1VQ6O

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vq6O00
1VQ5O 3I56L 3G4SL 3CC4O 1YHQL 1NJIM 3CCLL 1M1KM 1KD1P 1NJIP 3CCLO 1Q82M 3CPWN 1KC8M 1Q82P 2QEXL 1KC8P 1QVFN 2OTJO 1VQ6L 1QVGN 3CCML 1W2BN 3CCEL 1VQ6O 3CCJL 1VQ8L 3CCEO 3CCJO 1YI2O 1Q86M 1Q86P 3CXCN 3CMEL 3CMEO 3CC4L 1K73M 1JJ2N 1M1KP 1VQLO 2OTJL 2QA4L 1KQSN 3OW2K 1VQ7O 1Q81M 2QA4O 1M90M 3I55L 1YI2L 1Q81P 1M90P 3I55O 1VQKO 1VQ9L 1VQNL 1VQ9O 1VQOL 1VQNO 1YIJO 1VQOO 3CC7O 1VQPL 3G6EL 1VQPO 1Q7YM 3G6EO 3CMAL 3CMAO 1N8RM 1K9MM 1K73P 1N8RP 1K9MP 1VQ4O 1VQLL 3CD6L 3CPWK 3CD6O 1YJ9O 3CCVL 1VQ7L 3G71O 1QVFK 3CCVO 1QVGK 1W2BK 1VQKL 1YITL 2OTLO 3CCSO 1YJWO 1YITO 1YIJL 3CC2L 3I56O 3CXCK 3G4SO 3CC7L 1YJNL 1KD1M 3CC2O 1YJNO 3CCUL 1YHQO 1K8AM 3CCUO 3CCRL 1K8AP 3CCRO 1Q7YP 1VQML 1VQ4L 1JJ2K 1VQMO 2QEXO 3OW2N 1YJ9L 3G71L 3CCQL 3CCMO 1KQSK 3CCQO 1VQ8O 1S72L 2OTLL 1S72O 3CCSL 1YJWL 1VQ5L
chains in the Genus database with same CATH superfamily
1VQ5O 3I56L 3G4SL 3CC4O 1YHQL 1NJIM 3CCLL 1M1KM 1KD1P 1NJIP 3GODA 3CCLO 1Q82M 3CPWN 1KC8M 1Q82P 2QEXL 1KC8P 1QVFN 2OTJO 1VQ6L 1QVGN 3CCML 1W2BN 3CCEL 1VQ6O 3CCJL 5FCLA 3CCEO 1VQ8L 3CCJO 1YI2O 1Q86M 5DS4A 1Q86P 3CXCN 3CMEL 3CMEO 3CC4L 4XTKA 1K73M 4W8KA 1JJ2N 1M1KP 1VQLO 5DS6A 2OTJL 2QA4L 1KQSN 3OW2K 1VQ7O 1Q81M 2QA4O 1M90M 2YZSA 3I55L 1YI2L 1Q81P 1M90P 3I55O 1VQKO 1VQ9L 1VQNL 1VQ9O 1VQOL 1VQNO 1YIJO 1VQOO 3CC7O 1VQPL 3G6EL 1VQPO 1Q7YM 5DLJA 3G6EO 3CMAL 5DQZA 3CMAO 1N8RM 1K9MM 1K73P 1N8RP 1K9MP 1VQ4O 1VQLL 3CD6L 3CPWK 4WJ0A 3CD6O 1YJ9O 5DS5A 3CCVL 1VQ7L 3G71O 1QVFK 3CCVO 1QVGK 1W2BK 1VQKL 1YITL 2OTLO 3CCSO 1YJWO 1YITO 1YIJL 3CC2L 3I56O 3CXCK 3G4SO 3CC7L 1YJNL 1KD1M 3CC2O 1YJNO 4QDLA 3CCUL 1YHQO 1K8AM 3CCUO 3CCRL 5DQTA 1K8AP 3CCRO 1Q7YP 1VQML 1VQ4L 1JJ2K 1VQMO 2QEXO 3OW2N 1YJ9L 3NKDA 3G71L 3CCQL 3CCMO 1KQSK 3CCQO 1VQ8O 4N06A 1S72L 2OTLL 1S72O 4P6IC 3CCSL 1YJWL 1VQ5L
chains in the Genus database with same CATH topology
1VQ5O 3I56L 3G4SL 3CC4O 1YHQL 1NJIM 3CCLL 1M1KM 1KD1P 1NJIP 3GODA 3CCLO 1Q82M 3CPWN 1KC8M 1Q82P 2QEXL 1KC8P 1QVFN 2OTJO 1VQ6L 1QVGN 3CCML 1W2BN 3CCEL 1VQ6O 3CCJL 5FCLA 3CCEO 1VQ8L 3CCJO 1YI2O 1Q86M 5DS4A 1Q86P 3CXCN 3CMEL 3CMEO 3CC4L 4XTKA 1K73M 4W8KA 1JJ2N 1M1KP 1VQLO 5DS6A 2OTJL 2QA4L 1KQSN 3OW2K 1VQ7O 1Q81M 2QA4O 1M90M 2YZSA 3I55L 1YI2L 1Q81P 1M90P 3I55O 1VQKO 1VQ9L 1VQNL 1VQ9O 1VQOL 1VQNO 1YIJO 1VQOO 3CC7O 1VQPL 3G6EL 1VQPO 1Q7YM 5DLJA 3G6EO 3CMAL 5DQZA 3CMAO 1N8RM 1K9MM 1K73P 1N8RP 1K9MP 1VQ4O 1VQLL 3CD6L 3CPWK 4WJ0A 3CD6O 1YJ9O 5DS5A 3CCVL 1VQ7L 3G71O 1QVFK 3CCVO 1QVGK 1W2BK 1VQKL 1YITL 2OTLO 3CCSO 1YJWO 1YITO 1YIJL 3CC2L 3I56O 3CXCK 3G4SO 3CC7L 1YJNL 1KD1M 3CC2O 1YJNO 4QDLA 3CCUL 1YHQO 1K8AM 3CCUO 3CCRL 5DQTA 1K8AP 3CCRO 1Q7YP 1VQML 1VQ4L 1JJ2K 1VQMO 2QEXO 3OW2N 1YJ9L 3NKDA 3G71L 3CCQL 3CCMO 1KQSK 3CCQO 1VQ8O 4N06A 1S72L 2OTLL 1S72O 4P6IC 3CCSL 1YJWL 1VQ5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 O;  3I56 L;  3G4S L;  3CC4 O;  1YHQ L;  1NJI M;  3CCL L;  1M1K M;  1KD1 P;  1NJI P;  3CCL O;  1Q82 M;  3CPW N;  1KC8 M;  1Q82 P;  2QEX L;  1KC8 P;  1QVF N;  2OTJ O;  1VQ6 L;  1QVG N;  3CCM L;  1W2B N;  3CCE L;  1VQ6 O;  3CCJ L;  1VQ8 L;  3CCE O;  3CCJ O;  1YI2 O;  1Q86 M;  1Q86 P;  3CXC N;  3CME L;  3CME O;  3CC4 L;  1K73 M;  1JJ2 N;  1M1K P;  1VQL O;  2OTJ L;  2QA4 L;  1KQS N;  3OW2 K;  1VQ7 O;  1Q81 M;  2QA4 O;  1M90 M;  3I55 L;  1YI2 L;  1Q81 P;  1M90 P;  3I55 O;  1VQK O;  1VQ9 L;  1VQN L;  1VQ9 O;  1VQO L;  1VQN O;  1YIJ O;  1VQO O;  3CC7 O;  1VQP L;  3G6E L;  1VQP O;  1Q7Y M;  3G6E O;  3CMA L;  3CMA O;  1N8R M;  1K9M M;  1K73 P;  1N8R P;  1K9M P;  1VQ4 O;  1VQL L;  3CD6 L;  3CPW K;  3CD6 O;  1YJ9 O;  3CCV L;  1VQ7 L;  3G71 O;  1QVF K;  3CCV O;  1QVG K;  1W2B K;  1VQK L;  1YIT L;  2OTL O;  3CCS O;  1YJW O;  1YIT O;  1YIJ L;  3CC2 L;  3I56 O;  3CXC K;  3G4S O;  3CC7 L;  1YJN L;  1KD1 M;  3CC2 O;  1YJN O;  3CCU L;  1YHQ O;  1K8A M;  3CCU O;  3CCR L;  1K8A P;  3CCR O;  1Q7Y P;  1VQM L;  1VQ4 L;  1JJ2 K;  1VQM O;  2QEX O;  3OW2 N;  1YJ9 L;  3G71 L;  3CCQ L;  3CCM O;  1KQS K;  3CCQ O;  1VQ8 O;  1S72 L;  2OTL L;  1S72 O;  3CCS L;  1YJW L;  1VQ5 L; 
#chains in the Genus database with same CATH topology
 1VQ5 O;  3I56 L;  3G4S L;  3CC4 O;  1YHQ L;  1NJI M;  3CCL L;  1M1K M;  1KD1 P;  1NJI P;  3GOD A;  3CCL O;  1Q82 M;  3CPW N;  1KC8 M;  1Q82 P;  2QEX L;  1KC8 P;  1QVF N;  2OTJ O;  1VQ6 L;  1QVG N;  3CCM L;  1W2B N;  3CCE L;  1VQ6 O;  3CCJ L;  5FCL A;  3CCE O;  1VQ8 L;  3CCJ O;  1YI2 O;  1Q86 M;  5DS4 A;  1Q86 P;  3CXC N;  3CME L;  3CME O;  3CC4 L;  4XTK A;  1K73 M;  4W8K A;  1JJ2 N;  1M1K P;  1VQL O;  5DS6 A;  2OTJ L;  2QA4 L;  1KQS N;  3OW2 K;  1VQ7 O;  1Q81 M;  2QA4 O;  1M90 M;  2YZS A;  3I55 L;  1YI2 L;  1Q81 P;  1M90 P;  3I55 O;  1VQK O;  1VQ9 L;  1VQN L;  1VQ9 O;  1VQO L;  1VQN O;  1YIJ O;  1VQO O;  3CC7 O;  1VQP L;  3G6E L;  1VQP O;  1Q7Y M;  5DLJ A;  3G6E O;  3CMA L;  5DQZ A;  3CMA O;  1N8R M;  1K9M M;  1K73 P;  1N8R P;  1K9M P;  1VQ4 O;  1VQL L;  3CD6 L;  3CPW K;  4WJ0 A;  3CD6 O;  1YJ9 O;  5DS5 A;  3CCV L;  1VQ7 L;  3G71 O;  1QVF K;  3CCV O;  1QVG K;  1W2B K;  1VQK L;  1YIT L;  2OTL O;  3CCS O;  1YJW O;  1YIT O;  1YIJ L;  3CC2 L;  3I56 O;  3CXC K;  3G4S O;  3CC7 L;  1YJN L;  1KD1 M;  3CC2 O;  1YJN O;  4QDL A;  3CCU L;  1YHQ O;  1K8A M;  3CCU O;  3CCR L;  5DQT A;  1K8A P;  3CCR O;  1Q7Y P;  1VQM L;  1VQ4 L;  1JJ2 K;  1VQM O;  2QEX O;  3OW2 N;  1YJ9 L;  3NKD A;  3G71 L;  3CCQ L;  3CCM O;  1KQS K;  3CCQ O;  1VQ8 O;  4N06 A;  1S72 L;  2OTL L;  1S72 O;  4P6I C;  3CCS L;  1YJW L;  1VQ5 L; 
#chains in the Genus database with same CATH homology
 1VQ5 O;  3I56 L;  3G4S L;  3CC4 O;  1YHQ L;  1NJI M;  3CCL L;  1M1K M;  1KD1 P;  1NJI P;  3GOD A;  3CCL O;  1Q82 M;  3CPW N;  1KC8 M;  1Q82 P;  2QEX L;  1KC8 P;  1QVF N;  2OTJ O;  1VQ6 L;  1QVG N;  3CCM L;  1W2B N;  3CCE L;  1VQ6 O;  3CCJ L;  5FCL A;  3CCE O;  1VQ8 L;  3CCJ O;  1YI2 O;  1Q86 M;  5DS4 A;  1Q86 P;  3CXC N;  3CME L;  3CME O;  3CC4 L;  4XTK A;  1K73 M;  4W8K A;  1JJ2 N;  1M1K P;  1VQL O;  5DS6 A;  2OTJ L;  2QA4 L;  1KQS N;  3OW2 K;  1VQ7 O;  1Q81 M;  2QA4 O;  1M90 M;  2YZS A;  3I55 L;  1YI2 L;  1Q81 P;  1M90 P;  3I55 O;  1VQK O;  1VQ9 L;  1VQN L;  1VQ9 O;  1VQO L;  1VQN O;  1YIJ O;  1VQO O;  3CC7 O;  1VQP L;  3G6E L;  1VQP O;  1Q7Y M;  5DLJ A;  3G6E O;  3CMA L;  5DQZ A;  3CMA O;  1N8R M;  1K9M M;  1K73 P;  1N8R P;  1K9M P;  1VQ4 O;  1VQL L;  3CD6 L;  3CPW K;  4WJ0 A;  3CD6 O;  1YJ9 O;  5DS5 A;  3CCV L;  1VQ7 L;  3G71 O;  1QVF K;  3CCV O;  1QVG K;  1W2B K;  1VQK L;  1YIT L;  2OTL O;  3CCS O;  1YJW O;  1YIT O;  1YIJ L;  3CC2 L;  3I56 O;  3CXC K;  3G4S O;  3CC7 L;  1YJN L;  1KD1 M;  3CC2 O;  1YJN O;  4QDL A;  3CCU L;  1YHQ O;  1K8A M;  3CCU O;  3CCR L;  5DQT A;  1K8A P;  3CCR O;  1Q7Y P;  1VQM L;  1VQ4 L;  1JJ2 K;  1VQM O;  2QEX O;  3OW2 N;  1YJ9 L;  3NKD A;  3G71 L;  3CCQ L;  3CCM O;  1KQS K;  3CCQ O;  1VQ8 O;  4N06 A;  1S72 L;  2OTL L;  1S72 O;  4P6I C;  3CCS L;  1YJW L;  1VQ5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...