Y69 B;  3ZMT A;  1JX9 A;  4KP4 A;  3AEI A;  2IU0 A;  1K8A W;  4P2Z A;  1S72 V;  3OUS A;  1Q86 W;  5LHI A;  3CCV V;  2JK5 C;  3WG7 B;  2W0F C;  1SER A;  4PDR A;  1MSW D;  2IJJ A;  4UVC A;  1YJN V;  1VQP V;  3GB7 C;  1SRY A;  5B1B C;  1JQ0 A;  5B3S C;  2WLI B;  3E86 A;  2XAG A;  2WLH A;  5CN0 A;  4FK5 C;  1H38 A;  5L3G A;  1OCO B;  2JJ1 G;  3PJS K;  2QM8 A;  3AG2 B;  1AJQ A;  1PNM A;  1KP3 A;  2WLL A;  3X2Q B;  1YHQ V;  2V7Q G;  5H6R A;  3B8N A;  2EZO A;  3K3W A;  3KG2 A;  3E8B A;  2W6J G;  1R3K C;  4MW8 A;  1YI2 V;  4XBF A;  1OCR C;  2ZR3 A;  3SPC A;  2B5U A;  1H8E G;  3OR6 C;  1R3J C;  3LUT B;  5C93 A;  2HR3 A;  4LCU C;  2HJF C;  3RBZ A;  1K5Q A;  3SPI A;  2XAF A;  1XL4 A;  1EZJ A;  2IU3 A;  3QO7 A;  1PD3 A;  4JYC A;  4WCE V;  4MTF A;  1NH2 B;  3E8G A;  4QPK A;  1MAB G;  1BMF G;  4GCZ A;  1HWY A;  2EIL C;  4GX2 A;  4Q20 A;  1NKD A;  4Z1M G;  5IYD O;  3CC2 V;  3ETE A;  1CEZ A;  2X7R B;  1OCZ C;  4MVZ A;  3MD0 A;  2A9H A;  3OEH G;  4R8C A;  4MTO A;  3ZIA G;  2Z5U A;  2Y69 C;  3AG1 B;  1V55 C;  2Q6A A;  1KC8 W;  5LBQ A;  4UUJ C;  3FB5 C;  2X6B A;  2ZR2 A;  2HVJ C;  4WFB V;  3CMA V;  1RM1 B;  1GKF A;  2YEV B;  4JTC B;  1BL8 A;  1F23 A;  2DQ3 A;  4GX1 A;  2AHZ A;  3QO5 A;  2R9I A;  5B1N A;  5DN6 G;  3FB8 C;  2X0L A;  1F51 A;  4QNH B;  5L3F A;  2X6A A;  3AG2 C;  1ARO P;  1JCH A;  2HVK C;  2YEV A;  4CBC A;  4JTA B;  1MG1 A;  1Y66 A;  5LHG A;  3WFV A;  3MHS C;  2CK3 G;  3ZN0 A;  4HYO A;  4F4L A;  2V1D A;  1OCC B;  2NNU A;  4X89 A;  2OTJ V;  2BOC C;  1VQ6 V;  1K9M W;  1GO3 F;  3CCS V;  1R6N A;  3BEH A;  4N21 A;  4G2K A;  4KFM A;  5L3B A;  2XOK G;  2C2A A;  1IXM A;  3OEE G;  2OT5 A;  2KB1 A;  2ITC C;  3IGA C;  1S3J A;  3DGE A;  3ZMS A;  2EIM B;  3ABK B;  3ASO C;  4DO2 A;  1W2B U;  2WWW A;  4HAM A;  1GK9 A;  2A0L A;  4PDV A;  4GX5 A;  1CPY A;  4UV9 A;  2JDI G;  3EFF K;  2P7T C;  4KUM A;  5CMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...