1VQ6E

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
b'PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1vq6E02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1vq6E01
5H1SI 2OTJE 1RL6A 3CCEE 1K8AG 1KQSE 3CC2E 4WCEE 4WF9E 1YITE 1YJNE 2CQLA 3G6EE 5HL7E 3CCSE 1QVGE 5JVGE 4IO9E 1VQOE 1QVFE 1Q82G 3CCVE 4IOCE 3CCJE 3CD6E 3I55E 5DM6E 3J7ZG 3G4SE 5GAEG 4WFNE 3CPWE 1VQ6E 5DM7E 1VQME 1VQ7E 4U67E 5GAHG 1M1KG 1M90G 1JJ2E 3OW2E 3CMAE 3CXCE 1YJWE 1VQ5E 1KC8G 4WFBE 1K9MG 5GADG 4WFAE 1VQPE 1VQKE 1VQ9E 1YIJE 2QA4E 2ZJQE 1VQ8E 1VQ4E 3CC7E 5MLCH 2ZJPE 4UY8G 1YI2E 1W2BE 1K73G 3CF5E 1Q81G 3I56E 3CCME 3CCRE 3DLLE 3CMEE 1Q86G 5AN9B 3PIOE 1VQLE 2OTLE 4IOAE 3CC4E 3CCUE 2QEXE 1YHQE 2ZJRE 1N8RG 3PIPE 1S72E 1YJ9E 1VQNE 1Q7YG 5JVHE 3G71E 1KD1G 5GAGG 3CCQE 1NJIG 3CCLE
chains in the Genus database with same CATH superfamily
5H1SI 2OTJE 1RL6A 3CCEE 1K8AG 3CCLE 1KQSE 3CC2E 1FJ1E 4WCEE 4WF9E 2FKGA 1YITE 2OY5O 1YJNE 2CQLA 3IGEA 3G6EE 5HL7E 3CCSE 1QVGE 2AF5A 5JVGE 4IO9E 1VQOE 1QVFE 3EC5A 2OY1O 3CCVE 1Q82G 4IOCE 3CCJE 3CD6E 3I55E 5DM6E 2HKDA 3J7ZG 3G4SE 5GAEG 4WFNE 2I5ZO 3CPWE 1VQ6E 5B11O 5DM7E 1VQME 1VQ7E 4U67E 5GAHG 1M1KG 1M90G 5B2AO 1JJ2E 3OW2E 5B3MO 3CMAE 3CKGA 3AUMO 3CXCE 1YJWE 1VQ5E 1KC8G 4WFBE 1K9MG 2PI3O 5GADG 4WFAE 1VQPE 1VQKE 1VQ9E 1YIJE 2QA4E 2ZJQE 1VQ8E 3CKFA 5B10O 1VQ4E 2OY7A 2G8CO 3CC7E 2OL6O 2OYBO 5MLCH 2ZJPE 4UY8G 1YI2E 1W2BE 1K73G 3CF5E 1Q81G 3I56E 3CCME 3CCRE 3DLLE 3CMEE 1Q86G 2FKJA 2OY8A 5AN9B 3PIOE 2I5VO 1VQLE 2OTLE 1P4PA 4IOAE 1RJLC 3CC4E 3CCUE 2QEXE 1YHQE 2ZJRE 1N8RG 3PIPE 1S72E 1YJ9E 1VQNE 1Q7YG 5JVHE 2OL7A 3G71E 1KD1G 1OSPO 5GAGG 3CCQE 1NJIG 2OL8O 3IG9A
chains in the Genus database with same CATH topology
5H1SI 2OTJE 1RL6A 3CCEE 1K8AG 1KQSE 3CC2E 4WCEE 4WF9E 1YITE 1YJNE 2CQLA 3G6EE 5HL7E 3CCSE 1QVGE 5JVGE 4IO9E 1VQOE 1QVFE 1Q82G 3CCVE 4IOCE 3CCJE 3CD6E 3I55E 5DM6E 3J7ZG 3G4SE 5GAEG 4WFNE 3CPWE 1VQ6E 5DM7E 1VQME 1VQ7E 4U67E 5GAHG 1M1KG 1M90G 1JJ2E 3OW2E 3CMAE 3CXCE 1YJWE 1VQ5E 1KC8G 4WFBE 1K9MG 5GADG 4WFAE 1VQPE 1VQKE 1VQ9E 1YIJE 2QA4E 2ZJQE 1VQ8E 1VQ4E 3CC7E 5MLCH 2ZJPE 4UY8G 1YI2E 1W2BE 1K73G 3CF5E 1Q81G 3I56E 3CCME 3CCRE 3DLLE 3CMEE 1Q86G 5AN9B 3PIOE 1VQLE 2OTLE 4IOAE 3CC4E 3CCUE 2QEXE 1YHQE 2ZJRE 1N8RG 3PIPE 1S72E 1YJ9E 1VQNE 1Q7YG 5JVHE 3G71E 1KD1G 5GAGG 3CCQE 1NJIG 3CCLE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1S I;  2OTJ E;  1RL6 A;  3CCE E;  1K8A G;  1KQS E;  3CC2 E;  4WCE E;  4WF9 E;  1YIT E;  1YJN E;  2CQL A;  3G6E E;  5HL7 E;  3CCS E;  1QVG E;  5JVG E;  4IO9 E;  1VQO E;  1QVF E;  1Q82 G;  3CCV E;  4IOC E;  3CCJ E;  3CD6 E;  3I55 E;  5DM6 E;  3J7Z G;  3G4S E;  5GAE G;  4WFN E;  3CPW E;  1VQ6 E;  5DM7 E;  1VQM E;  1VQ7 E;  4U67 E;  5GAH G;  1M1K G;  1M90 G;  1JJ2 E;  3OW2 E;  3CMA E;  3CXC E;  1YJW E;  1VQ5 E;  1KC8 G;  4WFB E;  1K9M G;  5GAD G;  4WFA E;  1VQP E;  1VQK E;  1VQ9 E;  1YIJ E;  2QA4 E;  2ZJQ E;  1VQ8 E;  1VQ4 E;  3CC7 E;  5MLC H;  2ZJP E;  4UY8 G;  1YI2 E;  1W2B E;  1K73 G;  3CF5 E;  1Q81 G;  3I56 E;  3CCM E;  3CCR E;  3DLL E;  3CME E;  1Q86 G;  5AN9 B;  3PIO E;  1VQL E;  2OTL E;  4IOA E;  3CC4 E;  3CCU E;  2QEX E;  1YHQ E;  2ZJR E;  1N8R G;  3PIP E;  1S72 E;  1YJ9 E;  1VQN E;  1Q7Y G;  5JVH E;  3G71 E;  1KD1 G;  5GAG G;  3CCQ E;  1NJI G;  3CCL E; 
#chains in the Genus database with same CATH topology
 5H1S I;  2OTJ E;  1RL6 A;  3CCE E;  1K8A G;  3CCL E;  1KQS E;  3CC2 E;  1FJ1 E;  4WCE E;  4WF9 E;  2FKG A;  1YIT E;  2OY5 O;  1YJN E;  2CQL A;  3IGE A;  3G6E E;  5HL7 E;  3CCS E;  1QVG E;  2AF5 A;  5JVG E;  4IO9 E;  1VQO E;  1QVF E;  3EC5 A;  2OY1 O;  3CCV E;  1Q82 G;  4IOC E;  3CCJ E;  3CD6 E;  3I55 E;  5DM6 E;  2HKD A;  3J7Z G;  3G4S E;  5GAE G;  4WFN E;  2I5Z O;  3CPW E;  1VQ6 E;  5B11 O;  5DM7 E;  1VQM E;  1VQ7 E;  4U67 E;  5GAH G;  1M1K G;  1M90 G;  5B2A O;  1JJ2 E;  3OW2 E;  5B3M O;  3CMA E;  3CKG A;  3AUM O;  3CXC E;  1YJW E;  1VQ5 E;  1KC8 G;  4WFB E;  1K9M G;  2PI3 O;  5GAD G;  4WFA E;  1VQP E;  1VQK E;  1VQ9 E;  1YIJ E;  2QA4 E;  2ZJQ E;  1VQ8 E;  3CKF A;  5B10 O;  1VQ4 E;  2OY7 A;  2G8C O;  3CC7 E;  2OL6 O;  2OYB O;  5MLC H;  2ZJP E;  4UY8 G;  1YI2 E;  1W2B E;  1K73 G;  3CF5 E;  1Q81 G;  3I56 E;  3CCM E;  3CCR E;  3DLL E;  3CME E;  1Q86 G;  2FKJ A;  2OY8 A;  5AN9 B;  3PIO E;  2I5V O;  1VQL E;  2OTL E;  1P4P A;  4IOA E;  1RJL C;  3CC4 E;  3CCU E;  2QEX E;  1YHQ E;  2ZJR E;  1N8R G;  3PIP E;  1S72 E;  1YJ9 E;  1VQN E;  1Q7Y G;  5JVH E;  2OL7 A;  3G71 E;  1KD1 G;  1OSP O;  5GAG G;  3CCQ E;  1NJI G;  2OL8 O;  3IG9 A; 
#chains in the Genus database with same CATH homology
 5H1S I;  2OTJ E;  1RL6 A;  3CCE E;  1K8A G;  1KQS E;  3CC2 E;  4WCE E;  4WF9 E;  1YIT E;  1YJN E;  2CQL A;  3G6E E;  5HL7 E;  3CCS E;  1QVG E;  5JVG E;  4IO9 E;  1VQO E;  1QVF E;  1Q82 G;  3CCV E;  4IOC E;  3CCJ E;  3CD6 E;  3I55 E;  5DM6 E;  3J7Z G;  3G4S E;  5GAE G;  4WFN E;  3CPW E;  1VQ6 E;  5DM7 E;  1VQM E;  1VQ7 E;  4U67 E;  5GAH G;  1M1K G;  1M90 G;  1JJ2 E;  3OW2 E;  3CMA E;  3CXC E;  1YJW E;  1VQ5 E;  1KC8 G;  4WFB E;  1K9M G;  5GAD G;  4WFA E;  1VQP E;  1VQK E;  1VQ9 E;  1YIJ E;  2QA4 E;  2ZJQ E;  1VQ8 E;  1VQ4 E;  3CC7 E;  5MLC H;  2ZJP E;  4UY8 G;  1YI2 E;  1W2B E;  1K73 G;  3CF5 E;  1Q81 G;  3I56 E;  3CCM E;  3CCR E;  3DLL E;  3CME E;  1Q86 G;  5AN9 B;  3PIO E;  1VQL E;  2OTL E;  4IOA E;  3CC4 E;  3CCU E;  2QEX E;  1YHQ E;  2ZJR E;  1N8R G;  3PIP E;  1S72 E;  1YJ9 E;  1VQN E;  1Q7Y G;  5JVH E;  3G71 E;  1KD1 G;  5GAG G;  3CCQ E;  1NJI G;  3CCL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...