1VQ6P

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq6P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq6P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq6P02
1QVFO 3CC2P 3CCMP 1Q7YQ 3G4SP 1S72P 1JJ2O 3G6EP 1K9MQ 3I56P 1KC8Q 3I55P 1YJWP 3CCSP 3CC7P 2OTJP 1VQPP 3CCQP 3CXCO 1YHQP 1KD1Q 1N8RQ 1Q81Q 3CCVP 3OW2O 1KQSO 1VQMP 3CCJP 1W2BO 1Q86Q 1M90Q 1VQ5P 3CCLP 1VQ4P 2QEXP 3CCEP 1NJIQ 1VQ9P 1YIJP 1VQLP 1VQKP 3G71P 1VQ6P 2QA4P 3CMEP 3CCRP 1YJ9P 3CPWO 1M1KQ 3CC4P 1VQ7P 1Q82Q 1QVGO 1YITP 2OTLP 1YJNP 1K8AQ 1K73Q 3CD6P 3CCUP 1VQNP 1VQOP 1YI2P 3CMAP 1VQ8P
chains in the Genus database with same CATH superfamily
5AVVB 4XE5B 2I1JA 1P84E 1KFNA 2BEZF 5KP8B 4WY4D 4GOEA 1EDKA 3S9OA 2M0BA 1KN7A 3HUSC 5APTA 3AEGC 2E76C 5AW1B 3AEDC 1ZW0A 5APUA 1YJNP 3B5NA 1K30A 1L2PA 1PP9E 3S1KA 3HTKB 1LTAC 1FJKA 5HGOA 2AEMA 3M0DA 5AW7B 1NTZG 1N2DC 1L0NK 2LKMA 3WU2H 4JBZA 1AFOA 4BXLA 1T6AA 1ZMBA 3E1IA 2KS1A 2N5IA 2RMZA 2L22A 2O1KA 2I1KA 2H89C 1RF1C 3V4QA 2AXTE 4H44B 3B4SA 3CI9A 3H1IG 3OAKA 3KZIH 1HF9A 3BVHA 4HJGH 2HPCB 4D6TE 3BCCG 4U0DA 2JWAA 3F89A 3W68A 3JSVC 3RL0g 3Q1MA 5CCHC 2KOOA 1ZN5A 1FR2A 2KG6A 2HG5D 1GL2D 4EYYQ 1KC8Q 2IZ0A 4IFMA 1BE3D 3CX5I 1Q86Q 3U59A 3LW5J 2NPSB 1NTMG 1VQ4P 4ZKUA 3H1HJ 3L73D 2AXTH 1X8YA 1U7MA 2K5XA 2MKVA 5DJTB 2WSEH 4NPEA 1L0ND 2WSFJ 4C7NA 2FFDA 1Z6MA 2E42A 3C8VA 2V7QJ 4JPZB 2R3SA 3HE4B 5EJDA 2RH0A 3HD7B 4K3AA 2M8RA 3JCUE 2KODA 1VF5C 2BCCJ 4UB8E 2AFDA 4PJ0E 2OYIC 2A45G 5M1BA 2WWWA 2K93A 1WT6A 3SWYA 3IFMA 2NPSC 3GLMA 1EXIA 3B5IA 4HB1A 2N1TC 1KILE 1RF0A 1SQVG 1GD2E 1OIPA 2E1MA 2CK3H 2WQYC 3L37A 2K2QA 3II6A 1SQXJ 5KTBA 1E0HA 1OW7A 3W67A 1PP9J 1DD4A 3M91A 1DNYA 1Z56A 1IJDB 2WPSA 1R8EA 1OMIA 4AUWA 4I7ZC 2FADA 1OZHA 2QJYC 1BCCJ 2OARA 1NTMD 1N86A 2FYUD 3CX5E 5TISH 3CXHH 4DOJA 3T97B 2VLNA 2LXCB 1L4AC 1HJBA 2PY8A 3NY7B 4QKOA 3C9IA 2GZFA 1S3JA 2GDWA 2W8ZA 2Z4EA 1PPJD 4UHPB 3B8EB 1SFCC 3QH9A 5H2FE 5CBNA 4YTPC 1NTKK 4L73A 5B5EE 1JY3P 5CBOA 2QEXP 4GODA 3N7NA 3EWKA 1FZCC 3H1KE 3IAOA 5CCHA 1NOHA 1KZUB 2M3BA 2O01N 2WMMA 2ZT9D 3TDKA 2Y9YA 3B4QA 1HGVA 2WT7A 3HD7A 4Z1MH 4GIFA 3G6EP 1K9MQ 1IO4A 3GZMA 1N7LA 3H1JE 4GDOA 3AE5C 2ZFCA 2HPCA 1VPCA 2G3AA 3EJBA 2BUOA 2QJKC 2R3CA 1Q82Q 2MR8A 4U3FG 4U0AA 3GG2A 3GMAA 2FFDB 3N4XA 5GTIH 1IFPA 3LIDA 3P8MC 2JYGA 3RL0B 3V2NA 2XV6A 4LLHA 4N78E 5GTHE 4H13B 3K5BA 3KPEA 2FQ0A 2BCCE 4HKGA 3AE6C 1SQXG 1NTZJ 1P84I 3PP5A 3G26A 1PV3A 4H44C 3RBZA 1A02J 4H0LD 1IUQA 2FVAA 1OVVA 2WPRA 4L75A 3H1LJ 2K94A 4R0MA 1J2JB 2E75B 2FYZA 3CMEP 3RK2C 5HGNA 1KB9I 5AW0B 1SQXK 2PEKA 3TGUJ 1AQTA 3DS2A 2QJYB 5AW5B 4ZKPA 3DTJA 3L73E 1BSHA 1KYOI 2XZRA 2YO2A 4EOTA 2QSIA 1FJPA 2FYNB 1W2BO 1VQ5P 1M6NA 1MZ9A 3AE3C 3H1JJ 4MRTC 1L0LG 1NGMB 1QVGO 2PFXA 1BCCE 2L9FA 3TYYA 2JU2A 3WMM0 2HFED 1EXJA 4ZMDA 2J58A 2QJPB 2Q6QA 1KD1Q 2JO0A 2N1TB 2FVEA 2RN0A 1S5LH 2N50A 4NPDA 3G9RA 4TT3H 3NTNA 4UB6E 5E79E 1Y47A 1PEOA 2VRSA 4XA4A 3AEBC 2JYLA 2W90A 1JCDA 2QVAA 4BWNA 2HODA 1PEUA 2XV5A 1Q2NA 2YKPA 1G2CA 4DG9A 1BDCA 4GKGA 1T2KD 2HLOA 5F2KA 4ZNCA 2VLQA 2LKIA 4W7ZA 1N73C 2M5AA 1FOSE 4WYMA 2ZYAA 1ACPA 3TGUG 4WWIA 2W6BA 3D6YA 1PFIA 1IZNB 2MJZA 3Q5PA 1SQBD 2ERHA 1NAFA 1ZR2A 5BS1A 1LP1A 2CGQA 4XROA 3V6IA 2XZ0D 3RK2D 5F2OA 1NU1D 2KZJA 1RQUA 1NHLA 1SQQJ 2E5TA 4JF7A 1GK6A 3AECC 3PJSK 1Q81Q 3CXHI 3VTPC 2P7JA 1VF5D 4YXWH 3CX5H 5TISE 4BRYB 1EDJA 4R4LA 1OW8A 5KLVD 2HYNA 2OYHA 2KI7B 2E75C 1GU4A 2C9LY 3FXEA 1BE3G 2C9NY 2YKQA 1QL2A 3A5TA 3L74D 3Q2YA 1K05A 1HY8A 4DT0A 3M0AA 2XDJA 1DX7A 5AVUB 2KW2A 1KB9D 2E76B 1H8AA 1OXZA 3AEFC 1J1DC 2KOQA 1QL1A 1EQ7A 3KXDA 1DIPA 4YPCA 4TLFA 2Q7CA 1NJIQ 1MZ8A 2IFMA 2NRGA 4N78D 4Y99B 1NWQA 2ONTA 2QJPC 4Y99C 2BCCD 1NTMK 1LWUB 3MUDA 1NTKG 1OVUA 2R32A 3T97A 2MVVA 1X0TA 4PD4H 3TNUA 2KORA 4JQ0D 1FDIA 1JY2O 2XZ1C 2KLUA 1J1DB 2YO3A 1VHNA 5KLVK 3E1RA 3TNUB 2LIWA 1NTZE 2P2UA 2FYNC 2ITAA 1L4AD 2R5BA 2FHSC 3AE4C 1K73Q 2E75D 4K35A 2Q9IA 3L4FA 2KXPB 1ZNVA 1PGOA 3BCCD 3RK2B 1NKZB 4XFZA 4HKZH 2E74D 2VLPA 1YQ3C 2RKLA 3DS3A 5AW3B 2PNGA 1PPJE 1BCCD 3CXCO 3PTZA 3M0DC 2M8PA 1KYOD 1FU1A 3H1KJ 2LF4A 2N5HA 5BU5A 1VKUA 2EIAA 5AW8B 1A8OA 3L70D 2YMYA 2M5RA 2JR8A 1SQXE 1L0LK 2X2BA 5H2FH 1QEXA 2IYPA 4GR2A 1NTKJ 3AE2C 1SS1A 3WBHA 1X9VA 2L6EA 3CC2P 3V2RA 1XTCC 3VP8A 2FFDC 5GTIE 3RGUA 3BASA 1X79B 4WB4A 2KS1B 3GKLC 2FXMA 1FZCA 1N73B 2FYUK 2YXQB 3FWLA 5EW5E 2CPSA 3DS0A 4QNBA 2BHVA 1ZP0C 5HGMA 3G28A 1FC2C 2GUVA 2WSCJ 4LC1A 5CJ4A 4QMAA 1LT9B 4JYBA 3CWBJ 1HWTC 1AJYA 4H0LB 3WUUA 2Q1KA 1JNMA 5APVA 4LGDE 2OYIB 3MHVA 3CCUP 2AXCA 2L91A 1EMVA 2IFNA 2VLOA 1JO5A 1GL2C 2HODB 3L71G 1NTME 1E5WA 2YKOA 1NU1E 3Q5RA 3AE1C 5KP6B 1OWAA 4OVNF 1DD3A 1YJ9P 2OTKE 1JUNA 3CXHE 1GMJA 2PP6A 4COCA 3RG6C 3ZDMA 2FACA 1NTZK 4U3FJ 1U7JA 3JCUH 1FOSF 2O01H 1N7SC 3H1LD 3HD7D 1M1JC 3MIWA 4HYTB 1IFMA 1RE4C 4H2XC 3SWKA 2WPQA 3H1ID 1M1JA 3NXSA 1EDIA 3G3ZA 3WUVA 4GT1A 1BE3E 1ZXGA 2K0XA 1JMBA 2IX7C 1D1DA 3PRJA 1SQVD 1KILC 3I55P 2WSSH 3B5NC 1SFCA 1QX8A 3P7KA 1UJZA 1MV8A 4L76A 1MKMA 3A7OA 3H1JD 3BATA 2IBZI 2D2CC 3H1LE 2Z45A 2PGDA 3IF4A 2R5DA 3NFQA 5CHXA 5AW4B 2V4HA 4IFDK 2JEEA 3CWBG 3H4EA 2QM7A 1JY3N 2FXOA 2O01J 4KHXA 1KV4A 3OJAB 4U0BA 1LTJA 3KZIE 2E74C 2Y9ZA 1LT9A 1LTTC 1VQOP 2W27A 2M8LA 1LTJC 3WUTA 1G2CB 2GZEA 5CCHD 1KILD 2KUBA 4PWVB 1VQLP 1JY3O 5AVXB 4RKUJ 2VSQA 5AVRB 2V7QH 2BCCG 2MF4A 5B5EH 3O6QA 4RJTA 2K37A 2NO8A 2WSFH 3MD0A 1SQQE 2UWJE 1FZBA 2OYIA 2WSEJ 1ZV8A 2QRXA 2JWDA 4OH8B 2FBWC 2WSCH 1AUMA 2N6ZA 2Y0EA 1SQBJ 1GXHA 4AYCA 5CCGD 3L73J 4OWFA 1BSNA 2JB0A 2LR2A 4D6TJ 1NAYA 1LTJB 3FXDA 4L74A 1IK7A 3L35A 1NKNA 2FYUE 3CX5D 3H1JG 4IFFA 1W5CE 1BDDA 3EJEA 3CL3D 3HUSA 2YNYA 3L72J 2QM8A 3HE5A 1JY2P 1ZR4A 3P8CD 2KP8A 1S9KE 2KOPA 1KLPA 3GHGB 3H32A 4U0FA 2H43A 2KOGA 3CC7P 3H1HG 1AVYA 3D71A 1M1JB 4PD4E 2P58A 2Q5UA 4PV1B 3L72E 2WPTA 2D2CD 3HTKA 1RO2A 2O1JA 5K5GB 1PL5A 3MTUE 2P9XA 3B5ND 2FXPA 1R5SA 2KYVA 1HUCA 3M9QA 2QJKB 3S4RA 3P8CE 3H47A 1EZVI 4BRYA 2N98A 1QRJA 1UIXA 4WY4A 3G71P 1VQ6P 4C7NB 1N7SB 2PRRA 2EG5A 2PEIA 1RQVA 4IL6X 2ZVOB 2QG4A 1NU1G 2ZXXA 1N7SD 1TU3F 3HD7C 3TF5A 4R4MA 1H88A 5F2NA 2ZT9B 4JYCA 1NTMJ 2KLVA 2FYUJ 1VQKP 1E79H 2JDIH 1QGKB 5B66E 2KGAA 2KG9A 1VL2A 4XRQA 3LIEA 5KJ7C 4BPHA 1FDMA 3AEEC 2QE7H 1EZVD 1M57D 2WTYA 5E79H 4UB6H 4IL6H 1M74A 1EOQA 1JB0J 3L71J 3O6QB 1F80D 1KTMA 3H6PA 1CSBA 5KLVG 5TJHA 2GUSA 2Z5IA 2Z46A 2CWOA 2KIKA 1BGYJ 2HR3A 1FZFA 4H2WC 1J1EC 7CEIA 3V2PA 1GXGA 2KR5A 1YBKA 1L0IA 3L75E 3L71E 3HRNA 2N9YB 3H1KD 1KORA 1L4AA 1KILA 2CQ8A 2N1TA 4PH1A 3L70J 5EFWB 2JKVA 4EI2A 3BRTB 3Q5SA 1PGJA 3WU2E 1YI2P 2EHSA 3M06A 1JJ2O 5CZDB 3GHGA 1L0NE 1JTHB 2OQQA 1NTZD 3AE7C 2IZ1A 3L75D 1K8AQ 1LNQA 1AYIA 3HE5B 3RK3E 3MUDC 4RO0A 2K0YA 2OYHC 1NTKE 1KQSO 2IYOA 1PEQA 3VMZA 3RK3B 2JAZA 4OGQC 3ABVC 2MR7A 1LJ2A 2IPPA 5KLIC 1PZQA 2GM4A 1E6JP 1RHZB 4DCKA 4I1LA 1GZLA 3VMAA 1SQBE 1VQ9P 1EC5A 4PJ0H 3L70E 2Y0DA 1HGZA 1GW3A 2CG5B 5KAFE 1T8ZA 4KJMA 5AVTB 1SQPK 2P67A 1VDFA 3H1KG 2JU1A 2E74B 3ITKA 1S9KD 2ZT9C 1PPJG 2M8NA 3GF3A 1KQGB 1SQPD 1ZOYC 2KNCA 1IMPA 1ZMEC 2AEFA 1RF1B 5CJ0A 2EHTA 1SQVJ 1FDOA 3QWOC 1RE3C 2ZYGA 4NPFX 4W80A 2FQ2A 5CCGA 3USSA 3SFDC 1N8RQ 1CW5A 1L4AB 3UIAA 1USDA 4U3FE 3VOPA 1KB9E 4BPGA 1OX3A 1DH3A 1CEIA 3DPHA 2WITA 2W6AA 1RE4A 2PEQA 3NMDA 1H0TA 3CWBE 5AVYB 1IFNA 1KB9H 4CA3A 1XTGB 3PHLA 3VRLC 3DS4A 1BE3J 3HUSB 1P84D 3CCVP 1HJ0A 2KK7A 1PP9G 2IBZD 1JY2N 3RG2A 2KGCA 3HYBA 1P84H 2KSJA 3CC4P 4EDFA 2CPBA 1NYHA 5APYA 1NU1J 3CCMP 2KNCB 4O9BA 1SQQD 2YIUC 1OR5A 3Q20A 2L0QA 3LMOA 3MGEA 2R44A 5KP7B 3MZWB 2YXRB 1LWUA 3G1IA 2E5YA 5L8RJ 1EZVE 1SQQG 2N1TD 3VMYA 2B87B 2N9BA 5KLVJ 3BCCE 2NPSD 1VF5B 1LT9C 2NZ2A 2C0XA 1K04A 1LT1A 1RH5B 4H0LC 3EJDA 1BCCG 1URQA 1T2KC 3M9BA 2LPKA 1S5LX 4D6TD 1LTIC 1SQBK 3GJNA 2KOSA 2AVAA 1BGYE 1RO0A 3I56P 1QLED 4I2LC 1SQXD 3V2QA 1M56D 1IFIA 5I4TG 1HH0A 2BEQD 2K0DX 1NQ4A 2ZJSE 2Z5HA 3L72D 1JM0A 3GF7A 4C46A 5KLIB 1UNKA 1X22A 1L0NG 2KSEA 1L0LD 2LOLA 3L72G 4PV1C 5AVSB 1EIAA 3L73G 2WVRA 1N7SA 2FVFA 1SFCB 5JPAA 2QA4P 1RY3A 3V4WA 1YITP 2XXMA 4U0EA 4PH0A 3IR9A 4KT0J 5B66H 3TK1A 1U57A 1DV5A 5KAIH 1RNIA 3CCLP 3U1AA 2KZIA 1OVRA 3H32B 1BAJA 1PIXA 4I7ZB 2H8PD 2JP3A 2L4BA 3HE4A 3EFFK 2P10A 1S5LE 1M7LA 2DGYA 4AQRD 5AVWB 4B86A 2GA1A 4CPGA 3G29A 1KQFB 2MY5A 1AA0A 2KB7P 4W7YA 1MUUA 5APWA 3RL0D 3R4YA 3VMXA 2Z44A 4H13C 3H1LG 3AE8C 3EQ2A 3PLNA 4H13D 5KAIE 2XNXA 1EDLA 2E43A 3RL0C 2DNWA 3MP7B 3MGNA 1JOCA 2GDYA 3CMAP 2JBGA 2PENA 1LWUC 2K92A 2P1JA 2A06E 3PH0A 2G8YA 4DZOA 3CCSP 3KDPB 1KYOE 2ZXEB 1FZEA 1YYCA 2O3JA 5KLVE 3L71D 1GL2B 3R2PA 2AFEA 4M3LA 3SWFA 3L36A 4WBAA 3KHUA 3P05A 2GZJA 1SQVE 3M1MA 1PGPA 1CI6A 3A0BH 3LW5H 4RESB 2JQ4A 2I8DA 4N6JA 4Y28J 1FZCB 5KJ7A 3CWBD 1H0TB 1HQBA 3G21A 1KYOH 5KKZB 3LRYA 5HGLA 3TGUD 3O8ZA 4PV1D 1A02F 3L74E 3VP9A 1NVOA 3KYQA 2AEJA 2D2CB 1YHQP 3CCQP 2Y0CA 4ASWA 2K9YA 1IFDA 2DW3A 3GW6A 1IK9A 3FX0A 4IZ6A 2OYOA 4YXDC 3P32A 3A3YB 4N3YB 1MFTA 1S72P 2ZAEB 1GW4A 2XT1A 2K9JA 2QNWA 3L74G 1AF8A 2JGPA 1UIIA 1M90Q 5KJ7D 2B89A 3CXHD 3H1IJ 1X3OA 2A45H 2BQ1E 1GPJA 4MN4C 4ASVA 5KKZC 1LP1B 1GL2A 3BRVB 3D70A 2LXBA 2FQ1A 4PD4I 1PGQA 3FWNA 2A45I 2GZGA 4M0IA 3TSIA 2K3RA 3V5BA 1OW6A 1SP4A 3A2AA 3H1IE 1SQQK 1S2EA 3VN0A 2C0WA 1BGYG 1L0HA 2LTEA 1GK4A 1URQB 3I5CA 3A0HH 3G4SP 1M8OB 2SPZA 2IBZG 1USEA 1WMKA 4HH2A 1URQD 3FGAD 3G1GA 4COPA 1NU1K 4H44D 2WPVB 5AW9B 5AVQB 5APQA 4OGQD 3H1HD 1CI6B 1NH4A 4WVZA 4EIJA 2XU6A 2NPSA 2OTLP 2JO1A 1SQPJ 2YIUB 1FAVA 2W6JH 1ZRTD 4IPYA 1L0NJ 3RK3D 1YJWP 3RBXA 1HTLC 2KG8A 3CCJP 4XFXA 5DJUB 2OYHB 2IBZE 1R5LA 4U7JA 1T3JA 2K88A 2B88A 3U1CA 3VYIA 3HZQA 1Q90D 1LGHB 1MFZA 1ZRTE 5AVZB 1PEMA 1FE6A 1G1JA 2PEMA 3JC22 1WRGA 3B71A 3L74J 4C7RA 2B87A 3CLQA 2M3EA 2K9JB 1VQ7P 5CCGC 5APSA 1JTHA 5BS2A 3CD6P 3KQGA 3H25A 1VQ8P 1SFCD 1Q7YQ 4IOIH 3SSUA 2YMKA 2N6YA 2OGUA 5CMZA 1HVVA 3B5NB 2BASA 1RF1A 2KWLA 1PP9D 1FS0E 1J1EB 1S1CX 3OA7A 2A06D 4H2YC 4UB8H 4A7PA 1IMQA 1M1KQ 2M5AB 3AE9C 1LTBC 5HVCA 1T3UA 1KILB 1A43A 2K1AA 1SLQA 1IFJA 2J5UA 3U43A 2CNRA 4IL6E 3L70G 3AEAC 4XFJA 1FZAA 1GDTA 2ROQA 2FAEA 1VQMP 3DS1A 1GTWA 1OFCX 3CPWO 5DCKA 4WY4C 4D6TG 5BU8B 2Q3EA 1KMIZ 1LTGC 4PXHB 1RE3A 3IN6A 4OGQB 3TGUE 1L0LE 1YTZI 4GR6A 3E2DA 5AW2B 5HV8A 3BCCJ 2KGEA 1M6EX 2B9BA 2WT7B 3RK3C 2LL8A 4I6MC 1Y8AA 3A0BE 5C39A 5KAFH 1AVOA 3L75G 4DJGA 3EFGA 2MD9A 1H89A 1URQC 1L0LJ 4BPFA 1S4XA 2A06G 2OTJP 1SQBG 3Q3DA 1AV1A 1JEKA 2ZYDA 1GU5A 3CCRP 2H7HA 5AW6B 1IC2A 1NTKD 5GTHH 3M9HA 5APXA 2LIUA 4XFYA 1FZGA 3NTEA 1Y9BA 3H0DA 1RF0C 1D7MA 2GZIA 2XKMA 3CE7A 2L5GB 1SQVK 2KGDA 4GOFA 2H88C 1KFMA 1W2EA 2PEOA 3DS5A 2J59M 2W83C 4U0CA 1JCCA 1QVFO 1SVFA 1BGYD 1FBMA 1YQ4C 1HBWA 2WZ7A 3CCEP 1YIJP 1G1IA 2POHA 1KQLA 2Q3IA 2PAJA 3G0VA 3C1LA 3GHGC 1VQNP 3D6ZA 4F37A 3H1HE 2JJLA 2FY8A 1VQPP 1DEEG 1AQ5A 1JMMA 3OW2O 1YTZT 2FKWB 2PEJA 1LTSC 1CZQA 3E7KA 1T8KA 3A0HE 1BXIA 4NEOA 2XNDH 1SQPE 5BVZA 3L75J 1DEBA 2LMLA 2EFJA 1ZLLA 3SFEC 4U3FD 2GYKA 2ZVNB 2MVUA 2QIWA 3GZLA 2GDXA 1N73A 2FYUG 2E76D 1EZVG 2IDBA 1NO4A 2AF8A 3F5HA 4PD4D 4WY4B 1SQPG
chains in the Genus database with same CATH topology
4XFYA 2PENA 1Q7YQ 3NTEA 1JJ2O 1RO0A 3I56P 3CCSP 3H47A 3H0DA 1N8RQ 1QRJA 4M0IA 1Q81Q 1W2BO 1VQ5P 1M6NA 5I4TG 2QEXP 1VQLP 3G71P 1VQ6P 3DPHA 4XFZA 1YJ9P 2EG5A 2PEIA 1M1KQ 2PEOA 1QVGO 1YJNP 3P05A 1K8AQ 2KODA 1K30A 4COCA 3DS5A 2PEQA 1A43A 3RG6C 3M1MA 4U0CA 3DS3A 1QVFO 3G4SP 3G6EP 3VRLC 3DS4A 5HGOA 1K9MQ 5F2NA 3CXCO 1KD1Q 1EIAA 3CCVP 2JO0A 3G1GA 1VQMP 1KQSO 2M8PA 4COPA 3DS1A 1AUMA 3CCEP 1PEQA 2LF4A 3G21A 1YIJP 1VQKP 3B5IA 5JPAA 2QA4P 2EIAA 1A8OA 3HYBA 1ZMBA 3CPWO 2BUOA 3LRYA 3CC4P 1Q82Q 2OTLP 1YITP 4U0AA 3G0VA 5HGLA 5DCKA 1VQNP 4GR2A 4XRQA 2E1MA 4IPYA 3WBHA 1D1DA 2XXMA 2L6EA 3CC2P 2JYGA 4U0EA 3CCMP 1PEOA 4PH0A 2XV6A 3I55P 1YJWP 2JYLA 1E6JP 3Q20A 1VQPP 3CCQP 4GR6A 1YHQP 3E2DA 3MGEA 3OW2O 1M6EX 1RNIA 3CCJP 4XFXA 3CCLP 4U0DA 1M74A 1EOQA 3G1IA 1NJIQ 1VQ9P 2PEJA 1PEUA 1BAJA 2Z45A 5F2KA 3G26A 2ONTA 2DGYA 3HZQA 2EFJA 3DS0A 4QNBA 4WYMA 1IUQA 2BHVA 4U0FA 2Z46A 1S72P 2CWOA 5HGMA 3G28A 1KC8Q 2XT1A 3G29A 3CC7P 2OTJP 2OARA 3H4EA 1Q86Q 1M90Q 1PEMA 2PEMA 1VQ4P 2Z44A 4U0BA 3CMEP 5BS1A 4PH1A 3CCRP 5HGNA 4XROA 1RO2A 2M8NA 2PY8A 2PEKA 1VQ7P 2BQ1E 5BS2A 1K73Q 3CD6P 3CCUP 1VQOP 3DS2A 5F2OA 3DTJA 2P9XA 2M8LA 1YI2P 3CMAP 1VQ8P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF O;  3CC2 P;  3CCM P;  1Q7Y Q;  3G4S P;  1S72 P;  1JJ2 O;  3G6E P;  1K9M Q;  3I56 P;  1KC8 Q;  3I55 P;  1YJW P;  3CCS P;  3CC7 P;  2OTJ P;  1VQP P;  3CCQ P;  3CXC O;  1YHQ P;  1KD1 Q;  1N8R Q;  1Q81 Q;  3CCV P;  3OW2 O;  1KQS O;  1VQM P;  3CCJ P;  1W2B O;  1Q86 Q;  1M90 Q;  1VQ5 P;  3CCL P;  1VQ4 P;  2QEX P;  3CCE P;  1NJI Q;  1VQ9 P;  1YIJ P;  1VQL P;  1VQK P;  3G71 P;  1VQ6 P;  2QA4 P;  3CME P;  3CCR P;  1YJ9 P;  3CPW O;  1M1K Q;  3CC4 P;  1VQ7 P;  1Q82 Q;  1QVG O;  1YIT P;  2OTL P;  1YJN P;  1K8A Q;  1K73 Q;  3CD6 P;  3CCU P;  1VQN P;  1VQO P;  1YI2 P;  3CMA P;  1VQ8 P; 
#chains in the Genus database with same CATH topology
 5AVV B;  4XE5 B;  2I1J A;  1P84 E;  1KFN A;  2BEZ F;  5KP8 B;  4WY4 D;  4GOE A;  1EDK A;  3S9O A;  2M0B A;  1KN7 A;  3HUS C;  5APT A;  3AEG C;  2E76 C;  5AW1 B;  3AED C;  1ZW0 A;  5APU A;  1YJN P;  3B5N A;  1K30 A;  1L2P A;  1PP9 E;  3S1K A;  3HTK B;  1LTA C;  1FJK A;  5HGO A;  2AEM A;  3M0D A;  5AW7 B;  1NTZ G;  1N2D C;  1L0N K;  2LKM A;  3WU2 H;  4JBZ A;  1AFO A;  4BXL A;  1T6A A;  1ZMB A;  3E1I A;  2KS1 A;  2N5I A;  2RMZ A;  2L22 A;  2O1K A;  2I1K A;  2H89 C;  1RF1 C;  3V4Q A;  2AXT E;  4H44 B;  3B4S A;  3CI9 A;  3H1I G;  3OAK A;  3KZI H;  1HF9 A;  3BVH A;  4HJG H;  2HPC B;  4D6T E;  3BCC G;  4U0D A;  2JWA A;  3F89 A;  3W68 A;  3JSV C;  3RL0 g;  3Q1M A;  5CCH C;  2KOO A;  1ZN5 A;  1FR2 A;  2KG6 A;  2HG5 D;  1GL2 D;  4EYY Q;  1KC8 Q;  2IZ0 A;  4IFM A;  1BE3 D;  3CX5 I;  1Q86 Q;  3U59 A;  3LW5 J;  2NPS B;  1NTM G;  1VQ4 P;  4ZKU A;  3H1H J;  3L73 D;  2AXT H;  1X8Y A;  1U7M A;  2K5X A;  2MKV A;  5DJT B;  2WSE H;  4NPE A;  1L0N D;  2WSF J;  4C7N A;  2FFD A;  1Z6M A;  2E42 A;  3C8V A;  2V7Q J;  4JPZ B;  2R3S A;  3HE4 B;  5EJD A;  2RH0 A;  3HD7 B;  4K3A A;  2M8R A;  3JCU E;  2KOD A;  1VF5 C;  2BCC J;  4UB8 E;  2AFD A;  4PJ0 E;  2OYI C;  2A45 G;  5M1B A;  2WWW A;  2K93 A;  1WT6 A;  3SWY A;  3IFM A;  2NPS C;  3GLM A;  1EXI A;  3B5I A;  4HB1 A;  2N1T C;  1KIL E;  1RF0 A;  1SQV G;  1GD2 E;  1OIP A;  2E1M A;  2CK3 H;  2WQY C;  3L37 A;  2K2Q A;  3II6 A;  1SQX J;  5KTB A;  1E0H A;  1OW7 A;  3W67 A;  1PP9 J;  1DD4 A;  3M91 A;  1DNY A;  1Z56 A;  1IJD B;  2WPS A;  1R8E A;  1OMI A;  4AUW A;  4I7Z C;  2FAD A;  1OZH A;  2QJY C;  1BCC J;  2OAR A;  1NTM D;  1N86 A;  2FYU D;  3CX5 E;  5TIS H;  3CXH H;  4DOJ A;  3T97 B;  2VLN A;  2LXC B;  1L4A C;  1HJB A;  2PY8 A;  3NY7 B;  4QKO A;  3C9I A;  2GZF A;  1S3J A;  2GDW A;  2W8Z A;  2Z4E A;  1PPJ D;  4UHP B;  3B8E B;  1SFC C;  3QH9 A;  5H2F E;  5CBN A;  4YTP C;  1NTK K;  4L73 A;  5B5E E;  1JY3 P;  5CBO A;  2QEX P;  4GOD A;  3N7N A;  3EWK A;  1FZC C;  3H1K E;  3IAO A;  5CCH A;  1NOH A;  1KZU B;  2M3B A;  2O01 N;  2WMM A;  2ZT9 D;  3TDK A;  2Y9Y A;  3B4Q A;  1HGV A;  2WT7 A;  3HD7 A;  4Z1M H;  4GIF A;  3G6E P;  1K9M Q;  1IO4 A;  3GZM A;  1N7L A;  3H1J E;  4GDO A;  3AE5 C;  2ZFC A;  2HPC A;  1VPC A;  2G3A A;  3EJB A;  2BUO A;  2QJK C;  2R3C A;  1Q82 Q;  2MR8 A;  4U3F G;  4U0A A;  3GG2 A;  3GMA A;  2FFD B;  3N4X A;  5GTI H;  1IFP A;  3LID A;  3P8M C;  2JYG A;  3RL0 B;  3V2N A;  2XV6 A;  4LLH A;  4N78 E;  5GTH E;  4H13 B;  3K5B A;  3KPE A;  2FQ0 A;  2BCC E;  4HKG A;  3AE6 C;  1SQX G;  1NTZ J;  1P84 I;  3PP5 A;  3G26 A;  1PV3 A;  4H44 C;  3RBZ A;  1A02 J;  4H0L D;  1IUQ A;  2FVA A;  1OVV A;  2WPR A;  4L75 A;  3H1L J;  2K94 A;  4R0M A;  1J2J B;  2E75 B;  2FYZ A;  3CME P;  3RK2 C;  5HGN A;  1KB9 I;  5AW0 B;  1SQX K;  2PEK A;  3TGU J;  1AQT A;  3DS2 A;  2QJY B;  5AW5 B;  4ZKP A;  3DTJ A;  3L73 E;  1BSH A;  1KYO I;  2XZR A;  2YO2 A;  4EOT A;  2QSI A;  1FJP A;  2FYN B;  1W2B O;  1VQ5 P;  1M6N A;  1MZ9 A;  3AE3 C;  3H1J J;  4MRT C;  1L0L G;  1NGM B;  1QVG O;  2PFX A;  1BCC E;  2L9F A;  3TYY A;  2JU2 A;  3WMM 0;  2HFE D;  1EXJ A;  4ZMD A;  2J58 A;  2QJP B;  2Q6Q A;  1KD1 Q;  2JO0 A;  2N1T B;  2FVE A;  2RN0 A;  1S5L H;  2N50 A;  4NPD A;  3G9R A;  4TT3 H;  3NTN A;  4UB6 E;  5E79 E;  1Y47 A;  1PEO A;  2VRS A;  4XA4 A;  3AEB C;  2JYL A;  2W90 A;  1JCD A;  2QVA A;  4BWN A;  2HOD A;  1PEU A;  2XV5 A;  1Q2N A;  2YKP A;  1G2C A;  4DG9 A;  1BDC A;  4GKG A;  1T2K D;  2HLO A;  5F2K A;  4ZNC A;  2VLQ A;  2LKI A;  4W7Z A;  1N73 C;  2M5A A;  1FOS E;  4WYM A;  2ZYA A;  1ACP A;  3TGU G;  4WWI A;  2W6B A;  3D6Y A;  1PFI A;  1IZN B;  2MJZ A;  3Q5P A;  1SQB D;  2ERH A;  1NAF A;  1ZR2 A;  5BS1 A;  1LP1 A;  2CGQ A;  4XRO A;  3V6I A;  2XZ0 D;  3RK2 D;  5F2O A;  1NU1 D;  2KZJ A;  1RQU A;  1NHL A;  1SQQ J;  2E5T A;  4JF7 A;  1GK6 A;  3AEC C;  3PJS K;  1Q81 Q;  3CXH I;  3VTP C;  2P7J A;  1VF5 D;  4YXW H;  3CX5 H;  5TIS E;  4BRY B;  1EDJ A;  4R4L A;  1OW8 A;  5KLV D;  2HYN A;  2OYH A;  2KI7 B;  2E75 C;  1GU4 A;  2C9L Y;  3FXE A;  1BE3 G;  2C9N Y;  2YKQ A;  1QL2 A;  3A5T A;  3L74 D;  3Q2Y A;  1K05 A;  1HY8 A;  4DT0 A;  3M0A A;  2XDJ A;  1DX7 A;  5AVU B;  2KW2 A;  1KB9 D;  2E76 B;  1H8A A;  1OXZ A;  3AEF C;  1J1D C;  2KOQ A;  1QL1 A;  1EQ7 A;  3KXD A;  1DIP A;  4YPC A;  4TLF A;  2Q7C A;  1NJI Q;  1MZ8 A;  2IFM A;  2NRG A;  4N78 D;  4Y99 B;  1NWQ A;  2ONT A;  2QJP C;  4Y99 C;  2BCC D;  1NTM K;  1LWU B;  3MUD A;  1NTK G;  1OVU A;  2R32 A;  3T97 A;  2MVV A;  1X0T A;  4PD4 H;  3TNU A;  2KOR A;  4JQ0 D;  1FDI A;  1JY2 O;  2XZ1 C;  2KLU A;  1J1D B;  2YO3 A;  1VHN A;  5KLV K;  3E1R A;  3TNU B;  2LIW A;  1NTZ E;  2P2U A;  2FYN C;  2ITA A;  1L4A D;  2R5B A;  2FHS C;  3AE4 C;  1K73 Q;  2E75 D;  4K35 A;  2Q9I A;  3L4F A;  2KXP B;  1ZNV A;  1PGO A;  3BCC D;  3RK2 B;  1NKZ B;  4XFZ A;  4HKZ H;  2E74 D;  2VLP A;  1YQ3 C;  2RKL A;  3DS3 A;  5AW3 B;  2PNG A;  1PPJ E;  1BCC D;  3CXC O;  3PTZ A;  3M0D C;  2M8P A;  1KYO D;  1FU1 A;  3H1K J;  2LF4 A;  2N5H A;  5BU5 A;  1VKU A;  2EIA A;  5AW8 B;  1A8O A;  3L70 D;  2YMY A;  2M5R A;  2JR8 A;  1SQX E;  1L0L K;  2X2B A;  5H2F H;  1QEX A;  2IYP A;  4GR2 A;  1NTK J;  3AE2 C;  1SS1 A;  3WBH A;  1X9V A;  2L6E A;  3CC2 P;  3V2R A;  1XTC C;  3VP8 A;  2FFD C;  5GTI E;  3RGU A;  3BAS A;  1X79 B;  4WB4 A;  2KS1 B;  3GKL C;  2FXM A;  1FZC A;  1N73 B;  2FYU K;  2YXQ B;  3FWL A;  5EW5 E;  2CPS A;  3DS0 A;  4QNB A;  2BHV A;  1ZP0 C;  5HGM A;  3G28 A;  1FC2 C;  2GUV A;  2WSC J;  4LC1 A;  5CJ4 A;  4QMA A;  1LT9 B;  4JYB A;  3CWB J;  1HWT C;  1AJY A;  4H0L B;  3WUU A;  2Q1K A;  1JNM A;  5APV A;  4LGD E;  2OYI B;  3MHV A;  3CCU P;  2AXC A;  2L91 A;  1EMV A;  2IFN A;  2VLO A;  1JO5 A;  1GL2 C;  2HOD B;  3L71 G;  1NTM E;  1E5W A;  2YKO A;  1NU1 E;  3Q5R A;  3AE1 C;  5KP6 B;  1OWA A;  4OVN F;  1DD3 A;  1YJ9 P;  2OTK E;  1JUN A;  3CXH E;  1GMJ A;  2PP6 A;  4COC A;  3RG6 C;  3ZDM A;  2FAC A;  1NTZ K;  4U3F J;  1U7J A;  3JCU H;  1FOS F;  2O01 H;  1N7S C;  3H1L D;  3HD7 D;  1M1J C;  3MIW A;  4HYT B;  1IFM A;  1RE4 C;  4H2X C;  3SWK A;  2WPQ A;  3H1I D;  1M1J A;  3NXS A;  1EDI A;  3G3Z A;  3WUV A;  4GT1 A;  1BE3 E;  1ZXG A;  2K0X A;  1JMB A;  2IX7 C;  1D1D A;  3PRJ A;  1SQV D;  1KIL C;  3I55 P;  2WSS H;  3B5N C;  1SFC A;  1QX8 A;  3P7K A;  1UJZ A;  1MV8 A;  4L76 A;  1MKM A;  3A7O A;  3H1J D;  3BAT A;  2IBZ I;  2D2C C;  3H1L E;  2Z45 A;  2PGD A;  3IF4 A;  2R5D A;  3NFQ A;  5CHX A;  5AW4 B;  2V4H A;  4IFD K;  2JEE A;  3CWB G;  3H4E A;  2QM7 A;  1JY3 N;  2FXO A;  2O01 J;  4KHX A;  1KV4 A;  3OJA B;  4U0B A;  1LTJ A;  3KZI E;  2E74 C;  2Y9Z A;  1LT9 A;  1LTT C;  1VQO P;  2W27 A;  2M8L A;  1LTJ C;  3WUT A;  1G2C B;  2GZE A;  5CCH D;  1KIL D;  2KUB A;  4PWV B;  1VQL P;  1JY3 O;  5AVX B;  4RKU J;  2VSQ A;  5AVR B;  2V7Q H;  2BCC G;  2MF4 A;  5B5E H;  3O6Q A;  4RJT A;  2K37 A;  2NO8 A;  2WSF H;  3MD0 A;  1SQQ E;  2UWJ E;  1FZB A;  2OYI A;  2WSE J;  1ZV8 A;  2QRX A;  2JWD A;  4OH8 B;  2FBW C;  2WSC H;  1AUM A;  2N6Z A;  2Y0E A;  1SQB J;  1GXH A;  4AYC A;  5CCG D;  3L73 J;  4OWF A;  1BSN A;  2JB0 A;  2LR2 A;  4D6T J;  1NAY A;  1LTJ B;  3FXD A;  4L74 A;  1IK7 A;  3L35 A;  1NKN A;  2FYU E;  3CX5 D;  3H1J G;  4IFF A;  1W5C E;  1BDD A;  3EJE A;  3CL3 D;  3HUS A;  2YNY A;  3L72 J;  2QM8 A;  3HE5 A;  1JY2 P;  1ZR4 A;  3P8C D;  2KP8 A;  1S9K E;  2KOP A;  1KLP A;  3GHG B;  3H32 A;  4U0F A;  2H43 A;  2KOG A;  3CC7 P;  3H1H G;  1AVY A;  3D71 A;  1M1J B;  4PD4 E;  2P58 A;  2Q5U A;  4PV1 B;  3L72 E;  2WPT A;  2D2C D;  3HTK A;  1RO2 A;  2O1J A;  5K5G B;  1PL5 A;  3MTU E;  2P9X A;  3B5N D;  2FXP A;  1R5S A;  2KYV A;  1HUC A;  3M9Q A;  2QJK B;  3S4R A;  3P8C E;  3H47 A;  1EZV I;  4BRY A;  2N98 A;  1QRJ A;  1UIX A;  4WY4 A;  3G71 P;  1VQ6 P;  4C7N B;  1N7S B;  2PRR A;  2EG5 A;  2PEI A;  1RQV A;  4IL6 X;  2ZVO B;  2QG4 A;  1NU1 G;  2ZXX A;  1N7S D;  1TU3 F;  3HD7 C;  3TF5 A;  4R4M A;  1H88 A;  5F2N A;  2ZT9 B;  4JYC A;  1NTM J;  2KLV A;  2FYU J;  1VQK P;  1E79 H;  2JDI H;  1QGK B;  5B66 E;  2KGA A;  2KG9 A;  1VL2 A;  4XRQ A;  3LIE A;  5KJ7 C;  4BPH A;  1FDM A;  3AEE C;  2QE7 H;  1EZV D;  1M57 D;  2WTY A;  5E79 H;  4UB6 H;  4IL6 H;  1M74 A;  1EOQ A;  1JB0 J;  3L71 J;  3O6Q B;  1F80 D;  1KTM A;  3H6P A;  1CSB A;  5KLV G;  5TJH A;  2GUS A;  2Z5I A;  2Z46 A;  2CWO A;  2KIK A;  1BGY J;  2HR3 A;  1FZF A;  4H2W C;  1J1E C;  7CEI A;  3V2P A;  1GXG A;  2KR5 A;  1YBK A;  1L0I A;  3L75 E;  3L71 E;  3HRN A;  2N9Y B;  3H1K D;  1KOR A;  1L4A A;  1KIL A;  2CQ8 A;  2N1T A;  4PH1 A;  3L70 J;  5EFW B;  2JKV A;  4EI2 A;  3BRT B;  3Q5S A;  1PGJ A;  3WU2 E;  1YI2 P;  2EHS A;  3M06 A;  1JJ2 O;  5CZD B;  3GHG A;  1L0N E;  1JTH B;  2OQQ A;  1NTZ D;  3AE7 C;  2IZ1 A;  3L75 D;  1K8A Q;  1LNQ A;  1AYI A;  3HE5 B;  3RK3 E;  3MUD C;  4RO0 A;  2K0Y A;  2OYH C;  1NTK E;  1KQS O;  2IYO A;  1PEQ A;  3VMZ A;  3RK3 B;  2JAZ A;  4OGQ C;  3ABV C;  2MR7 A;  1LJ2 A;  2IPP A;  5KLI C;  1PZQ A;  2GM4 A;  1E6J P;  1RHZ B;  4DCK A;  4I1L A;  1GZL A;  3VMA A;  1SQB E;  1VQ9 P;  1EC5 A;  4PJ0 H;  3L70 E;  2Y0D A;  1HGZ A;  1GW3 A;  2CG5 B;  5KAF E;  1T8Z A;  4KJM A;  5AVT B;  1SQP K;  2P67 A;  1VDF A;  3H1K G;  2JU1 A;  2E74 B;  3ITK A;  1S9K D;  2ZT9 C;  1PPJ G;  2M8N A;  3GF3 A;  1KQG B;  1SQP D;  1ZOY C;  2KNC A;  1IMP A;  1ZME C;  2AEF A;  1RF1 B;  5CJ0 A;  2EHT A;  1SQV J;  1FDO A;  3QWO C;  1RE3 C;  2ZYG A;  4NPF X;  4W80 A;  2FQ2 A;  5CCG A;  3USS A;  3SFD C;  1N8R Q;  1CW5 A;  1L4A B;  3UIA A;  1USD A;  4U3F E;  3VOP A;  1KB9 E;  4BPG A;  1OX3 A;  1DH3 A;  1CEI A;  3DPH A;  2WIT A;  2W6A A;  1RE4 A;  2PEQ A;  3NMD A;  1H0T A;  3CWB E;  5AVY B;  1IFN A;  1KB9 H;  4CA3 A;  1XTG B;  3PHL A;  3VRL C;  3DS4 A;  1BE3 J;  3HUS B;  1P84 D;  3CCV P;  1HJ0 A;  2KK7 A;  1PP9 G;  2IBZ D;  1JY2 N;  3RG2 A;  2KGC A;  3HYB A;  1P84 H;  2KSJ A;  3CC4 P;  4EDF A;  2CPB A;  1NYH A;  5APY A;  1NU1 J;  3CCM P;  2KNC B;  4O9B A;  1SQQ D;  2YIU C;  1OR5 A;  3Q20 A;  2L0Q A;  3LMO A;  3MGE A;  2R44 A;  5KP7 B;  3MZW B;  2YXR B;  1LWU A;  3G1I A;  2E5Y A;  5L8R J;  1EZV E;  1SQQ G;  2N1T D;  3VMY A;  2B87 B;  2N9B A;  5KLV J;  3BCC E;  2NPS D;  1VF5 B;  1LT9 C;  2NZ2 A;  2C0X A;  1K04 A;  1LT1 A;  1RH5 B;  4H0L C;  3EJD A;  1BCC G;  1URQ A;  1T2K C;  3M9B A;  2LPK A;  1S5L X;  4D6T D;  1LTI C;  1SQB K;  3GJN A;  2KOS A;  2AVA A;  1BGY E;  1RO0 A;  3I56 P;  1QLE D;  4I2L C;  1SQX D;  3V2Q A;  1M56 D;  1IFI A;  5I4T G;  1HH0 A;  2BEQ D;  2K0D X;  1NQ4 A;  2ZJS E;  2Z5H A;  3L72 D;  1JM0 A;  3GF7 A;  4C46 A;  5KLI B;  1UNK A;  1X22 A;  1L0N G;  2KSE A;  1L0L D;  2LOL A;  3L72 G;  4PV1 C;  5AVS B;  1EIA A;  3L73 G;  2WVR A;  1N7S A;  2FVF A;  1SFC B;  5JPA A;  2QA4 P;  1RY3 A;  3V4W A;  1YIT P;  2XXM A;  4U0E A;  4PH0 A;  3IR9 A;  4KT0 J;  5B66 H;  3TK1 A;  1U57 A;  1DV5 A;  5KAI H;  1RNI A;  3CCL P;  3U1A A;  2KZI A;  1OVR A;  3H32 B;  1BAJ A;  1PIX A;  4I7Z B;  2H8P D;  2JP3 A;  2L4B A;  3HE4 A;  3EFF K;  2P10 A;  1S5L E;  1M7L A;  2DGY A;  4AQR D;  5AVW B;  4B86 A;  2GA1 A;  4CPG A;  3G29 A;  1KQF B;  2MY5 A;  1AA0 A;  2KB7 P;  4W7Y A;  1MUU A;  5APW A;  3RL0 D;  3R4Y A;  3VMX A;  2Z44 A;  4H13 C;  3H1L G;  3AE8 C;  3EQ2 A;  3PLN A;  4H13 D;  5KAI E;  2XNX A;  1EDL A;  2E43 A;  3RL0 C;  2DNW A;  3MP7 B;  3MGN A;  1JOC A;  2GDY A;  3CMA P;  2JBG A;  2PEN A;  1LWU C;  2K92 A;  2P1J A;  2A06 E;  3PH0 A;  2G8Y A;  4DZO A;  3CCS P;  3KDP B;  1KYO E;  2ZXE B;  1FZE A;  1YYC A;  2O3J A;  5KLV E;  3L71 D;  1GL2 B;  3R2P A;  2AFE A;  4M3L A;  3SWF A;  3L36 A;  4WBA A;  3KHU A;  3P05 A;  2GZJ A;  1SQV E;  3M1M A;  1PGP A;  1CI6 A;  3A0B H;  3LW5 H;  4RES B;  2JQ4 A;  2I8D A;  4N6J A;  4Y28 J;  1FZC B;  5KJ7 A;  3CWB D;  1H0T B;  1HQB A;  3G21 A;  1KYO H;  5KKZ B;  3LRY A;  5HGL A;  3TGU D;  3O8Z A;  4PV1 D;  1A02 F;  3L74 E;  3VP9 A;  1NVO A;  3KYQ A;  2AEJ A;  2D2C B;  1YHQ P;  3CCQ P;  2Y0C A;  4ASW A;  2K9Y A;  1IFD A;  2DW3 A;  3GW6 A;  1IK9 A;  3FX0 A;  4IZ6 A;  2OYO A;  4YXD C;  3P32 A;  3A3Y B;  4N3Y B;  1MFT A;  1S72 P;  2ZAE B;  1GW4 A;  2XT1 A;  2K9J A;  2QNW A;  3L74 G;  1AF8 A;  2JGP A;  1UII A;  1M90 Q;  5KJ7 D;  2B89 A;  3CXH D;  3H1I J;  1X3O A;  2A45 H;  2BQ1 E;  1GPJ A;  4MN4 C;  4ASV A;  5KKZ C;  1LP1 B;  1GL2 A;  3BRV B;  3D70 A;  2LXB A;  2FQ1 A;  4PD4 I;  1PGQ A;  3FWN A;  2A45 I;  2GZG A;  4M0I A;  3TSI A;  2K3R A;  3V5B A;  1OW6 A;  1SP4 A;  3A2A A;  3H1I E;  1SQQ K;  1S2E A;  3VN0 A;  2C0W A;  1BGY G;  1L0H A;  2LTE A;  1GK4 A;  1URQ B;  3I5C A;  3A0H H;  3G4S P;  1M8O B;  2SPZ A;  2IBZ G;  1USE A;  1WMK A;  4HH2 A;  1URQ D;  3FGA D;  3G1G A;  4COP A;  1NU1 K;  4H44 D;  2WPV B;  5AW9 B;  5AVQ B;  5APQ A;  4OGQ D;  3H1H D;  1CI6 B;  1NH4 A;  4WVZ A;  4EIJ A;  2XU6 A;  2NPS A;  2OTL P;  2JO1 A;  1SQP J;  2YIU B;  1FAV A;  2W6J H;  1ZRT D;  4IPY A;  1L0N J;  3RK3 D;  1YJW P;  3RBX A;  1HTL C;  2KG8 A;  3CCJ P;  4XFX A;  5DJU B;  2OYH B;  2IBZ E;  1R5L A;  4U7J A;  1T3J A;  2K88 A;  2B88 A;  3U1C A;  3VYI A;  3HZQ A;  1Q90 D;  1LGH B;  1MFZ A;  1ZRT E;  5AVZ B;  1PEM A;  1FE6 A;  1G1J A;  2PEM A;  3JC2 2;  1WRG A;  3B71 A;  3L74 J;  4C7R A;  2B87 A;  3CLQ A;  2M3E A;  2K9J B;  1VQ7 P;  5CCG C;  5APS A;  1JTH A;  5BS2 A;  3CD6 P;  3KQG A;  3H25 A;  1VQ8 P;  1SFC D;  1Q7Y Q;  4IOI H;  3SSU A;  2YMK A;  2N6Y A;  2OGU A;  5CMZ A;  1HVV A;  3B5N B;  2BAS A;  1RF1 A;  2KWL A;  1PP9 D;  1FS0 E;  1J1E B;  1S1C X;  3OA7 A;  2A06 D;  4H2Y C;  4UB8 H;  4A7P A;  1IMQ A;  1M1K Q;  2M5A B;  3AE9 C;  1LTB C;  5HVC A;  1T3U A;  1KIL B;  1A43 A;  2K1A A;  1SLQ A;  1IFJ A;  2J5U A;  3U43 A;  2CNR A;  4IL6 E;  3L70 G;  3AEA C;  4XFJ A;  1FZA A;  1GDT A;  2ROQ A;  2FAE A;  1VQM P;  3DS1 A;  1GTW A;  1OFC X;  3CPW O;  5DCK A;  4WY4 C;  4D6T G;  5BU8 B;  2Q3E A;  1KMI Z;  1LTG C;  4PXH B;  1RE3 A;  3IN6 A;  4OGQ B;  3TGU E;  1L0L E;  1YTZ I;  4GR6 A;  3E2D A;  5AW2 B;  5HV8 A;  3BCC J;  2KGE A;  1M6E X;  2B9B A;  2WT7 B;  3RK3 C;  2LL8 A;  4I6M C;  1Y8A A;  3A0B E;  5C39 A;  5KAF H;  1AVO A;  3L75 G;  4DJG A;  3EFG A;  2MD9 A;  1H89 A;  1URQ C;  1L0L J;  4BPF A;  1S4X A;  2A06 G;  2OTJ P;  1SQB G;  3Q3D A;  1AV1 A;  1JEK A;  2ZYD A;  1GU5 A;  3CCR P;  2H7H A;  5AW6 B;  1IC2 A;  1NTK D;  5GTH H;  3M9H A;  5APX A;  2LIU A;  4XFY A;  1FZG A;  3NTE A;  1Y9B A;  3H0D A;  1RF0 C;  1D7M A;  2GZI A;  2XKM A;  3CE7 A;  2L5G B;  1SQV K;  2KGD A;  4GOF A;  2H88 C;  1KFM A;  1W2E A;  2PEO A;  3DS5 A;  2J59 M;  2W83 C;  4U0C A;  1JCC A;  1QVF O;  1SVF A;  1BGY D;  1FBM A;  1YQ4 C;  1HBW A;  2WZ7 A;  3CCE P;  1YIJ P;  1G1I A;  2POH A;  1KQL A;  2Q3I A;  2PAJ A;  3G0V A;  3C1L A;  3GHG C;  1VQN P;  3D6Z A;  4F37 A;  3H1H E;  2JJL A;  2FY8 A;  1VQP P;  1DEE G;  1AQ5 A;  1JMM A;  3OW2 O;  1YTZ T;  2FKW B;  2PEJ A;  1LTS C;  1CZQ A;  3E7K A;  1T8K A;  3A0H E;  1BXI A;  4NEO A;  2XND H;  1SQP E;  5BVZ A;  3L75 J;  1DEB A;  2LML A;  2EFJ A;  1ZLL A;  3SFE C;  4U3F D;  2GYK A;  2ZVN B;  2MVU A;  2QIW A;  3GZL A;  2GDX A;  1N73 A;  2FYU G;  2E76 D;  1EZV G;  2IDB A;  1NO4 A;  2AF8 A;  3F5H A;  4PD4 D;  4WY4 B;  1SQP G; 
#chains in the Genus database with same CATH homology
 4XFY A;  2PEN A;  1Q7Y Q;  3NTE A;  1JJ2 O;  1RO0 A;  3I56 P;  3CCS P;  3H47 A;  3H0D A;  1N8R Q;  1QRJ A;  4M0I A;  1Q81 Q;  1W2B O;  1VQ5 P;  1M6N A;  5I4T G;  2QEX P;  1VQL P;  3G71 P;  1VQ6 P;  3DPH A;  4XFZ A;  1YJ9 P;  2EG5 A;  2PEI A;  1M1K Q;  2PEO A;  1QVG O;  1YJN P;  3P05 A;  1K8A Q;  2KOD A;  1K30 A;  4COC A;  3DS5 A;  2PEQ A;  1A43 A;  3RG6 C;  3M1M A;  4U0C A;  3DS3 A;  1QVF O;  3G4S P;  3G6E P;  3VRL C;  3DS4 A;  5HGO A;  1K9M Q;  5F2N A;  3CXC O;  1KD1 Q;  1EIA A;  3CCV P;  2JO0 A;  3G1G A;  1VQM P;  1KQS O;  2M8P A;  4COP A;  3DS1 A;  1AUM A;  3CCE P;  1PEQ A;  2LF4 A;  3G21 A;  1YIJ P;  1VQK P;  3B5I A;  5JPA A;  2QA4 P;  2EIA A;  1A8O A;  3HYB A;  1ZMB A;  3CPW O;  2BUO A;  3LRY A;  3CC4 P;  1Q82 Q;  2OTL P;  1YIT P;  4U0A A;  3G0V A;  5HGL A;  5DCK A;  1VQN P;  4GR2 A;  4XRQ A;  2E1M A;  4IPY A;  3WBH A;  1D1D A;  2XXM A;  2L6E A;  3CC2 P;  2JYG A;  4U0E A;  3CCM P;  1PEO A;  4PH0 A;  2XV6 A;  3I55 P;  1YJW P;  2JYL A;  1E6J P;  3Q20 A;  1VQP P;  3CCQ P;  4GR6 A;  1YHQ P;  3E2D A;  3MGE A;  3OW2 O;  1M6E X;  1RNI A;  3CCJ P;  4XFX A;  3CCL P;  4U0D A;  1M74 A;  1EOQ A;  3G1I A;  1NJI Q;  1VQ9 P;  2PEJ A;  1PEU A;  1BAJ A;  2Z45 A;  5F2K A;  3G26 A;  2ONT A;  2DGY A;  3HZQ A;  2EFJ A;  3DS0 A;  4QNB A;  4WYM A;  1IUQ A;  2BHV A;  4U0F A;  2Z46 A;  1S72 P;  2CWO A;  5HGM A;  3G28 A;  1KC8 Q;  2XT1 A;  3G29 A;  3CC7 P;  2OTJ P;  2OAR A;  3H4E A;  1Q86 Q;  1M90 Q;  1PEM A;  2PEM A;  1VQ4 P;  2Z44 A;  4U0B A;  3CME P;  5BS1 A;  4PH1 A;  3CCR P;  5HGN A;  4XRO A;  1RO2 A;  2M8N A;  2PY8 A;  2PEK A;  1VQ7 P;  2BQ1 E;  5BS2 A;  1K73 Q;  3CD6 P;  3CCU P;  1VQO P;  3DS2 A;  5F2O A;  3DTJ A;  2P9X A;  2M8L A;  1YI2 P;  3CMA P;  1VQ8 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...