1VQ5V

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq5V00
1QVFU 1VQ4V 1Q86W 3CCJV 1YIJV 2OTJV 1YJ9V 1Q81W 1YJNV 1K9MW 1YI2V 2OTLV 3CCUV 1YITV 1KQSU 1VQNV 1N8RW 3CCSV 1Q7YW 1M90W 3I55V 1YJWV 4WFBV 3CCVV 1VQPV 2QEXV 1K73W 3CPWU 1VQ8V 1VQ6V 4WCEV 2QA4V 1YHQV 1VQ5V 3CCLV 3CD6V 3OW2U 3CCEV 3CC2V 3CCRV 1Q82W 1KD1W 3G6EV 1VQMV 1NJIW 3CCQV 1VQLV 4WFAV 3CXCU 1VQ7V 3CMAV 3CCMV 1JJ2U 1VQKV 3G71V 1M1KW 1VQ9V 3G4SV 1VQOV 3CMEV 4WF9V 3CC7V 1S72V 1R73A 2D3OW 1QVGU 1KC8W 3CC4V 3I56V 1W2BU 5DM6V 1K8AW
chains in the Genus database with same CATH superfamily
3ZHQA 2LO1A 4F4LA 2QWRB 4WFGA 1YI2V 3NR7A 2RNBA 1Q7YW 3S3XA 3LUTB 5E79Z 2M7WA 2B5UA 1X4TA 1Y74A 1QNMA 2X6BA 1O9GA 3A0RA 4YHHO 1NT2B 2RN9A 2D3OW 2E75B 3CWBH 1PL0A 4EEQA 3K0GA 3CE2A 4JI6O 2Y0IA 4HAMA 4J9ZB 5L3CA 3X2QB 5L3FA 1GTOA 3JD0A 2DQ3A 2H3OA 1BZKA 2A9HA 1Y76B 1M56C 3GWOA 3OFNG 4I50B 2Y4TA 3CC7V 2EJ7A 1YEWA 5BR8B 5LYJA 2F4VB 5EBMC 3P30A 2E5LO 5IDJA 2ZDIA 5LYJB 3KCXA 4JV5O 1JX9A 2ZE7A 5CBGA 4LH7A 2M6YA 3CCMV 5B5EZ 3GWKC 4ZHQB 2IM9A 4D7SA 1H8EG 2A7WA 1SZXA 2WLLA 4X1KA 2EIJC 3J81N 3EFFK 2GTAA 4UB6Z 2JRIA 4F6RA 1N36O 2UUCB 4F6RB 2Q67A 2N05A 5KMGA 2MW2B 1B6QA 2H8PC 1JJOA 1KP3A 1NR1A 4NKGB 1BHAA 4CH3A 1QLNA 2PTMA 3OE7G 4TV9A 1Q6HA 2P7TC 3LDEA 3TXSA 2HLDG 3SPCA 4RWUA 2YUAA 3WG7C 1FXKA 3P32A 3ZS8C 1HWYA 2AGAA 4DR1O 4DV4O 4LF9B 1ENVA 4NB5A 2P6JA 1QU7A 4MSWC 4DV2B 1F7YA 5EZYB 2DWDC 4FMTA 1I5XA 1XMOO 3HR0A 4LWSA 5BMVB 4L8JA 1GN6A 2FMLA 3E8FA 1XUQA 3RGBA 4QIWF 3TCUA 3H1LH 1NS1A 3RWRD 3FAVA 1MSWD 3AK3A 1H38A 2WPDG 3OUFA 5KAFZ 1HDJA 4X64O 3FAVB 1OV9A 4QNHB 4YHHB 2NR5A 3DC5A 1YHQV 2EIKC 3MD0A 2VRZA 1NKDA 4LFCB 1N34B 1KUQA 3A0HZ 2JJ2G 4IHJB 1FAFA 5D5PA 2Q8VA 5DN6G 1WJZA 2OT5A 3JARB 1R73A 5LHIA 4OX9O 1AJPA 4I5SA 1OCRC 4NTXA 2Y69B 4GKJO 4QE7A 1V55C 2EIMB 4X89A 1BQZA 2EINB 2F66C 4H44B 4G28B 3CPWU 2VQFB 1VQ8V 3ZRWB 2LW7A 3DTUB 1GAXA 5GTIZ 4DR2O 2E5LB 4CS2A 2Q7GA 3PJSK 3HKEA 4G27B 2DYRC 1KBHA 3CXHF 5IJ0A 4WCEV 2YXLA 1EBOA 4WFFA 3SYPA 2Y48A 2DMXA 5IE9A 5B1BB 1BSMA 2ODMA 4B3SO 5J2TA 1KC8W 2PF4E 4RQFA 1N36B 3MHSC 4PJ0Z 4JYCA 4EFEA 3O9OA 2IBZH 4WBNB 1D2DA 2UXNA 4CH4A 4MS2A 4TQDA 2XAHA 5GONB 4FK5C 1WLEA 2F95B 1FJGO 1H2SB 2ZM6O 3CCQV 3K03A 5IT9N 2HVKC 5L3BA 4FLWA 1IBMB 5EK0A 1BMFG 4LFBB 3UQ8A 1Q81W 3HKCB 3F7VC 1RM1C 2KQXA 5IYZA 4C7UA 2E74B 2Y0PA 4FVMA 2CGOA 3ZMVA 4K8XA 1FFTB 1XMOB 1K4CC 3ZMUA 4FLYA 3BY6A 1WA8A 4JGSA 3QG5A 1NBMG 3CEIA 2PYLA 1H8HG 4FZ1A 1G4YB 4XBFA 1YVWA 3T4DA 2NLJC 4OPHA 1EN6A 3UM7A 3H9VA 3HKBB 3WB2A 4JASA 1VIBA 5JVDB 1SQVH 4DR7B 1THZA 3AK2A 1UFIA 4DUYO 4AHCA 3ZN1A 4JI5B 4U7NA 3D3IA 1SA0B 2XNDG 5EC2C 1SERA 4UCSA 1KQSU 1N8RW 1XEQA 2UXCO 3AK1A 3J7AU 3N2KA 5LMUO 1WNSA 1BCCH 1DK1A 1YZBA 3O65A 1KB9F 4JI2B 4OX9B 4DRXA 2EBOA 3D36A 2YS8A 1M1KW 4DRXB 1JA8A 4IGGA 4DV6O 3ABKB 4B3RO 1PV0A 4LF7O 3D3QA 2A79B 4W4KA 3OR6C 1TAEA 1K5SA 3FFQA 4ICGA 2F93B 3QVNA 2BE3A 4P9PA 3IAYA 4JI7O 2AHZA 3IFXA 4I0XB 2XAJA 2HFEC 3G80A 2OCCC 1F23A 2Q9LA 4X1YA 3CC4V 2Z3YA 1DLBA 1PP9H 5H6RA 2GUZA 2GHYA 1SRYA 2OWOA 1GN4A 2GUZB 1CPYA 5FNVA 4NR1A 3N27A 5KX5A 5EBLC 3M7MX 3CS5A 3TXQA 4LF5B 2YI9A 2KB1A 2CH7A 1BHBA 2ZDIC 3BFRA 5C93A 1OCZC 4YJ3A 1M90W 5KLVH 5IWAB 3VBBA 3G6BA 4LP8A 2BOCC 5JQGB 3SYAA 2IJJA 1HNZB 2ZIOA 1M93A 4DW1A 4J7JA 3ABMC 3K58A 2LFSA 2WLIB 4ZI7B 1DF4A 4DV7B 3B77A 5JH7A 3ML0A 3AG1C 3P3NA 3OW2U 1P49A 2Q7EA 4EKWA 4TV8A 5EIBD 2Q68A 2YI8A 5LOVA 3LDDA 1GM9A 4QE9A 4UB8Z 2CAZC 1MG1A 2Q6AA 4OGQB 1U97A 1FXKC 2JGDA 2EILC 3AG3B 5C8YA 5ITZA 4TUYA 2YICA 4GZRB 2ADPA 4PDRA 3RYCA 4JI4O 5ITZB 4P2ZA 3CCEV 4X62O 3RYCB 2CUGA 2XUMA 1VQLV 5LA6B 4DR5O 4H13B 2YEVA 3RFRA 2LQTA 5KHJA 1P4RA 1YSCA 2YEVB 4Z1MG 3ICXA 2DQ0A 5DM6V 2HHHB 4MVQA 2QGNA 2PYJA 2B9ZA 2E3CA 3ABLB 1V54B 1JFFA 5IY5C 3L75H 3MHHC 3U10A 4LF7B 3B8NA 1JFFB 1CXZB 4CBCA 4PA9A 2DN9A 1LUVA 4JYAB 4B3MB 5CB4A 2CK3G 5L3EA 2ZT9B 3OMIB 4XDJA 2WLKA 3B2EE 4Z1VA 1JPXA 4X8AA 3JSLA 3DGEA 4BW5A 1PKXA 3K79A 4X9QA 4DV5B 1YTFD 2WLHA 2XAFA 4DV1B 1EM1A 4QJFB 4AQYO 4FLUA 4ABMA 4FM0A 3DXRB 1B3QA 2R72A 2QM7A 3OTOB 3B40A 5F2VO 1AR1B 3EXAA 1ZWIC 3ZEDA 3ETDA 2GTSA 3FB5C 3K57A 4FFBA 4R8CA 4NXNO 1AI5A 1TUBA 2W0XA 4PA6A 1AROP 2QR4A 2UXXA 3K5OA 2ZR3A 4HNAB 1YXBA 2ZIMA 3H1HH 3JSNA 4UV8A 4YJ2B 2Q69A 1HNXB 2LW1A 4BAYA 3CRCA 1US6A 2KG7B 3E83A 1OJHA 1M57B 2QKAA 2ZXWB 1F4MA 4RUEA 4N23A 4GX5A 1NZ6A 1AILA 1MZFA 2DJVA 3JASB 3K9SA 1WPBA 4O2AB 1I94O 3CMAV 2A06H 3JD3A 3AG4C 1AR5A 1QVGU 3RYHB 1Z5VA 4O2BB 4OXSA 4GKKO 1HR0O 4ZIBA 1I5YA 1Y76A 3JALB 2R9RB 1R3LC 1RSOA 4CZZA 4I50A 3OMAB 4LH6A 3JYCA 1RSOB 2H94A 4JI4B 1K8AW 3K59A 4X62B 5D5QA 4K3AA 4WFBV 4MT8A 3L9DA 4FM1A 2HVJC 2PGGA 1N0NA 2QM4A 3CRMA 1QLEB 4I4TB 3SYCA 5BXZA 2XAGA 4ZHQA 3RVYA 1URFA 5E1AC 4DW0A 2UXBO 1S5HC 4UFZA 4LF4O 2ILMA 1PL4A 4DR3O 2YDEA 1HNWO 4CC5A 5A2QN 2WLNA 4HZ3A 2V7QG 2P4KA 2QSAA 4XDLA 3OUSA 3H1KH 4OPAA 2P5OA 2AHYA 4JI0B 4AI8A 1R6KA 4O4JA 4PI2A 1XREA 2BTOA 4O4JB 1OCOB 1S0VA 1MOFA 3SJCC 4NXMB 4LFAO 2NN4A 4ASUG 2AXTZ 3EHBB 3ABKC 3CCRV 5BY1A 1NJIW 4CC6A 3FD9A 1WP8A 1N4CA 2YXHA 3SPJA 5EZYA 3BA8A 3L72H 3ETGA 4RAIA 4IT5A 4NXNB 2CGNA 5BMVA 4IL6Z 2DW4A 2AW9A 5B1AC 1H2NA 1W0JG 4FZ0A 3T2MA 1XNRO 3LSUA 3OEHG 1IBLB 1MMMA 1R3JC 2OYQA 2N04A 3CC2V 4B3TO 1SKVA 1K33A 1A32A 3B09A 3KG2A 5KHHA 1J5EO 1L0NH 2RDCA 3JD1A 3QF7A 3CX5F 1GKFA 1QVFU 2JS5A 2YIBD 1NVPD 3I55V 5FLXN 1WAZA 2R9AA 1U96A 1E1QG 4DYLA 1AI4A 5B3SB 2HP8A 3ZMZA 4IHJA 4I7ZB 3ASNB 3JARA 4JTAB 2QWNB 1HR0B 1VQKV 2ZE5A 1XL4A 3BHPA 4JI6B 4X20B 2ZNIA 3ZHSA 3ZIAG 1XQ8A 4X1IB 1HP8A 2DYSB 4EFBA 1R6TA 1IZ3A 5LP6B 4MTGA 3ZRWA 4BWAA 3RT3C 4PHZA 3WB0A 1XHXA 1AB3A 1I7FA 2VWJA 2FKXA 3L73H 2Z0AA 3E86A 1TVKA 1IDSA 4D6TH 1L8DA 1GO3F 3K5NA 4J42A 1TVKB 4MW8A 2ETNA 4LR3A 4JAAA 5LBQA 3QO7A 1Y67A 1BL8A 4JV5B 4DR4O 1WN7A 3OMNB 1KECA 5JCOA 4PI0A 1OCCB 2JEXA 3DC6A 4JTCB 2UUBO 1KU9A 2UXBB 4PDVA 3UKMA 2VWKA 3SJQC 2CTPA 1XNQO 3CXCU 5KA6A 5EBWC 4I9QA 2ZE6A 1Q6UA 3K06A 4UCUA 5EC1C 3CMEV 3JAMN 3I5DA 4DR3B 1FPOA 2WWWA 1HNWB 3JCUZ 3E22B 4WBNA 1FYJA 1VMGA 3STLC 1GN2A 3VOUA 2L6LA 5GONA 4JYYA 3ETQA 1VEWA 4E2LA 1EN5A 2ATKC 1EFRG 1PD3A 1QHTA 5IYBO 3ZMSA 4DV3O 3Q4HB 3HKCA 3LNNA 1NVPB 1QR9A 5KHGA 4DR1B 4DV4B 1ZAUA 2K9PA 3BA9A 3CCVV 5H9CA 1QCEA 5IJ9B 3HKDB 3FYIB 2C2AA 1JMKC 3W7WA 5J2UA 4B7EA 4UVAA 4DR6O 5J2UB 3CRQA 3ZBHA 1DF5A 4RUFA 3TJTA 2A3QA 4PDLA 1M56B 1FKAO 3SJAC 3LSSA 3BVOA 1L0LH 2ZQMA 3HKBA 1NI8A 1J5EB 5FL7G 1VQ6V 4YY3O 1VQ5V 4P9OA 5JVDA 3T1HO 5CA1B 3UO2A 1K92A 4X64B 3G71V 4J11A 5LHHA 4LNUB 1SA0A 3D8CA 1W2BU 1JCHA 4IIJA 1IBKO 2EULA 4IIJB 3W7TA 2JJ1G 2QTOA 2ZE8A 1MA1A 3FKSG 2JK5C 1XDCA 1ZL8B 3CSXA 2EIJB 3OAAG 3VQWA 1M4UA 4GKJB 4UVBA 5JWPA 4JI8O 5A9GA 1NQTA 4KFMA 3LSQA 2Z5UA 2LGWA 5IYDO 2OTJV 3STZC 3JAKB 4MVMA 3N2GB 1ORQC 1IURA 2GDSA 4EB6A 4I0XA 2YSUB 4X66O 4DR2B 4J10A 4DV0O 4EB6B 3FB8C 1H2LA 1ZTEA 4FM2A 5BZBA 1XMQO 2Q0OC 2W0FC 3ABUA 3BABA 2UUAO 2P90A 3OT7A 3WG7B 3JAWB 3X2QC 1H2MA 4JTDB 1QQCA 5H6QA 2NNUA 2HEPA 1W59A 1XNQB 4K0KO 2LP7A 3GB7C 1GRJA 2IH3C 5CN0A 3T1YO 1N33O 2ADQB 4FLVA 2Q5ZA 2WSSG 4B3SB 1K5QA 2FL4A 4UCOA 2P4VA 4FJCC 4NVPA 4GX0A 5EYPB 3OTFA 1P84F 1M9NA 5JJJB 5LMNO 1N0JA 4AILC 2Q73A 1EZJA 1AP5A 1SC5B 2RMKB 1FJGB 4LBEC 2IJKA 1JVMA 2ZM6B 2WA4A 5HFLA 5JQGA 2QEXV 2WAMA 3SDLA 1GM8A 3VQYA 1T5EA 1YDXA 1DGSA 2G38A 3GVMA 2VQEO 5KHIA 2GV9A 1LR1A 1NR7A 2EIKB 1KKCA 2WLIA 4KUMA 4ZI7A 1KYOF 2CTQA 4UCTA 3ZCCA 1CP9A 1K3EA 4GX2A 1WB8A 1R3KC 3QO8A 1FFXB 4DO2A 3BEHA 1OCRB 4TQFA 3CCLV 3E8BA 4NYKA 1JQ0A 1V55B 2PZSA 1OCOC 1RPRA 2WLJA 3RYIA 2F1MA 1Q5OA 4O4HB 3RYIB 3AG2B 4YY3B 3T1HB 1XHZA 4NTWA 5LXTB 4GCZA 4GUNA 3MAQA 5LA6A 1UPGA 4DUYB 3FX7A 3IC9A 4B7KA 2DYRB 1VQ7V 3CP1A 4W4LA 3A2FA 4J80A 2UXCB 1E1RG 3FB7C 3RN4A 2CDYA 5LMUB 4J7KA 2QKSA 4LC1A 1B06A 4TT3G 4X65O 3JATA 2CE4A 5BR8O 2XASA 2F4VO 2QDOA 4DV6B 2ZINA 4B3RB 3K9AA 1J95A 3JATB 4XDKA 1NTZH 3W7XA 4IYIA 4X66B 5B3SC 2JIZG 4JI7B 4FIPC 1JR9A 4L87A 4HBNA 1VF6A 3APQA 3CB2A 2UUAB 2IJIA 4FLXA 3MDSA 3B8MA 3S3WA 2XAQA 3JCZA 1RM1B 3L71H 2Y69C 1KKDA 3DXRA 3OM3B 2EIMC 3G4SV 1FXVA 2EINC 4K0KB 1N33B 2KSDA 5GTHZ 3AG7A 1VQ4V 3UO3A 4CH6A 1K9MW 2ITCC 3F5TA 1PM9A 4UVCA 4JYBA 1G8MA 2OIGA 3OGIB 1UJWB 2YIDA 4HNAA 2YXYA 4YJ2A 1RFYA 4UCVA 4MVOA 1GH6A 4J9YB 4LF8O 4BR6A 2KG7A 1R6NA 4QPKA 4LF9O 4U3JA 3RYFB 1VF7A 1FXHA 4DV2O 2JGUA 4MW3A 2JEUA 4U3JB 2EZOA 5B1BC 3JASA 1YF2A 1BT8A 4O4LB 4O2AA 4D7TA 4X88A 4I55B 5LGNA 1R3IC 3WU2Z 3RYHA 2IU3A 1COWG 4O2BA 3RBZA 1AVMA 1SQXH 3BAAA 2GBOA 2BSKB 3CCUV 3C3TA 1NH2D 3JALA 3VQVA 1LUWA 3A0BZ 4BIZA 2B1IA 5FPOA 3LDCA 4JI3O 1D5AA 3E8HA 5FPRA 5LGTA 3QNEA 1G6UA 3SPHA 1Y74B 3P3PA 3E8GA 2E76B 1S77D 4MVRA 4LFCO 3ZJZA 1N34O 2OCCB 4DR5B 1MNGA 1VP7A 1B04A 1YTFB 4I4TA 1ZX3A 1PNMA 3ZHUA 4GT1A 4WFAV 1DTOA 4DXWA 2VQFO 2N74A 1YCIA 2GSMB 4BIOA 4X65B 2W6JG 2QTSA 3TGUH 1YIJV 2HG5C 1XBLA 2AZ0A 1YITV 3F7YC 1Q3EA 3QTCA 1IXMA 4TOIA 2ZCEA 3T4ZA 1H2KA 1I0HA 2LFRA 3VQXA 3U0ZA 4ZKIA 1OCZB 1AI7A 1WPXA 3B4SA 4TWKA 1QR8A 1O9HA 4LCUC 1SESA 4JF3A 1Y6XA 1NTKH 3UT5A 4YXWG 2RCVA 3UT5B 4H33A 3KKYA 2WLLB 4X1KB 2D2CB 4AQYB 4TSFG 3ZRSA 2B1GA 3ZRVA 3R66A 3ABMB 3D36C 3SPGA 1NU1H 3ZX6A 1KMIZ 1R1BA 1Y66A 4J41A 4A5UB 5KMGB 1FS0G 3AG1B 4N21A 1VF5B 1D5NA 3ZN0A 2PI5A 1BE3H 2K1EA 3CCJV 1NH2B 1OHHG 1VQNV 4JAVA 4TV9B 5L3GA 3H1IH 3L74H 1IBMO 4LF8B 4LFBO 2ZR2A 1FXKB 3K08A 3THOA 1N32O 4KHPO 1PNLA 2EILB 3CJHA 2LJ2A 3T1CA 2PY5A 3AEIA 3K04A 2ZNJA 2DE0X 3CJHB 2X6CA 2XHBA 4MVZA 4O4IA 2OTLV 4LWSB 3OD4A 1K4DC 1EN4A 1I94B 4O4IB 2L35A 3WFVA 1XI1A 1Q6IA 4X20A 4HYOA 3E2EA 4UV9A 5DEDA 4X1IA 4GKKB 3J80N 5IY5B 2FB5A 2CTWA 4JI3B 3CD6V 3ABTA 2JS3A 5LP6A 1ROPA 4DR7O 3APOA 1VQPV 4JI5O 5KUMA 3G67A 1X59A 1GMGA 3G6EV 2X7RB 4K35A 5LHGA 1E79G 4JI2O 4FLZA 4MVSA 3ASOB 3IGAC 4RQEA 4PDMA 2A0LA 3ZRXA 1S5LZ 3DSQA 5CBFA 3AG2C 2AZ2A 5HFMA 2EZPA 4R6ZA 2VS0A 1F4NA 3R65A 3ZHVA 4LF4B 5KA5A 5B1OA 4B08A 1JJ2U 3M8AA 1Z2GA 1VQOV 3ZHRA 3AG3C 1S72V 2DWEC 2XT9A 2HKOA 3E22A 3H1JH 4H37A 2RQ6A 4R50A 3HKEB 3K5LA 3K0DA 2QWQB 1S3JA 2ZD9A 4QPJA 1TUEB 5AG2A 5IJ0B 2HR3A 3UCSC 1L1FA 3CHXA 3Q4HA 2YIBA 4LFAB 4PV1B 3SJBC 3ABLC 5J2TB 1V54C 4QGPA 3SGIA 1XL6A 1YJNV 1W0KG 4MTFA 3AG4B 5IJ9A 3HKDA 3K5MA 4LF5O 2FYUH 2PUSA 1SQGA 2P67A 5CMUA 5H5NA 4Q6GA 5JJEB 5IWAO 4DK1A 4I9WA 3FB6C 3CYOA 3HPLC 5H2FZ 2F23A 2BTQA 1XNRB 1K34A 2QJ1A 5K1PA 2KKWA 1IX9A 2HJDA 3LNMB 1VF6C 4MVUA 1HNZO 2BTQB 3I56V 4DUZO 2LGQA 2QKCA 4B3TB 4KHPB 1N32B 3EVKA 4Q20A 2Q4PA 1XOUA 5JJNB 1Q90D 1K73W 5IYZB 2QA4V 3PN1A 3IC7A 1CEZA 3RVZA 2XOKG 2ITDC 2YC0A 5CA1A 1Q8IA 4DV7O 2JDIG 4JZGA 1VQMV 1GN3A 2UU9O 4LNUA 1Y4MA 2DOSA 1WA8B 4NTYA 1K7DA 1ZSPA 1RPOA 5EIBC 2Y4UA 3HB3B 1ZL8A 1PPJH 2R70A 1M57C 4JZ2A 3K3WA 4YIOA 2ZXWC 2Q0AA 1Q43A 1P7GA 1SQFA 3SR2C 1K97A 1TA8A 3JAKA 3N2GA 1JOYA 2OCHA 5TISZ 2F43G 2R9IA 4PA7A 3OGCC 1AJQA 1MZEA 1EZVH 4YIPA 1ZLZA 2QM8A 4FFKA 1TGOA 1G1XB 1OZ0A 1F51A 2HHHO 3N2KB 3OR7C 1KD1W 4DR4B 3JAWA 3OEEG 2JVDA 5GW7A 4WF9V 1KP2A 2UUBB 3BCCH 5B1NA 4JI1O 2IH1C 1WP7A 4CH5A 4JPRA 4MTXA 4MTOA 5KAIZ 4JYAO 4B3MO 2ARHA 2V1DA 5B1AB 5EYPA 3L70H 4DV5O 2RJZA 1AJNA 5B66Z 1MABG 4DV1O 1I08A 2W6IG 4X1YB 1QLEC 4UXNA 1BGYH 4Z2WA 5KUKA 3OTOO 4DV3B 3M99B 4KL1A 3SYOA 2Q7HA 3KCYA 3SPIA 5FNVB 1WB7A 2XTAA 1AI6A 5KX5B 2UXDO 1HNXO 2CH7B 1QBZA 1BQ0A 1FFXA 1Z5WA 1VARA 4LF6O 4DR6B 4YJ3B 4GX1A 4R7CA 3WB1A 3E89A 3FYEB 4DUZB 3KZIZ 3TK1A 4GYCB 1ZUQA 1HW7A 4O4HA 1SZTA 3CRRA 2ZKOA 1IXBA 2WA3A 4E4EA 3U11A 3JD4A 3RW0A 3BPZA 5CA3A 1Q86W 1YJ9V 5LXTA 3ZMTA 2UU9B 5J9PC 2X0LA 1S76D 4GLXA 3F5WC 4K8ZA 1NTMH 5JH7B 1IBKB 4WFEA 4ZOLA 4TV8B 5IYCO 4ZOLB 4ZBMA 3ZHTA 5LOVB 1V9PA 1BS3A 2BOBC 2CTRA 3QO5A 4BIUA 1LNQA 2EX3A 2FTKA 1P7BA 1SF9A 4KXRA 2JGDB 5CBHA 5C8YB 4PA3A 4TUYB 4JI8B 4WFHA 3IJ4A 4H0LB 2P06A 2MK3A 1AP6A 2PI4A 4UUJC 3W7SA 1MSDA 4RO2A 2IJHA 3JD2A 4PELA 4KP4A 3H01A 4G2KA 5K1XA 1SQQH 4DV0B 3CCSV 3ASNC 1XMQB 1FD9A 4JAUA 1GM7A 4CS3A 1RP3B 5DECA 4DK0A 3CRAA 4U3FH 2DYSC 4JI1B 4FLTA 2P22C 3E35A 1S5JA 4UCRA 3SYQA 1VQ9V 5LP6C 1H2GA 4BW9A 2UUCO 3T1YB 5LGUA 5CB4B 5L3DA 5LL6Y 2IU0A 1SETA 4PA4A 2QWOB 4JI0O 1SS3A 2WLMA 4U7OA 4P30A 2QWPB 1IVSA 1GK9A 4PD4F 1SQPH 5LMNB 3C3SA 1SQBH 1Q82W 4NXMO 2V4DA 5KHKA 3ASOC 2X6AA 4IYHA 1OCCC 1AR4A 3BRCA 4FPPA 3RYFA 5JCOC 1XILA 2O57A 3NXSA 3TETA 3C90A 2IW5A 2EJRA 2VQEB 1YJWV 2HJFC 4O4LA 2YIAA 4J7ZA 4FFBB 2UXDB 5CA0A 4CS4A 3A8TA 2QE7G 1TUBB 4I55A 2BCCH 5CA0B 3W7UA 1PNKA 4F6EA 1IBLO 4LF6B 2BSKA 2OIEA 3ETEA 1M5IA
chains in the Genus database with same CATH topology
4F4LA 4WFGA 2WLIB 3LSSA 1YI2V 2OTLV 1DF4A 3B77A 2ZQMA 1Q7YW 1K4DC 3LUTB 3WFVA 5FL7G 1VQ6V 3ML0A 1VQ5V 4P9OA 2M7WA 2B5UA 3AG1C 3OW2U 4EKWA 2X6BA 3A0RA 2Q68A 4HYOA 1K92A 3E2EA 3G71V 4UV9A 2D3OW 5LHHA 5IY5B 3LDDA 1GM9A 1PL0A 4QE9A 1W2BU 1JCHA 3K0GA 3ABTA 3CD6V 1MG1A 1ROPA 2Q6AA 1FXKC 4HAMA 5L3CA 4J9ZB 2EILC 3AG3B 3W7TA 3X2QB 2JJ1G 1VQPV 2QTOA 4PDRA 5L3FA 1GTOA 3JD0A 2DQ3A 3FKSG 2JK5C 4P2ZA 2A9HA 5KUMA 3CCEV 2EIJB 1GMGA 3G6EV 1M56C 2X7RB 1VQLV 2YEVA 3OAAG 3GWOA 4UVBA 3OFNG 5LHGA 3CC7V 1P4RA 1YSCA 2YEVB 1E79G 1NQTA 4KFMA 4Z1MG 3LSQA 2DQ0A 2Z5UA 5DM6V 5IYDO 4MVSA 2OTJV 3STZC 4MVQA 5EBMC 4MVMA 1ORQC 3ASOB 3IGAC 3P30A 4RQEA 5IDJA 4PDMA 2ZDIA 3ABLB 2A0LA 3ZRXA 1V54B 2YSUB 5CBFA 1JX9A 3MHHC 3AG2C 5IY5C 5HFMA 2EZPA 3FB8C 4R6ZA 5CBGA 3B8NA 5BZBA 2W0FC 1F4NA 3R65A 3ABUA 5B1OA 5KA5A 3CCMV 4CBCA 1JJ2U 4PA9A 1VQOV 2P90A 3WG7B 3AG3C 1S72V 3X2QC 2CK3G 2DWEC 5L3EA 2HKOA 4JTDB 1H8EG 4H37A 3OMIB 4XDJA 5H6QA 2NNUA 2WLLA 2WLKA 4R50A 1JPXA 2EIJC 4X8AA 3K0DA 2LP7A 1S3JA 2ZD9A 3DGEA 3EFFK 3GB7C 2IH3C 4QPJA 5CN0A 4BW5A 1PKXA 1TUEB 2WSSG 3K79A 1K5QA 1YTFD 2WLHA 2XAFA 2HR3A 4FJCC 2Q67A 4QJFB 1L1FA 4GX0A 1B6QA 2H8PC 1KP3A 1M9NA 1NR1A 1BHAA 3ABLC 1EZJA 2QM7A 1QLNA 1V54C 1AR1B 3OE7G 1ZWIC 1XL6A 2P7TC 1YJNV 3ETDA 3FB5C 4LBEC 2IJKA 1JVMA 1W0KG 4MTFA 3LDEA 3AG4B 5HFLA 4R8CA 2QEXV 2HLDG 3SPCA 1AI5A 2WAMA 1GM8A 3WG7C 1FXKA 2P67A 3P32A 5CMUA 1HWYA 4PA6A 1AROP 2UXXA 2ZR3A 4UV8A 1ENVA 4I9WA 3FB6C 2Q69A 2P6JA 3CYOA 3HPLC 1NR7A 4BAYA 4MSWC 1K34A 3LNMB 2DWDC 4FMTA 1I5XA 2EIKB 4MVUA 2WLIA 3E83A 4KUMA 3I56V 1M57B 3ZCCA 2ZXWB 1CP9A 1F4MA 1K3EA 4GX2A 4RUEA 4Q20A 4N23A 4GX5A 3E8FA 1K73W 1R3KC 3QO8A 4DO2A 3BEHA 2QA4V 1OCRB 3CCLV 3E8BA 3IC7A 1CEZA 3RVZA 2XOKG 2ITDC 1JQ0A 2JDIG 1V55B 1VQMV 4QIWF 3TCUA 1OCOC 3CMAV 1RPRA 3JD3A 2WLJA 1Y4MA 3AG4C 1QVGU 3AG2B 1MSWD 1K7DA 1H38A 1RPOA 2WPDG 3OUFA 4OXSA 4QNHB 3HB3B 1I5YA 4GCZA 1YHQV 2EIKC 2R9RB 1R3LC 3MD0A 1NKDA 1M57C 3K3WA 4CZZA 2DYRB 1VQ7V 2JJ2G 3CP1A 3OMAB 2ZXWC 5DN6G 3JYCA 2OT5A 2H94A 1R73A 1E1RG 5LHIA 3FB7C 1K97A 1AJPA 1K8AW 4I5SA 1OCRC 1JOYA 2Y69B 2QKSA 2F43G 2R9IA 4PA7A 1V55C 2EIMB 1AJQA 3OGCC 2EINB 4LC1A 4QE7A 4X89A 4TT3G 4WFBV 4MT8A 4G28B 3CPWU 2QM8A 1VQ8V 1OZ0A 2HVJC 3ZRWB 1F51A 2XASA 3DTUB 3OR7C 1QLEB 1KD1W 3SYCA 3K9AA 1J95A 2XAGA 4XDKA 3OEEG 3RVYA 3ETEA 5GW7A 4WF9V 5E1AC 1S5HC 3W7XA 1KP2A 5B3SC 3PJSK 2JIZG 5B1NA 2IH1C 4FIPC 4JPRA 4L87A 4MTXA 4MTOA 4G27B 2DYRC 2IJIA 4WCEV 3B8MA 2XAQA 1EBOA 3JCZA 4WFFA 3SYPA 2V1DA 5B1AB 1RM1B 2WLNA 2Y48A 4HZ3A 2V7QG 4XDLA 2Y69C 3OUSA 5B1BB 1KKDA 3OM3B 2EIMC 3G4SV 1FXVA 2EINC 2AHYA 1R6KA 1KC8W 1AJNA 4RQFA 1MABG 3MHSC 1VQ4V 2W6IG 1K9MW 4JYCA 1OCOB 1QLEC 2ITCC 1MOFA 4UXNA 1S0VA 4UVCA 2UXNA 4JYBA 1G8MA 5KUKA 4MS2A 1UJWB 4ASUG 2XAHA 3EHBB 3ABKC 1WLEA 4FK5C 3M99B 3CCRV 3SYOA 1NJIW 3CCQV 4MVOA 3K03A 3SPJA 4J9YB 3SPIA 2HVKC 1R6NA 3ETGA 5L3BA 4RAIA 4QPKA 1AI6A 5EK0A 1BMFG 1Q81W 2DW4A 3F7VC 1FXHA 5B1AC 1RM1C 1W0JG 4MW3A 3T2MA 1QBZA 2JEUA 2EZOA 5B1BC 3OEHG 3ZMVA 4GX1A 1FFTB 1R3JC 4R7CA 1K4CC 3ZMUA 3E89A 3FYEB 3CC2V 3TK1A 1K33A 3BY6A 4JGSA 4X88A 5LGNA 1R3IC 3KG2A 1SZTA 1NBMG 2IU3A 1COWG 1H8HG 3JD1A 3RBZA 1GKFA 1G4YB 3JD4A 3RW0A 4XBFA 5CA3A 3T4DA 1Q86W 2NLJC 1QVFU 1YJ9V 3CCUV 1NVPD 3ZMTA 1NH2D 5J9PC 3I55V 3UM7A 4BIZA 2X0LA 2B1IA 3LDCA 1S76D 1E1QG 4JASA 5B3SB 1AI4A 3F5WC 3E8HA 3ZMZA 5LGTA 3QNEA 4WFEA 3ASNB 3SPHA 4JTAB 1VQKV 1XL4A 1THZA 5IYCO 3ZIAG 3E8GA 1S77D 4ZBMA 3ZN1A 4MVRA 3ZJZA 4U7NA 2DYSB 2BOBC 3D3IA 2XNDG 5EC2C 3QO5A 1SERA 4BIUA 1KQSU 1N8RW 1LNQA 2OCCB 2FTKA 4MTGA 3ZRWA 1P7BA 5CBHA 4PA3A 1YTFB 1PNMA 4WFHA 3E86A 2MK3A 2EBOA 4GT1A 4WFAV 1DTOA 3D36A 4DXWA 1GO3F 2PI4A 1M1KW 4MW8A 4UUJC 3W7SA 4RO2A 3QO7A 5LBQA 1BL8A 2GSMB 3ABKB 2IJHA 3JD2A 4PELA 2W6JG 4KP4A 3H01A 4G2KA 1YIJV 2HG5C 2A79B 1KECA 3OMNB 3OR6C 1YITV 3F7YC 3CCSV 1K5SA 1OCCB 3ASNC 1IXMA 2JEXA 4JAUA 1GM7A 4JTCB 4P9PA 3T4ZA 4PDVA 2LFRA 2AHZA 3UKMA 4ZKIA 3IFXA 3SJQC 2XAJA 1OCZB 2HFEC 2DYSC 1AI7A 1WPXA 3CXCU 5KA6A 4TWKA 1QR8A 3E35A 5EBWC 5EC1C 3SYQA 3K06A 1VQ9V 4LCUC 1SESA 1H2GA 2OCCC 4JF3A 3CMEV 1F23A 5LGUA 3CC4V 2Z3YA 1DLBA 2WWWA 4YXWG 5L3DA 2IU0A 1SETA 3STLC 5H6RA 4H33A 2WLLB 4PA4A 3VOUA 2GHYA 1SRYA 4TSFG 3ZRSA 2B1GA 3ZRVA 3ABMB 2WLMA 4U7OA 4P30A 1GK9A 4E2LA 3SPGA 1Q82W 1CPYA 2ATKC 1EFRG 1PD3A 5IYBO 3ASOC 5EBLC 2X6AA 1Y66A 1OCCC 4FPPA 1FS0G 3AG1B 4N21A 3ZMSA 2KB1A 3ZN0A 1NVPB 2K1EA 3NXSA 2ZDIC 3CCJV 1NH2B 2PI5A 1QR9A 3TETA 1BHBA 1OHHG 2IW5A 2EJRA 1VQNV 5C93A 1OCZC 4JAVA 1M90W 5L3GA 3VBBA 4LP8A 3CCVV 1YJWV 2HJFC 2BOCC 5H9CA 1QCEA 3SYAA 3FYIB 2C2AA 2IJJA 2ZR2A 4MVZA 2QE7G 3W7WA 1FXKB 3K08A 1PNLA 4UVAA 2EILB 3W7UA 1PNKA 3T1CA 3AEIA 3K04A 1DF5A 4RUFA 2X6CA 4PDLA 3ABMC 2LFSA 1M56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF U;  1VQ4 V;  1Q86 W;  3CCJ V;  1YIJ V;  2OTJ V;  1YJ9 V;  1Q81 W;  1YJN V;  1K9M W;  1YI2 V;  2OTL V;  3CCU V;  1YIT V;  1KQS U;  1VQN V;  1N8R W;  3CCS V;  1Q7Y W;  1M90 W;  3I55 V;  1YJW V;  4WFB V;  3CCV V;  1VQP V;  2QEX V;  1K73 W;  3CPW U;  1VQ8 V;  1VQ6 V;  4WCE V;  2QA4 V;  1YHQ V;  1VQ5 V;  3CCL V;  3CD6 V;  3OW2 U;  3CCE V;  3CC2 V;  3CCR V;  1Q82 W;  1KD1 W;  3G6E V;  1VQM V;  1NJI W;  3CCQ V;  1VQL V;  4WFA V;  3CXC U;  1VQ7 V;  3CMA V;  3CCM V;  1JJ2 U;  1VQK V;  3G71 V;  1M1K W;  1VQ9 V;  3G4S V;  1VQO V;  3CME V;  4WF9 V;  3CC7 V;  1S72 V;  1R73 A;  2D3O W;  1QVG U;  1KC8 W;  3CC4 V;  3I56 V;  1W2B U;  5DM6 V;  1K8A W; 
#chains in the Genus database with same CATH topology
 3ZHQ A;  2LO1 A;  4F4L A;  2QWR B;  4WFG A;  1YI2 V;  3NR7 A;  2RNB A;  1Q7Y W;  3S3X A;  3LUT B;  5E79 Z;  2M7W A;  2B5U A;  1X4T A;  1Y74 A;  1QNM A;  2X6B A;  1O9G A;  3A0R A;  4YHH O;  1NT2 B;  2RN9 A;  2D3O W;  2E75 B;  3CWB H;  1PL0 A;  4EEQ A;  3K0G A;  3CE2 A;  4JI6 O;  2Y0I A;  4HAM A;  4J9Z B;  5L3C A;  3X2Q B;  5L3F A;  1GTO A;  3JD0 A;  2DQ3 A;  2H3O A;  1BZK A;  2A9H A;  1Y76 B;  1M56 C;  3GWO A;  3OFN G;  4I50 B;  2Y4T A;  3CC7 V;  2EJ7 A;  1YEW A;  5BR8 B;  5LYJ A;  2F4V B;  5EBM C;  3P30 A;  2E5L O;  5IDJ A;  2ZDI A;  5LYJ B;  3KCX A;  4JV5 O;  1JX9 A;  2ZE7 A;  5CBG A;  4LH7 A;  2M6Y A;  3CCM V;  5B5E Z;  3GWK C;  4ZHQ B;  2IM9 A;  4D7S A;  1H8E G;  2A7W A;  1SZX A;  2WLL A;  4X1K A;  2EIJ C;  3J81 N;  3EFF K;  2GTA A;  4UB6 Z;  2JRI A;  4F6R A;  1N36 O;  2UUC B;  4F6R B;  2Q67 A;  2N05 A;  5KMG A;  2MW2 B;  1B6Q A;  2H8P C;  1JJO A;  1KP3 A;  1NR1 A;  4NKG B;  1BHA A;  4CH3 A;  1QLN A;  2PTM A;  3OE7 G;  4TV9 A;  1Q6H A;  2P7T C;  3LDE A;  3TXS A;  2HLD G;  3SPC A;  4RWU A;  2YUA A;  3WG7 C;  1FXK A;  3P32 A;  3ZS8 C;  1HWY A;  2AGA A;  4DR1 O;  4DV4 O;  4LF9 B;  1ENV A;  4NB5 A;  2P6J A;  1QU7 A;  4MSW C;  4DV2 B;  1F7Y A;  5EZY B;  2DWD C;  4FMT A;  1I5X A;  1XMO O;  3HR0 A;  4LWS A;  5BMV B;  4L8J A;  1GN6 A;  2FML A;  3E8F A;  1XUQ A;  3RGB A;  4QIW F;  3TCU A;  3H1L H;  1NS1 A;  3RWR D;  3FAV A;  1MSW D;  3AK3 A;  1H38 A;  2WPD G;  3OUF A;  5KAF Z;  1HDJ A;  4X64 O;  3FAV B;  1OV9 A;  4QNH B;  4YHH B;  2NR5 A;  3DC5 A;  1YHQ V;  2EIK C;  3MD0 A;  2VRZ A;  1NKD A;  4LFC B;  1N34 B;  1KUQ A;  3A0H Z;  2JJ2 G;  4IHJ B;  1FAF A;  5D5P A;  2Q8V A;  5DN6 G;  1WJZ A;  2OT5 A;  3JAR B;  1R73 A;  5LHI A;  4OX9 O;  1AJP A;  4I5S A;  1OCR C;  4NTX A;  2Y69 B;  4GKJ O;  4QE7 A;  1V55 C;  2EIM B;  4X89 A;  1BQZ A;  2EIN B;  2F66 C;  4H44 B;  4G28 B;  3CPW U;  2VQF B;  1VQ8 V;  3ZRW B;  2LW7 A;  3DTU B;  1GAX A;  5GTI Z;  4DR2 O;  2E5L B;  4CS2 A;  2Q7G A;  3PJS K;  3HKE A;  4G27 B;  2DYR C;  1KBH A;  3CXH F;  5IJ0 A;  4WCE V;  2YXL A;  1EBO A;  4WFF A;  3SYP A;  2Y48 A;  2DMX A;  5IE9 A;  5B1B B;  1BSM A;  2ODM A;  4B3S O;  5J2T A;  1KC8 W;  2PF4 E;  4RQF A;  1N36 B;  3MHS C;  4PJ0 Z;  4JYC A;  4EFE A;  3O9O A;  2IBZ H;  4WBN B;  1D2D A;  2UXN A;  4CH4 A;  4MS2 A;  4TQD A;  2XAH A;  5GON B;  4FK5 C;  1WLE A;  2F95 B;  1FJG O;  1H2S B;  2ZM6 O;  3CCQ V;  3K03 A;  5IT9 N;  2HVK C;  5L3B A;  4FLW A;  1IBM B;  5EK0 A;  1BMF G;  4LFB B;  3UQ8 A;  1Q81 W;  3HKC B;  3F7V C;  1RM1 C;  2KQX A;  5IYZ A;  4C7U A;  2E74 B;  2Y0P A;  4FVM A;  2CGO A;  3ZMV A;  4K8X A;  1FFT B;  1XMO B;  1K4C C;  3ZMU A;  4FLY A;  3BY6 A;  1WA8 A;  4JGS A;  3QG5 A;  1NBM G;  3CEI A;  2PYL A;  1H8H G;  4FZ1 A;  1G4Y B;  4XBF A;  1YVW A;  3T4D A;  2NLJ C;  4OPH A;  1EN6 A;  3UM7 A;  3H9V A;  3HKB B;  3WB2 A;  4JAS A;  1VIB A;  5JVD B;  1SQV H;  4DR7 B;  1THZ A;  3AK2 A;  1UFI A;  4DUY O;  4AHC A;  3ZN1 A;  4JI5 B;  4U7N A;  3D3I A;  1SA0 B;  2XND G;  5EC2 C;  1SER A;  4UCS A;  1KQS U;  1N8R W;  1XEQ A;  2UXC O;  3AK1 A;  3J7A U;  3N2K A;  5LMU O;  1WNS A;  1BCC H;  1DK1 A;  1YZB A;  3O65 A;  1KB9 F;  4JI2 B;  4OX9 B;  4DRX A;  2EBO A;  3D36 A;  2YS8 A;  1M1K W;  4DRX B;  1JA8 A;  4IGG A;  4DV6 O;  3ABK B;  4B3R O;  1PV0 A;  4LF7 O;  3D3Q A;  2A79 B;  4W4K A;  3OR6 C;  1TAE A;  1K5S A;  3FFQ A;  4ICG A;  2F93 B;  3QVN A;  2BE3 A;  4P9P A;  3IAY A;  4JI7 O;  2AHZ A;  3IFX A;  4I0X B;  2XAJ A;  2HFE C;  3G80 A;  2OCC C;  1F23 A;  2Q9L A;  4X1Y A;  3CC4 V;  2Z3Y A;  1DLB A;  1PP9 H;  5H6R A;  2GUZ A;  2GHY A;  1SRY A;  2OWO A;  1GN4 A;  2GUZ B;  1CPY A;  5FNV A;  4NR1 A;  3N27 A;  5KX5 A;  5EBL C;  3M7M X;  3CS5 A;  3TXQ A;  4LF5 B;  2YI9 A;  2KB1 A;  2CH7 A;  1BHB A;  2ZDI C;  3BFR A;  5C93 A;  1OCZ C;  4YJ3 A;  1M90 W;  5KLV H;  5IWA B;  3VBB A;  3G6B A;  4LP8 A;  2BOC C;  5JQG B;  3SYA A;  2IJJ A;  1HNZ B;  2ZIO A;  1M93 A;  4DW1 A;  4J7J A;  3ABM C;  3K58 A;  2LFS A;  2WLI B;  4ZI7 B;  1DF4 A;  4DV7 B;  3B77 A;  5JH7 A;  3ML0 A;  3AG1 C;  3P3N A;  3OW2 U;  1P49 A;  2Q7E A;  4EKW A;  4TV8 A;  5EIB D;  2Q68 A;  2YI8 A;  5LOV A;  3LDD A;  1GM9 A;  4QE9 A;  4UB8 Z;  2CAZ C;  1MG1 A;  2Q6A A;  4OGQ B;  1U97 A;  1FXK C;  2JGD A;  2EIL C;  3AG3 B;  5C8Y A;  5ITZ A;  4TUY A;  2YIC A;  4GZR B;  2ADP A;  4PDR A;  3RYC A;  4JI4 O;  5ITZ B;  4P2Z A;  3CCE V;  4X62 O;  3RYC B;  2CUG A;  2XUM A;  1VQL V;  5LA6 B;  4DR5 O;  4H13 B;  2YEV A;  3RFR A;  2LQT A;  5KHJ A;  1P4R A;  1YSC A;  2YEV B;  4Z1M G;  3ICX A;  2DQ0 A;  5DM6 V;  2HHH B;  4MVQ A;  2QGN A;  2PYJ A;  2B9Z A;  2E3C A;  3ABL B;  1V54 B;  1JFF A;  5IY5 C;  3L75 H;  3MHH C;  3U10 A;  4LF7 B;  3B8N A;  1JFF B;  1CXZ B;  4CBC A;  4PA9 A;  2DN9 A;  1LUV A;  4JYA B;  4B3M B;  5CB4 A;  2CK3 G;  5L3E A;  2ZT9 B;  3OMI B;  4XDJ A;  2WLK A;  3B2E E;  4Z1V A;  1JPX A;  4X8A A;  3JSL A;  3DGE A;  4BW5 A;  1PKX A;  3K79 A;  4X9Q A;  4DV5 B;  1YTF D;  2WLH A;  2XAF A;  4DV1 B;  1EM1 A;  4QJF B;  4AQY O;  4FLU A;  4ABM A;  4FM0 A;  3DXR B;  1B3Q A;  2R72 A;  2QM7 A;  3OTO B;  3B40 A;  5F2V O;  1AR1 B;  3EXA A;  1ZWI C;  3ZED A;  3ETD A;  2GTS A;  3FB5 C;  3K57 A;  4FFB A;  4R8C A;  4NXN O;  1AI5 A;  1TUB A;  2W0X A;  4PA6 A;  1ARO P;  2QR4 A;  2UXX A;  3K5O A;  2ZR3 A;  4HNA B;  1YXB A;  2ZIM A;  3H1H H;  3JSN A;  4UV8 A;  4YJ2 B;  2Q69 A;  1HNX B;  2LW1 A;  4BAY A;  3CRC A;  1US6 A;  2KG7 B;  3E83 A;  1OJH A;  1M57 B;  2QKA A;  2ZXW B;  1F4M A;  4RUE A;  4N23 A;  4GX5 A;  1NZ6 A;  1AIL A;  1MZF A;  2DJV A;  3JAS B;  3K9S A;  1WPB A;  4O2A B;  1I94 O;  3CMA V;  2A06 H;  3JD3 A;  3AG4 C;  1AR5 A;  1QVG U;  3RYH B;  1Z5V A;  4O2B B;  4OXS A;  4GKK O;  1HR0 O;  4ZIB A;  1I5Y A;  1Y76 A;  3JAL B;  2R9R B;  1R3L C;  1RSO A;  4CZZ A;  4I50 A;  3OMA B;  4LH6 A;  3JYC A;  1RSO B;  2H94 A;  4JI4 B;  1K8A W;  3K59 A;  4X62 B;  5D5Q A;  4K3A A;  4WFB V;  4MT8 A;  3L9D A;  4FM1 A;  2HVJ C;  2PGG A;  1N0N A;  2QM4 A;  3CRM A;  1QLE B;  4I4T B;  3SYC A;  5BXZ A;  2XAG A;  4ZHQ A;  3RVY A;  1URF A;  5E1A C;  4DW0 A;  2UXB O;  1S5H C;  4UFZ A;  4LF4 O;  2ILM A;  1PL4 A;  4DR3 O;  2YDE A;  1HNW O;  4CC5 A;  5A2Q N;  2WLN A;  4HZ3 A;  2V7Q G;  2P4K A;  2QSA A;  4XDL A;  3OUS A;  3H1K H;  4OPA A;  2P5O A;  2AHY A;  4JI0 B;  4AI8 A;  1R6K A;  4O4J A;  4PI2 A;  1XRE A;  2BTO A;  4O4J B;  1OCO B;  1S0V A;  1MOF A;  3SJC C;  4NXM B;  4LFA O;  2NN4 A;  4ASU G;  2AXT Z;  3EHB B;  3ABK C;  3CCR V;  5BY1 A;  1NJI W;  4CC6 A;  3FD9 A;  1WP8 A;  1N4C A;  2YXH A;  3SPJ A;  5EZY A;  3BA8 A;  3L72 H;  3ETG A;  4RAI A;  4IT5 A;  4NXN B;  2CGN A;  5BMV A;  4IL6 Z;  2DW4 A;  2AW9 A;  5B1A C;  1H2N A;  1W0J G;  4FZ0 A;  3T2M A;  1XNR O;  3LSU A;  3OEH G;  1IBL B;  1MMM A;  1R3J C;  2OYQ A;  2N04 A;  3CC2 V;  4B3T O;  1SKV A;  1K33 A;  1A32 A;  3B09 A;  3KG2 A;  5KHH A;  1J5E O;  1L0N H;  2RDC A;  3JD1 A;  3QF7 A;  3CX5 F;  1GKF A;  1QVF U;  2JS5 A;  2YIB D;  1NVP D;  3I55 V;  5FLX N;  1WAZ A;  2R9A A;  1U96 A;  1E1Q G;  4DYL A;  1AI4 A;  5B3S B;  2HP8 A;  3ZMZ A;  4IHJ A;  4I7Z B;  3ASN B;  3JAR A;  4JTA B;  2QWN B;  1HR0 B;  1VQK V;  2ZE5 A;  1XL4 A;  3BHP A;  4JI6 B;  4X20 B;  2ZNI A;  3ZHS A;  3ZIA G;  1XQ8 A;  4X1I B;  1HP8 A;  2DYS B;  4EFB A;  1R6T A;  1IZ3 A;  5LP6 B;  4MTG A;  3ZRW A;  4BWA A;  3RT3 C;  4PHZ A;  3WB0 A;  1XHX A;  1AB3 A;  1I7F A;  2VWJ A;  2FKX A;  3L73 H;  2Z0A A;  3E86 A;  1TVK A;  1IDS A;  4D6T H;  1L8D A;  1GO3 F;  3K5N A;  4J42 A;  1TVK B;  4MW8 A;  2ETN A;  4LR3 A;  4JAA A;  5LBQ A;  3QO7 A;  1Y67 A;  1BL8 A;  4JV5 B;  4DR4 O;  1WN7 A;  3OMN B;  1KEC A;  5JCO A;  4PI0 A;  1OCC B;  2JEX A;  3DC6 A;  4JTC B;  2UUB O;  1KU9 A;  2UXB B;  4PDV A;  3UKM A;  2VWK A;  3SJQ C;  2CTP A;  1XNQ O;  3CXC U;  5KA6 A;  5EBW C;  4I9Q A;  2ZE6 A;  1Q6U A;  3K06 A;  4UCU A;  5EC1 C;  3CME V;  3JAM N;  3I5D A;  4DR3 B;  1FPO A;  2WWW A;  1HNW B;  3JCU Z;  3E22 B;  4WBN A;  1FYJ A;  1VMG A;  3STL C;  1GN2 A;  3VOU A;  2L6L A;  5GON A;  4JYY A;  3ETQ A;  1VEW A;  4E2L A;  1EN5 A;  2ATK C;  1EFR G;  1PD3 A;  1QHT A;  5IYB O;  3ZMS A;  4DV3 O;  3Q4H B;  3HKC A;  3LNN A;  1NVP B;  1QR9 A;  5KHG A;  4DR1 B;  4DV4 B;  1ZAU A;  2K9P A;  3BA9 A;  3CCV V;  5H9C A;  1QCE A;  5IJ9 B;  3HKD B;  3FYI B;  2C2A A;  1JMK C;  3W7W A;  5J2U A;  4B7E A;  4UVA A;  4DR6 O;  5J2U B;  3CRQ A;  3ZBH A;  1DF5 A;  4RUF A;  3TJT A;  2A3Q A;  4PDL A;  1M56 B;  1FKA O;  3SJA C;  3LSS A;  3BVO A;  1L0L H;  2ZQM A;  3HKB A;  1NI8 A;  1J5E B;  5FL7 G;  1VQ6 V;  4YY3 O;  1VQ5 V;  4P9O A;  5JVD A;  3T1H O;  5CA1 B;  3UO2 A;  1K92 A;  4X64 B;  3G71 V;  4J11 A;  5LHH A;  4LNU B;  1SA0 A;  3D8C A;  1W2B U;  1JCH A;  4IIJ A;  1IBK O;  2EUL A;  4IIJ B;  3W7T A;  2JJ1 G;  2QTO A;  2ZE8 A;  1MA1 A;  3FKS G;  2JK5 C;  1XDC A;  1ZL8 B;  3CSX A;  2EIJ B;  3OAA G;  3VQW A;  1M4U A;  4GKJ B;  4UVB A;  5JWP A;  4JI8 O;  5A9G A;  1NQT A;  4KFM A;  3LSQ A;  2Z5U A;  2LGW A;  5IYD O;  2OTJ V;  3STZ C;  3JAK B;  4MVM A;  3N2G B;  1ORQ C;  1IUR A;  2GDS A;  4EB6 A;  4I0X A;  2YSU B;  4X66 O;  4DR2 B;  4J10 A;  4DV0 O;  4EB6 B;  3FB8 C;  1H2L A;  1ZTE A;  4FM2 A;  5BZB A;  1XMQ O;  2Q0O C;  2W0F C;  3ABU A;  3BAB A;  2UUA O;  2P90 A;  3OT7 A;  3WG7 B;  3JAW B;  3X2Q C;  1H2M A;  4JTD B;  1QQC A;  5H6Q A;  2NNU A;  2HEP A;  1W59 A;  1XNQ B;  4K0K O;  2LP7 A;  3GB7 C;  1GRJ A;  2IH3 C;  5CN0 A;  3T1Y O;  1N33 O;  2ADQ B;  4FLV A;  2Q5Z A;  2WSS G;  4B3S B;  1K5Q A;  2FL4 A;  4UCO A;  2P4V A;  4FJC C;  4NVP A;  4GX0 A;  5EYP B;  3OTF A;  1P84 F;  1M9N A;  5JJJ B;  5LMN O;  1N0J A;  4AIL C;  2Q73 A;  1EZJ A;  1AP5 A;  1SC5 B;  2RMK B;  1FJG B;  4LBE C;  2IJK A;  1JVM A;  2ZM6 B;  2WA4 A;  5HFL A;  5JQG A;  2QEX V;  2WAM A;  3SDL A;  1GM8 A;  3VQY A;  1T5E A;  1YDX A;  1DGS A;  2G38 A;  3GVM A;  2VQE O;  5KHI A;  2GV9 A;  1LR1 A;  1NR7 A;  2EIK B;  1KKC A;  2WLI A;  4KUM A;  4ZI7 A;  1KYO F;  2CTQ A;  4UCT A;  3ZCC A;  1CP9 A;  1K3E A;  4GX2 A;  1WB8 A;  1R3K C;  3QO8 A;  1FFX B;  4DO2 A;  3BEH A;  1OCR B;  4TQF A;  3CCL V;  3E8B A;  4NYK A;  1JQ0 A;  1V55 B;  2PZS A;  1OCO C;  1RPR A;  2WLJ A;  3RYI A;  2F1M A;  1Q5O A;  4O4H B;  3RYI B;  3AG2 B;  4YY3 B;  3T1H B;  1XHZ A;  4NTW A;  5LXT B;  4GCZ A;  4GUN A;  3MAQ A;  5LA6 A;  1UPG A;  4DUY B;  3FX7 A;  3IC9 A;  4B7K A;  2DYR B;  1VQ7 V;  3CP1 A;  4W4L A;  3A2F A;  4J80 A;  2UXC B;  1E1R G;  3FB7 C;  3RN4 A;  2CDY A;  5LMU B;  4J7K A;  2QKS A;  4LC1 A;  1B06 A;  4TT3 G;  4X65 O;  3JAT A;  2CE4 A;  5BR8 O;  2XAS A;  2F4V O;  2QDO A;  4DV6 B;  2ZIN A;  4B3R B;  3K9A A;  1J95 A;  3JAT B;  4XDK A;  1NTZ H;  3W7X A;  4IYI A;  4X66 B;  5B3S C;  2JIZ G;  4JI7 B;  4FIP C;  1JR9 A;  4L87 A;  4HBN A;  1VF6 A;  3APQ A;  3CB2 A;  2UUA B;  2IJI A;  4FLX A;  3MDS A;  3B8M A;  3S3W A;  2XAQ A;  3JCZ A;  1RM1 B;  3L71 H;  2Y69 C;  1KKD A;  3DXR A;  3OM3 B;  2EIM C;  3G4S V;  1FXV A;  2EIN C;  4K0K B;  1N33 B;  2KSD A;  5GTH Z;  3AG7 A;  1VQ4 V;  3UO3 A;  4CH6 A;  1K9M W;  2ITC C;  3F5T A;  1PM9 A;  4UVC A;  4JYB A;  1G8M A;  2OIG A;  3OGI B;  1UJW B;  2YID A;  4HNA A;  2YXY A;  4YJ2 A;  1RFY A;  4UCV A;  4MVO A;  1GH6 A;  4J9Y B;  4LF8 O;  4BR6 A;  2KG7 A;  1R6N A;  4QPK A;  4LF9 O;  4U3J A;  3RYF B;  1VF7 A;  1FXH A;  4DV2 O;  2JGU A;  4MW3 A;  2JEU A;  4U3J B;  2EZO A;  5B1B C;  3JAS A;  1YF2 A;  1BT8 A;  4O4L B;  4O2A A;  4D7T A;  4X88 A;  4I55 B;  5LGN A;  1R3I C;  3WU2 Z;  3RYH A;  2IU3 A;  1COW G;  4O2B A;  3RBZ A;  1AVM A;  1SQX H;  3BAA A;  2GBO A;  2BSK B;  3CCU V;  3C3T A;  1NH2 D;  3JAL A;  3VQV A;  1LUW A;  3A0B Z;  4BIZ A;  2B1I A;  5FPO A;  3LDC A;  4JI3 O;  1D5A A;  3E8H A;  5FPR A;  5LGT A;  3QNE A;  1G6U A;  3SPH A;  1Y74 B;  3P3P A;  3E8G A;  2E76 B;  1S77 D;  4MVR A;  4LFC O;  3ZJZ A;  1N34 O;  2OCC B;  4DR5 B;  1MNG A;  1VP7 A;  1B04 A;  1YTF B;  4I4T A;  1ZX3 A;  1PNM A;  3ZHU A;  4GT1 A;  4WFA V;  1DTO A;  4DXW A;  2VQF O;  2N74 A;  1YCI A;  2GSM B;  4BIO A;  4X65 B;  2W6J G;  2QTS A;  3TGU H;  1YIJ V;  2HG5 C;  1XBL A;  2AZ0 A;  1YIT V;  3F7Y C;  1Q3E A;  3QTC A;  1IXM A;  4TOI A;  2ZCE A;  3T4Z A;  1H2K A;  1I0H A;  2LFR A;  3VQX A;  3U0Z A;  4ZKI A;  1OCZ B;  1AI7 A;  1WPX A;  3B4S A;  4TWK A;  1QR8 A;  1O9H A;  4LCU C;  1SES A;  4JF3 A;  1Y6X A;  1NTK H;  3UT5 A;  4YXW G;  2RCV A;  3UT5 B;  4H33 A;  3KKY A;  2WLL B;  4X1K B;  2D2C B;  4AQY B;  4TSF G;  3ZRS A;  2B1G A;  3ZRV A;  3R66 A;  3ABM B;  3D36 C;  3SPG A;  1NU1 H;  3ZX6 A;  1KMI Z;  1R1B A;  1Y66 A;  4J41 A;  4A5U B;  5KMG B;  1FS0 G;  3AG1 B;  4N21 A;  1VF5 B;  1D5N A;  3ZN0 A;  2PI5 A;  1BE3 H;  2K1E A;  3CCJ V;  1NH2 B;  1OHH G;  1VQN V;  4JAV A;  4TV9 B;  5L3G A;  3H1I H;  3L74 H;  1IBM O;  4LF8 B;  4LFB O;  2ZR2 A;  1FXK B;  3K08 A;  3THO A;  1N32 O;  4KHP O;  1PNL A;  2EIL B;  3CJH A;  2LJ2 A;  3T1C A;  2PY5 A;  3AEI A;  3K04 A;  2ZNJ A;  2DE0 X;  3CJH B;  2X6C A;  2XHB A;  4MVZ A;  4O4I A;  2OTL V;  4LWS B;  3OD4 A;  1K4D C;  1EN4 A;  1I94 B;  4O4I B;  2L35 A;  3WFV A;  1XI1 A;  1Q6I A;  4X20 A;  4HYO A;  3E2E A;  4UV9 A;  5DED A;  4X1I A;  4GKK B;  3J80 N;  5IY5 B;  2FB5 A;  2CTW A;  4JI3 B;  3CD6 V;  3ABT A;  2JS3 A;  5LP6 A;  1ROP A;  4DR7 O;  3APO A;  1VQP V;  4JI5 O;  5KUM A;  3G67 A;  1X59 A;  1GMG A;  3G6E V;  2X7R B;  4K35 A;  5LHG A;  1E79 G;  4JI2 O;  4FLZ A;  4MVS A;  3ASO B;  3IGA C;  4RQE A;  4PDM A;  2A0L A;  3ZRX A;  1S5L Z;  3DSQ A;  5CBF A;  3AG2 C;  2AZ2 A;  5HFM A;  2EZP A;  4R6Z A;  2VS0 A;  1F4N A;  3R65 A;  3ZHV A;  4LF4 B;  5KA5 A;  5B1O A;  4B08 A;  1JJ2 U;  3M8A A;  1Z2G A;  1VQO V;  3ZHR A;  3AG3 C;  1S72 V;  2DWE C;  2XT9 A;  2HKO A;  3E22 A;  3H1J H;  4H37 A;  2RQ6 A;  4R50 A;  3HKE B;  3K5L A;  3K0D A;  2QWQ B;  1S3J A;  2ZD9 A;  4QPJ A;  1TUE B;  5AG2 A;  5IJ0 B;  2HR3 A;  3UCS C;  1L1F A;  3CHX A;  3Q4H A;  2YIB A;  4LFA B;  4PV1 B;  3SJB C;  3ABL C;  5J2T B;  1V54 C;  4QGP A;  3SGI A;  1XL6 A;  1YJN V;  1W0K G;  4MTF A;  3AG4 B;  5IJ9 A;  3HKD A;  3K5M A;  4LF5 O;  2FYU H;  2PUS A;  1SQG A;  2P67 A;  5CMU A;  5H5N A;  4Q6G A;  5JJE B;  5IWA O;  4DK1 A;  4I9W A;  3FB6 C;  3CYO A;  3HPL C;  5H2F Z;  2F23 A;  2BTQ A;  1XNR B;  1K34 A;  2QJ1 A;  5K1P A;  2KKW A;  1IX9 A;  2HJD A;  3LNM B;  1VF6 C;  4MVU A;  1HNZ O;  2BTQ B;  3I56 V;  4DUZ O;  2LGQ A;  2QKC A;  4B3T B;  4KHP B;  1N32 B;  3EVK A;  4Q20 A;  2Q4P A;  1XOU A;  5JJN B;  1Q90 D;  1K73 W;  5IYZ B;  2QA4 V;  3PN1 A;  3IC7 A;  1CEZ A;  3RVZ A;  2XOK G;  2ITD C;  2YC0 A;  5CA1 A;  1Q8I A;  4DV7 O;  2JDI G;  4JZG A;  1VQM V;  1GN3 A;  2UU9 O;  4LNU A;  1Y4M A;  2DOS A;  1WA8 B;  4NTY A;  1K7D A;  1ZSP A;  1RPO A;  5EIB C;  2Y4U A;  3HB3 B;  1ZL8 A;  1PPJ H;  2R70 A;  1M57 C;  4JZ2 A;  3K3W A;  4YIO A;  2ZXW C;  2Q0A A;  1Q43 A;  1P7G A;  1SQF A;  3SR2 C;  1K97 A;  1TA8 A;  3JAK A;  3N2G A;  1JOY A;  2OCH A;  5TIS Z;  2F43 G;  2R9I A;  4PA7 A;  3OGC C;  1AJQ A;  1MZE A;  1EZV H;  4YIP A;  1ZLZ A;  2QM8 A;  4FFK A;  1TGO A;  1G1X B;  1OZ0 A;  1F51 A;  2HHH O;  3N2K B;  3OR7 C;  1KD1 W;  4DR4 B;  3JAW A;  3OEE G;  2JVD A;  5GW7 A;  4WF9 V;  1KP2 A;  2UUB B;  3BCC H;  5B1N A;  4JI1 O;  2IH1 C;  1WP7 A;  4CH5 A;  4JPR A;  4MTX A;  4MTO A;  5KAI Z;  4JYA O;  4B3M O;  2ARH A;  2V1D A;  5B1A B;  5EYP A;  3L70 H;  4DV5 O;  2RJZ A;  1AJN A;  5B66 Z;  1MAB G;  4DV1 O;  1I08 A;  2W6I G;  4X1Y B;  1QLE C;  4UXN A;  1BGY H;  4Z2W A;  5KUK A;  3OTO O;  4DV3 B;  3M99 B;  4KL1 A;  3SYO A;  2Q7H A;  3KCY A;  3SPI A;  5FNV B;  1WB7 A;  2XTA A;  1AI6 A;  5KX5 B;  2UXD O;  1HNX O;  2CH7 B;  1QBZ A;  1BQ0 A;  1FFX A;  1Z5W A;  1VAR A;  4LF6 O;  4DR6 B;  4YJ3 B;  4GX1 A;  4R7C A;  3WB1 A;  3E89 A;  3FYE B;  4DUZ B;  3KZI Z;  3TK1 A;  4GYC B;  1ZUQ A;  1HW7 A;  4O4H A;  1SZT A;  3CRR A;  2ZKO A;  1IXB A;  2WA3 A;  4E4E A;  3U11 A;  3JD4 A;  3RW0 A;  3BPZ A;  5CA3 A;  1Q86 W;  1YJ9 V;  5LXT A;  3ZMT A;  2UU9 B;  5J9P C;  2X0L A;  1S76 D;  4GLX A;  3F5W C;  4K8Z A;  1NTM H;  5JH7 B;  1IBK B;  4WFE A;  4ZOL A;  4TV8 B;  5IYC O;  4ZOL B;  4ZBM A;  3ZHT A;  5LOV B;  1V9P A;  1BS3 A;  2BOB C;  2CTR A;  3QO5 A;  4BIU A;  1LNQ A;  2EX3 A;  2FTK A;  1P7B A;  1SF9 A;  4KXR A;  2JGD B;  5CBH A;  5C8Y B;  4PA3 A;  4TUY B;  4JI8 B;  4WFH A;  3IJ4 A;  4H0L B;  2P06 A;  2MK3 A;  1AP6 A;  2PI4 A;  4UUJ C;  3W7S A;  1MSD A;  4RO2 A;  2IJH A;  3JD2 A;  4PEL A;  4KP4 A;  3H01 A;  4G2K A;  5K1X A;  1SQQ H;  4DV0 B;  3CCS V;  3ASN C;  1XMQ B;  1FD9 A;  4JAU A;  1GM7 A;  4CS3 A;  1RP3 B;  5DEC A;  4DK0 A;  3CRA A;  4U3F H;  2DYS C;  4JI1 B;  4FLT A;  2P22 C;  3E35 A;  1S5J A;  4UCR A;  3SYQ A;  1VQ9 V;  5LP6 C;  1H2G A;  4BW9 A;  2UUC O;  3T1Y B;  5LGU A;  5CB4 B;  5L3D A;  5LL6 Y;  2IU0 A;  1SET A;  4PA4 A;  2QWO B;  4JI0 O;  1SS3 A;  2WLM A;  4U7O A;  4P30 A;  2QWP B;  1IVS A;  1GK9 A;  4PD4 F;  1SQP H;  5LMN B;  3C3S A;  1SQB H;  1Q82 W;  4NXM O;  2V4D A;  5KHK A;  3ASO C;  2X6A A;  4IYH A;  1OCC C;  1AR4 A;  3BRC A;  4FPP A;  3RYF A;  5JCO C;  1XIL A;  2O57 A;  3NXS A;  3TET A;  3C90 A;  2IW5 A;  2EJR A;  2VQE B;  1YJW V;  2HJF C;  4O4L A;  2YIA A;  4J7Z A;  4FFB B;  2UXD B;  5CA0 A;  4CS4 A;  3A8T A;  2QE7 G;  1TUB B;  4I55 A;  2BCC H;  5CA0 B;  3W7U A;  1PNK A;  4F6E A;  1IBL O;  4LF6 B;  2BSK A;  2OIE A;  3ETE A;  1M5I A; 
#chains in the Genus database with same CATH homology
 4F4L A;  4WFG A;  2WLI B;  3LSS A;  1YI2 V;  2OTL V;  1DF4 A;  3B77 A;  2ZQM A;  1Q7Y W;  1K4D C;  3LUT B;  3WFV A;  5FL7 G;  1VQ6 V;  3ML0 A;  1VQ5 V;  4P9O A;  2M7W A;  2B5U A;  3AG1 C;  3OW2 U;  4EKW A;  2X6B A;  3A0R A;  2Q68 A;  4HYO A;  1K92 A;  3E2E A;  3G71 V;  4UV9 A;  2D3O W;  5LHH A;  5IY5 B;  3LDD A;  1GM9 A;  1PL0 A;  4QE9 A;  1W2B U;  1JCH A;  3K0G A;  3ABT A;  3CD6 V;  1MG1 A;  1ROP A;  2Q6A A;  1FXK C;  4HAM A;  5L3C A;  4J9Z B;  2EIL C;  3AG3 B;  3W7T A;  3X2Q B;  2JJ1 G;  1VQP V;  2QTO A;  4PDR A;  5L3F A;  1GTO A;  3JD0 A;  2DQ3 A;  3FKS G;  2JK5 C;  4P2Z A;  2A9H A;  5KUM A;  3CCE V;  2EIJ B;  1GMG A;  3G6E V;  1M56 C;  2X7R B;  1VQL V;  2YEV A;  3OAA G;  3GWO A;  4UVB A;  3OFN G;  5LHG A;  3CC7 V;  1P4R A;  1YSC A;  2YEV B;  1E79 G;  1NQT A;  4KFM A;  4Z1M G;  3LSQ A;  2DQ0 A;  2Z5U A;  5DM6 V;  5IYD O;  4MVS A;  2OTJ V;  3STZ C;  4MVQ A;  5EBM C;  4MVM A;  1ORQ C;  3ASO B;  3IGA C;  3P30 A;  4RQE A;  5IDJ A;  4PDM A;  2ZDI A;  3ABL B;  2A0L A;  3ZRX A;  1V54 B;  2YSU B;  5CBF A;  1JX9 A;  3MHH C;  3AG2 C;  5IY5 C;  5HFM A;  2EZP A;  3FB8 C;  4R6Z A;  5CBG A;  3B8N A;  5BZB A;  2W0F C;  1F4N A;  3R65 A;  3ABU A;  5B1O A;  5KA5 A;  3CCM V;  4CBC A;  1JJ2 U;  4PA9 A;  1VQO V;  2P90 A;  3WG7 B;  3AG3 C;  1S72 V;  3X2Q C;  2CK3 G;  2DWE C;  5L3E A;  2HKO A;  4JTD B;  1H8E G;  4H37 A;  3OMI B;  4XDJ A;  5H6Q A;  2NNU A;  2WLL A;  2WLK A;  4R50 A;  1JPX A;  2EIJ C;  4X8A A;  3K0D A;  2LP7 A;  1S3J A;  2ZD9 A;  3DGE A;  3EFF K;  3GB7 C;  2IH3 C;  4QPJ A;  5CN0 A;  4BW5 A;  1PKX A;  1TUE B;  2WSS G;  3K79 A;  1K5Q A;  1YTF D;  2WLH A;  2XAF A;  2HR3 A;  4FJC C;  2Q67 A;  4QJF B;  1L1F A;  4GX0 A;  1B6Q A;  2H8P C;  1KP3 A;  1M9N A;  1NR1 A;  1BHA A;  3ABL C;  1EZJ A;  2QM7 A;  1QLN A;  1V54 C;  1AR1 B;  3OE7 G;  1ZWI C;  1XL6 A;  2P7T C;  1YJN V;  3ETD A;  3FB5 C;  4LBE C;  2IJK A;  1JVM A;  1W0K G;  4MTF A;  3LDE A;  3AG4 B;  5HFL A;  4R8C A;  2QEX V;  2HLD G;  3SPC A;  1AI5 A;  2WAM A;  1GM8 A;  3WG7 C;  1FXK A;  2P67 A;  3P32 A;  5CMU A;  1HWY A;  4PA6 A;  1ARO P;  2UXX A;  2ZR3 A;  4UV8 A;  1ENV A;  4I9W A;  3FB6 C;  2Q69 A;  2P6J A;  3CYO A;  3HPL C;  1NR7 A;  4BAY A;  4MSW C;  1K34 A;  3LNM B;  2DWD C;  4FMT A;  1I5X A;  2EIK B;  4MVU A;  2WLI A;  3E83 A;  4KUM A;  3I56 V;  1M57 B;  3ZCC A;  2ZXW B;  1CP9 A;  1F4M A;  1K3E A;  4GX2 A;  4RUE A;  4Q20 A;  4N23 A;  4GX5 A;  3E8F A;  1K73 W;  1R3K C;  3QO8 A;  4DO2 A;  3BEH A;  2QA4 V;  1OCR B;  3CCL V;  3E8B A;  3IC7 A;  1CEZ A;  3RVZ A;  2XOK G;  2ITD C;  1JQ0 A;  2JDI G;  1V55 B;  1VQM V;  4QIW F;  3TCU A;  1OCO C;  3CMA V;  1RPR A;  3JD3 A;  2WLJ A;  1Y4M A;  3AG4 C;  1QVG U;  3AG2 B;  1MSW D;  1K7D A;  1H38 A;  1RPO A;  2WPD G;  3OUF A;  4OXS A;  4QNH B;  3HB3 B;  1I5Y A;  4GCZ A;  1YHQ V;  2EIK C;  2R9R B;  1R3L C;  3MD0 A;  1NKD A;  1M57 C;  3K3W A;  4CZZ A;  2DYR B;  1VQ7 V;  2JJ2 G;  3CP1 A;  3OMA B;  2ZXW C;  5DN6 G;  3JYC A;  2OT5 A;  2H94 A;  1R73 A;  1E1R G;  5LHI A;  3FB7 C;  1K97 A;  1AJP A;  1K8A W;  4I5S A;  1OCR C;  1JOY A;  2Y69 B;  2QKS A;  2F43 G;  2R9I A;  4PA7 A;  1V55 C;  2EIM B;  1AJQ A;  3OGC C;  2EIN B;  4LC1 A;  4QE7 A;  4X89 A;  4TT3 G;  4WFB V;  4MT8 A;  4G28 B;  3CPW U;  2QM8 A;  1VQ8 V;  1OZ0 A;  2HVJ C;  3ZRW B;  1F51 A;  2XAS A;  3DTU B;  3OR7 C;  1QLE B;  1KD1 W;  3SYC A;  3K9A A;  1J95 A;  2XAG A;  4XDK A;  3OEE G;  3RVY A;  3ETE A;  5GW7 A;  4WF9 V;  5E1A C;  1S5H C;  3W7X A;  1KP2 A;  5B3S C;  3PJS K;  2JIZ G;  5B1N A;  2IH1 C;  4FIP C;  4JPR A;  4L87 A;  4MTX A;  4MTO A;  4G27 B;  2DYR C;  2IJI A;  4WCE V;  3B8M A;  2XAQ A;  1EBO A;  3JCZ A;  4WFF A;  3SYP A;  2V1D A;  5B1A B;  1RM1 B;  2WLN A;  2Y48 A;  4HZ3 A;  2V7Q G;  4XDL A;  2Y69 C;  3OUS A;  5B1B B;  1KKD A;  3OM3 B;  2EIM C;  3G4S V;  1FXV A;  2EIN C;  2AHY A;  1R6K A;  1KC8 W;  1AJN A;  4RQF A;  1MAB G;  3MHS C;  1VQ4 V;  2W6I G;  1K9M W;  4JYC A;  1OCO B;  1QLE C;  2ITC C;  1MOF A;  4UXN A;  1S0V A;  4UVC A;  2UXN A;  4JYB A;  1G8M A;  5KUK A;  4MS2 A;  1UJW B;  4ASU G;  2XAH A;  3EHB B;  3ABK C;  1WLE A;  4FK5 C;  3M99 B;  3CCR V;  3SYO A;  1NJI W;  3CCQ V;  4MVO A;  3K03 A;  3SPJ A;  4J9Y B;  3SPI A;  2HVK C;  1R6N A;  3ETG A;  5L3B A;  4RAI A;  4QPK A;  1AI6 A;  5EK0 A;  1BMF G;  1Q81 W;  2DW4 A;  3F7V C;  1FXH A;  5B1A C;  1RM1 C;  1W0J G;  4MW3 A;  3T2M A;  1QBZ A;  2JEU A;  2EZO A;  5B1B C;  3OEH G;  3ZMV A;  4GX1 A;  1FFT B;  1R3J C;  4R7C A;  1K4C C;  3ZMU A;  3E89 A;  3FYE B;  3CC2 V;  3TK1 A;  1K33 A;  3BY6 A;  4JGS A;  4X88 A;  5LGN A;  1R3I C;  3KG2 A;  1SZT A;  1NBM G;  2IU3 A;  1COW G;  1H8H G;  3JD1 A;  3RBZ A;  1GKF A;  1G4Y B;  3JD4 A;  3RW0 A;  4XBF A;  5CA3 A;  3T4D A;  1Q86 W;  2NLJ C;  1QVF U;  1YJ9 V;  3CCU V;  1NVP D;  3ZMT A;  1NH2 D;  5J9P C;  3I55 V;  3UM7 A;  4BIZ A;  2X0L A;  2B1I A;  3LDC A;  1S76 D;  1E1Q G;  4JAS A;  5B3S B;  1AI4 A;  3F5W C;  3E8H A;  3ZMZ A;  5LGT A;  3QNE A;  4WFE A;  3ASN B;  3SPH A;  4JTA B;  1VQK V;  1XL4 A;  1THZ A;  5IYC O;  3ZIA G;  3E8G A;  1S77 D;  4ZBM A;  3ZN1 A;  4MVR A;  3ZJZ A;  4U7N A;  2DYS B;  2BOB C;  3D3I A;  2XND G;  5EC2 C;  3QO5 A;  1SER A;  4BIU A;  1KQS U;  1N8R W;  1LNQ A;  2OCC B;  2FTK A;  4MTG A;  3ZRW A;  1P7B A;  5CBH A;  4PA3 A;  1YTF B;  1PNM A;  4WFH A;  3E86 A;  2MK3 A;  2EBO A;  4GT1 A;  4WFA V;  1DTO A;  3D36 A;  4DXW A;  1GO3 F;  2PI4 A;  1M1K W;  4MW8 A;  4UUJ C;  3W7S A;  4RO2 A;  3QO7 A;  5LBQ A;  1BL8 A;  2GSM B;  3ABK B;  2IJH A;  3JD2 A;  4PEL A;  2W6J G;  4KP4 A;  3H01 A;  4G2K A;  1YIJ V;  2HG5 C;  2A79 B;  1KEC A;  3OMN B;  3OR6 C;  1YIT V;  3F7Y C;  3CCS V;  1K5S A;  1OCC B;  3ASN C;  1IXM A;  2JEX A;  4JAU A;  1GM7 A;  4JTC B;  4P9P A;  3T4Z A;  4PDV A;  2LFR A;  2AHZ A;  3UKM A;  4ZKI A;  3IFX A;  3SJQ C;  2XAJ A;  1OCZ B;  2HFE C;  2DYS C;  1AI7 A;  1WPX A;  3CXC U;  5KA6 A;  4TWK A;  1QR8 A;  3E35 A;  5EBW C;  5EC1 C;  3SYQ A;  3K06 A;  1VQ9 V;  4LCU C;  1SES A;  1H2G A;  2OCC C;  4JF3 A;  3CME V;  1F23 A;  5LGU A;  3CC4 V;  2Z3Y A;  1DLB A;  2WWW A;  4YXW G;  5L3D A;  2IU0 A;  1SET A;  3STL C;  5H6R A;  4H33 A;  2WLL B;  4PA4 A;  3VOU A;  2GHY A;  1SRY A;  4TSF G;  3ZRS A;  2B1G A;  3ZRV A;  3ABM B;  2WLM A;  4U7O A;  4P30 A;  1GK9 A;  4E2L A;  3SPG A;  1Q82 W;  1CPY A;  2ATK C;  1EFR G;  1PD3 A;  5IYB O;  3ASO C;  5EBL C;  2X6A A;  1Y66 A;  1OCC C;  4FPP A;  1FS0 G;  3AG1 B;  4N21 A;  3ZMS A;  2KB1 A;  3ZN0 A;  1NVP B;  2K1E A;  3NXS A;  2ZDI C;  3CCJ V;  1NH2 B;  2PI5 A;  1QR9 A;  3TET A;  1BHB A;  1OHH G;  2IW5 A;  2EJR A;  1VQN V;  5C93 A;  1OCZ C;  4JAV A;  1M90 W;  5L3G A;  3VBB A;  4LP8 A;  3CCV V;  1YJW V;  2HJF C;  2BOC C;  5H9C A;  1QCE A;  3SYA A;  3FYI B;  2C2A A;  2IJJ A;  2ZR2 A;  4MVZ A;  2QE7 G;  3W7W A;  1FXK B;  3K08 A;  1PNL A;  4UVA A;  2EIL B;  3W7U A;  1PNK A;  3T1C A;  3AEI A;  3K04 A;  1DF5 A;  4RUF A;  2X6C A;  4PDL A;  3ABM C;  2LFS A;  1M56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...