1VQ6P

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq6P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq6P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq6P02
2QA4P 3G4SP 1VQMP 3CCRP 1M90Q 1YIJP 1YITP 1YJWP 1YJNP 2OTJP 1VQLP 1QVGO 1Q7YQ 3CC2P 1S72P 3CMEP 2OTLP 3CCQP 3OW2O 1KQSO 1YI2P 3CCLP 1YJ9P 1VQ6P 3CCUP 1W2BO 1VQ9P 3CCEP 3CCSP 1VQNP 1Q86Q 1VQ8P 3CC7P 3G71P 1JJ2O 1KD1Q 1YHQP 3CCJP 3CCMP 1KC8Q 3I56P 3CPWO 1Q81Q 1QVFO 3CCVP 1VQPP 1K8AQ 1Q82Q 1K9MQ 1M1KQ 1K73Q 2QEXP 3CMAP 1VQ5P 3CC4P 3CD6P 3G6EP 3CXCO 1VQKP 1N8RQ 1VQOP 1VQ7P 1VQ4P 1NJIQ 3I55P
chains in the Genus database with same CATH superfamily
3B5NB 1KILA 1DH3A 1KILB 3CCQP 1NGMB 2FYNC 3CXHD 3Q5SA 5CMZA 2OGUA 1JTHA 2C9LY 2PEMA 3AEFC 2K92A 3RBXA 1JTHB 1RQUA 2E74B 1NAYA 2N1TA 3BCCE 4KJMA 2N1TB 1YTZT 1PGOA 1N8RQ 1SQVK 1KLPA 5AW0B 1SQBJ 3FGAD 2K9JA 2LXCB 2LKMA 2H89C 2K9JB 1AJYA 5EJDA 3A0HH 3HZQA 3GG2A 3CWBE 4WWIA 2D2CD 1MZ8A 1T8KA 2A45I 2MVUA 4BPGA 1GZLA 5KAFE 1M1JA 3H1IE 3OW2O 1M1JB 1NKZB 1GU5A 2FFDA 5B66E 1VQ8P 2FFDB 1NTKJ 4K3AA 1YQ4C 3D6ZA 1VQ5P 5HGOA 1NU1K 5APWA 4H2XC 1IC2A 2JU2A 3AEGC 2OYHA 1ZP0C 3SFEC 2OYHB 1USEA 1L0LJ 2AFDA 3P8CD 4DJGA 3FXDA 5KKZB 3L70J 3H1KJ 1L0NJ 3AE4C 2Y0DA 1URQB 3L73G 3LMOA 1WRGA 1GK4A 4TLFA 3G21A 4Y28J 4N78D 4MN4C 2CG5B 3V2PA 4OGQD 1LTIC 3KYQA 3G1GA 2L4BA 3VP9A 3F5HA 3H1JJ 1Q82Q 4R4MA 4U0DA 1W5CE 1VQ4P 1LT9A 1ZRTD 1FDIA 1LT9B 4BPFA 1NVOA 1FBMA 1CEIA 2EFJA 4EIJA 1X22A 3L71J 3P8CE 1L4AC 2XNXA 1R8EA 2FYNB 2JEEA 5KLIC 3MTUE 2QNWA 2XXMA 2W6BA 4N78E 3TGUE 5KLVJ 1YTZI 1VQMP 1H88A 2B9BA 2G8YA 2K3RA 1UJZA 5DJUB 2ZVOB 2FXMA 2AFEA 1N2DC 1DX7A 2HLOA 1DEEG 3G9RA 1M6NA 3PH0A 1CI6A 1CI6B 1NHLA 4U7JA 3SWFA 2VLQA 1BE3J 3V4QA 1S5LX 2MKVA 2OTJP 1HWTC 1BGYE 4IFDK 5KJ7C 1M56D 1QL1A 1HBWA 1X9VA 3CCUP 3B71A 3CWBG 2QM7A 1KB9H 2N50A 3M91A 4XE5B 1VQKP 4L76A 3N4XA 2QA4P 2KGDA 1HUCA 2MVVA 1JB0J 1RO0A 3NXSA 2FQ0A 1WT6A 3AEEC 4HKZH 3CC2P 2MF4A 3H1IG 1IUQA 1EQ7A 2FQ1A 4UHPB 2IBZD 4WY4C 2IFMA 5E79H 3H32B 3V2RA 2IBZI 4PD4D 3HD7D 2POHA 4ZMDA 2Z5IA 3EJBA 1Y9BA 1JCCA 1P84H 1L0LK 1NTZK 2FBWC 4PD4I 4L74A 4YPCA 1J2JB 2JAZA 1KC8Q 3L72E 2Y9YA 1SQPG 3G4SP 4W80A 4H0LD 2KK7A 2XDJA 2GUSA 3KZIE 1QLED 2QE7H 2QVAA 3OA7A 4HYTB 2IBZE 1G1IA 2EHTA 3NFQA 4D6TD 1SQQJ 1KZUB 1L4AA 1T6AA 1L4AB 4PD4E 3CCVP 3L75J 3DPHA 3B5ND 2ROQA 1GXGA 4U0EA 2K88A 1Y8AA 1HH0A 2WSCH 1SFCA 5KLIB 1KILD 4Z1MH 4PJ0H 1UIXA 3H1HG 2YXRB 5BU8B 2FADA 2E74D 5H2FH 2N1TD 3CCSP 1AQTA 3OJAB 4NPDA 2E75C 4AYCA 1OX3A 2QJYC 2JO0A 1S3JA 3BCCJ 5HGNA 2KNCA 2KNCB 3L74D 4GODA 2ZYDA 4ZNCA 3TGUG 2M8LA 1EOQA 1SQVG 1GL2C 2WQYC 1OW6A 5AW2B 4BPHA 4W7YA 1VPCA 1AFOA 1KILE 1PPJE 1W2EA 5CHXA 1NWQA 3V2QA 3L36A 2GYKA 5AW4B 3H25A 2R5BA 3GHGA 5AVUB 1BGYG 2NRGA 1EDKA 3HE4A 2L91A 2YKOA 1USDA 3HE4B 4WY4B 1GTWA 2K0DX 3M06A 1NU1G 2O01H 3FWLA 4BWNA 1SVFA 2Y0CA 2M0BA 1AV1A 4H2YC 4AQRD 2WWWA 4DG9A 4L75A 2IYPA 3RK3C 2CPSA 1YYCA 1GD2E 1PEMA 1SQXE 1MKMA 1JOCA 4ASWA 4PV1C 3PLNA 1UNKA 2Q5UA 5GTHH 1E5WA 4RKUJ 1X79B 1OZHA 5APTA 2L9FA 3L72G 3ABVC 2QJPC 2N5HA 5TISH 2IDBA 3DS3A 3I55P 2GA1A 5CJ4A 2R32A 1VF5D 1LTTC 2DW3A 3VMAA 1IK9A 3LIEA 3B5IA 3V6IA 3EJEA 3CCLP 2FY8A 2GDYA 3CE7A 1OWAA 1IK7A 4C7NA 3AE2C 4A7PA 2KWLA 2L22A 4C7NB 4DCKA 3CMAP 2N9BA 1LT1A 2Y0EA 1KYOE 2QJYB 2BQ1E 1YIJP 1KTMA 3NY7B 4U0FA 2W90A 1FZBA 1PP9D 2AXTE 3L73D 1BCCE 1NO4A 3V5BA 4GIFA 1QVFO 2K1AA 4AUWA 3VTPC 3NTEA 1K04A 4LC1A 3AE5C 3GF7A 2Q3IA 4NPFX 1PFIA 1AF8A 5GTIE 1AUMA 3RGUA 5BS2A 2GZJA 2JWAA 1LGHB 3C8VA 1PGJA 2BCCG 4YXWH 2R3CA 1JJ2O 2FYUK 1FOSE 3KHUA 1IFDA 5KAFH 2HPCB 4L73A 1PPJG 4KHXA 1RE4C 1GDTA 1ZLLA 4WYMA 3TF5A 1MFZA 3A2AA 1PP9E 3L73E 3QH9A 5B66H 1AYIA 5CCGC 4IOIH 2P58A 3RK2C 3QWOC 1EDLA 3H1LE 2KR5A 1EDJA 1RE3C 2RMZA 4IZ6A 2CK3H 5GTHE 4WB4A 3RK3B 2ZAEB 1M90Q 3VOPA 1H8AA 1YJWP 1ZV8A 2YNYA 4PV1B 1FZFA 1OR5A 2JBGA 2WITA 4QKOA 1KORA 3DS0A 1NTZG 2WMMA 4TT3H 2M8NA 2WSFJ 1VHNA 2K9YA 3CWBD 1H89A 1X8YA 3NMDA 1SQXG 2JU1A 2I1KA 4EYYQ 1R5LA 2QJKC 5APYA 2OYIC 1VKUA 4GOFA 2QJPB 3EFFK 1HY8A 2IZ0A 4H13C 3R4YA 1L4AD 4C7RA 4IL6E 5HGMA 1W2BO 4JF7A 2H43A 1KQLA 3CPWO 1SFCD 2G3AA 3H1ID 4F37A 3E7KA 2JO1A 1S2EA 2YMYA 1KV4A 3Q3DA 1Q2NA 1S1CX 4PXHB 3M0AA 1YHQP 1SLQA 2E1MA 2JB0A 3BRTB 3CX5H 4R0MA 3M9QA 5BVZA 3VN0A 1OVUA 2W27A 5AVSB 1ZMBA 2AVAA 5CJ0A 4W7ZA 1EXIA 1G1JA 3HYBA 1ZOYC 1BSHA 1QVGO 1SQPD 2ZYAA 3GZLA 4D6TJ 2V7QJ 4JYCA 5APVA 3V4WA 2GM4A 2B88A 1BCCG 4GR2A 1RF0A 3Q5RA 1VDFA 3S9OA 3LW5H 1VQOP 1HJBA 1BDCA 1D1DA 3USSA 1RE4A 2O01N 3U59A 4UB8E 2J59M 3BVHA 3MUDC 2FVAA 1NTME 3U1CA 3H1HD 3WBHA 4M3LA 5CCGA 4COCA 2QSIA 1JM0A 2FACA 3L74J 3RK2B 2E76B 5F2OA 1SQPE 5DCKA 1OXZA 3CX5D 1URQA 1E6JP 2MR8A 1PP9G 2E43A 3TGUD 3M9BA 1SQVD 3CX5I 2KUBA 3CC7P 1Q81Q 1Q90D 3H1LG 2FKWB 2QEXP 3E2DA 2WPTA 1QEXA 2VLNA 1SQXJ 2LIWA 4CA3A 2Q7CA 1PEQA 3VRLC 3H1HE 2WSFH 1PGPA 3S1KA 2ZFCA 2QJKB 4H44C 2WSCJ 2LTEA 4H2WC 1BGYD 1M57D 2YIUC 1EDIA 2A06G 4H13B 1JNMA 4R4LA 3KZIH 1NQ4A 3CX5E 4U0CA 1Y47A 5AVYB 2PEOA 2WSEJ 1PGQA 2KGAA 1JUNA 2M8RA 1SQVE 4PD4H 3L37A 2K37A 3WU2E 1NU1D 2XV6A 1PZQA 2YMKA 1VQ9P 2HG5D 1FJKA 2P67A 2KZJA 1HQBA 7CEIA 4QMAA 5JPAA 1SQBK 1UIIA 3BATA 3GMAA 4CPGA 1K73Q 2H88C 1L0HA 1E0HA 1CW5A 4U3FE 4UB6E 1IFJA 3G26A 3GZMA 1HGZA 2KOSA 2D2CC 3MD0A 2N98A 2V7QH 3AE8C 4NEOA 1OW8A 1X0TA 2KZIA 1RQVA 3L72D 3SFDC 1NU1E 2W83C 2WPVB 1U57A 2OQQA 1NTKK 5KP8B 3MUDA 1VL2A 1G2CA 1G2CB 3L35A 3RBZA 1FZEA 3H32A 5AVQB 1HTLC 2FYUG 1DIPA 1T2KD 2O01J 2EHSA 2MD9A 3OAKA 2C0XA 1PP9J 2R3SA 3L73J 2KG6A 2KSEA 1IFNA 1ZXGA 2CPBA 1D7MA 1NTMG 2KSJA 3Q2YA 1MFTA 3W67A 3CCEP 2KIKA 3PP5A 3KQGA 4HH2A 5CCHC 2DGYA 1L0NK 2KOGA 2L5GB 2YKQA 1DD3A 3IAOA 2P10A 4PV1D 1A02F 1OVRA 1EIAA 4GDOA 3ZDMA 4QNBA 4IPYA 1H0TA 2NPSC 1H0TB 1KQFB 2KYVA 1Q86Q 3IFMA 4H44B 2XU6A 2BCCD 2YIUB 3HE5A 3HE5B 1QX8A 1FZGA 1PPJD 3KXDA 2GZFA 1K05A 2KW2A 2KOOA 1N7LA 2WSEH 4XA4A 3RK3E 5BS1A 3JCUE 2LIUA 2IZ1A 4JBZA 3B4QA 1QL2A 3P05A 1YQ3C 2QRXA 1GU4A 5KLVK 2KGEA 2ZXEB 3P7KA 1GXHA 3AEDC 4N3YB 4XFXA 3HUSC 1PL5A 2BCCE 1KYOH 5HGLA 1FZAA 5KJ7A 2E42A 3CWBJ 3FX0A 4JQ0D 2KG9A 2J5UA 2PGDA 1NTZD 2AXTH 2Z4EA 3RL0C 2KI7B 2Q9IA 4PH1A 3GLMA 3DTJA 1SQXD 4U3FG 1CSBA 3FXEA 4I6MC 3H1IJ 1NTKE 3G71P 1M6EX 1KD1Q 5GTIH 2YO2A 5K5GB 4WY4A 1LTJC 2K94A 4XFZA 1EC5A 2K2QA 2IPPA 5KP7B 2WPRA 1VQLP 5F2NA 1N7SC 5CCGD 3GW6A 2HR3A 1JEKA 1LJ2A 3RK2D 3GF3A 1L0LE 1NTZE 4OVNF 2KOPA 2E76D 1OIPA 2O1KA 3G3ZA 5APUA 1DNYA 3H4EA 3SWKA 1Z56A 2FHSC 1XTCC 1URQD 3H1KE 3L70E 5CCHA 1PIXA 3LRYA 1SQPJ 1JMMA 2KODA 2M5AA 2M5AB 3AEAC 2IFNA 5BU5A 1KYOD 3O6QA 1NOHA 4XRQA 3O6QB 5EW5E 4PWVB 4YTPC 1MUUA 2NPSA 1FJPA 1BCCD 1KYOI 2NPSB 2ITAA 1HGVA 2BASA 2R5DA 1FZCC 3VMYA 1LTSC 1J1DC 4KT0J 1FS0E 4H0LC 2MR7A 2XV5A 1JY2O 3H1HJ 1SQQK 1FDMA 1RHZB 4H13D 1KFMA 2Q1KA 2PAJA 2KOQA 1NAFA 2XNDH 4Y99C 1RY3A 4LLHA 2RH0A 3MHVA 2JP3A 2ZYGA 1VQPP 3B5NC 5B5EE 1K9MQ 2O3JA 1BAJA 1E79H 1KMIZ 5AW7B 5KAIE 4IL6H 1NJIQ 1ZR4A 2E75B 2N6YA 2LMLA 3TGUJ 1L0IA 4IFFA 1SQVJ 4WVZA 3DS5A 1GL2A 3HUSA 2N1TC 1GL2B 3HUSB 2GUVA 3G0VA 2JGPA 1Z6MA 4EOTA 1MV8A 4EI2A 2J58A 3H1LD 1DV5A 1SQBG 1R5SA 2RN0A 2PNGA 3RL0B 5DJTB 5HVCA 1BGYJ 3LW5J 2ZVNB 1K30A 3EJDA 3TK1A 4XROA 2Z5HA 2HPCA 1T3UA 4YXDC 1N73C 2A06D 4N6JA 1LTJA 1A02J 1LTJB 1NKNA 2KB7P 5CZDB 1NU1J 2Z45A 2M8PA 5AVTB 1JO5A 1N7SA 1N7SB 2ZJSE 4PH0A 1X3OA 3CCJP 1NTKG 4UB8H 5AW6B 3CC4P 3MP7B 3KPEA 1OMIA 2W8ZA 2NZ2A 3SWYA 2M5RA 1L0LG 2A06E 3WUTA 2KGCA 2JQ4A 1EXJA 2OARA 3L72J 1IFIA 1FOSF 3L70G 3H1KG 1L0NG 1IFMA 2Z44A 1FAVA 1FZCB 1IMPA 2ZXXA 1JY3O 2JYLA 4H44D 2WSSH 1DD4A 3L75E 2FYZA 3H1JG 2ERHA 4Y99B 4EDFA 2C9NY 3M0DC 3MZWB 2UWJE 2FYUD 2KP8A 1VF5C 3L71G 4XFYA 3B4SA 1KQSO 3RG2A 1IZNB 3TYYA 1NTMD 2FQ2A 2PEJA 2LKIA 2QIWA 3CXHI 3TNUA 3TNUB 3GKLC 3WU2H 5KLVG 1RO2A 2FXOA 1BXIA 1FE6A 2B89A 3DS2A 3O8ZA 5KJ7D 2LPKA 4U0BA 1S9KE 2PENA 3VMZA 2BCCJ 2XZRA 2N5IA 1LWUC 5AW9B 3WUUA 5AW8B 3T97A 2GZGA 2FYUE 3T97B 3MGNA 4UB6H 2WT7A 2BHVA 3CXHE 2WT7B 1BE3G 1N73A 2AXCA 3ITKA 3D71A 2LOLA 1N73B 2CGQA 2CWOA 5C39A 4OWFA 1KQGB 1U7MA 4WY4D 3HTKA 3CCMP 3HTKB 3U43A 1M1KQ 1HVVA 1QGKB 2QG4A 3G6EP 2KLUA 1S5LE 1M8OB 1RE3A 1KFNA 1N86A 1T3JA 4OH8B 1AA0A 2OTKE 3H0DA 3KDPB 1AQ5A 3CI9A 3G28A 4B86A 2VSQA 2GZEA 1NTZJ 2EIAA 1MZ9A 5CCHD 3I56P 4IL6X 3A0BE 1FC2C 3M1MA 1EZVG 2M3BA 3R2PA 1S4XA 3CCRP 4GT1A 1Q7YQ 2V4HA 3M9HA 1OFCX 2ZT9C 3C9IA 2OYIA 2AF8A 2YO3A 2OYIB 2NPSD 2YXQB 3RG6C 4U3FD 5AVZB 1IMQA 4I7ZC 1GW4A 3WMM0 2SPZA 2JR8A 2MY5A 4IFMA 1LTAC 3M0DA 3EFGA 5KTBA 2PP6A 1DEBA 2WZ7A 1VF5B 5KP6B 1SQQG 2MJZA 3VP8A 1SFCC 3L75G 2E75D 5AVVB 1L2PA 5I4TG 3A0HE 3JCUH 1WMKA 4O9BA 4U0AA 1M74A 1GL2D 4GR6A 1GMJA 2K5XA 2X2BA 3E1RA 2WVRA 1LP1A 2H7HA 1ZNVA 3N7NA 1XTGB 1LP1B 3A7OA 1BCCJ 3I5CA 2PRRA 5F2KA 1ZRTE 4RO0A 1OVVA 2LF4A 2GDXA 3BCCG 1LWUA 2JWDA 1LWUB 3G1IA 3RL0D 4MRTC 2JKVA 3IN6A 2HODA 2HODB 4NPEA 4K35A 4DOJA 3AE6C 1RH5B 1SS1A 3GHGC 4HKGA 2WTYA 1N7SD 2OTLP 1EMVA 2W6AA 1HJ0A 1YI2P 2I1JA 1KN7A 5EFWB 1U7JA 3RK3D 1J1EC 1JY2N 2M3EA 3H1LJ 4JPZB 3H6PA 2XT1A 1CZQA 2A45G 1BDDA 3AE9C 1ACPA 2XZ1C 4C46A 2RKLA 2FVFA 1SQBD 3PHLA 1IJDB 1VQ6P 3V2NA 1VQNP 4OGQC 1ZW0A 2ZT9B 2PFXA 3PJSK 5L8RJ 1SQXK 2L0QA 2LR2A 1SP4A 4I7ZB 2BEZF 2P9XA 4RESB 2XKMA 3Q1MA 3A3YB 2NO8A 1ZMEC 2JYGA 2JDIH 1KB9D 2XZ0D 3BRVB 4RJTA 4LGDE 1HF9A 4DZOA 1KB9I 1A43A 1NTKD 1SFCB 2CQ8A 1SQBE 3JSVC 3JC22 2P2UA 5B5EH 3CMEP 3TSIA 1RF1C 3RL0g 2R44A 2VLOA 1IFPA 2K0YA 5KAIH 2BUOA 4GKGA 3NTNA 4XFJA 5AW1B 3II6A 4COPA 5AVXB 1L0LD 2D2CB 2W6JH 1QRJA 4HJGH 1P84D 4BXLA 3CL3D 4D6TE 3L70D 1KB9E 1L0ND 3H1KD 5HV8A 1BSNA 4ZKUA 1P84I 4I2LC 2AEMA 2O1JA 3GJNA 1GPJA 2FYUJ 3CXCO 2IYOA 3H1JD 3C1LA 2IX7C 5E79E 5APQA 3P32A 3GHGB 5AW5B 1ZR2A 2WPSA 1NTMJ 3SSUA 3U1AA 3AE3C 2VRSA 3L74E 3L71D 1T8ZA 2HFED 1P84E 1ZN5A 1JY3N 1T2KC 1L0NE 3FWNA 1J1EB 3HD7C 2L6EA 3VMXA 2PEQA 5CBOA 1OW7A 5KLVD 3G29A 1JY2P 3PRJA 1PEOA 3EQ2A 3MIWA 2ONTA 3H1JE 3W68A 2PEIA 4OGQB 1AVYA 2WPQA 1A8OA 5AVRB 1M7LA 2HYNA 4GOEA 3MGEA 3L71E 4WBAA 3Q20A 1BE3D 2K93A 3HRNA 2KXPB 2P7JA 3LIDA 2E5TA 2DNWA 3H47A 3DS1A 4PJ0E 1GK6A 1LNQA 2KG8A 2E5YA 3K5BA 4JYBA 4M0IA 5M1BA 5H2FE 3AECC 5CBNA 5KLVE 1KILC 1IO4A 3L4FA 1RNIA 2IBZG 2E74C 2Q6QA 3S4RA 1RF1A 1JCDA 3WUVA 1RF1B 2N6ZA 2EG5A 2BEQD 2LXBA 3VYIA 3IR9A 2KORA 1NH4A 1NYHA 2B87A 5AVWB 1BE3E 1EZVD 2B87B 1FU1A 2Q3EA 3IF4A 3A5TA 1PEUA 1YBKA 2K0XA 3AE7C 4U3FJ 1EZVI 2C0WA 1LTGC 2AEJA 3D70A 1GW3A 2N9YB 1AVOA 5TJHA 2YKPA 4BRYA 2Z46A 2KLVA 4BRYB 3CD6P 3P8MC 5AW3B 2PEKA 3E1IA 3AEBC 1YITP 1M1JC 2VLPA 2JJLA 4D6TG 2FFDC 3PTZA 3F89A 4HB1A 1RF0C 2OYOA 3CXHH 1FDOA 3BASA 3CLQA 2PY8A 2FAEA 1EZVE 1K8AQ 1LTBC 3UIAA 1SQQD 3AE1C 3B8EB 2Y9ZA 2LL8A 4ASVA 1F80D 3L75D 3TDKA 3DS4A 1NTMK 2P1JA 3HD7A 2OYHC 1JY3P 3HD7B 3Q5PA 1S5LH 1TU3F 2A45H 1YJ9P 2E76C 5KKZC 3L74G 1SQPK 1URQC 2I8DA 2FVEA 1FR2A 4DT0A 5APSA 5APXA 3BCCD 4I1LA 2AEFA 1YJNP 1FZCA 3A0BH 3D6YA 1S72P 2ZT9D 1J1DB 3EWKA 2GDWA 4H0LB 2FXPA 5TISE 1JMBA 2GZIA 1SQQE 2CNRA 1PV3A 2QM8A 4ZKPA 1S9KD 2H8PD 1LT9C 2KS1A 1VQ7P 2KS1B 3B5NA
chains in the Genus database with same CATH topology
2QA4P 2XT1A 1RO2A 2KODA 1M90Q 2M8LA 1RO0A 1EOQA 1YJWP 2Z45A 3G21A 2M8PA 3DS2A 3CC2P 1PEUA 3CCQP 5BS1A 3B5IA 4U0BA 3CCLP 1IUQA 4XRQA 3I55P 2PENA 3G26A 3DS0A 3WBHA 1VQ6P 1VQNP 4COCA 2PEMA 4PH0A 3P05A 3G1GA 3CCJP 2M8NA 2Z46A 1Q82Q 1K73Q 4U0DA 3CMAP 3CC4P 5I4TG 3CD6P 1N8RQ 2PEKA 5F2OA 1VQ4P 5DCKA 2BHVA 2P9XA 2L6EA 1YIJP 1E6JP 1YITP 2BQ1E 4U0AA 1M74A 2PEQA 4U0FA 4GR6A 4XFXA 2EFJA 3G29A 2CWOA 3HZQA 2JYGA 1PEOA 5HGMA 5HGLA 1W2BO 3CC7P 2ONTA 5F2KA 2PY8A 3CCMP 1KC8Q 3CPWO 1Q81Q 1QVFO 1VQPP 2LF4A 1K8AQ 1M1KQ 2PEIA 1K9MQ 1BAJA 2QEXP 2OARA 3G6EP 3E2DA 3NTEA 2XXMA 1A43A 1A8OA 3G1IA 1NJIQ 1YHQP 3G4SP 1VQMP 4PH1A 3DS4A 2E1MA 1PEQA 2Z44A 1AUMA 3VRLC 3DTJA 3MGEA 3CMEP 3Q20A 5BS2A 3H0DA 2JYLA 3DS5A 3OW2O 2BUOA 1YJ9P 3G28A 1ZMBA 3H47A 3CCEP 3DS1A 3G0VA 1VQ8P 3G71P 1JJ2O 1M6EX 2EIAA 1KD1Q 1M6NA 4COPA 3I56P 2DGYA 3CCVP 3M1MA 3DPHA 4U0CA 4M0IA 4U0EA 1VQ5P 2PEOA 5HGOA 4XFZA 1PEMA 4WYMA 1QRJA 3CCRP 3HYBA 1YJNP 1EIAA 2OTJP 1VQLP 5F2NA 1Q7YQ 1QVGO 1S72P 1RNIA 2OTLP 4XFYA 4QNBA 4IPYA 1YI2P 1KQSO 2XV6A 4GR2A 3CCUP 1VQ9P 3RG6C 3CCSP 1Q86Q 1K30A 4XROA 2PEJA 3H4EA 2EG5A 2JO0A 5JPAA 5HGNA 3CXCO 1VQKP 1VQOP 1VQ7P 3LRYA 3DS3A 1D1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 P;  3G4S P;  1VQM P;  3CCR P;  1M90 Q;  1YIJ P;  1YIT P;  1YJW P;  1YJN P;  2OTJ P;  1VQL P;  1QVG O;  1Q7Y Q;  3CC2 P;  1S72 P;  3CME P;  2OTL P;  3CCQ P;  3OW2 O;  1KQS O;  1YI2 P;  3CCL P;  1YJ9 P;  1VQ6 P;  3CCU P;  1W2B O;  1VQ9 P;  3CCE P;  3CCS P;  1VQN P;  1Q86 Q;  1VQ8 P;  3CC7 P;  3G71 P;  1JJ2 O;  1KD1 Q;  1YHQ P;  3CCJ P;  3CCM P;  1KC8 Q;  3I56 P;  3CPW O;  1Q81 Q;  1QVF O;  3CCV P;  1VQP P;  1K8A Q;  1Q82 Q;  1K9M Q;  1M1K Q;  1K73 Q;  2QEX P;  3CMA P;  1VQ5 P;  3CC4 P;  3CD6 P;  3G6E P;  3CXC O;  1VQK P;  1N8R Q;  1VQO P;  1VQ7 P;  1VQ4 P;  1NJI Q;  3I55 P; 
#chains in the Genus database with same CATH topology
 3B5N B;  1KIL A;  1DH3 A;  1KIL B;  3CCQ P;  1NGM B;  2FYN C;  3CXH D;  3Q5S A;  5CMZ A;  2OGU A;  1JTH A;  2C9L Y;  2PEM A;  3AEF C;  2K92 A;  3RBX A;  1JTH B;  1RQU A;  2E74 B;  1NAY A;  2N1T A;  3BCC E;  4KJM A;  2N1T B;  1YTZ T;  1PGO A;  1N8R Q;  1SQV K;  1KLP A;  5AW0 B;  1SQB J;  3FGA D;  2K9J A;  2LXC B;  2LKM A;  2H89 C;  2K9J B;  1AJY A;  5EJD A;  3A0H H;  3HZQ A;  3GG2 A;  3CWB E;  4WWI A;  2D2C D;  1MZ8 A;  1T8K A;  2A45 I;  2MVU A;  4BPG A;  1GZL A;  5KAF E;  1M1J A;  3H1I E;  3OW2 O;  1M1J B;  1NKZ B;  1GU5 A;  2FFD A;  5B66 E;  1VQ8 P;  2FFD B;  1NTK J;  4K3A A;  1YQ4 C;  3D6Z A;  1VQ5 P;  5HGO A;  1NU1 K;  5APW A;  4H2X C;  1IC2 A;  2JU2 A;  3AEG C;  2OYH A;  1ZP0 C;  3SFE C;  2OYH B;  1USE A;  1L0L J;  2AFD A;  3P8C D;  4DJG A;  3FXD A;  5KKZ B;  3L70 J;  3H1K J;  1L0N J;  3AE4 C;  2Y0D A;  1URQ B;  3L73 G;  3LMO A;  1WRG A;  1GK4 A;  4TLF A;  3G21 A;  4Y28 J;  4N78 D;  4MN4 C;  2CG5 B;  3V2P A;  4OGQ D;  1LTI C;  3KYQ A;  3G1G A;  2L4B A;  3VP9 A;  3F5H A;  3H1J J;  1Q82 Q;  4R4M A;  4U0D A;  1W5C E;  1VQ4 P;  1LT9 A;  1ZRT D;  1FDI A;  1LT9 B;  4BPF A;  1NVO A;  1FBM A;  1CEI A;  2EFJ A;  4EIJ A;  1X22 A;  3L71 J;  3P8C E;  1L4A C;  2XNX A;  1R8E A;  2FYN B;  2JEE A;  5KLI C;  3MTU E;  2QNW A;  2XXM A;  2W6B A;  4N78 E;  3TGU E;  5KLV J;  1YTZ I;  1VQM P;  1H88 A;  2B9B A;  2G8Y A;  2K3R A;  1UJZ A;  5DJU B;  2ZVO B;  2FXM A;  2AFE A;  1N2D C;  1DX7 A;  2HLO A;  1DEE G;  3G9R A;  1M6N A;  3PH0 A;  1CI6 A;  1CI6 B;  1NHL A;  4U7J A;  3SWF A;  2VLQ A;  1BE3 J;  3V4Q A;  1S5L X;  2MKV A;  2OTJ P;  1HWT C;  1BGY E;  4IFD K;  5KJ7 C;  1M56 D;  1QL1 A;  1HBW A;  1X9V A;  3CCU P;  3B71 A;  3CWB G;  2QM7 A;  1KB9 H;  2N50 A;  3M91 A;  4XE5 B;  1VQK P;  4L76 A;  3N4X A;  2QA4 P;  2KGD A;  1HUC A;  2MVV A;  1JB0 J;  1RO0 A;  3NXS A;  2FQ0 A;  1WT6 A;  3AEE C;  4HKZ H;  3CC2 P;  2MF4 A;  3H1I G;  1IUQ A;  1EQ7 A;  2FQ1 A;  4UHP B;  2IBZ D;  4WY4 C;  2IFM A;  5E79 H;  3H32 B;  3V2R A;  2IBZ I;  4PD4 D;  3HD7 D;  2POH A;  4ZMD A;  2Z5I A;  3EJB A;  1Y9B A;  1JCC A;  1P84 H;  1L0L K;  1NTZ K;  2FBW C;  4PD4 I;  4L74 A;  4YPC A;  1J2J B;  2JAZ A;  1KC8 Q;  3L72 E;  2Y9Y A;  1SQP G;  3G4S P;  4W80 A;  4H0L D;  2KK7 A;  2XDJ A;  2GUS A;  3KZI E;  1QLE D;  2QE7 H;  2QVA A;  3OA7 A;  4HYT B;  2IBZ E;  1G1I A;  2EHT A;  3NFQ A;  4D6T D;  1SQQ J;  1KZU B;  1L4A A;  1T6A A;  1L4A B;  4PD4 E;  3CCV P;  3L75 J;  3DPH A;  3B5N D;  2ROQ A;  1GXG A;  4U0E A;  2K88 A;  1Y8A A;  1HH0 A;  2WSC H;  1SFC A;  5KLI B;  1KIL D;  4Z1M H;  4PJ0 H;  1UIX A;  3H1H G;  2YXR B;  5BU8 B;  2FAD A;  2E74 D;  5H2F H;  2N1T D;  3CCS P;  1AQT A;  3OJA B;  4NPD A;  2E75 C;  4AYC A;  1OX3 A;  2QJY C;  2JO0 A;  1S3J A;  3BCC J;  5HGN A;  2KNC A;  2KNC B;  3L74 D;  4GOD A;  2ZYD A;  4ZNC A;  3TGU G;  2M8L A;  1EOQ A;  1SQV G;  1GL2 C;  2WQY C;  1OW6 A;  5AW2 B;  4BPH A;  4W7Y A;  1VPC A;  1AFO A;  1KIL E;  1PPJ E;  1W2E A;  5CHX A;  1NWQ A;  3V2Q A;  3L36 A;  2GYK A;  5AW4 B;  3H25 A;  2R5B A;  3GHG A;  5AVU B;  1BGY G;  2NRG A;  1EDK A;  3HE4 A;  2L91 A;  2YKO A;  1USD A;  3HE4 B;  4WY4 B;  1GTW A;  2K0D X;  3M06 A;  1NU1 G;  2O01 H;  3FWL A;  4BWN A;  1SVF A;  2Y0C A;  2M0B A;  1AV1 A;  4H2Y C;  4AQR D;  2WWW A;  4DG9 A;  4L75 A;  2IYP A;  3RK3 C;  2CPS A;  1YYC A;  1GD2 E;  1PEM A;  1SQX E;  1MKM A;  1JOC A;  4ASW A;  4PV1 C;  3PLN A;  1UNK A;  2Q5U A;  5GTH H;  1E5W A;  4RKU J;  1X79 B;  1OZH A;  5APT A;  2L9F A;  3L72 G;  3ABV C;  2QJP C;  2N5H A;  5TIS H;  2IDB A;  3DS3 A;  3I55 P;  2GA1 A;  5CJ4 A;  2R32 A;  1VF5 D;  1LTT C;  2DW3 A;  3VMA A;  1IK9 A;  3LIE A;  3B5I A;  3V6I A;  3EJE A;  3CCL P;  2FY8 A;  2GDY A;  3CE7 A;  1OWA A;  1IK7 A;  4C7N A;  3AE2 C;  4A7P A;  2KWL A;  2L22 A;  4C7N B;  4DCK A;  3CMA P;  2N9B A;  1LT1 A;  2Y0E A;  1KYO E;  2QJY B;  2BQ1 E;  1YIJ P;  1KTM A;  3NY7 B;  4U0F A;  2W90 A;  1FZB A;  1PP9 D;  2AXT E;  3L73 D;  1BCC E;  1NO4 A;  3V5B A;  4GIF A;  1QVF O;  2K1A A;  4AUW A;  3VTP C;  3NTE A;  1K04 A;  4LC1 A;  3AE5 C;  3GF7 A;  2Q3I A;  4NPF X;  1PFI A;  1AF8 A;  5GTI E;  1AUM A;  3RGU A;  5BS2 A;  2GZJ A;  2JWA A;  1LGH B;  3C8V A;  1PGJ A;  2BCC G;  4YXW H;  2R3C A;  1JJ2 O;  2FYU K;  1FOS E;  3KHU A;  1IFD A;  5KAF H;  2HPC B;  4L73 A;  1PPJ G;  4KHX A;  1RE4 C;  1GDT A;  1ZLL A;  4WYM A;  3TF5 A;  1MFZ A;  3A2A A;  1PP9 E;  3L73 E;  3QH9 A;  5B66 H;  1AYI A;  5CCG C;  4IOI H;  2P58 A;  3RK2 C;  3QWO C;  1EDL A;  3H1L E;  2KR5 A;  1EDJ A;  1RE3 C;  2RMZ A;  4IZ6 A;  2CK3 H;  5GTH E;  4WB4 A;  3RK3 B;  2ZAE B;  1M90 Q;  3VOP A;  1H8A A;  1YJW P;  1ZV8 A;  2YNY A;  4PV1 B;  1FZF A;  1OR5 A;  2JBG A;  2WIT A;  4QKO A;  1KOR A;  3DS0 A;  1NTZ G;  2WMM A;  4TT3 H;  2M8N A;  2WSF J;  1VHN A;  2K9Y A;  3CWB D;  1H89 A;  1X8Y A;  3NMD A;  1SQX G;  2JU1 A;  2I1K A;  4EYY Q;  1R5L A;  2QJK C;  5APY A;  2OYI C;  1VKU A;  4GOF A;  2QJP B;  3EFF K;  1HY8 A;  2IZ0 A;  4H13 C;  3R4Y A;  1L4A D;  4C7R A;  4IL6 E;  5HGM A;  1W2B O;  4JF7 A;  2H43 A;  1KQL A;  3CPW O;  1SFC D;  2G3A A;  3H1I D;  4F37 A;  3E7K A;  2JO1 A;  1S2E A;  2YMY A;  1KV4 A;  3Q3D A;  1Q2N A;  1S1C X;  4PXH B;  3M0A A;  1YHQ P;  1SLQ A;  2E1M A;  2JB0 A;  3BRT B;  3CX5 H;  4R0M A;  3M9Q A;  5BVZ A;  3VN0 A;  1OVU A;  2W27 A;  5AVS B;  1ZMB A;  2AVA A;  5CJ0 A;  4W7Z A;  1EXI A;  1G1J A;  3HYB A;  1ZOY C;  1BSH A;  1QVG O;  1SQP D;  2ZYA A;  3GZL A;  4D6T J;  2V7Q J;  4JYC A;  5APV A;  3V4W A;  2GM4 A;  2B88 A;  1BCC G;  4GR2 A;  1RF0 A;  3Q5R A;  1VDF A;  3S9O A;  3LW5 H;  1VQO P;  1HJB A;  1BDC A;  1D1D A;  3USS A;  1RE4 A;  2O01 N;  3U59 A;  4UB8 E;  2J59 M;  3BVH A;  3MUD C;  2FVA A;  1NTM E;  3U1C A;  3H1H D;  3WBH A;  4M3L A;  5CCG A;  4COC A;  2QSI A;  1JM0 A;  2FAC A;  3L74 J;  3RK2 B;  2E76 B;  5F2O A;  1SQP E;  5DCK A;  1OXZ A;  3CX5 D;  1URQ A;  1E6J P;  2MR8 A;  1PP9 G;  2E43 A;  3TGU D;  3M9B A;  1SQV D;  3CX5 I;  2KUB A;  3CC7 P;  1Q81 Q;  1Q90 D;  3H1L G;  2FKW B;  2QEX P;  3E2D A;  2WPT A;  1QEX A;  2VLN A;  1SQX J;  2LIW A;  4CA3 A;  2Q7C A;  1PEQ A;  3VRL C;  3H1H E;  2WSF H;  1PGP A;  3S1K A;  2ZFC A;  2QJK B;  4H44 C;  2WSC J;  2LTE A;  4H2W C;  1BGY D;  1M57 D;  2YIU C;  1EDI A;  2A06 G;  4H13 B;  1JNM A;  4R4L A;  3KZI H;  1NQ4 A;  3CX5 E;  4U0C A;  1Y47 A;  5AVY B;  2PEO A;  2WSE J;  1PGQ A;  2KGA A;  1JUN A;  2M8R A;  1SQV E;  4PD4 H;  3L37 A;  2K37 A;  3WU2 E;  1NU1 D;  2XV6 A;  1PZQ A;  2YMK A;  1VQ9 P;  2HG5 D;  1FJK A;  2P67 A;  2KZJ A;  1HQB A;  7CEI A;  4QMA A;  5JPA A;  1SQB K;  1UII A;  3BAT A;  3GMA A;  4CPG A;  1K73 Q;  2H88 C;  1L0H A;  1E0H A;  1CW5 A;  4U3F E;  4UB6 E;  1IFJ A;  3G26 A;  3GZM A;  1HGZ A;  2KOS A;  2D2C C;  3MD0 A;  2N98 A;  2V7Q H;  3AE8 C;  4NEO A;  1OW8 A;  1X0T A;  2KZI A;  1RQV A;  3L72 D;  3SFD C;  1NU1 E;  2W83 C;  2WPV B;  1U57 A;  2OQQ A;  1NTK K;  5KP8 B;  3MUD A;  1VL2 A;  1G2C A;  1G2C B;  3L35 A;  3RBZ A;  1FZE A;  3H32 A;  5AVQ B;  1HTL C;  2FYU G;  1DIP A;  1T2K D;  2O01 J;  2EHS A;  2MD9 A;  3OAK A;  2C0X A;  1PP9 J;  2R3S A;  3L73 J;  2KG6 A;  2KSE A;  1IFN A;  1ZXG A;  2CPB A;  1D7M A;  1NTM G;  2KSJ A;  3Q2Y A;  1MFT A;  3W67 A;  3CCE P;  2KIK A;  3PP5 A;  3KQG A;  4HH2 A;  5CCH C;  2DGY A;  1L0N K;  2KOG A;  2L5G B;  2YKQ A;  1DD3 A;  3IAO A;  2P10 A;  4PV1 D;  1A02 F;  1OVR A;  1EIA A;  4GDO A;  3ZDM A;  4QNB A;  4IPY A;  1H0T A;  2NPS C;  1H0T B;  1KQF B;  2KYV A;  1Q86 Q;  3IFM A;  4H44 B;  2XU6 A;  2BCC D;  2YIU B;  3HE5 A;  3HE5 B;  1QX8 A;  1FZG A;  1PPJ D;  3KXD A;  2GZF A;  1K05 A;  2KW2 A;  2KOO A;  1N7L A;  2WSE H;  4XA4 A;  3RK3 E;  5BS1 A;  3JCU E;  2LIU A;  2IZ1 A;  4JBZ A;  3B4Q A;  1QL2 A;  3P05 A;  1YQ3 C;  2QRX A;  1GU4 A;  5KLV K;  2KGE A;  2ZXE B;  3P7K A;  1GXH A;  3AED C;  4N3Y B;  4XFX A;  3HUS C;  1PL5 A;  2BCC E;  1KYO H;  5HGL A;  1FZA A;  5KJ7 A;  2E42 A;  3CWB J;  3FX0 A;  4JQ0 D;  2KG9 A;  2J5U A;  2PGD A;  1NTZ D;  2AXT H;  2Z4E A;  3RL0 C;  2KI7 B;  2Q9I A;  4PH1 A;  3GLM A;  3DTJ A;  1SQX D;  4U3F G;  1CSB A;  3FXE A;  4I6M C;  3H1I J;  1NTK E;  3G71 P;  1M6E X;  1KD1 Q;  5GTI H;  2YO2 A;  5K5G B;  4WY4 A;  1LTJ C;  2K94 A;  4XFZ A;  1EC5 A;  2K2Q A;  2IPP A;  5KP7 B;  2WPR A;  1VQL P;  5F2N A;  1N7S C;  5CCG D;  3GW6 A;  2HR3 A;  1JEK A;  1LJ2 A;  3RK2 D;  3GF3 A;  1L0L E;  1NTZ E;  4OVN F;  2KOP A;  2E76 D;  1OIP A;  2O1K A;  3G3Z A;  5APU A;  1DNY A;  3H4E A;  3SWK A;  1Z56 A;  2FHS C;  1XTC C;  1URQ D;  3H1K E;  3L70 E;  5CCH A;  1PIX A;  3LRY A;  1SQP J;  1JMM A;  2KOD A;  2M5A A;  2M5A B;  3AEA C;  2IFN A;  5BU5 A;  1KYO D;  3O6Q A;  1NOH A;  4XRQ A;  3O6Q B;  5EW5 E;  4PWV B;  4YTP C;  1MUU A;  2NPS A;  1FJP A;  1BCC D;  1KYO I;  2NPS B;  2ITA A;  1HGV A;  2BAS A;  2R5D A;  1FZC C;  3VMY A;  1LTS C;  1J1D C;  4KT0 J;  1FS0 E;  4H0L C;  2MR7 A;  2XV5 A;  1JY2 O;  3H1H J;  1SQQ K;  1FDM A;  1RHZ B;  4H13 D;  1KFM A;  2Q1K A;  2PAJ A;  2KOQ A;  1NAF A;  2XND H;  4Y99 C;  1RY3 A;  4LLH A;  2RH0 A;  3MHV A;  2JP3 A;  2ZYG A;  1VQP P;  3B5N C;  5B5E E;  1K9M Q;  2O3J A;  1BAJ A;  1E79 H;  1KMI Z;  5AW7 B;  5KAI E;  4IL6 H;  1NJI Q;  1ZR4 A;  2E75 B;  2N6Y A;  2LML A;  3TGU J;  1L0I A;  4IFF A;  1SQV J;  4WVZ A;  3DS5 A;  1GL2 A;  3HUS A;  2N1T C;  1GL2 B;  3HUS B;  2GUV A;  3G0V A;  2JGP A;  1Z6M A;  4EOT A;  1MV8 A;  4EI2 A;  2J58 A;  3H1L D;  1DV5 A;  1SQB G;  1R5S A;  2RN0 A;  2PNG A;  3RL0 B;  5DJT B;  5HVC A;  1BGY J;  3LW5 J;  2ZVN B;  1K30 A;  3EJD A;  3TK1 A;  4XRO A;  2Z5H A;  2HPC A;  1T3U A;  4YXD C;  1N73 C;  2A06 D;  4N6J A;  1LTJ A;  1A02 J;  1LTJ B;  1NKN A;  2KB7 P;  5CZD B;  1NU1 J;  2Z45 A;  2M8P A;  5AVT B;  1JO5 A;  1N7S A;  1N7S B;  2ZJS E;  4PH0 A;  1X3O A;  3CCJ P;  1NTK G;  4UB8 H;  5AW6 B;  3CC4 P;  3MP7 B;  3KPE A;  1OMI A;  2W8Z A;  2NZ2 A;  3SWY A;  2M5R A;  1L0L G;  2A06 E;  3WUT A;  2KGC A;  2JQ4 A;  1EXJ A;  2OAR A;  3L72 J;  1IFI A;  1FOS F;  3L70 G;  3H1K G;  1L0N G;  1IFM A;  2Z44 A;  1FAV A;  1FZC B;  1IMP A;  2ZXX A;  1JY3 O;  2JYL A;  4H44 D;  2WSS H;  1DD4 A;  3L75 E;  2FYZ A;  3H1J G;  2ERH A;  4Y99 B;  4EDF A;  2C9N Y;  3M0D C;  3MZW B;  2UWJ E;  2FYU D;  2KP8 A;  1VF5 C;  3L71 G;  4XFY A;  3B4S A;  1KQS O;  3RG2 A;  1IZN B;  3TYY A;  1NTM D;  2FQ2 A;  2PEJ A;  2LKI A;  2QIW A;  3CXH I;  3TNU A;  3TNU B;  3GKL C;  3WU2 H;  5KLV G;  1RO2 A;  2FXO A;  1BXI A;  1FE6 A;  2B89 A;  3DS2 A;  3O8Z A;  5KJ7 D;  2LPK A;  4U0B A;  1S9K E;  2PEN A;  3VMZ A;  2BCC J;  2XZR A;  2N5I A;  1LWU C;  5AW9 B;  3WUU A;  5AW8 B;  3T97 A;  2GZG A;  2FYU E;  3T97 B;  3MGN A;  4UB6 H;  2WT7 A;  2BHV A;  3CXH E;  2WT7 B;  1BE3 G;  1N73 A;  2AXC A;  3ITK A;  3D71 A;  2LOL A;  1N73 B;  2CGQ A;  2CWO A;  5C39 A;  4OWF A;  1KQG B;  1U7M A;  4WY4 D;  3HTK A;  3CCM P;  3HTK B;  3U43 A;  1M1K Q;  1HVV A;  1QGK B;  2QG4 A;  3G6E P;  2KLU A;  1S5L E;  1M8O B;  1RE3 A;  1KFN A;  1N86 A;  1T3J A;  4OH8 B;  1AA0 A;  2OTK E;  3H0D A;  3KDP B;  1AQ5 A;  3CI9 A;  3G28 A;  4B86 A;  2VSQ A;  2GZE A;  1NTZ J;  2EIA A;  1MZ9 A;  5CCH D;  3I56 P;  4IL6 X;  3A0B E;  1FC2 C;  3M1M A;  1EZV G;  2M3B A;  3R2P A;  1S4X A;  3CCR P;  4GT1 A;  1Q7Y Q;  2V4H A;  3M9H A;  1OFC X;  2ZT9 C;  3C9I A;  2OYI A;  2AF8 A;  2YO3 A;  2OYI B;  2NPS D;  2YXQ B;  3RG6 C;  4U3F D;  5AVZ B;  1IMQ A;  4I7Z C;  1GW4 A;  3WMM 0;  2SPZ A;  2JR8 A;  2MY5 A;  4IFM A;  1LTA C;  3M0D A;  3EFG A;  5KTB A;  2PP6 A;  1DEB A;  2WZ7 A;  1VF5 B;  5KP6 B;  1SQQ G;  2MJZ A;  3VP8 A;  1SFC C;  3L75 G;  2E75 D;  5AVV B;  1L2P A;  5I4T G;  3A0H E;  3JCU H;  1WMK A;  4O9B A;  4U0A A;  1M74 A;  1GL2 D;  4GR6 A;  1GMJ A;  2K5X A;  2X2B A;  3E1R A;  2WVR A;  1LP1 A;  2H7H A;  1ZNV A;  3N7N A;  1XTG B;  1LP1 B;  3A7O A;  1BCC J;  3I5C A;  2PRR A;  5F2K A;  1ZRT E;  4RO0 A;  1OVV A;  2LF4 A;  2GDX A;  3BCC G;  1LWU A;  2JWD A;  1LWU B;  3G1I A;  3RL0 D;  4MRT C;  2JKV A;  3IN6 A;  2HOD A;  2HOD B;  4NPE A;  4K35 A;  4DOJ A;  3AE6 C;  1RH5 B;  1SS1 A;  3GHG C;  4HKG A;  2WTY A;  1N7S D;  2OTL P;  1EMV A;  2W6A A;  1HJ0 A;  1YI2 P;  2I1J A;  1KN7 A;  5EFW B;  1U7J A;  3RK3 D;  1J1E C;  1JY2 N;  2M3E A;  3H1L J;  4JPZ B;  3H6P A;  2XT1 A;  1CZQ A;  2A45 G;  1BDD A;  3AE9 C;  1ACP A;  2XZ1 C;  4C46 A;  2RKL A;  2FVF A;  1SQB D;  3PHL A;  1IJD B;  1VQ6 P;  3V2N A;  1VQN P;  4OGQ C;  1ZW0 A;  2ZT9 B;  2PFX A;  3PJS K;  5L8R J;  1SQX K;  2L0Q A;  2LR2 A;  1SP4 A;  4I7Z B;  2BEZ F;  2P9X A;  4RES B;  2XKM A;  3Q1M A;  3A3Y B;  2NO8 A;  1ZME C;  2JYG A;  2JDI H;  1KB9 D;  2XZ0 D;  3BRV B;  4RJT A;  4LGD E;  1HF9 A;  4DZO A;  1KB9 I;  1A43 A;  1NTK D;  1SFC B;  2CQ8 A;  1SQB E;  3JSV C;  3JC2 2;  2P2U A;  5B5E H;  3CME P;  3TSI A;  1RF1 C;  3RL0 g;  2R44 A;  2VLO A;  1IFP A;  2K0Y A;  5KAI H;  2BUO A;  4GKG A;  3NTN A;  4XFJ A;  5AW1 B;  3II6 A;  4COP A;  5AVX B;  1L0L D;  2D2C B;  2W6J H;  1QRJ A;  4HJG H;  1P84 D;  4BXL A;  3CL3 D;  4D6T E;  3L70 D;  1KB9 E;  1L0N D;  3H1K D;  5HV8 A;  1BSN A;  4ZKU A;  1P84 I;  4I2L C;  2AEM A;  2O1J A;  3GJN A;  1GPJ A;  2FYU J;  3CXC O;  2IYO A;  3H1J D;  3C1L A;  2IX7 C;  5E79 E;  5APQ A;  3P32 A;  3GHG B;  5AW5 B;  1ZR2 A;  2WPS A;  1NTM J;  3SSU A;  3U1A A;  3AE3 C;  2VRS A;  3L74 E;  3L71 D;  1T8Z A;  2HFE D;  1P84 E;  1ZN5 A;  1JY3 N;  1T2K C;  1L0N E;  3FWN A;  1J1E B;  3HD7 C;  2L6E A;  3VMX A;  2PEQ A;  5CBO A;  1OW7 A;  5KLV D;  3G29 A;  1JY2 P;  3PRJ A;  1PEO A;  3EQ2 A;  3MIW A;  2ONT A;  3H1J E;  3W68 A;  2PEI A;  4OGQ B;  1AVY A;  2WPQ A;  1A8O A;  5AVR B;  1M7L A;  2HYN A;  4GOE A;  3MGE A;  3L71 E;  4WBA A;  3Q20 A;  1BE3 D;  2K93 A;  3HRN A;  2KXP B;  2P7J A;  3LID A;  2E5T A;  2DNW A;  3H47 A;  3DS1 A;  4PJ0 E;  1GK6 A;  1LNQ A;  2KG8 A;  2E5Y A;  3K5B A;  4JYB A;  4M0I A;  5M1B A;  5H2F E;  3AEC C;  5CBN A;  5KLV E;  1KIL C;  1IO4 A;  3L4F A;  1RNI A;  2IBZ G;  2E74 C;  2Q6Q A;  3S4R A;  1RF1 A;  1JCD A;  3WUV A;  1RF1 B;  2N6Z A;  2EG5 A;  2BEQ D;  2LXB A;  3VYI A;  3IR9 A;  2KOR A;  1NH4 A;  1NYH A;  2B87 A;  5AVW B;  1BE3 E;  1EZV D;  2B87 B;  1FU1 A;  2Q3E A;  3IF4 A;  3A5T A;  1PEU A;  1YBK A;  2K0X A;  3AE7 C;  4U3F J;  1EZV I;  2C0W A;  1LTG C;  2AEJ A;  3D70 A;  1GW3 A;  2N9Y B;  1AVO A;  5TJH A;  2YKP A;  4BRY A;  2Z46 A;  2KLV A;  4BRY B;  3CD6 P;  3P8M C;  5AW3 B;  2PEK A;  3E1I A;  3AEB C;  1YIT P;  1M1J C;  2VLP A;  2JJL A;  4D6T G;  2FFD C;  3PTZ A;  3F89 A;  4HB1 A;  1RF0 C;  2OYO A;  3CXH H;  1FDO A;  3BAS A;  3CLQ A;  2PY8 A;  2FAE A;  1EZV E;  1K8A Q;  1LTB C;  3UIA A;  1SQQ D;  3AE1 C;  3B8E B;  2Y9Z A;  2LL8 A;  4ASV A;  1F80 D;  3L75 D;  3TDK A;  3DS4 A;  1NTM K;  2P1J A;  3HD7 A;  2OYH C;  1JY3 P;  3HD7 B;  3Q5P A;  1S5L H;  1TU3 F;  2A45 H;  1YJ9 P;  2E76 C;  5KKZ C;  3L74 G;  1SQP K;  1URQ C;  2I8D A;  2FVE A;  1FR2 A;  4DT0 A;  5APS A;  5APX A;  3BCC D;  4I1L A;  2AEF A;  1YJN P;  1FZC A;  3A0B H;  3D6Y A;  1S72 P;  2ZT9 D;  1J1D B;  3EWK A;  2GDW A;  4H0L B;  2FXP A;  5TIS E;  1JMB A;  2GZI A;  1SQQ E;  2CNR A;  1PV3 A;  2QM8 A;  4ZKP A;  1S9K D;  2H8P D;  1LT9 C;  2KS1 A;  1VQ7 P;  2KS1 B;  3B5N A; 
#chains in the Genus database with same CATH homology
 2QA4 P;  2XT1 A;  1RO2 A;  2KOD A;  1M90 Q;  2M8L A;  1RO0 A;  1EOQ A;  1YJW P;  2Z45 A;  3G21 A;  2M8P A;  3DS2 A;  3CC2 P;  1PEU A;  3CCQ P;  5BS1 A;  3B5I A;  4U0B A;  3CCL P;  1IUQ A;  4XRQ A;  3I55 P;  2PEN A;  3G26 A;  3DS0 A;  3WBH A;  1VQ6 P;  1VQN P;  4COC A;  2PEM A;  4PH0 A;  3P05 A;  3G1G A;  3CCJ P;  2M8N A;  2Z46 A;  1Q82 Q;  1K73 Q;  4U0D A;  3CMA P;  3CC4 P;  5I4T G;  3CD6 P;  1N8R Q;  2PEK A;  5F2O A;  1VQ4 P;  5DCK A;  2BHV A;  2P9X A;  2L6E A;  1YIJ P;  1E6J P;  1YIT P;  2BQ1 E;  4U0A A;  1M74 A;  2PEQ A;  4U0F A;  4GR6 A;  4XFX A;  2EFJ A;  3G29 A;  2CWO A;  3HZQ A;  2JYG A;  1PEO A;  5HGM A;  5HGL A;  1W2B O;  3CC7 P;  2ONT A;  5F2K A;  2PY8 A;  3CCM P;  1KC8 Q;  3CPW O;  1Q81 Q;  1QVF O;  1VQP P;  2LF4 A;  1K8A Q;  1M1K Q;  2PEI A;  1K9M Q;  1BAJ A;  2QEX P;  2OAR A;  3G6E P;  3E2D A;  3NTE A;  2XXM A;  1A43 A;  1A8O A;  3G1I A;  1NJI Q;  1YHQ P;  3G4S P;  1VQM P;  4PH1 A;  3DS4 A;  2E1M A;  1PEQ A;  2Z44 A;  1AUM A;  3VRL C;  3DTJ A;  3MGE A;  3CME P;  3Q20 A;  5BS2 A;  3H0D A;  2JYL A;  3DS5 A;  3OW2 O;  2BUO A;  1YJ9 P;  3G28 A;  1ZMB A;  3H47 A;  3CCE P;  3DS1 A;  3G0V A;  1VQ8 P;  3G71 P;  1JJ2 O;  1M6E X;  2EIA A;  1KD1 Q;  1M6N A;  4COP A;  3I56 P;  2DGY A;  3CCV P;  3M1M A;  3DPH A;  4U0C A;  4M0I A;  4U0E A;  1VQ5 P;  2PEO A;  5HGO A;  4XFZ A;  1PEM A;  4WYM A;  1QRJ A;  3CCR P;  3HYB A;  1YJN P;  1EIA A;  2OTJ P;  1VQL P;  5F2N A;  1Q7Y Q;  1QVG O;  1S72 P;  1RNI A;  2OTL P;  4XFY A;  4QNB A;  4IPY A;  1YI2 P;  1KQS O;  2XV6 A;  4GR2 A;  3CCU P;  1VQ9 P;  3RG6 C;  3CCS P;  1Q86 Q;  1K30 A;  4XRO A;  2PEJ A;  3H4E A;  2EG5 A;  2JO0 A;  5JPA A;  5HGN A;  3CXC O;  1VQK P;  1VQO P;  1VQ7 P;  3LRY A;  3DS3 A;  1D1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...