1VQ6P

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 45
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq6P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq6P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq6P02
3CCUP 1VQNP 1W2BO 1YHQP 3CCRP 1Q81Q 1KC8Q 3CCVP 3OW2O 3CCJP 1YI2P 1VQPP 1KQSO 1KD1Q 3G4SP 3I56P 1N8RQ 1YITP 1YJ9P 1VQ6P 3I55P 3CCEP 1VQ7P 3CPWO 1VQKP 3CC7P 3G6EP 2OTJP 1VQ5P 1VQ9P 3CCMP 1VQLP 3CXCO 3CD6P 1QVGO 2QEXP 1S72P 1K73Q 1K9MQ 2OTLP 2QA4P 1K8AQ 1YJNP 1VQOP 1Q82Q 1NJIQ 3CCSP 3CCQP 1VQ4P 3CMEP 1QVFO 1YJWP 1M1KQ 3CC2P 1Q7YQ 3G71P 1Q86Q 3CMAP 1VQ8P 3CCLP 1JJ2O 1VQMP 1M90Q 3CC4P 1YIJP
chains in the Genus database with same CATH superfamily
2FVEA 1L0NG 2I8DA 1LTIC 2E42A 4IFFA 5AVRB 5L8RJ 1X8YA 3MUDA 3VYIA 3MGEA 2K1AA 3L37A 1IMQA 1ZR4A 1HWTC 3NTEA 2R3CA 1NTKK 3H1KG 2JU1A 3VP9A 5BS2A 3P8CD 4DZOA 2FHSC 4C7RA 2H43A 2H7HA 4PV1B 1IZNB 3AE4C 1EZVD 2O3JA 5KLVG 3RG6C 2QSIA 1NH4A 3Q1MA 2P9XA 2K93A 1E5WA 1HJ0A 2GDWA 2KYVA 1EZVG 2G3AA 2Q1KA 2M5AA 2JO1A 2LOLA 3B8EB 5HGLA 5APWA 1JY3P 1SQVD 3WBHA 4MN4C 2FYUE 3L72D 1CZQA 2YO3A 3U1AA 4EOTA 2BEZF 1QL2A 2JAZA 1XTGB 5CHXA 4XROA 3G0VA 1VPCA 3A0BE 1RF1B 2KGAA 1SQVG 2QRXA 5AW5B 1AA0A 2N9BA 4RJTA 1FZFA 1VQMP 1GL2A 3CC4P 3TK1A 4PD4I 2LPKA 3L74J 2VLOA 3H6PA 2K0DX 4N3YB 2WSSH 1NTMD 2OYIA 1AYIA 2HLOA 2KB7P 1L4AA 3GHGA 1EZVI 4CA3A 1NTMG 2B9BA 1LNQA 2QJYB 2AEJA 2Y0DA 3SWYA 2K2QA 1NU1D 3JC22 2QEXP 2PEIA 3CI9A 2PEMA 3T97A 3M0DC 4L74A 1YJWP 2VLPA 2WITA 3KZIH 5AW4B 3C1LA 3IFMA 5H2FH 4Z1MH 1KFNA 3L71D 1L0NJ 4L76A 3ZDMA 2AXTE 1NU1G 1A43A 2KSJA 1URQD 4JF7A 2H88C 3H1IJ 4DJGA 3RK3E 3U59A 5KP8B 1KB9H 2QNWA 3H1KJ 2WPRA 2GZJA 2D2CD 2K9JB 3L71G 2M8LA 5EFWB 4L75A 3NMDA 1SQQD 3GLMA 1L0NE 3M0AA 5B66H 2Y0CA 1Q81Q 2RH0A 3RL0C 2AF8A 3HUSA 3H1IE 1PP9G 1SFCA 2KR5A 2PFXA 2FXMA 3H1KE 4PD4H 2BCCD 2XNXA 4HKGA 5I4TG 3CMEP 1SQBK 3Q20A 1IFNA 2EIAA 2WSEJ 2AEFA 1M1JC 2B87A 2CK3H 2QJKC 2IBZG 3JCUH 2BCCG 3S9OA 3NXSA 2HYNA 3P8CE 2ZXXA 3S4RA 3A7OA 1GDTA 4Y99B 2KNCA 2ZYAA 1OZHA 2UWJE 3HD7D 1LGHB 1JTHA 1EZVE 1SQVJ 5F2NA 3G28A 2OARA 3BCCD 4OWFA 1YTZI 3H32B 4L73A 4KT0J 3F89A 1OXZA 4DG9A 2L5GB 2XXMA 3H0DA 4XRQA 1MUUA 1RHZB 1BE3D 1S72P 1U7JA 3BCCG 3USSA 4XA4A 1SQVE 5GTIH 3P8MC 3L72E 3HD7B 2YKOA 5KKZC 3Q3DA 2PY8A 2LL8A 1NTMJ 1KV4A 1LT1A 3AEDC 1MFTA 2ITAA 1LT9C 2PEKA 2JR8A 3AEFC 5TISH 5BVZA 2YXRB 1RY3A 2P10A 1GXGA 1HGZA 1LP1B 1ZNVA 2Q5UA 1NTME 1SQPD 3P7KA 1YJ9P 1NU1J 2JGPA 2CPBA 1EDIA 1H88A 1T3JA 2WVRA 1GMJA 1LTBC 1IFJA 3G29A 1NAFA 3L71J 1LWUB 1J1EC 1M6NA 3LRYA 5CBNA 4KJMA 4N78D 4U3FD 3B4SA 2E1MA 1NU1E 1YBKA 2RN0A 2JB0A 2FYNC 1PP9J 4IZ6A 1IK9A 2I1KA 4H0LC 3AE8C 1KFMA 3R2PA 4LLHA 3L71E 2ZVOB 5HGOA 1UNKA 1SS1A 1DNYA 1S1CX 2PEQA 2PAJA 2LMLA 2ERHA 1KC8Q 1LTJC 2QJPC 4C7NB 4LC1A 4WY4B 2WSCJ 1Z56A 1EOQA 2JP3A 2EG5A 2BCCJ 2M8RA 2KGCA 2M5RA 4IFMA 1USDA 1DH3A 2GDYA 5CCHC 1SQQE 3FWLA 2LR2A 3WU2H 1YTZT 2Q3EA 1ZMEC 4WWIA 1N73B 2KK7A 2YIUB 4IFDK 3TF5A 3P32A 4WB4A 5DJUB 4EDFA 1KQSO 3UIAA 2BCCE 2FVAA 2K5XA 2FQ1A 4JPZB 4XFJA 1P84D 3L75D 4H13C 5E79E 2OYOA 3BCCJ 1Q82Q 4PJ0H 1QX8A 3PLNA 3D71A 1JJ2O 1YIJP 2HODA 3DS1A 4R0MA 1BE3J 4WYMA 1DD4A 3FGAD 3Q2YA 3BCCE 2C9LY 3O6QB 1GL2D 1IFIA 2M5AB 2IYOA 4BPHA 2NZ2A 1WT6A 2A45I 1NKNA 1BE3E 2KGDA 3H1HD 2HR3A 1G2CB 2G8YA 1L4AD 5CCGA 2E76D 2N6YA 2YKPA 1PZQA 3BRVB 4JBZA 1SQXD 3H1HG 5AW3B 2W6JH 1P84I 3TYYA 5HGNA 5AW0B 2KOPA 3E1RA 1K04A 2OYHB 1RE3C 2JJLA 2L6EA 1SQXG 1L4AB 2JBGA 5F2OA 2WSFH 4AYCA 2E76B 3M91A 1SQPE 3II6A 2Q7CA 1S9KD 3CCLP 1Y8AA 4HH2A 1L0NK 1FZCC 3TGUD 3VTPC 3R4YA 2FYUG 2XKMA 1HF9A 3BRTB 1JMMA 1RO2A 3MZWB 4AUWA 4N78E 4U3FE 4K3AA 1QVFO 1LT9A 4RESB 3TGUG 2KZJA 4R4MA 3I5CA 2M0BA 5AVVB 1FZEA 2O01N 4U0BA 2PEOA 1PGPA 3O8ZA 1HJBA 4JQ0D 2B89A 2A45H 1ZMBA 2IZ0A 1ACPA 1NWQA 1U7MA 2C0XA 1M74A 4ASWA 2L0QA 3L36A 2W27A 2DNWA 3ITKA 1NVOA 3L35A 1EQ7A 3L70D 1LWUA 3GG2A 3HUSB 4YXDC 4PH1A 2BASA 1BSNA 4DT0A 3VOPA 1FJPA 3EWKA 3L70G 3CXHH 4MRTC 3RK2C 2MVUA 1SQVK 4GKGA 2GZIA 1VQ8P 4WVZA 4RO0A 2Y0EA 1PEMA 1AV1A 1BCCD 3BATA 1YI2P 1P84E 3L75E 3G4SP 1KB9D 2HG5D 4WY4A 3D6YA 3DS0A 1LTJA 1FOSF 1JY2P 2KNCB 1FJKA 1JTHB 4GOFA 2I1JA 1JM0A 1BCCG 3HRNA 4RKUJ 2FYZA 2FFDB 1NKZB 2DW3A 2N1TB 2WPVB 3H1HJ 1N73A 2W83C 1NTMK 2KOOA 1S5LH 4PD4D 1M56D 3H1IG 3QH9A 2XZRA 3VRLC 1G1JA 3AECC 3QWOC 1EDJA 2IPPA 2IYPA 1SQXJ 1D7MA 3V6IA 2JWAA 3DS3A 2MKVA 3D70A 1GW3A 1JY2N 1HVVA 3H1HE 2DGYA 4DCKA 1NU1K 1CI6B 1Q90D 2FYUJ 5AVXB 5KLIC 2CQ8A 3G1GA 1PEUA 1SQXE 3HTKA 3M06A 3O6QA 3G71P 1WRGA 3TGUJ 2NPSC 1QEXA 2CWOA 1KB9I 2J59M 2VSQA 5KJ7C 2IZ1A 3HE5B 3RL0g 2IFMA 2SPZA 2ZFCA 1G2CA 1PL5A 1M57D 2K3RA 1SQQK 3TGUE 3HYBA 4HJGH 3L72G 1M90Q 1NOHA 4PH0A 1OMIA 3FWNA 1QLED 2FXPA 4HB1A 2OYHA 3L70J 2FACA 1H8AA 1DX7A 1GTWA 1RE3A 4H44C 5DCKA 3AE6C 4W7ZA 1KILC 2GZFA 1R5SA 4JYCA 1L0LD 3L70E 5CMZA 1NTKD 1M1KQ 1BCCJ 2KW2A 1DEEG 3M9QA 5APTA 2J5UA 3G26A 2EFJA 1EIAA 2CPSA 1DIPA 3RL0D 4QNBA 3E7KA 4XFZA 3KZIE 1EDKA 5H2FE 5KAIH 1L0LG 2GM4A 1QGKB 2XV5A 3AEGC 3VN0A 4TT3H 2WWWA 5AVYB 3C8VA 1BCCE 2IDBA 4COCA 1Q7YQ 2QVAA 2HODB 1FOSE 1DEBA 5BU5A 1KB9E 3CLQA 3MHVA 4XFYA 1FAVA 4UHPB 4IL6H 5BU8B 1KQFB 5CCGD 1IC2A 3RL0B 1S5LX 4CPGA 5B66E 2EHSA 3AEEC 1QRJA 3DTJA 2M3BA 2Q9IA 3LMOA 1GZLA 2KG9A 1FE6A 1SQQG 3GKLC 5TJHA 2NO8A 1XTCC 2V4HA 2BQ1E 4PD4E 4H2YC 2FKWB 3CCVP 1URQC 3AE3C 1KQGB 2KXPB 2M8NA 2E75C 1M1JB 3KHUA 3CPWO 1HTLC 2QJKB 1PIXA 2D2CC 1BDCA 2KI7B 3M9BA 1LTTC 2GUVA 3Q5PA 1UJZA 2JEEA 2GUSA 3L72J 3PJSK 1IFDA 4EIJA 1Y9BA 2FFDA 1HH0A 2N1TA 4UB8H 3HE4B 2WSEH 4TLFA 2PRRA 3CX5H 3WUUA 5AW9B 2Z46A 5AVZB 3GF3A 5CJ4A 1RF0C 3A3YB 1OWAA 2AVAA 4BWNA 5GTIE 3I56P 2LIUA 5KKZB 1BE3G 2KZIA 3VMZA 1CI6A 1NTZD 2JQ4A 2LKMA 1QVGO 1LT9B 2FVFA 3VMXA 2AFDA 4U0CA 2GZEA 1M8OB 4I7ZC 3V4QA 4PXHB 5TISE 1OFCX 5CZDB 1NTZG 3Q5SA 3A0HH 3G9RA 3HE5A 1L0LJ 1E79H 2H89C 4W7YA 4H0LD 1KORA 1SLQA 1SQPG 4UB6H 1YHQP 1NAYA 1VF5C 4WY4D 1J1EB 2WTYA 1L0LE 2N98A 4ZKUA 3GZLA 3W67A 1NTKE 3WMM0 5AVSB 2K92A 2E43A 2KSEA 2FYNB 2N6ZA 3DPHA 4U3FG 1SQQJ 4H0LB 4DOJA 5HVCA 3A5TA 1KZUB 1L2PA 1W2EA 4D6TD 2A06D 4IL6X 2H8PD 1LTJB 2QJPB 2KORA 1MFZA 3DS2A 1MKMA 1NJIQ 1SQXK 2VLQA 1Q86Q 1N7SC 2A45G 1MV8A 3KYQA 3GZMA 1IFMA 4D6TG 1OVRA 1BSHA 3M0DA 2V7QJ 2MF4A 1R8EA 2FYUK 3WU2E 2WQYC 2XT1A 3CXHD 4BXLA 5KAFH 3CWBD 2EHTA 1LTAC 1ZN5A 3MUDC 4H13B 2AXCA 1FU1A 3LIEA 4PJ0E 3CWBG 3L75G 2K94A 2JDIH 2Z4EA 2OTJP 1K30A 2YNYA 3HTKB 1HGVA 1T3UA 2LF4A 3H1JD 3D6ZA 1X3OA 4BPGA 2Y9YA 3PHLA 5AW2B 2M3EA 1NTZJ 2GZGA 2XZ0D 3KPEA 1JCDA 2KOGA 4BRYB 1H0TA 3H1LD 1VL2A 3Q5RA 1OVUA 2C9NY 1M1JA 3JSVC 3H1JG 3IAOA 2LTEA 1VQ4P 1VKUA 2FY8A 4GOEA 1MZ8A 1SQPJ 3B5NC 3IR9A 3H1LG 1NTZE 3CXHI 2WSFJ 1CW5A 2LXCB 2IFNA 2R32A 1RH5B 2FQ0A 2P67A 2ZVNB 5AW8B 3CD6P 3HE4A 1GL2C 3EJEA 4EYYQ 3E2DA 2E74C 3RBZA 5BS1A 2FADA 4U3FJ 1DV5A 5GTHH 1KYOI 4U7JA 2W6AA 4M0IA 3I55P 3V2PA 2OYIC 4OGQC 1ZR2A 2HFED 1FZCB 1BXIA 3G6EP 3GHGC 1GU5A 3CCMP 2MVVA 1N2DC 1NO4A 1FS0E 3IF4A 2VRSA 5B5EH 1GPJA 3AEAC 2ONTA 1JEKA 3DS5A 4D6TJ 2KOQA 3H4EA 1GXHA 1VQPP 4ZNCA 1GK4A 1PEQA 2O01H 3EJDA 2Z44A 3MIWA 2X2BA 4ZKPA 1MZ9A 3U43A 1N7LA 1FBMA 2YO2A 1T8ZA 3RK2D 3V2NA 1JY3O 1X79B 4KHXA 2KLUA 4D6TE 3KXDA 1AQTA 2YXQB 2A06E 2P2UA 1S3JA 3EQ2A 1RE4C 4R4LA 2MR8A 2PP6A 2QE7H 1TU3F 3FXEA 3MD0A 1OVVA 3LW5J 3CWBJ 1IUQA 3L75J 3L74D 2WPQA 1RO0A 2QA4P 2JO0A 4GR6A 3N4XA 2ZXEB 2J58A 4GDOA 2N1TD 1D1DA 1J1DC 1SFCC 3RK2B 1FDMA 3PP5A 3CXHE 4AQRD 3SFEC 2KP8A 4YPCA 4QMAA 3CWBE 1T8KA 1BDDA 4ZMDA 3PH0A 1AUMA 2ZYGA 1E0HA 2LXBA 1S2EA 1KYOH 2KS1B 3H1JJ 1KTMA 3CCQP 1M7LA 1PPJD 1PV3A 1JCCA 1EMVA 2HPCA 3EFGA 5APYA 1ZLLA 1UIXA 5CCHA 2ZT9C 3MTUE 1L0IA 2LIWA 3H1LJ 2MJZA 4XE5B 2AFEA 1N7SA 4NPDA 4HKZH 2PENA 3M9HA 3A2AA 1PPJG 3NFQA 3H1JE 1LTSC 1K9MQ 3RK3C 1S5LE 4BPFA 1T2KC 4GR2A 1USEA 3H1LE 2NPSD 5KJ7D 1L0LK 1GD2E 5KLVD 4LGDE 1RNIA 1L0HA 4PV1C 5KLIB 2YMYA 4Y28J 1WMKA 1M6EX 2WMMA 2AEMA 1J2JB 4XFXA 2Q3IA 5APSA 1AJYA 2PGDA 2NPSB 1OW7A 1FC2C 1A02F 1ZXGA 3CX5D 2R3SA 4BRYA 1JMBA 2Z5HA 4GIFA 1S9KE 1QL1A 3RBXA 1E6JP 3ABVC 3AE1C 1FR2A 5KTBA 3GMAA 4IOIH 3SWKA 4H44D 1IO4A 2CGQA 3A0BH 3SWFA 1VQ6P 1KILD 2B88A 2XU6A 1RF1C 1GW4A 3B5NA 1VQ7P 1YQ3C 2JU2A 1ZP0C 1K73Q 4N6JA 2L91A 4M3LA 1AFOA 3VP8A 2N5IA 1JY3N 4H44B 4NPEA 2IX7C 4F37A 1KILB 1FZCA 1GU4A 1FZBA 1VDFA 1OR5A 3BASA 2N9YB 3EJBA 3B71A 5JPAA 2QJYC 1PEOA 5EJDA 5APXA 3L74E 1JOCA 2YMKA 3SFDC 1OW8A 4ASVA 3CX5I 2K0XA 1ZRTD 2MY5A 3TNUA 1NTKG 3VMAA 2KOSA 5KAIE 3CCSP 2AXTH 1R5LA 3KQGA 2PNGA 2XZ1C 2BHVA 4I6MC 1NTZK 1KD1Q 3GF7A 2E75D 1PPJE 1RE4A 3FX0A 1OIPA 1KMIZ 1NYHA 1PP9D 4IL6E 3OJAB 3MGNA 2WT7A 3AE7C 4H2XC 1SQPK 3IN6A 2XDJA 5CJ0A 2QIWA 2W6BA 2L9FA 5KLVJ 1H0TB 2OTKE 2MR7A 2FXOA 2LKIA 1URQB 3CC7P 5APQA 4OVNF 1X0TA 2E75B 2IBZD 3EFFK 3B5IA 4W80A 1K05A 2E5TA 2KS1A 2RKLA 3JCUE 2D2CB 1UIIA 1A02J 1FDIA 5KLVE 5CCGC 4YTPC 3PRJA 3SSUA 1PGQA 3V2QA 4Y99C 3H25A 5APVA 4UB8E 4K35A 2E5YA 4B86A 1W2BO 5KP6B 3OW2O 3CX5E 1LTGC 1HUCA 4QKOA 5AVQB 1NHLA 3TDKA 4PWVB 2YKQA 1HBWA 3HD7C 2K0YA 4C46A 1KILE 3NTNA 1JUNA 4GODA 2GYKA 1VF5D 1IMPA 2Y9ZA 1FZGA 4I7ZB 1HY8A 3LIDA 2CNRA 1PGOA 1FDOA 2IBZI 5APUA 5AW7B 2XV6A 1VQLP 1EC5A 2NPSA 1NTKJ 3P05A 5KJ7A 3A0HE 1VQOP 5AVTB 2O1KA 2ROQA 1SQBD 3TSIA 1RQUA 3HZQA 1YYCA 5AVUB 2Q6QA 1VF5B 4UB6E 1F80D 3U1CA 3AE5C 2GDXA 4NEOA 1LWUC 1RF1A 5AW1B 1SQBG 2KLVA 5CCHD 3CL3D 3CMAP 2ZYDA 1N7SD 2P58A 1VQ9P 1PFIA 3CCUP 3G21A 1ZRTE 1HQBA 1BGYD 3FXDA 3KDPB 5M1BA 2Z5IA 1X22A 3WUTA 3N7NA 4U0FA 1OW6A 4U0AA 3GJNA 1KILA 4H13D 2K88A 1BGYG 3V4WA 2HPCB 2KODA 4WY4C 1GK6A 2OQQA 4IPYA 2A06G 1N7SB 2WZ7A 1PP9E 3CE7A 3AEBC 2JWDA 3G3ZA 2FBWC 2R44A 4HYTB 4JYBA 1Q2NA 2JYGA 1Y47A 3M1MA 2P1JA 1N73C 1G1IA 4H2WC 3CC2P 2YIUC 2WSCH 1AQ5A 5AVWB 5KAFE 2L22A 5E79H 1AF8A 2IBZE 2VLNA 1KYOD 4O9BA 3K5BA 1VQ5P 5C39A 3CXCO 4NPFX 2V7QH 1Z6MA 2FAEA 5HV8A 3B4QA 1RQVA 1U57A 1VHNA 5EW5E 2K9JA 2KUBA 1S4XA 1JB0J 5K5GB 3L73D 1EXJA 2WPTA 3B5ND 3PTZA 1N86A 2QM7A 1T6AA 2ZJSE 1AVOA 1KN7A 2RMZA 1YQ4C 1URQA 4OH8B 3L73G 5F2KA 2JYLA 1EXIA 2QM8A 2E74D 3AE9C 4I1LA 4WBAA 1N8RQ 3B5NB 1A8OA 3G1IA 4YXWH 1JY2O 4OGQD 1JNMA 2KG8A 3WUVA 3AE2C 2L4BA 2ZAEB 3OAKA 1NGMB 1SQBJ 2GA1A 1GL2B 1BAJA 2K37A 1SP4A 2E74B 2QG4A 3H32A 1X9VA 2P7JA 2KWLA 2OYHC 5HGMA 4EI2A 1RF0A 5GTHE 3RG2A 1L4AC 2FYUD 1KLPA 3W68A 2KIKA 2E76C 1IK7A 2C0WA 2OYIB 4OGQB 4A7PA 2OTLP 1YJNP 1EDLA 1SQBE 2KG6A 3E1IA 3GHGB 2O01J 3VMYA 1AVYA 1W5CE 2OGUA 1BGYJ 2R5BA 3HD7A 3L4FA 5B5EE 1NQ4A 3CCJP 4U0DA 2Z45A 3TNUB 2POHA 3T97B 2R5DA 1CEIA 1KQLA 3MP7B 3RGUA 2XNDH 1BGYE 1FZAA 2NRGA 1SVFA 2N50A 1ZOYC 2N5HA 1SFCD 3BVHA 1LP1A 3CCRP 3OA7A 1IJDB 5KLVK 1H89A 3CCEP 2K9YA 2BUOA 1ZW0A 2MD9A 2WT7B 1LJ2A 3F5HA 2KGEA 5DJTB 3HUSC 2M8PA 3V2RA 1VQNP 1ZV8A 2ZT9D 3L74G 1CSBA 1J1DB 3GW6A 2WPSA 1SFCB 3NY7B 2W90A 4I2LC 1JO5A 1DD3A 5AW6B 4GT1A 3L73J 3LW5H 1P84H 3RK3D 3C9IA 1T2KD 2B87B 4U0EA 3V5BA 1KYOE 3DS4A 1OX3A 2O1JA 2W8ZA 2FQ2A 1YITP 4C7NA 1L0ND 2BEQD 2ZT9B 1VQKP 7CEIA 3S1KA 4COPA 5KP7B 1PGJA 1IFPA 3H1ID 3L73E 2JKVA 4PV1D 3H47A 2FFDC 2N1TC 2PEJA 5CBOA 3H1KD 3RK3B 1K8AQ 2CG5B
chains in the Genus database with same CATH topology
2BHVA 1PEMA 4XFXA 4PH0A 1YHQP 1KC8Q 3CCVP 1YI2P 3CCJP 2M8NA 1KD1Q 3G4SP 4U0DA 1IUQA 2Z45A 5HGNA 3MGEA 1EOQA 2XXMA 2EG5A 3H0DA 3CPWO 1VQ5P 4XRQA 2XV6A 3DS0A 1VQLP 3CXCO 3NTEA 2QEXP 1S72P 1RO0A 2PEIA 3P05A 2QA4P 2PEMA 2JO0A 2L6EA 4GR6A 1VQOP 5BS2A 1VQ4P 1E6JP 3DPHA 5F2OA 1YJWP 3CCLP 1D1DA 2PY8A 5DCKA 3CCRP 3HZQA 1A43A 1KQSO 3RG6C 1VQ6P 1AUMA 3CCEP 2P9XA 1VQ7P 3VRLC 2PEKA 3CC7P 1RO2A 3CD6P 2BUOA 3DS2A 1K73Q 3B5IA 3E2DA 5F2KA 1Q82Q 1NJIQ 3CCQP 1QVFO 2JYLA 2M8LA 3DS3A 5BS1A 1M1KQ 2Z46A 1Q86Q 3CMAP 2M8PA 5HGLA 1JJ2O 3G26A 1VQ9P 1YIJP 3CCUP 3G21A 3DS1A 2EFJA 1VQNP 1EIAA 1Q81Q 2DGYA 3WBHA 4QNBA 4U0BA 4XFZA 3I56P 1N8RQ 2PEOA 1YJ9P 4M0IA 3I55P 1A8OA 2PENA 2XT1A 3G1IA 4WYMA 3G1GA 3G6EP 1ZMBA 3CCMP 4U0FA 4XROA 4U0AA 1QVGO 3G0VA 1K9MQ 1M74A 1PEUA 5I4TG 3CMEP 3G29A 4COCA 3Q20A 4GR2A 1Q7YQ 3G71P 4U0CA 1BAJA 1M6NA 3LRYA 2EIAA 5JPAA 2ONTA 2KODA 1VQMP 4U0EA 1PEOA 3CC4P 3DS5A 3DS4A 4IPYA 3H4EA 1W2BO 2CWOA 3OW2O 4XFYA 1VQPP 2E1MA 4PH1A 1YITP 1PEQA 5HGMA 2Z44A 1VQKP 2OTJP 4COPA 1QRJA 1RNIA 3DTJA 1K30A 2OTLP 2JYGA 1YJNP 3M1MA 3CCSP 3H47A 1M6EX 5HGOA 3CC2P 5F2NA 2PEJA 2LF4A 3G28A 1VQ8P 2OARA 3HYBA 2PEQA 1K8AQ 1M90Q 2BQ1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU P;  1VQN P;  1W2B O;  1YHQ P;  3CCR P;  1Q81 Q;  1KC8 Q;  3CCV P;  3OW2 O;  3CCJ P;  1YI2 P;  1VQP P;  1KQS O;  1KD1 Q;  3G4S P;  3I56 P;  1N8R Q;  1YIT P;  1YJ9 P;  1VQ6 P;  3I55 P;  3CCE P;  1VQ7 P;  3CPW O;  1VQK P;  3CC7 P;  3G6E P;  2OTJ P;  1VQ5 P;  1VQ9 P;  3CCM P;  1VQL P;  3CXC O;  3CD6 P;  1QVG O;  2QEX P;  1S72 P;  1K73 Q;  1K9M Q;  2OTL P;  2QA4 P;  1K8A Q;  1YJN P;  1VQO P;  1Q82 Q;  1NJI Q;  3CCS P;  3CCQ P;  1VQ4 P;  3CME P;  1QVF O;  1YJW P;  1M1K Q;  3CC2 P;  1Q7Y Q;  3G71 P;  1Q86 Q;  3CMA P;  1VQ8 P;  3CCL P;  1JJ2 O;  1VQM P;  1M90 Q;  3CC4 P;  1YIJ P; 
#chains in the Genus database with same CATH topology
 2FVE A;  1L0N G;  2I8D A;  1LTI C;  2E42 A;  4IFF A;  5AVR B;  5L8R J;  1X8Y A;  3MUD A;  3VYI A;  3MGE A;  2K1A A;  3L37 A;  1IMQ A;  1ZR4 A;  1HWT C;  3NTE A;  2R3C A;  1NTK K;  3H1K G;  2JU1 A;  3VP9 A;  5BS2 A;  3P8C D;  4DZO A;  2FHS C;  4C7R A;  2H43 A;  2H7H A;  4PV1 B;  1IZN B;  3AE4 C;  1EZV D;  2O3J A;  5KLV G;  3RG6 C;  2QSI A;  1NH4 A;  3Q1M A;  2P9X A;  2K93 A;  1E5W A;  1HJ0 A;  2GDW A;  2KYV A;  1EZV G;  2G3A A;  2Q1K A;  2M5A A;  2JO1 A;  2LOL A;  3B8E B;  5HGL A;  5APW A;  1JY3 P;  1SQV D;  3WBH A;  4MN4 C;  2FYU E;  3L72 D;  1CZQ A;  2YO3 A;  3U1A A;  4EOT A;  2BEZ F;  1QL2 A;  2JAZ A;  1XTG B;  5CHX A;  4XRO A;  3G0V A;  1VPC A;  3A0B E;  1RF1 B;  2KGA A;  1SQV G;  2QRX A;  5AW5 B;  1AA0 A;  2N9B A;  4RJT A;  1FZF A;  1VQM P;  1GL2 A;  3CC4 P;  3TK1 A;  4PD4 I;  2LPK A;  3L74 J;  2VLO A;  3H6P A;  2K0D X;  4N3Y B;  2WSS H;  1NTM D;  2OYI A;  1AYI A;  2HLO A;  2KB7 P;  1L4A A;  3GHG A;  1EZV I;  4CA3 A;  1NTM G;  2B9B A;  1LNQ A;  2QJY B;  2AEJ A;  2Y0D A;  3SWY A;  2K2Q A;  1NU1 D;  3JC2 2;  2QEX P;  2PEI A;  3CI9 A;  2PEM A;  3T97 A;  3M0D C;  4L74 A;  1YJW P;  2VLP A;  2WIT A;  3KZI H;  5AW4 B;  3C1L A;  3IFM A;  5H2F H;  4Z1M H;  1KFN A;  3L71 D;  1L0N J;  4L76 A;  3ZDM A;  2AXT E;  1NU1 G;  1A43 A;  2KSJ A;  1URQ D;  4JF7 A;  2H88 C;  3H1I J;  4DJG A;  3RK3 E;  3U59 A;  5KP8 B;  1KB9 H;  2QNW A;  3H1K J;  2WPR A;  2GZJ A;  2D2C D;  2K9J B;  3L71 G;  2M8L A;  5EFW B;  4L75 A;  3NMD A;  1SQQ D;  3GLM A;  1L0N E;  3M0A A;  5B66 H;  2Y0C A;  1Q81 Q;  2RH0 A;  3RL0 C;  2AF8 A;  3HUS A;  3H1I E;  1PP9 G;  1SFC A;  2KR5 A;  2PFX A;  2FXM A;  3H1K E;  4PD4 H;  2BCC D;  2XNX A;  4HKG A;  5I4T G;  3CME P;  1SQB K;  3Q20 A;  1IFN A;  2EIA A;  2WSE J;  2AEF A;  1M1J C;  2B87 A;  2CK3 H;  2QJK C;  2IBZ G;  3JCU H;  2BCC G;  3S9O A;  3NXS A;  2HYN A;  3P8C E;  2ZXX A;  3S4R A;  3A7O A;  1GDT A;  4Y99 B;  2KNC A;  2ZYA A;  1OZH A;  2UWJ E;  3HD7 D;  1LGH B;  1JTH A;  1EZV E;  1SQV J;  5F2N A;  3G28 A;  2OAR A;  3BCC D;  4OWF A;  1YTZ I;  3H32 B;  4L73 A;  4KT0 J;  3F89 A;  1OXZ A;  4DG9 A;  2L5G B;  2XXM A;  3H0D A;  4XRQ A;  1MUU A;  1RHZ B;  1BE3 D;  1S72 P;  1U7J A;  3BCC G;  3USS A;  4XA4 A;  1SQV E;  5GTI H;  3P8M C;  3L72 E;  3HD7 B;  2YKO A;  5KKZ C;  3Q3D A;  2PY8 A;  2LL8 A;  1NTM J;  1KV4 A;  1LT1 A;  3AED C;  1MFT A;  2ITA A;  1LT9 C;  2PEK A;  2JR8 A;  3AEF C;  5TIS H;  5BVZ A;  2YXR B;  1RY3 A;  2P10 A;  1GXG A;  1HGZ A;  1LP1 B;  1ZNV A;  2Q5U A;  1NTM E;  1SQP D;  3P7K A;  1YJ9 P;  1NU1 J;  2JGP A;  2CPB A;  1EDI A;  1H88 A;  1T3J A;  2WVR A;  1GMJ A;  1LTB C;  1IFJ A;  3G29 A;  1NAF A;  3L71 J;  1LWU B;  1J1E C;  1M6N A;  3LRY A;  5CBN A;  4KJM A;  4N78 D;  4U3F D;  3B4S A;  2E1M A;  1NU1 E;  1YBK A;  2RN0 A;  2JB0 A;  2FYN C;  1PP9 J;  4IZ6 A;  1IK9 A;  2I1K A;  4H0L C;  3AE8 C;  1KFM A;  3R2P A;  4LLH A;  3L71 E;  2ZVO B;  5HGO A;  1UNK A;  1SS1 A;  1DNY A;  1S1C X;  2PEQ A;  2PAJ A;  2LML A;  2ERH A;  1KC8 Q;  1LTJ C;  2QJP C;  4C7N B;  4LC1 A;  4WY4 B;  2WSC J;  1Z56 A;  1EOQ A;  2JP3 A;  2EG5 A;  2BCC J;  2M8R A;  2KGC A;  2M5R A;  4IFM A;  1USD A;  1DH3 A;  2GDY A;  5CCH C;  1SQQ E;  3FWL A;  2LR2 A;  3WU2 H;  1YTZ T;  2Q3E A;  1ZME C;  4WWI A;  1N73 B;  2KK7 A;  2YIU B;  4IFD K;  3TF5 A;  3P32 A;  4WB4 A;  5DJU B;  4EDF A;  1KQS O;  3UIA A;  2BCC E;  2FVA A;  2K5X A;  2FQ1 A;  4JPZ B;  4XFJ A;  1P84 D;  3L75 D;  4H13 C;  5E79 E;  2OYO A;  3BCC J;  1Q82 Q;  4PJ0 H;  1QX8 A;  3PLN A;  3D71 A;  1JJ2 O;  1YIJ P;  2HOD A;  3DS1 A;  4R0M A;  1BE3 J;  4WYM A;  1DD4 A;  3FGA D;  3Q2Y A;  3BCC E;  2C9L Y;  3O6Q B;  1GL2 D;  1IFI A;  2M5A B;  2IYO A;  4BPH A;  2NZ2 A;  1WT6 A;  2A45 I;  1NKN A;  1BE3 E;  2KGD A;  3H1H D;  2HR3 A;  1G2C B;  2G8Y A;  1L4A D;  5CCG A;  2E76 D;  2N6Y A;  2YKP A;  1PZQ A;  3BRV B;  4JBZ A;  1SQX D;  3H1H G;  5AW3 B;  2W6J H;  1P84 I;  3TYY A;  5HGN A;  5AW0 B;  2KOP A;  3E1R A;  1K04 A;  2OYH B;  1RE3 C;  2JJL A;  2L6E A;  1SQX G;  1L4A B;  2JBG A;  5F2O A;  2WSF H;  4AYC A;  2E76 B;  3M91 A;  1SQP E;  3II6 A;  2Q7C A;  1S9K D;  3CCL P;  1Y8A A;  4HH2 A;  1L0N K;  1FZC C;  3TGU D;  3VTP C;  3R4Y A;  2FYU G;  2XKM A;  1HF9 A;  3BRT B;  1JMM A;  1RO2 A;  3MZW B;  4AUW A;  4N78 E;  4U3F E;  4K3A A;  1QVF O;  1LT9 A;  4RES B;  3TGU G;  2KZJ A;  4R4M A;  3I5C A;  2M0B A;  5AVV B;  1FZE A;  2O01 N;  4U0B A;  2PEO A;  1PGP A;  3O8Z A;  1HJB A;  4JQ0 D;  2B89 A;  2A45 H;  1ZMB A;  2IZ0 A;  1ACP A;  1NWQ A;  1U7M A;  2C0X A;  1M74 A;  4ASW A;  2L0Q A;  3L36 A;  2W27 A;  2DNW A;  3ITK A;  1NVO A;  3L35 A;  1EQ7 A;  3L70 D;  1LWU A;  3GG2 A;  3HUS B;  4YXD C;  4PH1 A;  2BAS A;  1BSN A;  4DT0 A;  3VOP A;  1FJP A;  3EWK A;  3L70 G;  3CXH H;  4MRT C;  3RK2 C;  2MVU A;  1SQV K;  4GKG A;  2GZI A;  1VQ8 P;  4WVZ A;  4RO0 A;  2Y0E A;  1PEM A;  1AV1 A;  1BCC D;  3BAT A;  1YI2 P;  1P84 E;  3L75 E;  3G4S P;  1KB9 D;  2HG5 D;  4WY4 A;  3D6Y A;  3DS0 A;  1LTJ A;  1FOS F;  1JY2 P;  2KNC B;  1FJK A;  1JTH B;  4GOF A;  2I1J A;  1JM0 A;  1BCC G;  3HRN A;  4RKU J;  2FYZ A;  2FFD B;  1NKZ B;  2DW3 A;  2N1T B;  2WPV B;  3H1H J;  1N73 A;  2W83 C;  1NTM K;  2KOO A;  1S5L H;  4PD4 D;  1M56 D;  3H1I G;  3QH9 A;  2XZR A;  3VRL C;  1G1J A;  3AEC C;  3QWO C;  1EDJ A;  2IPP A;  2IYP A;  1SQX J;  1D7M A;  3V6I A;  2JWA A;  3DS3 A;  2MKV A;  3D70 A;  1GW3 A;  1JY2 N;  1HVV A;  3H1H E;  2DGY A;  4DCK A;  1NU1 K;  1CI6 B;  1Q90 D;  2FYU J;  5AVX B;  5KLI C;  2CQ8 A;  3G1G A;  1PEU A;  1SQX E;  3HTK A;  3M06 A;  3O6Q A;  3G71 P;  1WRG A;  3TGU J;  2NPS C;  1QEX A;  2CWO A;  1KB9 I;  2J59 M;  2VSQ A;  5KJ7 C;  2IZ1 A;  3HE5 B;  3RL0 g;  2IFM A;  2SPZ A;  2ZFC A;  1G2C A;  1PL5 A;  1M57 D;  2K3R A;  1SQQ K;  3TGU E;  3HYB A;  4HJG H;  3L72 G;  1M90 Q;  1NOH A;  4PH0 A;  1OMI A;  3FWN A;  1QLE D;  2FXP A;  4HB1 A;  2OYH A;  3L70 J;  2FAC A;  1H8A A;  1DX7 A;  1GTW A;  1RE3 A;  4H44 C;  5DCK A;  3AE6 C;  4W7Z A;  1KIL C;  2GZF A;  1R5S A;  4JYC A;  1L0L D;  3L70 E;  5CMZ A;  1NTK D;  1M1K Q;  1BCC J;  2KW2 A;  1DEE G;  3M9Q A;  5APT A;  2J5U A;  3G26 A;  2EFJ A;  1EIA A;  2CPS A;  1DIP A;  3RL0 D;  4QNB A;  3E7K A;  4XFZ A;  3KZI E;  1EDK A;  5H2F E;  5KAI H;  1L0L G;  2GM4 A;  1QGK B;  2XV5 A;  3AEG C;  3VN0 A;  4TT3 H;  2WWW A;  5AVY B;  3C8V A;  1BCC E;  2IDB A;  4COC A;  1Q7Y Q;  2QVA A;  2HOD B;  1FOS E;  1DEB A;  5BU5 A;  1KB9 E;  3CLQ A;  3MHV A;  4XFY A;  1FAV A;  4UHP B;  4IL6 H;  5BU8 B;  1KQF B;  5CCG D;  1IC2 A;  3RL0 B;  1S5L X;  4CPG A;  5B66 E;  2EHS A;  3AEE C;  1QRJ A;  3DTJ A;  2M3B A;  2Q9I A;  3LMO A;  1GZL A;  2KG9 A;  1FE6 A;  1SQQ G;  3GKL C;  5TJH A;  2NO8 A;  1XTC C;  2V4H A;  2BQ1 E;  4PD4 E;  4H2Y C;  2FKW B;  3CCV P;  1URQ C;  3AE3 C;  1KQG B;  2KXP B;  2M8N A;  2E75 C;  1M1J B;  3KHU A;  3CPW O;  1HTL C;  2QJK B;  1PIX A;  2D2C C;  1BDC A;  2KI7 B;  3M9B A;  1LTT C;  2GUV A;  3Q5P A;  1UJZ A;  2JEE A;  2GUS A;  3L72 J;  3PJS K;  1IFD A;  4EIJ A;  1Y9B A;  2FFD A;  1HH0 A;  2N1T A;  4UB8 H;  3HE4 B;  2WSE H;  4TLF A;  2PRR A;  3CX5 H;  3WUU A;  5AW9 B;  2Z46 A;  5AVZ B;  3GF3 A;  5CJ4 A;  1RF0 C;  3A3Y B;  1OWA A;  2AVA A;  4BWN A;  5GTI E;  3I56 P;  2LIU A;  5KKZ B;  1BE3 G;  2KZI A;  3VMZ A;  1CI6 A;  1NTZ D;  2JQ4 A;  2LKM A;  1QVG O;  1LT9 B;  2FVF A;  3VMX A;  2AFD A;  4U0C A;  2GZE A;  1M8O B;  4I7Z C;  3V4Q A;  4PXH B;  5TIS E;  1OFC X;  5CZD B;  1NTZ G;  3Q5S A;  3A0H H;  3G9R A;  3HE5 A;  1L0L J;  1E79 H;  2H89 C;  4W7Y A;  4H0L D;  1KOR A;  1SLQ A;  1SQP G;  4UB6 H;  1YHQ P;  1NAY A;  1VF5 C;  4WY4 D;  1J1E B;  2WTY A;  1L0L E;  2N98 A;  4ZKU A;  3GZL A;  3W67 A;  1NTK E;  3WMM 0;  5AVS B;  2K92 A;  2E43 A;  2KSE A;  2FYN B;  2N6Z A;  3DPH A;  4U3F G;  1SQQ J;  4H0L B;  4DOJ A;  5HVC A;  3A5T A;  1KZU B;  1L2P A;  1W2E A;  4D6T D;  2A06 D;  4IL6 X;  2H8P D;  1LTJ B;  2QJP B;  2KOR A;  1MFZ A;  3DS2 A;  1MKM A;  1NJI Q;  1SQX K;  2VLQ A;  1Q86 Q;  1N7S C;  2A45 G;  1MV8 A;  3KYQ A;  3GZM A;  1IFM A;  4D6T G;  1OVR A;  1BSH A;  3M0D A;  2V7Q J;  2MF4 A;  1R8E A;  2FYU K;  3WU2 E;  2WQY C;  2XT1 A;  3CXH D;  4BXL A;  5KAF H;  3CWB D;  2EHT A;  1LTA C;  1ZN5 A;  3MUD C;  4H13 B;  2AXC A;  1FU1 A;  3LIE A;  4PJ0 E;  3CWB G;  3L75 G;  2K94 A;  2JDI H;  2Z4E A;  2OTJ P;  1K30 A;  2YNY A;  3HTK B;  1HGV A;  1T3U A;  2LF4 A;  3H1J D;  3D6Z A;  1X3O A;  4BPG A;  2Y9Y A;  3PHL A;  5AW2 B;  2M3E A;  1NTZ J;  2GZG A;  2XZ0 D;  3KPE A;  1JCD A;  2KOG A;  4BRY B;  1H0T A;  3H1L D;  1VL2 A;  3Q5R A;  1OVU A;  2C9N Y;  1M1J A;  3JSV C;  3H1J G;  3IAO A;  2LTE A;  1VQ4 P;  1VKU A;  2FY8 A;  4GOE A;  1MZ8 A;  1SQP J;  3B5N C;  3IR9 A;  3H1L G;  1NTZ E;  3CXH I;  2WSF J;  1CW5 A;  2LXC B;  2IFN A;  2R32 A;  1RH5 B;  2FQ0 A;  2P67 A;  2ZVN B;  5AW8 B;  3CD6 P;  3HE4 A;  1GL2 C;  3EJE A;  4EYY Q;  3E2D A;  2E74 C;  3RBZ A;  5BS1 A;  2FAD A;  4U3F J;  1DV5 A;  5GTH H;  1KYO I;  4U7J A;  2W6A A;  4M0I A;  3I55 P;  3V2P A;  2OYI C;  4OGQ C;  1ZR2 A;  2HFE D;  1FZC B;  1BXI A;  3G6E P;  3GHG C;  1GU5 A;  3CCM P;  2MVV A;  1N2D C;  1NO4 A;  1FS0 E;  3IF4 A;  2VRS A;  5B5E H;  1GPJ A;  3AEA C;  2ONT A;  1JEK A;  3DS5 A;  4D6T J;  2KOQ A;  3H4E A;  1GXH A;  1VQP P;  4ZNC A;  1GK4 A;  1PEQ A;  2O01 H;  3EJD A;  2Z44 A;  3MIW A;  2X2B A;  4ZKP A;  1MZ9 A;  3U43 A;  1N7L A;  1FBM A;  2YO2 A;  1T8Z A;  3RK2 D;  3V2N A;  1JY3 O;  1X79 B;  4KHX A;  2KLU A;  4D6T E;  3KXD A;  1AQT A;  2YXQ B;  2A06 E;  2P2U A;  1S3J A;  3EQ2 A;  1RE4 C;  4R4L A;  2MR8 A;  2PP6 A;  2QE7 H;  1TU3 F;  3FXE A;  3MD0 A;  1OVV A;  3LW5 J;  3CWB J;  1IUQ A;  3L75 J;  3L74 D;  2WPQ A;  1RO0 A;  2QA4 P;  2JO0 A;  4GR6 A;  3N4X A;  2ZXE B;  2J58 A;  4GDO A;  2N1T D;  1D1D A;  1J1D C;  1SFC C;  3RK2 B;  1FDM A;  3PP5 A;  3CXH E;  4AQR D;  3SFE C;  2KP8 A;  4YPC A;  4QMA A;  3CWB E;  1T8K A;  1BDD A;  4ZMD A;  3PH0 A;  1AUM A;  2ZYG A;  1E0H A;  2LXB A;  1S2E A;  1KYO H;  2KS1 B;  3H1J J;  1KTM A;  3CCQ P;  1M7L A;  1PPJ D;  1PV3 A;  1JCC A;  1EMV A;  2HPC A;  3EFG A;  5APY A;  1ZLL A;  1UIX A;  5CCH A;  2ZT9 C;  3MTU E;  1L0I A;  2LIW A;  3H1L J;  2MJZ A;  4XE5 B;  2AFE A;  1N7S A;  4NPD A;  4HKZ H;  2PEN A;  3M9H A;  3A2A A;  1PPJ G;  3NFQ A;  3H1J E;  1LTS C;  1K9M Q;  3RK3 C;  1S5L E;  4BPF A;  1T2K C;  4GR2 A;  1USE A;  3H1L E;  2NPS D;  5KJ7 D;  1L0L K;  1GD2 E;  5KLV D;  4LGD E;  1RNI A;  1L0H A;  4PV1 C;  5KLI B;  2YMY A;  4Y28 J;  1WMK A;  1M6E X;  2WMM A;  2AEM A;  1J2J B;  4XFX A;  2Q3I A;  5APS A;  1AJY A;  2PGD A;  2NPS B;  1OW7 A;  1FC2 C;  1A02 F;  1ZXG A;  3CX5 D;  2R3S A;  4BRY A;  1JMB A;  2Z5H A;  4GIF A;  1S9K E;  1QL1 A;  3RBX A;  1E6J P;  3ABV C;  3AE1 C;  1FR2 A;  5KTB A;  3GMA A;  4IOI H;  3SWK A;  4H44 D;  1IO4 A;  2CGQ A;  3A0B H;  3SWF A;  1VQ6 P;  1KIL D;  2B88 A;  2XU6 A;  1RF1 C;  1GW4 A;  3B5N A;  1VQ7 P;  1YQ3 C;  2JU2 A;  1ZP0 C;  1K73 Q;  4N6J A;  2L91 A;  4M3L A;  1AFO A;  3VP8 A;  2N5I A;  1JY3 N;  4H44 B;  4NPE A;  2IX7 C;  4F37 A;  1KIL B;  1FZC A;  1GU4 A;  1FZB A;  1VDF A;  1OR5 A;  3BAS A;  2N9Y B;  3EJB A;  3B71 A;  5JPA A;  2QJY C;  1PEO A;  5EJD A;  5APX A;  3L74 E;  1JOC A;  2YMK A;  3SFD C;  1OW8 A;  4ASV A;  3CX5 I;  2K0X A;  1ZRT D;  2MY5 A;  3TNU A;  1NTK G;  3VMA A;  2KOS A;  5KAI E;  3CCS P;  2AXT H;  1R5L A;  3KQG A;  2PNG A;  2XZ1 C;  2BHV A;  4I6M C;  1NTZ K;  1KD1 Q;  3GF7 A;  2E75 D;  1PPJ E;  1RE4 A;  3FX0 A;  1OIP A;  1KMI Z;  1NYH A;  1PP9 D;  4IL6 E;  3OJA B;  3MGN A;  2WT7 A;  3AE7 C;  4H2X C;  1SQP K;  3IN6 A;  2XDJ A;  5CJ0 A;  2QIW A;  2W6B A;  2L9F A;  5KLV J;  1H0T B;  2OTK E;  2MR7 A;  2FXO A;  2LKI A;  1URQ B;  3CC7 P;  5APQ A;  4OVN F;  1X0T A;  2E75 B;  2IBZ D;  3EFF K;  3B5I A;  4W80 A;  1K05 A;  2E5T A;  2KS1 A;  2RKL A;  3JCU E;  2D2C B;  1UII A;  1A02 J;  1FDI A;  5KLV E;  5CCG C;  4YTP C;  3PRJ A;  3SSU A;  1PGQ A;  3V2Q A;  4Y99 C;  3H25 A;  5APV A;  4UB8 E;  4K35 A;  2E5Y A;  4B86 A;  1W2B O;  5KP6 B;  3OW2 O;  3CX5 E;  1LTG C;  1HUC A;  4QKO A;  5AVQ B;  1NHL A;  3TDK A;  4PWV B;  2YKQ A;  1HBW A;  3HD7 C;  2K0Y A;  4C46 A;  1KIL E;  3NTN A;  1JUN A;  4GOD A;  2GYK A;  1VF5 D;  1IMP A;  2Y9Z A;  1FZG A;  4I7Z B;  1HY8 A;  3LID A;  2CNR A;  1PGO A;  1FDO A;  2IBZ I;  5APU A;  5AW7 B;  2XV6 A;  1VQL P;  1EC5 A;  2NPS A;  1NTK J;  3P05 A;  5KJ7 A;  3A0H E;  1VQO P;  5AVT B;  2O1K A;  2ROQ A;  1SQB D;  3TSI A;  1RQU A;  3HZQ A;  1YYC A;  5AVU B;  2Q6Q A;  1VF5 B;  4UB6 E;  1F80 D;  3U1C A;  3AE5 C;  2GDX A;  4NEO A;  1LWU C;  1RF1 A;  5AW1 B;  1SQB G;  2KLV A;  5CCH D;  3CL3 D;  3CMA P;  2ZYD A;  1N7S D;  2P58 A;  1VQ9 P;  1PFI A;  3CCU P;  3G21 A;  1ZRT E;  1HQB A;  1BGY D;  3FXD A;  3KDP B;  5M1B A;  2Z5I A;  1X22 A;  3WUT A;  3N7N A;  4U0F A;  1OW6 A;  4U0A A;  3GJN A;  1KIL A;  4H13 D;  2K88 A;  1BGY G;  3V4W A;  2HPC B;  2KOD A;  4WY4 C;  1GK6 A;  2OQQ A;  4IPY A;  2A06 G;  1N7S B;  2WZ7 A;  1PP9 E;  3CE7 A;  3AEB C;  2JWD A;  3G3Z A;  2FBW C;  2R44 A;  4HYT B;  4JYB A;  1Q2N A;  2JYG A;  1Y47 A;  3M1M A;  2P1J A;  1N73 C;  1G1I A;  4H2W C;  3CC2 P;  2YIU C;  2WSC H;  1AQ5 A;  5AVW B;  5KAF E;  2L22 A;  5E79 H;  1AF8 A;  2IBZ E;  2VLN A;  1KYO D;  4O9B A;  3K5B A;  1VQ5 P;  5C39 A;  3CXC O;  4NPF X;  2V7Q H;  1Z6M A;  2FAE A;  5HV8 A;  3B4Q A;  1RQV A;  1U57 A;  1VHN A;  5EW5 E;  2K9J A;  2KUB A;  1S4X A;  1JB0 J;  5K5G B;  3L73 D;  1EXJ A;  2WPT A;  3B5N D;  3PTZ A;  1N86 A;  2QM7 A;  1T6A A;  2ZJS E;  1AVO A;  1KN7 A;  2RMZ A;  1YQ4 C;  1URQ A;  4OH8 B;  3L73 G;  5F2K A;  2JYL A;  1EXI A;  2QM8 A;  2E74 D;  3AE9 C;  4I1L A;  4WBA A;  1N8R Q;  3B5N B;  1A8O A;  3G1I A;  4YXW H;  1JY2 O;  4OGQ D;  1JNM A;  2KG8 A;  3WUV A;  3AE2 C;  2L4B A;  2ZAE B;  3OAK A;  1NGM B;  1SQB J;  2GA1 A;  1GL2 B;  1BAJ A;  2K37 A;  1SP4 A;  2E74 B;  2QG4 A;  3H32 A;  1X9V A;  2P7J A;  2KWL A;  2OYH C;  5HGM A;  4EI2 A;  1RF0 A;  5GTH E;  3RG2 A;  1L4A C;  2FYU D;  1KLP A;  3W68 A;  2KIK A;  2E76 C;  1IK7 A;  2C0W A;  2OYI B;  4OGQ B;  4A7P A;  2OTL P;  1YJN P;  1EDL A;  1SQB E;  2KG6 A;  3E1I A;  3GHG B;  2O01 J;  3VMY A;  1AVY A;  1W5C E;  2OGU A;  1BGY J;  2R5B A;  3HD7 A;  3L4F A;  5B5E E;  1NQ4 A;  3CCJ P;  4U0D A;  2Z45 A;  3TNU B;  2POH A;  3T97 B;  2R5D A;  1CEI A;  1KQL A;  3MP7 B;  3RGU A;  2XND H;  1BGY E;  1FZA A;  2NRG A;  1SVF A;  2N50 A;  1ZOY C;  2N5H A;  1SFC D;  3BVH A;  1LP1 A;  3CCR P;  3OA7 A;  1IJD B;  5KLV K;  1H89 A;  3CCE P;  2K9Y A;  2BUO A;  1ZW0 A;  2MD9 A;  2WT7 B;  1LJ2 A;  3F5H A;  2KGE A;  5DJT B;  3HUS C;  2M8P A;  3V2R A;  1VQN P;  1ZV8 A;  2ZT9 D;  3L74 G;  1CSB A;  1J1D B;  3GW6 A;  2WPS A;  1SFC B;  3NY7 B;  2W90 A;  4I2L C;  1JO5 A;  1DD3 A;  5AW6 B;  4GT1 A;  3L73 J;  3LW5 H;  1P84 H;  3RK3 D;  3C9I A;  1T2K D;  2B87 B;  4U0E A;  3V5B A;  1KYO E;  3DS4 A;  1OX3 A;  2O1J A;  2W8Z A;  2FQ2 A;  1YIT P;  4C7N A;  1L0N D;  2BEQ D;  2ZT9 B;  1VQK P;  7CEI A;  3S1K A;  4COP A;  5KP7 B;  1PGJ A;  1IFP A;  3H1I D;  3L73 E;  2JKV A;  4PV1 D;  3H47 A;  2FFD C;  2N1T C;  2PEJ A;  5CBO A;  3H1K D;  3RK3 B;  1K8A Q;  2CG5 B; 
#chains in the Genus database with same CATH homology
 2BHV A;  1PEM A;  4XFX A;  4PH0 A;  1YHQ P;  1KC8 Q;  3CCV P;  1YI2 P;  3CCJ P;  2M8N A;  1KD1 Q;  3G4S P;  4U0D A;  1IUQ A;  2Z45 A;  5HGN A;  3MGE A;  1EOQ A;  2XXM A;  2EG5 A;  3H0D A;  3CPW O;  1VQ5 P;  4XRQ A;  2XV6 A;  3DS0 A;  1VQL P;  3CXC O;  3NTE A;  2QEX P;  1S72 P;  1RO0 A;  2PEI A;  3P05 A;  2QA4 P;  2PEM A;  2JO0 A;  2L6E A;  4GR6 A;  1VQO P;  5BS2 A;  1VQ4 P;  1E6J P;  3DPH A;  5F2O A;  1YJW P;  3CCL P;  1D1D A;  2PY8 A;  5DCK A;  3CCR P;  3HZQ A;  1A43 A;  1KQS O;  3RG6 C;  1VQ6 P;  1AUM A;  3CCE P;  2P9X A;  1VQ7 P;  3VRL C;  2PEK A;  3CC7 P;  1RO2 A;  3CD6 P;  2BUO A;  3DS2 A;  1K73 Q;  3B5I A;  3E2D A;  5F2K A;  1Q82 Q;  1NJI Q;  3CCQ P;  1QVF O;  2JYL A;  2M8L A;  3DS3 A;  5BS1 A;  1M1K Q;  2Z46 A;  1Q86 Q;  3CMA P;  2M8P A;  5HGL A;  1JJ2 O;  3G26 A;  1VQ9 P;  1YIJ P;  3CCU P;  3G21 A;  3DS1 A;  2EFJ A;  1VQN P;  1EIA A;  1Q81 Q;  2DGY A;  3WBH A;  4QNB A;  4U0B A;  4XFZ A;  3I56 P;  1N8R Q;  2PEO A;  1YJ9 P;  4M0I A;  3I55 P;  1A8O A;  2PEN A;  2XT1 A;  3G1I A;  4WYM A;  3G1G A;  3G6E P;  1ZMB A;  3CCM P;  4U0F A;  4XRO A;  4U0A A;  1QVG O;  3G0V A;  1K9M Q;  1M74 A;  1PEU A;  5I4T G;  3CME P;  3G29 A;  4COC A;  3Q20 A;  4GR2 A;  1Q7Y Q;  3G71 P;  4U0C A;  1BAJ A;  1M6N A;  3LRY A;  2EIA A;  5JPA A;  2ONT A;  2KOD A;  1VQM P;  4U0E A;  1PEO A;  3CC4 P;  3DS5 A;  3DS4 A;  4IPY A;  3H4E A;  1W2B O;  2CWO A;  3OW2 O;  4XFY A;  1VQP P;  2E1M A;  4PH1 A;  1YIT P;  1PEQ A;  5HGM A;  2Z44 A;  1VQK P;  2OTJ P;  4COP A;  1QRJ A;  1RNI A;  3DTJ A;  1K30 A;  2OTL P;  2JYG A;  1YJN P;  3M1M A;  3CCS P;  3H47 A;  1M6E X;  5HGO A;  3CC2 P;  5F2N A;  2PEJ A;  2LF4 A;  3G28 A;  1VQ8 P;  2OAR A;  3HYB A;  2PEQ A;  1K8A Q;  1M90 Q;  2BQ1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...