1VQ6P

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq6P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq6P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq6P02
1KQSO 1W2BO 3CC2P 1VQ6P 1Q81Q 1K73Q 3CPWO 3CC4P 3CMEP 1M1KQ 1YJ9P 1Q7YQ 3G6EP 3CC7P 3CCRP 3CMAP 3G71P 1VQNP 3CD6P 1YIJP 1K9MQ 1YI2P 1QVGO 1VQKP 1K8AQ 1YITP 2QA4P 3CCMP 1VQLP 1QVFO 2OTLP 1KD1Q 1VQPP 1VQ5P 3I55P 3CCSP 1VQMP 1VQOP 3CCJP 1S72P 3CCQP 3CCUP 1Q82Q 3OW2O 1YJWP 1JJ2O 3I56P 3CCEP 1YJNP 1M90Q 3CCVP 3CXCO 1YHQP 1VQ4P 1VQ8P 3CCLP 2OTJP 1VQ9P 1Q86Q 2QEXP 1NJIQ 1KC8Q 3G4SP 1N8RQ 1VQ7P
chains in the Genus database with same CATH superfamily
3FX0A 1FBMA 1JCDA 1KILD 3G71P 4M0IA 1BDDA 5GTIE 2LKMA 3WUUA 2XZRA 3KHUA 1URQB 3L72D 3M1MA 2E74B 1KD1Q 1R8EA 3KYQA 3GW6A 2ZXEB 3CCUP 5KLVG 1PL5A 4UB6H 1SQVD 4WY4A 1BGYD 1ZNVA 3L73G 1PEOA 3L73E 2E76B 2FVAA 2JYLA 3Q3DA 2WVRA 3TK1A 3L75J 1QVGO 2I1KA 3AEFC 4NPDA 1RE3A 2QVAA 4DG9A 2R5DA 2Q7CA 1VQ4P 2OYIB 1IFNA 1SS1A 3M9QA 3TGUJ 3A0BH 2AEJA 1S9KD 5CHXA 3WUVA 1J2JB 1NTZD 1S5LH 2FYUJ 2OARA 1LP1A 1P84D 1G1IA 3WMM0 2K37A 4C7RA 3AEDC 5KAFE 1KB9H 3CI9A 1LTJC 1YJNP 3L36A 1N7SC 2N1TA 2CQ8A 1E0HA 5AW6B 2IYOA 2K1AA 2A06D 1KILC 4W7ZA 1A02F 1FDOA 1K04A 3G6EP 1GL2A 1OX3A 2GZIA 4Y99B 2Q9IA 3CCMP 1EZVI 1X0TA 3MZWB 2WSCH 2OYHC 5TISH 3TDKA 1J1EB 2Y0EA 5BVZA 4TT3H 4JYCA 3P8CD 1WMKA 4PJ0E 4KT0J 3CCRP 3C9IA 4PV1B 3FXEA 1VQKP 4H2YC 3WU2E 2Y0CA 1OR5A 1Z56A 1PPJG 5C39A 3V4QA 4R4MA 4L75A 1FR2A 2FKWB 3SWYA 5M1BA 4H13C 2W8ZA 3B5ND 3OJAB 5AW1B 5AW3B 1K30A 1J1DB 2CPBA 1AA0A 1D7MA 5AVRB 4DJGA 1UJZA 2CG5B 2VLQA 1JY3O 3FXDA 3PLNA 2JYGA 3TF5A 1NTMK 3MTUE 5EW5E 1JUNA 1VQ9P 2WWWA 1GL2D 4DT0A 3H32A 4U0EA 1M1JA 1EZVE 2KS1A 1PP9D 2YIUC 2K5XA 1KB9I 2QJYC 2JAZA 2MKVA 1LNQA 1FDMA 4JBZA 1BAJA 3DS2A 4LGDE 3T97B 3PP5A 2GDWA 2KGAA 5B66H 2O01H 3H1LJ 1WRGA 1RE3C 5H2FE 1SQPG 2H89C 5B5EE 4U0DA 2B9BA 4LC1A 2PEOA 2JU1A 3B5NC 2PGDA 1OW8A 3M0DC 5KLVD 1GDTA 1A43A 1NTME 2KODA 2N98A 3L73D 1Q7YQ 2YKOA 2LIUA 3L71J 4XFYA 1Y8AA 2AEFA 4H0LB 4EIJA 1L0LG 5APQA 1VQOP 3OW2O 1ZLLA 2NZ2A 1GL2C 1JY2O 3Q5RA 3G4SP 1LWUB 1H0TA 3CPWO 3G1GA 1XTGB 3NMDA 1Y9BA 2FYUK 3CD6P 2PENA 4QKOA 3KQGA 3LMOA 1P84H 5CBOA 2XT1A 4XRQA 1MZ8A 1Y47A 5AVQB 2LTEA 2ZT9D 1AF8A 2Z46A 1M90Q 3HD7B 2P10A 2ZVNB 2GYKA 2PFXA 3GF3A 3P8MC 3RK3D 3VOPA 4ZKUA 4HJGH 1MFTA 3PHLA 1L0IA 4H44B 1LTAC 1M1KQ 3BRVB 3H1HG 3QH9A 1XTCC 1FOSE 3V2NA 1DH3A 2E74D 2N5IA 4IL6E 2AXTE 3L75E 3LIDA 2FBWC 2WPRA 1AV1A 1S2EA 1IZNB 1L4AA 3GHGB 2J58A 2BHVA 3NTNA 1FE6A 1KQFB 2FFDA 3TGUE 4W7YA 4EYYQ 2KK7A 2FYUE 1PPJD 3SFEC 4EI2A 2PP6A 3SWKA 2P2UA 4BXLA 2WSSH 5I4TG 2GZGA 1X9VA 5AW2B 1RE4A 1FC2C 3L70G 3AEBC 3W67A 3RL0g 2KR5A 1BCCG 1BCCE 1SQQJ 1PFIA 2ZT9C 1QL2A 1HUCA 1EDKA 3RK3C 2HLOA 3RL0B 3VMXA 5AVYB 1W2BO 1OWAA 4RESB 1CI6A 5BS2A 5DJUB 2QM8A 4EOTA 2H7HA 1HGZA 4ZMDA 1Q90D 2C0XA 1VF5B 4CA3A 3MP7B 1G2CB 2K9YA 3H0DA 1NU1J 1H8AA 1L4AD 3EJBA 1VQ7P 2O01N 1PEQA 3RK2B 2N9YB 4K3AA 4PV1D 3AE6C 5AW9B 3G21A 1YITP 1AFOA 2KLUA 2KNCA 3V5BA 3CCSP 2JO0A 1SQPD 4L76A 5GTIH 4PH1A 4ZKPA 3EQ2A 3BRTB 3C8VA 4U3FG 4U3FE 2XKMA 2ZYDA 3H1KG 1RO2A 2V7QH 1ZMEC 5CZDB 2L4BA 1M7LA 1NTKG 4DOJA 1L0LD 2FY8A 3DS5A 2QJPC 5APSA 1KYOI 2ITAA 1FOSF 2QIWA 2CGQA 3L74G 2Q6QA 4HYTB 2JKVA 3L74E 4I7ZC 1SQBJ 3GZLA 3MGNA 1KB9D 1YYCA 4IZ6A 3CCQP 3H1LG 2WMMA 3H1LE 1LP1B 4DZOA 5KAFH 4WVZA 1L4AC 2H88C 1IK9A 5BU5A 1L0HA 1ZP0C 4D6TJ 1K73Q 3A3YB 4AYCA 2LL8A 3QWOC 5HGMA 1QX8A 2H43A 3E2DA 2N1TB 1W2EA 3H1HD 3HE5B 1T6AA 3L35A 3L71E 1YHQP 1BSNA 5HVCA 1RF1B 2PEQA 2YKQA 1LTJA 2W6JH 1N7SA 2X2BA 1SFCA 3AECC 2OYOA 3G26A 4PJ0H 4KHXA 1PEMA 2K2QA 2N6YA 5L8RJ 3CCEP 3WU2H 3H1JG 3EWKA 3H1JE 2LR2A 1KYOE 5APXA 1RNIA 2E75D 1Q81Q 2Z4EA 1FZCB 2P1JA 2OYHA 3AEEC 3EFFK 3L70D 1QL1A 4PWVB 1BCCD 1SQQK 1CEIA 3HUSC 1BDCA 1CZQA 4F37A 4GKGA 3HD7D 1HTLC 1E5WA 1IFIA 1GK4A 3TNUA 2CK3H 2JWAA 1JY3N 3L4FA 3CWBJ 3FWNA 1T2KD 4I2LC 4JQ0D 4HH2A 3F89A 2KGDA 1Q2NA 3H32B 2M8RA 2EHTA 3C1LA 2EG5A 3I56P 3B4SA 5KKZB 1M1JB 1NU1K 3V6IA 2ZXXA 3LW5J 3G0VA 4M3LA 3RG6C 4WYMA 2IYPA 2GZEA 3M91A 5KJ7A 5H2FH 2OQQA 1BXIA 4XFZA 4IFMA 5B5EH 4NPEA 2E75C 5APTA 1SQQE 2L9FA 2IFMA 4U3FD 3OA7A 4WB4A 2C9NY 3H1KD 2K0YA 3G9RA 3O6QB 3P32A 2B87A 2WSCJ 1JB0J 3IAOA 1N2DC 3GF7A 2BASA 1NTKD 5KLIB 1EIAA 2IBZE 2AEMA 2M0BA 4PD4E 2O1JA 3CXHE 3OAKA 3B5NA 1T2KC 1RQUA 2WPSA 3M0DA 1SQBK 5GTHE 2BCCJ 2WSEH 1BE3G 1JY2N 1NU1E 3L74D 1BE3E 5KP7B 4BPHA 1OZHA 1SLQA 1H0TB 2LOLA 1PEUA 1IMPA 1E79H 2O3JA 2G8YA 2XV5A 3H1LD 4IOIH 3P7KA 2EHSA 1SFCC 3NFQA 1X3OA 1SQXJ 1VQ6P 1FZBA 2KZIA 1GD2E 2Y9YA 2Y0DA 1VDFA 2WPQA 4RJTA 5APWA 5KJ7D 1QEXA 4AQRD 2KSEA 1M56D 3HE4B 3USSA 4YXDC 2KGCA 4XFXA 3BATA 2M8NA 2DNWA 2Y9ZA 4IL6H 4U0FA 2AXTH 4ZNCA 1PZQA 1OMIA 1L0NJ 1FU1A 2WTYA 1JNMA 3MD0A 1MKMA 4L74A 3M9BA 2MVUA 5HGNA 4TLFA 3V4WA 1YQ3C 1CW5A 1GK6A 1SQBE 1EMVA 3PH0A 3H1JD 1OW7A 2FFDB 1OW6A 2JGPA 5CJ0A 1MFZA 1EC5A 3F5HA 4N78E 5CCGD 1TU3F 5APVA 4D6TG 2L0QA 4OGQD 4D6TE 1ZW0A 3L72J 2GZJA 1NWQA 5APYA 3D6ZA 3BVHA 1N73A 1N8RQ 1AJYA 2FVEA 5KAIE 1SQVJ 2ZJSE 1BGYJ 5KJ7C 1EZVG 1FJPA 3Q20A 3NXSA 3NTEA 1AQTA 1CI6B 5BU8B 2FAEA 4QMAA 3H47A 1GW4A 2YNYA 2I1JA 3DPHA 2KOPA 3NY7B 1RF0C 2VLOA 1H89A 3IR9A 1NAFA 2KXPB 2IDBA 1NTZJ 2KOOA 2YXQB 3K5BA 2XNDH 1H88A 1IO4A 4MN4C 2C0WA 3A7OA 1IFPA 1NTMG 2FXMA 2LIWA 3S9OA 2QJKB 3VMZA 2KIKA 4OGQC 4PH0A 1VQ5P 3HRNA 3H1IG 1VQMP 4GDOA 3H1IE 4C7NB 3CWBE 2HPCB 2D2CD 1R5SA 3CCVP 2R32A 5F2NA 1X79B 5F2OA 1NGMB 5EFWB 1S4XA 2HFED 2OYIA 1KN7A 2Q3IA 4EDFA 1NH4A 3Q5SA 3JC22 1BE3D 1KV4A 4RO0A 1RF1C 1SQXK 3B5IA 3DS0A 3VMAA 2WPTA 4BRYB 2ROQA 2W6BA 1URQD 3CL3D 1OVUA 4N6JA 5AVUB 1DEEG 3L75G 2JB0A 2Z45A 1E6JP 2FHSC 1S1CX 4B86A 4O9BA 2I8DA 3R2PA 4MRTC 1FZCC 1NO4A 2JBGA 2E76D 3SSUA 2NPSB 1LTGC 1L0NK 4BPGA 2W6AA 3GLMA 3TGUG 1IMQA 1N73C 3Q1MA 5APUA 2FYUG 2AXCA 1PP9J 2D2CC 2GUVA 4GR2A 2KLVA 1N7SB 3AE3C 2BCCE 4XA4A 3V2RA 2J59M 2PRRA 2RMZA 2HODA 3CC2P 1AYIA 1KILB 2XZ1C 1UNKA 3G29A 1KYOH 1RY3A 3DTJA 2P7JA 1JTHA 1F80D 1RH5B 4N78D 1LTBC 1SQXE 4U0CA 5CMZA 4COCA 1DD3A 2N50A 4NEOA 3RGUA 5KKZC 2OYHB 4D6TD 4IFFA 3AE8C 3HTKA 2BQ1E 5DJTB 3S4RA 1JMMA 4LLHA 2Z5HA 4COPA 5KLVJ 5CCHD 1URQC 3EJEA 1VPCA 1VQLP 4JPZB 2E74C 3TNUB 1LT9B 4A7PA 1EZVD 1IK7A 1IFDA 4GIFA 4H2XC 3WBHA 1L0NE 4HKGA 3CCLP 1KQGB 2J5UA 4H13B 2Z5IA 1HH0A 2FACA 3U1AA 1USDA 2E76C 2QSIA 3HUSA 2KB7P 2KYVA 4I1LA 2IZ1A 3G3ZA 4I6MC 2WT7B 1NTZK 2M8PA 3KPEA 2AFDA 1AQ5A 2KG6A 1WT6A 2Q3EA 2RN0A 3MGEA 2XNXA 1PIXA 2OYIC 2LXBA 3KDPB 1KILE 1OVVA 1EQ7A 3L72E 1VQNP 2O1KA 1FDIA 5HGLA 1IFMA 1K8AQ 1NTMD 2R3CA 2WPVB 2YIUB 2QJYB 2VSQA 1KQLA 4WY4B 2E42A 1YBKA 1BGYE 3H1ID 1S5LX 2W83C 5EJDA 4W80A 3I5CA 3GKLC 2OGUA 1ZV8A 5CCHC 4OWFA 2MVVA 2FXPA 4Y99C 2MR7A 1IFJA 4R4LA 2OTLP 3CXHH 4GODA 2AFEA 3B71A 2RKLA 1J1EC 1S9KE 1NTZE 3AE1C 5KP8B 1P84E 3HD7A 5K5GB 4PV1C 1GPJA 2E5YA 3M0AA 3CE7A 4BPFA 2YMKA 3L71G 3Q5PA 4OH8B 4DCKA 4IFDK 2A06E 1GL2B 3L75D 3KXDA 3G1IA 1J1DC 3FWLA 2JO1A 1FAVA 2WSFH 2A45I 2GDXA 4QNBA 4H0LD 3B4QA 3TGUD 5AW0B 3GHGA 5HGOA 2K0XA 3P8CE 2FYUD 2IFNA 2E1MA 2M3EA 2YMYA 2KOQA 3V2PA 3AEAC 2LKIA 2ZAEB 2NRGA 3LIEA 2E5TA 2KGEA 2KW2A 3KZIE 1OXZA 2KG9A 2CWOA 2KP8A 1OIPA 1SQPJ 4HB1A 1DD4A 4ASVA 4H44D 2PEIA 2FYNB 2IBZI 4AUWA 2HG5D 5KLVK 2R44A 1YQ4C 3AE7C 4PD4I 4XFJA 3CXHI 2M5AA 1KMIZ 1NQ4A 3N7NA 5KAIH 3MHVA 3L37A 2IPPA 4GT1A 4C46A 3A2AA 1GXGA 2KS1B 1JO5A 2G3AA 1L0LJ 4GR6A 3CC4P 2YO2A 1SVFA 1PP9E 2NPSD 1D1DA 1YTZT 5E79E 3D71A 3D6YA 2WITA 4H0LC 3GJNA 3I55P 2ZT9B 5AW8B 5F2KA 5AW5B 2GUSA 3CXCO 2KSJA 1ZMBA 3RK3B 1UIIA 1SQQG 2SPZA 1LWUC 2MY5A 1RQVA 3M06A 3CX5I 2P9XA 1RF0A 2Z44A 3BCCJ 3VP8A 3H1HJ 5KLVE 2ZVOB 3HD7C 2YXRB 1ZR2A 3TYYA 2QE7H 2IBZG 3RL0D 5KTBA 5BS1A 4HKZH 4H44C 2N6ZA 1LTSC 1NOHA 1JOCA 1NU1G 1QVFO 4GOEA 1VF5D 2L91A 4CPGA 2KUBA 1ACPA 1BSHA 5CCGA 3S1KA 2JJLA 2QG4A 4H13D 1GU4A 5AVVB 1DNYA 2JDIH 1EXJA 2B88A 2NPSC 3Q2YA 2VLNA 2KWLA 3RK2D 1OFCX 1HJBA 3LW5H 1YI2P 3B8EB 3GHGC 1K05A 1QLED 1GMJA 2ZYGA 2ZYAA 1JY3P 3L70J 3RK3E 1LT1A 1NKNA 1NYHA 3DS3A 1BCCJ 1LGHB 1X22A 2QJPB 3L71D 2R5BA 3PTZA 3HE5A 2POHA 3CX5E 4UB8E 2GM4A 3VYIA 1M57D 1KORA 3II6A 4I7ZB 4U0BA 2AVAA 2FYZA 1RF1A 2VLPA 4U7JA 4WY4D 3A0HE 4UHPB 2JQ4A 2MJZA 2KG8A 1PGPA 3VRLC 1SQBG 1L4AB 1JMBA 1VKUA 4ASWA 3RL0C 2GDYA 2L6EA 3MUDC 3V2QA 1KYOD 3JCUE 1DIPA 5AVZB 2BEQD 2O01J 1HQBA 1LT9C 1PPJE 1FZCA 1VF5C 2HODB 4WBAA 4Y28J 1MZ9A 3SFDC 1KTMA 1JTHB 1SQPK 2PY8A 3RK2C 4NPFX 3P05A 5TJHA 4U0AA 4PXHB 2K9JA 3HTKB 4U3FJ 2N1TD 3IF4A 1W5CE 1VL2A 1USEA 3H1KJ 1ZR4A 1PGOA 4JYBA 2QEXP 2E43A 1FS0E 1JY2P 2JP3A 3DS1A 1L0LK 1LTTC 3CMEP 1NTKJ 3M9HA 1HJ0A 1HGVA 2UWJE 5AVTB 2BUOA 4YTPC 4WY4C 2BEZF 1DEBA 3ZDMA 1S72P 3CCJP 3HUSB 1HWTC 2HYNA 3L74J 1FZFA 1URQA 3CLQA 1G1JA 2L5GB 5KP6B 1GTWA 2KNCB 1M74A 4OVNF 1KFMA 3IFMA 1IUQA 1SQQD 1T3JA 5CCGC 2QA4P 1SQPE 4UB6E 2K0DX 2EFJA 2ZFCA 3CWBG 2YO3A 3E1IA 1NKZB 3O6QA 2WZ7A 5CBNA 1KQSO 2IBZD 1S3JA 4PD4D 1HVVA 3CXHD 1MV8A 1DX7A 3HZQA 2GA1A 2N1TC 3U1CA 3SWFA 1L0LE 3AE2C 3A0BE 1M6EX 1NU1D 2JWDA 4H2WC 1S5LE 1JM0A 1A02J 5AW4B 2OTJP 2Q5UA 2E75B 1NJIQ 2CNRA 3AE9C 2XV6A 2DGYA 1KB9E 1GU5A 5AVXB 3H1JJ 2JR8A 1EDJA 3BASA 2LXCB 2VRSA 5CCHA 2LF4A 1PGJA 2QM7A 3HE4A 3BCCG 2K3RA 4JF7A 3BCCE 3VTPC 2QNWA 2AF8A 3U43A 3H1HE 3CX5D 2FQ0A 1VHNA 5TISE 2RH0A 4YXWH 4N3YB 3N4XA 3O8ZA 4YPCA 2JU2A 3RBXA 1LTJB 2MR8A 2BCCG 1SFCB 1SP4A 3PJSK 1NVOA 1SQBD 2FYNC 2FVFA 2H8PD 1K9MQ 2PEKA 2PEJA 1AVOA 2XDJA 2CPSA 1U7JA 1SQXG 2KOGA 2GZFA 1YTZI 2M3BA 1AVYA 1Q82Q 3ITKA 1KFNA 2EIAA 2N5HA 1QRJA 1JCCA 1M1JC 3KZIH 2P67A 1T3UA 1L2PA 3GG2A 2K92A 3PRJA 2HR3A 1JEKA 1NAYA 3L70E 1SQVK 3A5TA 2K94A 1EOQA 1N7LA 2XXMA 3H6PA 1IC2A 4BWNA 2FADA 3L73J 2V7QJ 1ZRTE 5HV8A 2ONTA 1FZGA 4WWIA 1L0NG 3VMYA 2WQYC 1M8OB 4GOFA 7CEIA 2M5AB 2C9LY 2KOSA 1NTKK 2IZ0A 2R3SA 1P84I 1HBWA 3T97A 2L22A 3HYBA 3DS4A 1UIXA 3RBZA 3H4EA 2A45H 2KORA 1R5LA 5B66E 5E79H 5KLIC 1BE3J 1KC8Q 2XU6A 4XROA 1T8KA 3L72G 2K93A 1FZAA 4RKUJ 5AW7B 2PEMA 3AEGC 1X8YA 2P58A 2FQ1A 1HY8A 1SQVG 3EJDA 3VN0A 2QRXA 1SQVE 1BGYG 1Z6MA 3H25A 1PGQA 3AE5C 3CWBD 3G28A 3MIWA 1RHZB 4C7NA 1NHLA 2HPCA 2PAJA 3H1KE 2B87B 1PV3A 3GMAA 5AVSB 3EFGA 2WSFJ 2OTKE 1LWUA 1VQPP 4PD4H 3E7KA 2ERHA 1NTKE 2MF4A 5GTHH 1NTZG 3GZMA 3B5NB 4KJMA 2N9BA 1GZLA 2K88A 5CJ4A 3CMAP 3UIAA 5AVWB 2MD9A 4XE5B 4OGQB 3RG2A 1ZN5A 4BRYA 4R0MA 4IL6X 2A06G 1KZUB 2JEEA 2FFDC 3TSIA 5DCKA 1LTIC 1N86A 3BCCD 1KLPA 4IPYA 2FXOA 1IJDB 3CX5H 3JSVC 4UB8H 1LJ2A 2NPSA 1RE4C 1MUUA 3E1RA 4L73A 1FZEA 3D70A 3A0HH 2M5RA 2FQ2A 2LPKA 1OVRA 2LMLA 2BCCD 1ZXGA 1YJ9P 3AE4C 3JCUH 1KILA 3U59A 2W90A 1SQXD 2XZ0D 1CSBA 1DV5A 1Q86Q 2V4HA 1HF9A 3W68A 3IN6A 1AUMA 2KI7B 3FGAD 3CC7P 1EDLA 3WUTA 1EXIA 1M6NA 1YIJP 2W27A 1ZOYC 5JPAA 3MUDA 2KZJA 1N73B 1NTMJ 2D2CB 1YJWP 1JJ2O 1ZRTD 1A8OA 4K35A 1LT9A 1FJKA 1L0ND 3ABVC 2K9JB 3H1IJ 2DW3A 3VP9A 1PP9G 2A45G 1G2CA 2PNGA 4Z1MH 1GW3A 2QJKC 3R4YA 2NO8A 3LRYA 1GXHA 1RO0A 2Q1KA 1U57A 2WSEJ 1EDIA 1QGKB 2M8LA 1T8ZA 2WT7A 2YKPA 1N7SD 2B89A 1U7MA 1SFCD 2IX7C 1VQ8P
chains in the Genus database with same CATH topology
1VQ6P 5BS1A 2PY8A 1A43A 2XV6A 5DCKA 2DGYA 2KODA 1Q7YQ 1VQNP 3CCRP 5HGLA 3G71P 4M0IA 1VQKP 3P05A 4IPYA 1K8AQ 4XFYA 4U0AA 3HYBA 3M1MA 3DS4A 1QVFO 1KD1Q 3H4EA 1VQOP 3CCQP 3CCUP 3OW2O 2EG5A 3I56P 2LF4A 4XFXA 4GR2A 2M8NA 2CWOA 2QEXP 1KC8Q 3G4SP 1PEOA 3DS1A 1W2BO 3CC2P 4U0FA 2JYLA 1K73Q 4XROA 5BS2A 3G1GA 3CPWO 3CMEP 3G29A 1K30A 1YJ9P 2PEIA 3CD6P 2PENA 3DTJA 1YI2P 1QVGO 5HGMA 2BUOA 2PEMA 3E2DA 3G0VA 2XT1A 4XRQA 3RG6C 2OTLP 4PH0A 4WYMA 1VQ5P 4U0CA 1VQMP 2JYGA 5HGNA 4COCA 1S72P 3CCJP 2Z46A 1M90Q 3CCVP 1YHQP 3DS3A 1VQ4P 4XFZA 3H0DA 1VQ9P 2BQ1E 1Q86Q 5F2NA 5F2OA 3G28A 1VQ7P 4U0EA 2PEQA 1M74A 4GR6A 3CC4P 1PEQA 1M1KQ 1AUMA 2OARA 3CC7P 1IUQA 1M6NA 4COPA 1YIJP 1K9MQ 3G21A 4U0BA 2PEKA 1D1DA 1YITP 2PEJA 2QA4P 5JPAA 1VQLP 1VQPP 3G26A 3I55P 3CCSP 2JO0A 1PEMA 5F2KA 1Q82Q 2EFJA 3WBHA 1YJWP 1JJ2O 3CCEP 1YJNP 4PH1A 2EIAA 1A8OA 1QRJA 3VRLC 3CXCO 3CCLP 1BAJA 1ZMBA 3DS2A 1EIAA 2L6EA 1RNIA 1N8RQ 1KQSO 3B5IA 3G1IA 1Q81Q 3DS0A 3G6EP 3CMAP 2P9XA 1EOQA 2BHVA 2XXMA 1RO2A 3HZQA 3Q20A 2M8PA 3CCMP 3NTEA 3LRYA 1RO0A 4QNBA 2Z44A 4U0DA 2ONTA 1M6EX 1PEUA 2M8LA 2Z45A 1E6JP 5HGOA 3MGEA 3DS5A 3H47A 2PEOA 2OTJP 3DPHA 5I4TG 2E1MA 1NJIQ 1VQ8P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS O;  1W2B O;  3CC2 P;  1VQ6 P;  1Q81 Q;  1K73 Q;  3CPW O;  3CC4 P;  3CME P;  1M1K Q;  1YJ9 P;  1Q7Y Q;  3G6E P;  3CC7 P;  3CCR P;  3CMA P;  3G71 P;  1VQN P;  3CD6 P;  1YIJ P;  1K9M Q;  1YI2 P;  1QVG O;  1VQK P;  1K8A Q;  1YIT P;  2QA4 P;  3CCM P;  1VQL P;  1QVF O;  2OTL P;  1KD1 Q;  1VQP P;  1VQ5 P;  3I55 P;  3CCS P;  1VQM P;  1VQO P;  3CCJ P;  1S72 P;  3CCQ P;  3CCU P;  1Q82 Q;  3OW2 O;  1YJW P;  1JJ2 O;  3I56 P;  3CCE P;  1YJN P;  1M90 Q;  3CCV P;  3CXC O;  1YHQ P;  1VQ4 P;  1VQ8 P;  3CCL P;  2OTJ P;  1VQ9 P;  1Q86 Q;  2QEX P;  1NJI Q;  1KC8 Q;  3G4S P;  1N8R Q;  1VQ7 P; 
#chains in the Genus database with same CATH topology
 3FX0 A;  1FBM A;  1JCD A;  1KIL D;  3G71 P;  4M0I A;  1BDD A;  5GTI E;  2LKM A;  3WUU A;  2XZR A;  3KHU A;  1URQ B;  3L72 D;  3M1M A;  2E74 B;  1KD1 Q;  1R8E A;  3KYQ A;  3GW6 A;  2ZXE B;  3CCU P;  5KLV G;  1PL5 A;  4UB6 H;  1SQV D;  4WY4 A;  1BGY D;  1ZNV A;  3L73 G;  1PEO A;  3L73 E;  2E76 B;  2FVA A;  2JYL A;  3Q3D A;  2WVR A;  3TK1 A;  3L75 J;  1QVG O;  2I1K A;  3AEF C;  4NPD A;  1RE3 A;  2QVA A;  4DG9 A;  2R5D A;  2Q7C A;  1VQ4 P;  2OYI B;  1IFN A;  1SS1 A;  3M9Q A;  3TGU J;  3A0B H;  2AEJ A;  1S9K D;  5CHX A;  3WUV A;  1J2J B;  1NTZ D;  1S5L H;  2FYU J;  2OAR A;  1LP1 A;  1P84 D;  1G1I A;  3WMM 0;  2K37 A;  4C7R A;  3AED C;  5KAF E;  1KB9 H;  3CI9 A;  1LTJ C;  1YJN P;  3L36 A;  1N7S C;  2N1T A;  2CQ8 A;  1E0H A;  5AW6 B;  2IYO A;  2K1A A;  2A06 D;  1KIL C;  4W7Z A;  1A02 F;  1FDO A;  1K04 A;  3G6E P;  1GL2 A;  1OX3 A;  2GZI A;  4Y99 B;  2Q9I A;  3CCM P;  1EZV I;  1X0T A;  3MZW B;  2WSC H;  2OYH C;  5TIS H;  3TDK A;  1J1E B;  2Y0E A;  5BVZ A;  4TT3 H;  4JYC A;  3P8C D;  1WMK A;  4PJ0 E;  4KT0 J;  3CCR P;  3C9I A;  4PV1 B;  3FXE A;  1VQK P;  4H2Y C;  3WU2 E;  2Y0C A;  1OR5 A;  1Z56 A;  1PPJ G;  5C39 A;  3V4Q A;  4R4M A;  4L75 A;  1FR2 A;  2FKW B;  3SWY A;  5M1B A;  4H13 C;  2W8Z A;  3B5N D;  3OJA B;  5AW1 B;  5AW3 B;  1K30 A;  1J1D B;  2CPB A;  1AA0 A;  1D7M A;  5AVR B;  4DJG A;  1UJZ A;  2CG5 B;  2VLQ A;  1JY3 O;  3FXD A;  3PLN A;  2JYG A;  3TF5 A;  1NTM K;  3MTU E;  5EW5 E;  1JUN A;  1VQ9 P;  2WWW A;  1GL2 D;  4DT0 A;  3H32 A;  4U0E A;  1M1J A;  1EZV E;  2KS1 A;  1PP9 D;  2YIU C;  2K5X A;  1KB9 I;  2QJY C;  2JAZ A;  2MKV A;  1LNQ A;  1FDM A;  4JBZ A;  1BAJ A;  3DS2 A;  4LGD E;  3T97 B;  3PP5 A;  2GDW A;  2KGA A;  5B66 H;  2O01 H;  3H1L J;  1WRG A;  1RE3 C;  5H2F E;  1SQP G;  2H89 C;  5B5E E;  4U0D A;  2B9B A;  4LC1 A;  2PEO A;  2JU1 A;  3B5N C;  2PGD A;  1OW8 A;  3M0D C;  5KLV D;  1GDT A;  1A43 A;  1NTM E;  2KOD A;  2N98 A;  3L73 D;  1Q7Y Q;  2YKO A;  2LIU A;  3L71 J;  4XFY A;  1Y8A A;  2AEF A;  4H0L B;  4EIJ A;  1L0L G;  5APQ A;  1VQO P;  3OW2 O;  1ZLL A;  2NZ2 A;  1GL2 C;  1JY2 O;  3Q5R A;  3G4S P;  1LWU B;  1H0T A;  3CPW O;  3G1G A;  1XTG B;  3NMD A;  1Y9B A;  2FYU K;  3CD6 P;  2PEN A;  4QKO A;  3KQG A;  3LMO A;  1P84 H;  5CBO A;  2XT1 A;  4XRQ A;  1MZ8 A;  1Y47 A;  5AVQ B;  2LTE A;  2ZT9 D;  1AF8 A;  2Z46 A;  1M90 Q;  3HD7 B;  2P10 A;  2ZVN B;  2GYK A;  2PFX A;  3GF3 A;  3P8M C;  3RK3 D;  3VOP A;  4ZKU A;  4HJG H;  1MFT A;  3PHL A;  1L0I A;  4H44 B;  1LTA C;  1M1K Q;  3BRV B;  3H1H G;  3QH9 A;  1XTC C;  1FOS E;  3V2N A;  1DH3 A;  2E74 D;  2N5I A;  4IL6 E;  2AXT E;  3L75 E;  3LID A;  2FBW C;  2WPR A;  1AV1 A;  1S2E A;  1IZN B;  1L4A A;  3GHG B;  2J58 A;  2BHV A;  3NTN A;  1FE6 A;  1KQF B;  2FFD A;  3TGU E;  4W7Y A;  4EYY Q;  2KK7 A;  2FYU E;  1PPJ D;  3SFE C;  4EI2 A;  2PP6 A;  3SWK A;  2P2U A;  4BXL A;  2WSS H;  5I4T G;  2GZG A;  1X9V A;  5AW2 B;  1RE4 A;  1FC2 C;  3L70 G;  3AEB C;  3W67 A;  3RL0 g;  2KR5 A;  1BCC G;  1BCC E;  1SQQ J;  1PFI A;  2ZT9 C;  1QL2 A;  1HUC A;  1EDK A;  3RK3 C;  2HLO A;  3RL0 B;  3VMX A;  5AVY B;  1W2B O;  1OWA A;  4RES B;  1CI6 A;  5BS2 A;  5DJU B;  2QM8 A;  4EOT A;  2H7H A;  1HGZ A;  4ZMD A;  1Q90 D;  2C0X A;  1VF5 B;  4CA3 A;  3MP7 B;  1G2C B;  2K9Y A;  3H0D A;  1NU1 J;  1H8A A;  1L4A D;  3EJB A;  1VQ7 P;  2O01 N;  1PEQ A;  3RK2 B;  2N9Y B;  4K3A A;  4PV1 D;  3AE6 C;  5AW9 B;  3G21 A;  1YIT P;  1AFO A;  2KLU A;  2KNC A;  3V5B A;  3CCS P;  2JO0 A;  1SQP D;  4L76 A;  5GTI H;  4PH1 A;  4ZKP A;  3EQ2 A;  3BRT B;  3C8V A;  4U3F G;  4U3F E;  2XKM A;  2ZYD A;  3H1K G;  1RO2 A;  2V7Q H;  1ZME C;  5CZD B;  2L4B A;  1M7L A;  1NTK G;  4DOJ A;  1L0L D;  2FY8 A;  3DS5 A;  2QJP C;  5APS A;  1KYO I;  2ITA A;  1FOS F;  2QIW A;  2CGQ A;  3L74 G;  2Q6Q A;  4HYT B;  2JKV A;  3L74 E;  4I7Z C;  1SQB J;  3GZL A;  3MGN A;  1KB9 D;  1YYC A;  4IZ6 A;  3CCQ P;  3H1L G;  2WMM A;  3H1L E;  1LP1 B;  4DZO A;  5KAF H;  4WVZ A;  1L4A C;  2H88 C;  1IK9 A;  5BU5 A;  1L0H A;  1ZP0 C;  4D6T J;  1K73 Q;  3A3Y B;  4AYC A;  2LL8 A;  3QWO C;  5HGM A;  1QX8 A;  2H43 A;  3E2D A;  2N1T B;  1W2E A;  3H1H D;  3HE5 B;  1T6A A;  3L35 A;  3L71 E;  1YHQ P;  1BSN A;  5HVC A;  1RF1 B;  2PEQ A;  2YKQ A;  1LTJ A;  2W6J H;  1N7S A;  2X2B A;  1SFC A;  3AEC C;  2OYO A;  3G26 A;  4PJ0 H;  4KHX A;  1PEM A;  2K2Q A;  2N6Y A;  5L8R J;  3CCE P;  3WU2 H;  3H1J G;  3EWK A;  3H1J E;  2LR2 A;  1KYO E;  5APX A;  1RNI A;  2E75 D;  1Q81 Q;  2Z4E A;  1FZC B;  2P1J A;  2OYH A;  3AEE C;  3EFF K;  3L70 D;  1QL1 A;  4PWV B;  1BCC D;  1SQQ K;  1CEI A;  3HUS C;  1BDC A;  1CZQ A;  4F37 A;  4GKG A;  3HD7 D;  1HTL C;  1E5W A;  1IFI A;  1GK4 A;  3TNU A;  2CK3 H;  2JWA A;  1JY3 N;  3L4F A;  3CWB J;  3FWN A;  1T2K D;  4I2L C;  4JQ0 D;  4HH2 A;  3F89 A;  2KGD A;  1Q2N A;  3H32 B;  2M8R A;  2EHT A;  3C1L A;  2EG5 A;  3I56 P;  3B4S A;  5KKZ B;  1M1J B;  1NU1 K;  3V6I A;  2ZXX A;  3LW5 J;  3G0V A;  4M3L A;  3RG6 C;  4WYM A;  2IYP A;  2GZE A;  3M91 A;  5KJ7 A;  5H2F H;  2OQQ A;  1BXI A;  4XFZ A;  4IFM A;  5B5E H;  4NPE A;  2E75 C;  5APT A;  1SQQ E;  2L9F A;  2IFM A;  4U3F D;  3OA7 A;  4WB4 A;  2C9N Y;  3H1K D;  2K0Y A;  3G9R A;  3O6Q B;  3P32 A;  2B87 A;  2WSC J;  1JB0 J;  3IAO A;  1N2D C;  3GF7 A;  2BAS A;  1NTK D;  5KLI B;  1EIA A;  2IBZ E;  2AEM A;  2M0B A;  4PD4 E;  2O1J A;  3CXH E;  3OAK A;  3B5N A;  1T2K C;  1RQU A;  2WPS A;  3M0D A;  1SQB K;  5GTH E;  2BCC J;  2WSE H;  1BE3 G;  1JY2 N;  1NU1 E;  3L74 D;  1BE3 E;  5KP7 B;  4BPH A;  1OZH A;  1SLQ A;  1H0T B;  2LOL A;  1PEU A;  1IMP A;  1E79 H;  2O3J A;  2G8Y A;  2XV5 A;  3H1L D;  4IOI H;  3P7K A;  2EHS A;  1SFC C;  3NFQ A;  1X3O A;  1SQX J;  1VQ6 P;  1FZB A;  2KZI A;  1GD2 E;  2Y9Y A;  2Y0D A;  1VDF A;  2WPQ A;  4RJT A;  5APW A;  5KJ7 D;  1QEX A;  4AQR D;  2KSE A;  1M56 D;  3HE4 B;  3USS A;  4YXD C;  2KGC A;  4XFX A;  3BAT A;  2M8N A;  2DNW A;  2Y9Z A;  4IL6 H;  4U0F A;  2AXT H;  4ZNC A;  1PZQ A;  1OMI A;  1L0N J;  1FU1 A;  2WTY A;  1JNM A;  3MD0 A;  1MKM A;  4L74 A;  3M9B A;  2MVU A;  5HGN A;  4TLF A;  3V4W A;  1YQ3 C;  1CW5 A;  1GK6 A;  1SQB E;  1EMV A;  3PH0 A;  3H1J D;  1OW7 A;  2FFD B;  1OW6 A;  2JGP A;  5CJ0 A;  1MFZ A;  1EC5 A;  3F5H A;  4N78 E;  5CCG D;  1TU3 F;  5APV A;  4D6T G;  2L0Q A;  4OGQ D;  4D6T E;  1ZW0 A;  3L72 J;  2GZJ A;  1NWQ A;  5APY A;  3D6Z A;  3BVH A;  1N73 A;  1N8R Q;  1AJY A;  2FVE A;  5KAI E;  1SQV J;  2ZJS E;  1BGY J;  5KJ7 C;  1EZV G;  1FJP A;  3Q20 A;  3NXS A;  3NTE A;  1AQT A;  1CI6 B;  5BU8 B;  2FAE A;  4QMA A;  3H47 A;  1GW4 A;  2YNY A;  2I1J A;  3DPH A;  2KOP A;  3NY7 B;  1RF0 C;  2VLO A;  1H89 A;  3IR9 A;  1NAF A;  2KXP B;  2IDB A;  1NTZ J;  2KOO A;  2YXQ B;  3K5B A;  2XND H;  1H88 A;  1IO4 A;  4MN4 C;  2C0W A;  3A7O A;  1IFP A;  1NTM G;  2FXM A;  2LIW A;  3S9O A;  2QJK B;  3VMZ A;  2KIK A;  4OGQ C;  4PH0 A;  1VQ5 P;  3HRN A;  3H1I G;  1VQM P;  4GDO A;  3H1I E;  4C7N B;  3CWB E;  2HPC B;  2D2C D;  1R5S A;  3CCV P;  2R32 A;  5F2N A;  1X79 B;  5F2O A;  1NGM B;  5EFW B;  1S4X A;  2HFE D;  2OYI A;  1KN7 A;  2Q3I A;  4EDF A;  1NH4 A;  3Q5S A;  3JC2 2;  1BE3 D;  1KV4 A;  4RO0 A;  1RF1 C;  1SQX K;  3B5I A;  3DS0 A;  3VMA A;  2WPT A;  4BRY B;  2ROQ A;  2W6B A;  1URQ D;  3CL3 D;  1OVU A;  4N6J A;  5AVU B;  1DEE G;  3L75 G;  2JB0 A;  2Z45 A;  1E6J P;  2FHS C;  1S1C X;  4B86 A;  4O9B A;  2I8D A;  3R2P A;  4MRT C;  1FZC C;  1NO4 A;  2JBG A;  2E76 D;  3SSU A;  2NPS B;  1LTG C;  1L0N K;  4BPG A;  2W6A A;  3GLM A;  3TGU G;  1IMQ A;  1N73 C;  3Q1M A;  5APU A;  2FYU G;  2AXC A;  1PP9 J;  2D2C C;  2GUV A;  4GR2 A;  2KLV A;  1N7S B;  3AE3 C;  2BCC E;  4XA4 A;  3V2R A;  2J59 M;  2PRR A;  2RMZ A;  2HOD A;  3CC2 P;  1AYI A;  1KIL B;  2XZ1 C;  1UNK A;  3G29 A;  1KYO H;  1RY3 A;  3DTJ A;  2P7J A;  1JTH A;  1F80 D;  1RH5 B;  4N78 D;  1LTB C;  1SQX E;  4U0C A;  5CMZ A;  4COC A;  1DD3 A;  2N50 A;  4NEO A;  3RGU A;  5KKZ C;  2OYH B;  4D6T D;  4IFF A;  3AE8 C;  3HTK A;  2BQ1 E;  5DJT B;  3S4R A;  1JMM A;  4LLH A;  2Z5H A;  4COP A;  5KLV J;  5CCH D;  1URQ C;  3EJE A;  1VPC A;  1VQL P;  4JPZ B;  2E74 C;  3TNU B;  1LT9 B;  4A7P A;  1EZV D;  1IK7 A;  1IFD A;  4GIF A;  4H2X C;  3WBH A;  1L0N E;  4HKG A;  3CCL P;  1KQG B;  2J5U A;  4H13 B;  2Z5I A;  1HH0 A;  2FAC A;  3U1A A;  1USD A;  2E76 C;  2QSI A;  3HUS A;  2KB7 P;  2KYV A;  4I1L A;  2IZ1 A;  3G3Z A;  4I6M C;  2WT7 B;  1NTZ K;  2M8P A;  3KPE A;  2AFD A;  1AQ5 A;  2KG6 A;  1WT6 A;  2Q3E A;  2RN0 A;  3MGE A;  2XNX A;  1PIX A;  2OYI C;  2LXB A;  3KDP B;  1KIL E;  1OVV A;  1EQ7 A;  3L72 E;  1VQN P;  2O1K A;  1FDI A;  5HGL A;  1IFM A;  1K8A Q;  1NTM D;  2R3C A;  2WPV B;  2YIU B;  2QJY B;  2VSQ A;  1KQL A;  4WY4 B;  2E42 A;  1YBK A;  1BGY E;  3H1I D;  1S5L X;  2W83 C;  5EJD A;  4W80 A;  3I5C A;  3GKL C;  2OGU A;  1ZV8 A;  5CCH C;  4OWF A;  2MVV A;  2FXP A;  4Y99 C;  2MR7 A;  1IFJ A;  4R4L A;  2OTL P;  3CXH H;  4GOD A;  2AFE A;  3B71 A;  2RKL A;  1J1E C;  1S9K E;  1NTZ E;  3AE1 C;  5KP8 B;  1P84 E;  3HD7 A;  5K5G B;  4PV1 C;  1GPJ A;  2E5Y A;  3M0A A;  3CE7 A;  4BPF A;  2YMK A;  3L71 G;  3Q5P A;  4OH8 B;  4DCK A;  4IFD K;  2A06 E;  1GL2 B;  3L75 D;  3KXD A;  3G1I A;  1J1D C;  3FWL A;  2JO1 A;  1FAV A;  2WSF H;  2A45 I;  2GDX A;  4QNB A;  4H0L D;  3B4Q A;  3TGU D;  5AW0 B;  3GHG A;  5HGO A;  2K0X A;  3P8C E;  2FYU D;  2IFN A;  2E1M A;  2M3E A;  2YMY A;  2KOQ A;  3V2P A;  3AEA C;  2LKI A;  2ZAE B;  2NRG A;  3LIE A;  2E5T A;  2KGE A;  2KW2 A;  3KZI E;  1OXZ A;  2KG9 A;  2CWO A;  2KP8 A;  1OIP A;  1SQP J;  4HB1 A;  1DD4 A;  4ASV A;  4H44 D;  2PEI A;  2FYN B;  2IBZ I;  4AUW A;  2HG5 D;  5KLV K;  2R44 A;  1YQ4 C;  3AE7 C;  4PD4 I;  4XFJ A;  3CXH I;  2M5A A;  1KMI Z;  1NQ4 A;  3N7N A;  5KAI H;  3MHV A;  3L37 A;  2IPP A;  4GT1 A;  4C46 A;  3A2A A;  1GXG A;  2KS1 B;  1JO5 A;  2G3A A;  1L0L J;  4GR6 A;  3CC4 P;  2YO2 A;  1SVF A;  1PP9 E;  2NPS D;  1D1D A;  1YTZ T;  5E79 E;  3D71 A;  3D6Y A;  2WIT A;  4H0L C;  3GJN A;  3I55 P;  2ZT9 B;  5AW8 B;  5F2K A;  5AW5 B;  2GUS A;  3CXC O;  2KSJ A;  1ZMB A;  3RK3 B;  1UII A;  1SQQ G;  2SPZ A;  1LWU C;  2MY5 A;  1RQV A;  3M06 A;  3CX5 I;  2P9X A;  1RF0 A;  2Z44 A;  3BCC J;  3VP8 A;  3H1H J;  5KLV E;  2ZVO B;  3HD7 C;  2YXR B;  1ZR2 A;  3TYY A;  2QE7 H;  2IBZ G;  3RL0 D;  5KTB A;  5BS1 A;  4HKZ H;  4H44 C;  2N6Z A;  1LTS C;  1NOH A;  1JOC A;  1NU1 G;  1QVF O;  4GOE A;  1VF5 D;  2L91 A;  4CPG A;  2KUB A;  1ACP A;  1BSH A;  5CCG A;  3S1K A;  2JJL A;  2QG4 A;  4H13 D;  1GU4 A;  5AVV B;  1DNY A;  2JDI H;  1EXJ A;  2B88 A;  2NPS C;  3Q2Y A;  2VLN A;  2KWL A;  3RK2 D;  1OFC X;  1HJB A;  3LW5 H;  1YI2 P;  3B8E B;  3GHG C;  1K05 A;  1QLE D;  1GMJ A;  2ZYG A;  2ZYA A;  1JY3 P;  3L70 J;  3RK3 E;  1LT1 A;  1NKN A;  1NYH A;  3DS3 A;  1BCC J;  1LGH B;  1X22 A;  2QJP B;  3L71 D;  2R5B A;  3PTZ A;  3HE5 A;  2POH A;  3CX5 E;  4UB8 E;  2GM4 A;  3VYI A;  1M57 D;  1KOR A;  3II6 A;  4I7Z B;  4U0B A;  2AVA A;  2FYZ A;  1RF1 A;  2VLP A;  4U7J A;  4WY4 D;  3A0H E;  4UHP B;  2JQ4 A;  2MJZ A;  2KG8 A;  1PGP A;  3VRL C;  1SQB G;  1L4A B;  1JMB A;  1VKU A;  4ASW A;  3RL0 C;  2GDY A;  2L6E A;  3MUD C;  3V2Q A;  1KYO D;  3JCU E;  1DIP A;  5AVZ B;  2BEQ D;  2O01 J;  1HQB A;  1LT9 C;  1PPJ E;  1FZC A;  1VF5 C;  2HOD B;  4WBA A;  4Y28 J;  1MZ9 A;  3SFD C;  1KTM A;  1JTH B;  1SQP K;  2PY8 A;  3RK2 C;  4NPF X;  3P05 A;  5TJH A;  4U0A A;  4PXH B;  2K9J A;  3HTK B;  4U3F J;  2N1T D;  3IF4 A;  1W5C E;  1VL2 A;  1USE A;  3H1K J;  1ZR4 A;  1PGO A;  4JYB A;  2QEX P;  2E43 A;  1FS0 E;  1JY2 P;  2JP3 A;  3DS1 A;  1L0L K;  1LTT C;  3CME P;  1NTK J;  3M9H A;  1HJ0 A;  1HGV A;  2UWJ E;  5AVT B;  2BUO A;  4YTP C;  4WY4 C;  2BEZ F;  1DEB A;  3ZDM A;  1S72 P;  3CCJ P;  3HUS B;  1HWT C;  2HYN A;  3L74 J;  1FZF A;  1URQ A;  3CLQ A;  1G1J A;  2L5G B;  5KP6 B;  1GTW A;  2KNC B;  1M74 A;  4OVN F;  1KFM A;  3IFM A;  1IUQ A;  1SQQ D;  1T3J A;  5CCG C;  2QA4 P;  1SQP E;  4UB6 E;  2K0D X;  2EFJ A;  2ZFC A;  3CWB G;  2YO3 A;  3E1I A;  1NKZ B;  3O6Q A;  2WZ7 A;  5CBN A;  1KQS O;  2IBZ D;  1S3J A;  4PD4 D;  1HVV A;  3CXH D;  1MV8 A;  1DX7 A;  3HZQ A;  2GA1 A;  2N1T C;  3U1C A;  3SWF A;  1L0L E;  3AE2 C;  3A0B E;  1M6E X;  1NU1 D;  2JWD A;  4H2W C;  1S5L E;  1JM0 A;  1A02 J;  5AW4 B;  2OTJ P;  2Q5U A;  2E75 B;  1NJI Q;  2CNR A;  3AE9 C;  2XV6 A;  2DGY A;  1KB9 E;  1GU5 A;  5AVX B;  3H1J J;  2JR8 A;  1EDJ A;  3BAS A;  2LXC B;  2VRS A;  5CCH A;  2LF4 A;  1PGJ A;  2QM7 A;  3HE4 A;  3BCC G;  2K3R A;  4JF7 A;  3BCC E;  3VTP C;  2QNW A;  2AF8 A;  3U43 A;  3H1H E;  3CX5 D;  2FQ0 A;  1VHN A;  5TIS E;  2RH0 A;  4YXW H;  4N3Y B;  3N4X A;  3O8Z A;  4YPC A;  2JU2 A;  3RBX A;  1LTJ B;  2MR8 A;  2BCC G;  1SFC B;  1SP4 A;  3PJS K;  1NVO A;  1SQB D;  2FYN C;  2FVF A;  2H8P D;  1K9M Q;  2PEK A;  2PEJ A;  1AVO A;  2XDJ A;  2CPS A;  1U7J A;  1SQX G;  2KOG A;  2GZF A;  1YTZ I;  2M3B A;  1AVY A;  1Q82 Q;  3ITK A;  1KFN A;  2EIA A;  2N5H A;  1QRJ A;  1JCC A;  1M1J C;  3KZI H;  2P67 A;  1T3U A;  1L2P A;  3GG2 A;  2K92 A;  3PRJ A;  2HR3 A;  1JEK A;  1NAY A;  3L70 E;  1SQV K;  3A5T A;  2K94 A;  1EOQ A;  1N7L A;  2XXM A;  3H6P A;  1IC2 A;  4BWN A;  2FAD A;  3L73 J;  2V7Q J;  1ZRT E;  5HV8 A;  2ONT A;  1FZG A;  4WWI A;  1L0N G;  3VMY A;  2WQY C;  1M8O B;  4GOF A;  7CEI A;  2M5A B;  2C9L Y;  2KOS A;  1NTK K;  2IZ0 A;  2R3S A;  1P84 I;  1HBW A;  3T97 A;  2L22 A;  3HYB A;  3DS4 A;  1UIX A;  3RBZ A;  3H4E A;  2A45 H;  2KOR A;  1R5L A;  5B66 E;  5E79 H;  5KLI C;  1BE3 J;  1KC8 Q;  2XU6 A;  4XRO A;  1T8K A;  3L72 G;  2K93 A;  1FZA A;  4RKU J;  5AW7 B;  2PEM A;  3AEG C;  1X8Y A;  2P58 A;  2FQ1 A;  1HY8 A;  1SQV G;  3EJD A;  3VN0 A;  2QRX A;  1SQV E;  1BGY G;  1Z6M A;  3H25 A;  1PGQ A;  3AE5 C;  3CWB D;  3G28 A;  3MIW A;  1RHZ B;  4C7N A;  1NHL A;  2HPC A;  2PAJ A;  3H1K E;  2B87 B;  1PV3 A;  3GMA A;  5AVS B;  3EFG A;  2WSF J;  2OTK E;  1LWU A;  1VQP P;  4PD4 H;  3E7K A;  2ERH A;  1NTK E;  2MF4 A;  5GTH H;  1NTZ G;  3GZM A;  3B5N B;  4KJM A;  2N9B A;  1GZL A;  2K88 A;  5CJ4 A;  3CMA P;  3UIA A;  5AVW B;  2MD9 A;  4XE5 B;  4OGQ B;  3RG2 A;  1ZN5 A;  4BRY A;  4R0M A;  4IL6 X;  2A06 G;  1KZU B;  2JEE A;  2FFD C;  3TSI A;  5DCK A;  1LTI C;  1N86 A;  3BCC D;  1KLP A;  4IPY A;  2FXO A;  1IJD B;  3CX5 H;  3JSV C;  4UB8 H;  1LJ2 A;  2NPS A;  1RE4 C;  1MUU A;  3E1R A;  4L73 A;  1FZE A;  3D70 A;  3A0H H;  2M5R A;  2FQ2 A;  2LPK A;  1OVR A;  2LML A;  2BCC D;  1ZXG A;  1YJ9 P;  3AE4 C;  3JCU H;  1KIL A;  3U59 A;  2W90 A;  1SQX D;  2XZ0 D;  1CSB A;  1DV5 A;  1Q86 Q;  2V4H A;  1HF9 A;  3W68 A;  3IN6 A;  1AUM A;  2KI7 B;  3FGA D;  3CC7 P;  1EDL A;  3WUT A;  1EXI A;  1M6N A;  1YIJ P;  2W27 A;  1ZOY C;  5JPA A;  3MUD A;  2KZJ A;  1N73 B;  1NTM J;  2D2C B;  1YJW P;  1JJ2 O;  1ZRT D;  1A8O A;  4K35 A;  1LT9 A;  1FJK A;  1L0N D;  3ABV C;  2K9J B;  3H1I J;  2DW3 A;  3VP9 A;  1PP9 G;  2A45 G;  1G2C A;  2PNG A;  4Z1M H;  1GW3 A;  2QJK C;  3R4Y A;  2NO8 A;  3LRY A;  1GXH A;  1RO0 A;  2Q1K A;  1U57 A;  2WSE J;  1EDI A;  1QGK B;  2M8L A;  1T8Z A;  2WT7 A;  2YKP A;  1N7S D;  2B89 A;  1U7M A;  1SFC D;  2IX7 C;  1VQ8 P; 
#chains in the Genus database with same CATH homology
 1VQ6 P;  5BS1 A;  2PY8 A;  1A43 A;  2XV6 A;  5DCK A;  2DGY A;  2KOD A;  1Q7Y Q;  1VQN P;  3CCR P;  5HGL A;  3G71 P;  4M0I A;  1VQK P;  3P05 A;  4IPY A;  1K8A Q;  4XFY A;  4U0A A;  3HYB A;  3M1M A;  3DS4 A;  1QVF O;  1KD1 Q;  3H4E A;  1VQO P;  3CCQ P;  3CCU P;  3OW2 O;  2EG5 A;  3I56 P;  2LF4 A;  4XFX A;  4GR2 A;  2M8N A;  2CWO A;  2QEX P;  1KC8 Q;  3G4S P;  1PEO A;  3DS1 A;  1W2B O;  3CC2 P;  4U0F A;  2JYL A;  1K73 Q;  4XRO A;  5BS2 A;  3G1G A;  3CPW O;  3CME P;  3G29 A;  1K30 A;  1YJ9 P;  2PEI A;  3CD6 P;  2PEN A;  3DTJ A;  1YI2 P;  1QVG O;  5HGM A;  2BUO A;  2PEM A;  3E2D A;  3G0V A;  2XT1 A;  4XRQ A;  3RG6 C;  2OTL P;  4PH0 A;  4WYM A;  1VQ5 P;  4U0C A;  1VQM P;  2JYG A;  5HGN A;  4COC A;  1S72 P;  3CCJ P;  2Z46 A;  1M90 Q;  3CCV P;  1YHQ P;  3DS3 A;  1VQ4 P;  4XFZ A;  3H0D A;  1VQ9 P;  2BQ1 E;  1Q86 Q;  5F2N A;  5F2O A;  3G28 A;  1VQ7 P;  4U0E A;  2PEQ A;  1M74 A;  4GR6 A;  3CC4 P;  1PEQ A;  1M1K Q;  1AUM A;  2OAR A;  3CC7 P;  1IUQ A;  1M6N A;  4COP A;  1YIJ P;  1K9M Q;  3G21 A;  4U0B A;  2PEK A;  1D1D A;  1YIT P;  2PEJ A;  2QA4 P;  5JPA A;  1VQL P;  1VQP P;  3G26 A;  3I55 P;  3CCS P;  2JO0 A;  1PEM A;  5F2K A;  1Q82 Q;  2EFJ A;  3WBH A;  1YJW P;  1JJ2 O;  3CCE P;  1YJN P;  4PH1 A;  2EIA A;  1A8O A;  1QRJ A;  3VRL C;  3CXC O;  3CCL P;  1BAJ A;  1ZMB A;  3DS2 A;  1EIA A;  2L6E A;  1RNI A;  1N8R Q;  1KQS O;  3B5I A;  3G1I A;  1Q81 Q;  3DS0 A;  3G6E P;  3CMA P;  2P9X A;  1EOQ A;  2BHV A;  2XXM A;  1RO2 A;  3HZQ A;  3Q20 A;  2M8P A;  3CCM P;  3NTE A;  3LRY A;  1RO0 A;  4QNB A;  2Z44 A;  4U0D A;  2ONT A;  1M6E X;  1PEU A;  2M8L A;  2Z45 A;  1E6J P;  5HGO A;  3MGE A;  3DS5 A;  3H47 A;  2PEO A;  2OTJ P;  3DPH A;  5I4T G;  2E1M A;  1NJI Q;  1VQ8 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...