1VQ7V

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq7V00
1YJNV 3OW2U 1VQOV 1YJ9V 4WFBV 3CXCU 3CCVV 1NJIW 1M90W 1VQ9V 3CD6V 1K8AW 1VQ5V 3CCRV 1YIJV 3CCEV 1Q7YW 1VQ8V 4WF9V 3G4SV 1VQ4V 3CMEV 1JJ2U 1YITV 2OTJV 1KD1W 2QEXV 3G71V 1N8RW 3CC4V 1Q82W 1S72V 1KC8W 1K9MW 1VQMV 3CPWU 1VQPV 2OTLV 1VQ7V 2QA4V 1K73W 1KQSU 1YI2V 1W2BU 3CCUV 3CCQV 3CMAV 1QVGU 3CCSV 3I56V 1YHQV 1M1KW 1VQ6V 4WFAV 1R73A 3CCLV 5DM6V 1VQLV 1YJWV 3CC2V 3G6EV 3CCMV 1Q81W 1VQNV 3I55V 1QVFU 1Q86W 3CCJV 4WCEV 3CC7V 1VQKV 2D3OW
chains in the Genus database with same CATH superfamily
2EILC 2EINB 2R70A 2Q68A 5KHHA 1XNQB 1KD1W 5IJ0B 1I94O 4TV8A 3T4DA 5KX5A 1YI2V 5LMNO 3ETQA 4GKKB 1NS1A 2ZXWC 4TUYB 4DRXB 1VF6C 2Q0OC 4QPKA 4LFBB 4GX1A 2EBOA 1D5NA 4UCRA 1XREA 5EYPA 4DV4B 1VQ8V 3SPIA 2DMXA 4FFBA 4NYKA 3OMIB 4MTFA 2YSUB 4UVBA 5LMUO 1VF7A 5EBMC 1XNRB 2ITDC 2ZM6O 2JS3A 2EIMB 4WBNB 5LOVB 1JFFB 3E8HA 4FLYA 1IVSA 4I0XA 4OXSA 1YVWA 2YIBA 4FLTA 4TOIA 2P5OA 3ZX6A 3E2EA 1JJ2U 2WLKA 4JI6B 1XL4A 1YTFD 2HVKC 4FZ0A 4O4IA 1I0HA 3UCSC 4PDVA 4YY3O 1YHQV 4LF5B 1FPOA 3H01A 4PA9A 3WG7B 1H2NA 1GN3A 4I5SA 1NU1H 3CP1A 1K4CC 2F43G 2E5LO 1VF6A 1TVKA 2P90A 4I50B 1FFXA 4GZRB 4EFEA 2QDOA 3MD0A 1RSOB 3SPGA 1XMQB 2XAJA 1URFA 1US6A 1YEWA 2GDSA 2PYLA 4WFBV 4FIPC 2R72A 4QNHB 3OTOO 5ITZA 4JPRA 4JI4B 3AG7A 2OT5A 4O4JA 2F66C 1JOYA 2PTMA 3B8NA 4UV9A 5KLVH 4FJCC 2X6BA 2F4VO 3A0HZ 4YJ3A 3ZRWB 2RJZA 5J2TA 3IC9A 3BHPA 2KQXA 4ZI7A 2WA3A 4OPAA 4I7ZB 2K1EA 2AZ2A 2M7WA 2YEVB 4NB5A 4MVQA 4U7OA 1WP8A 2Z5UA 2P6JA 3LDCA 2UXXA 1Q6IA 2WPDG 3OR7C 1FJGB 2EIJB 3ZRSA 4B7EA 3L75H 5JH7A 3F5TA 2ZR2A 2D2CB 2M6YA 1NBMG 3CD6V 1V54B 2AHZA 1EN6A 1N32O 3FB7C 1VEWA 4PI2A 1WP7A 5LA6A 1R6TA 2Y4TA 1Z5WA 5KHGA 2G38A 4O2BB 1N33B 4X66B 3K3WA 5A2QN 2EZOA 4TQFA 3JASB 3L71H 4J42A 3K0GA 2HHHO 4D6TH 2ADPA 3VQWA 3WG7C 2CGOA 2Q0AA 3E89A 3ZIAG 4JASA 3JARA 4LC1A 2X6CA 2UXBO 4MTOA 1FKAO 1K73W 2ZQMA 3C90A 4G27B 2FL4A 1K3EA 1M57C 1NR1A 1TUBA 2A06H 1IXBA 5EBWC 1U96A 3CC7V 2HLDG 2YIBD 4X1IA 2YIAA 1XILA 1VQ5V 3G67A 5JJJB 3CWBH 1G8MA 3J80N 2OWOA 3ZMUA 4CH4A 3A0RA 4LF4O 2GUZA 2JJ2G 3RW0A 4DR2O 2A9HA 1JA8A 1G4YB 3FAVB 3I55V 3SPCA 2IW5A 2QM8A 1DF4A 2E76B 1SESA 4PA7A 1I5YA 5KMGB 4ZBMA 3OEHG 4QE9A 2WLLB 2OCCB 1HNWB 4JI6O 3TCUA 2QWPB 2GBOA 3ZMZA 4LFCB 4JI1B 2DYRC 5B1BB 4W4KA 5C8YB 3EHBB 5BMVB 3K5LA 4RQEA 1ZL8A 2FMLA 5IY5C 4AILC 4LNUA 2BOBC 4K0KB 4JI2O 3CCRV 4NR1A 1FXHA 3APOA 1EZVH 3CC4V 3L72H 3T1YB 1YZBA 3RWRD 1Y76A 4LF9B 1BT8A 4ZI7B 5KUKA 1L0NH 1NH2B 2Y4UA 1Q5OA 4CS3A 4D7TA 1YJ9V 1YJNV 2YS8A 4NXNO 2N04A 3K08A 1OCRB 3JAKB 2OYQA 1BGYH 1UPGA 3OFNG 2B9ZA 1YSCA 4UFZA 1EZJA 2XT9A 4LWSA 3STZC 3BPZA 1WLEA 3ZMSA 2CH7B 4DK0A 4GKKO 4Q6GA 4PA6A 3AG3C 2D3OW 3APQA 2UUCB 1O9GA 2EX3A 3QO5A 2YUAA 1GKFA 5JQGA 4MVSA 1N0JA 1S0VA 1J95A 2B1GA 5E79Z 4TUYA 5B66Z 4FM0A 4DR6O 4CH3A 3FD9A 1P84F 4X1YB 2XAGA 4ZOLA 1PNKA 2GV9A 3WU2Z 2JDIG 1N36B 1FXKA 5LXTB 4YIOA 4O4HA 2N05A 1PD3A 4LF4B 4KP4A 4XDLA 1GN4A 3K5NA 2OCHA 5LL6Y 4DR4B 2HJFC 1JFFA 3SGIA 4DV0O 4UVAA 1ZWIC 1Y74A 2XAFA 4UCOA 4MVRA 1H2GA 1OV9A 5L3FA 5IT9N 4I9WA 1Q6HA 1OCOB 2EILB 4EFBA 5B3SC 4CS4A 5BR8B 3E22B 3RVYA 2JEXA 2GUZB 2P67A 1K92A 4NXMO 4OX9O 4PDMA 1N4CA 1HNXB 4DV5O 2ZNIA 4QGPA 4RAIA 1QVFU 2CTPA 1G6UA 1A32A 3FYEB 3JSLA 4O2AB 5EC1C 4HNAA 2XUMA 2JRIA 4XDKA 2HFEC 4GYCB 4L87A 5LYJA 5FLXN 3L9DA 1Z2GA 2FB5A 2FTKA 1ZL8B 4JZ2A 4ZKIA 4DV6O 1B06A 1OCCB 4FLVA 5EBLC 1CXZB 3K9AA 4I9QA 4AI8A 5EZYB 3J7AU 4I4TA 5L3BA 3QF7A 4JI7O 1JX9A 3RYIB 1M56C 2Y69B 3U10A 3AG3B 2DQ3A 3ICXA 4RUFA 5DECA 3G71V 2ITCC 3WB0A 2GHYA 1BMFG 5FNVB 4FVMA 1SZXA 1SQQH 1XHXA 5GONA 2JJ1G 1SF9A 2WLNA 3L74H 2QTSA 3JAKA 5K1PA 1OZ0A 4CBCA 4K0KO 3ZMVA 4X65O 4AHCA 3LNMB 3HKEA 4WFFA 3T1YO 1HR0B 2IJIA 5IJ9B 3OEEG 1PNMA 3RYHA 2RQ6A 4JI2B 5CA0A 4F4LA 2ZKOA 1VQNV 5B5EZ 1AI4A 3L73H 1V55B 5KA5A 2UXCO 1XMQO 4IT5A 2AXTZ 5JCOC 1NVPB 4CZZA 5IJ0A 2P7TC 2RCVA 2QEXV 2QTOA 2ILMA 2Y48A 3W7SA 5D5QA 5BY1A 4H44B 5B3SB 2LFSA 3N2KA 1HNZB 4FPPA 1E79G 4JI3B 2KSDA 3K57A 5EC2C 4BAYA 1F23A 4IYHA 4DV2O 1AJPA 1CP9A 2QE7G 5CA1B 4JI0B 2LQTA 3RYCA 4X65B 2VWKA 1Q3EA 5BZBA 4ASUG 5DN6G 2YIDA 2QGNA 4X20A 3BVOA 3KKYA 4DV1B 4DXWA 2ZM6B 1VQ7V 4LR3A 3NXSA 1M9NA 5L3DA 4X1IB 4DR5O 1BZKA 1H8EG 4GX5A 4Z1MG 3ASOB 1S5JA 2OTJV 4MVZA 1I7FA 3VQYA 1OCZC 3ABLB 5LMNB 4NTXA 1IBKB 4JI0O 2F1MA 2NNUA 5L3GA 3AG1C 1YCIA 1XMOB 2NR5A 1AJNA 3SJQC 3C3SA 2H8PC 1BQ0A 4JTAB 1IX9A 1FYJA 3E8BA 4DW1A 5C8YA 5TISZ 1E1QG 3CCQV 1QHTA 2AW9A 1XQ8A 1Q6UA 4WFAV 1S76D 3FB5C 1NZ6A 3L70H 1M57B 1QU7A 1UJWB 4NXMB 1AROP 1G1XB 1Y76B 3SYOA 1BL8A 2F4VB 3ZRXA 2ZE8A 3UT5B 5IYZB 5LHHA 5J2TB 3M8AA 2V4DA 4BIZA 4U3JA 3MHHC 1MZFA 2EINC 3LNNA 1NH2D 3LUTB 4UCTA 1GRJA 4DR5B 4HAMA 1N0NA 1TAEA 4B3SO 1AI7A 2HEPA 4WBNA 4MSWC 4JI4O 2IJJA 2A7WA 2JIZG 2ADQB 2ZE7A 4DUZB 4RO2A 2ZINA 4FLWA 2E5LB 3TGUH 2RMKB 1R1BA 4GKJO 2QSAA 1RPRA 3BA9A 4RWUA 4LF8O 4IIJA 4K35A 2CUGA 4X89A 3CJHB 4GCZA 1YDXA 5J2UA 4DR1O 1H2KA 4R8CA 1TUEB 5KAIZ 3AG4B 2X7RB 1K97A 2CGNA 4LF7O 3KG2A 4DR1B 3ABLC 4LF6B 4O4LB 1TVKB 4O4HB 4LCUC 3CXCU 2QWOB 1K8AW 2DYSC 1BHAA 4B7KA 5C93A 5B1OA 3FX7A 1GMGA 2BSKA 4B3MO 3R66A 3X2QC 1PKXA 4DUZO 4LF5O 3HB3B 2GTSA 1IBLO 4U3FH 5D5PA 3ZN1A 2UXNA 5H6QA 2PZSA 1VQ9V 3T1HO 2JS5A 4R7CA 3CRRA 3T2MA 4DV4O 1F7YA 4JAVA 1YTFB 1KB9F 1FS0G 2QM7A 4YHHO 5J9PC 5KHIA 2QWRB 2E3CA 5CBHA 4DV6B 3CX5F 1GM9A 2WLLA 4J9YB 1HNZO 4I50A 2BOCC 3ZHRA 3AG2C 2HG5C 4RUEA 2EJRA 3GB7C 1Y4MA 4J41A 2JGUA 1IZ3A 3LDDA 1W0JG 4YIPA 2PGGA 3RFRA 2H3OA 4RQFA 3G6EV 3ABKC 3SYQA 1SC5B 1P7GA 1M90W 4FM2A 4O2BA 3SJAC 4ZIBA 2BTQB 1KKCA 3SDLA 4C7UA 1OCOC 1THZA 5IYZA 1V9PA 3DC5A 4OPHA 3LSUA 2EJ7A 4A5UB 1GH6A 1ZX3A 4J7KA 3CB2A 1BQZA 2HKOA 1NR7A 3B8MA 1DGSA 2F23A 5EYPB 2IH3C 4YXWG 3JARB 3AG4C 4U7NA 2YICA 4KUMA 1B04A 4JTCB 5IE9A 3JALA 3UKMA 1LUWA 2WLMA 2V7QG 1GN2A 2KG7B 3OUFA 2PI4A 5LMUB 1TGOA 4UVCA 4F6EA 1XL6A 3ABTA 4J11A 1RM1C 2NLJC 2HJDA 1WB8A 1P4RA 3WFVA 3X2QB 1SRYA 2UXDO 4JAAA 4UCVA 3JSNA 1W0KG 1Z5VA 4JYYA 2VQEB 1Q82W 1EBOA 5GTHZ 3THOA 1SA0B 2VQEO 3E83A 1M1KW 1JVMA 2YI8A 4CS2A 3BABA 1WJZA 3JAMN 4LFCO 3JASA 3SYAA 3Q4HA 4IHJA 1AR1B 3UO2A 4PDLA 1PL4A 2W0FC 1BCCH 1AILA 3CMEV 1RP3B 4LP8A 2L6LA 4YJ2A 1N8RW 1O9HA 4DV0B 5LHGA 3ASNC 4PV1B 2QJ1A 4CC6A 1M93A 1MOFA 4H0LB 4DR3O 3WB2A 2DWEC 3CE2A 3DXRA 4WCEV 5ITZB 4W4LA 3U11A 3STLC 4LH7A 5B1AC 3D8CA 1MSWD 1TA8A 1PL0A 2QKAA 3JCUZ 4PA4A 2L35A 4PELA 1W59A 4UB6Z 4X64B 4TV9A 1ENVA 2WLIA 5KMGA 1KUQA 3E8FA 4UXNA 2VWJA 2AHYA 2CTRA 4G2KA 3RT3C 1J5EB 1SQGA 4MW3A 5DEDA 1MG1A 2ZXWB 4DYLA 3N2GB 4LF6O 5A9GA 5EIBC 2W6IG 3P3PA 1XDCA 5BMVA 4JAUA 4F6RB 4J7JA 2B5UA 1Q8IA 1HR0O 3K58A 2YI9A 5IYDO 1FJGO 3D3IA 4XDJA 1RSOA 3H1KH 4WFHA 4P9PA 2AZ0A 1R3LC 1HDJA 3ZRVA 2YDEA 3UQ8A 3OT7A 1VARA 3SPHA 1M5IA 1S5HC 1VQ4V 1VMGA 3EXAA 3ZS8C 3RYFA 2ODMA 4BWAA 3ETGA 1KP3A 3TXQA 5JWPA 4KL1A 4DV5B 3KCXA 1AP6A 4MW8A 1I08A 4TT3G 1Q90D 1FXKB 2XAHA 2LJ2A 4DR3B 5FPRA 1BSMA 4H37A 1CPYA 1NI8A 3UO3A 5KA6A 1SQVH 4HYOA 3H1JH 2CH7A 4BW5A 5LP6B 1I94B 4LF9O 1FXVA 2JEUA 2HP8A 1HP8A 4PJ0Z 2Z0AA 3TJTA 3AK1A 4GUNA 3TK1A 4UCSA 5JQGB 1SQPH 4L8JA 5GW7A 1LUVA 3HKBB 3CHXA 1DLBA 3OE7G 1GM7A 1ZUQA 2EZPA 1DK1A 3HR0A 3JD2A 2OTLV 4DUYB 3QO7A 3DC6A 2MW2B 1QVGU 4X1KB 4JI1O 2VQFB 3S3XA 3OM3B 1D2DA 5HFMA 1EN4A 1QLEC 4J10A 1F4NA 5LXTA 4KFMA 4DRXA 2JGDA 1VQOV 3H1IH 1NJIW 3MDSA 4PHZA 3G4SV 4K8XA 4JYAO 4P9OA 4YHHB 1XUQA 3P30A 2PI5A 1BHBA 2IU3A 3BCCH 5JCOA 3JYCA 4EB6B 1AI5A 4BW9A 3P3NA 4ZHQB 1VQ6V 2ZR3A 5EK0A 3GWKC 1P7BA 3CSXA 1L1FA 3JAWB 1WPBA 3K59A 4DR4O 4FZ1A 5LOVA 1S5LZ 3HPLC 1XEQA 4O4JB 3K03A 4I0XB 3T1HB 2R9AA 4JI8B 3H1HH 1COWG 4ABMA 1QNMA 3S3WA 4KXRA 5H5NA 2WLJA 3QVNA 2LO1A 2X6AA 5H2FZ 1AJQA 2RDCA 3SJBC 1PV0A 4IYIA 4MS2A 4MTGA 3K9SA 1Q43A 1VP7A 2LW1A 3EVKA 1KMIZ 1AB3A 5IWAB 4LFAB 5CBFA 2DYSB 4JI3O 3HKCA 2CDYA 4R50A 4J9ZB 4KHPB 3CCUV 2O57A 2JK5C 3BAAA 4PD4F 1EN5A 4JTDB 5LHIA 3M7MX 1ZLZA 2HR3A 5DM6V 4LF8B 4DUYO 1X4TA 2BTQA 4JYCA 1MABG 1XHZA 4LNUB 2P22C 4X64O 3RN4A 3RYFB 4FLXA 3KZIZ 2A3QA 4CH5A 3CYOA 1I5XA 3PN1A 5GONB 5CA1A 4IGGA 2OCCC 5KX5B 2DN9A 1JMKC 3AEIA 3OGIB 3QTCA 4DR2B 1JR9A 5JJEB 2IM9A 2ZIMA 1ZSPA 1QLEB 4DO2A 1CEZA 5IY5B 1S72V 4H13B 1DTOA 1GTOA 4NTWA 1B3QA 1WNSA 5FPOA 2Q7GA 3FKSG 1SKVA 3RYHB 4WFEA 3H1LH 4BIUA 2EULA 1VQLV 2QWQB 2LW7A 3B77A 3QO8A 3IJ4A 1PM9A 1PP9H 5H6RA 2DE0X 3ABKB 4AQYO 4MVMA 5B1NA 1KBHA 4UCUA 3HKDB 4DV3O 1HW7A 3JD0A 1YIJV 2P4KA 4E4EA 4D7SA 5CN0A 3BRCA 3CRQA 5LBQA 1XMOO 4I55A 1GO3F 5IYBO 5IWAO 4X1KA 2R9IA 1OCRC 1W2BU 4LF7B 2XHBA 4DR7O 2ZT9B 5GTIZ 2JGDB 3JCZA 2PF4E 1SETA 4O2AA 1SZTA 1Q86W 2EIMC 4X1YA 1HNWO 4GX0A 3RYCB 3CCEV 4X20B 4X88A 2QWNB 2PYJA 1KECA 1K9MW 1JPXA 1PPJH 4NTYA 5L3CA 2DW4A 1OJHA 5KUMA 3K5MA 3ETDA 3I56V 3UM7A 1WB7A 4AQYB 3VQXA 1MMMA 2W0XA 4B08A 2QR4A 3CRCA 5LGNA 1Y74B 1Y66A 4GX2A 1TUBB 3W7UA 4CC5A 2XTAA 5HFLA 2UUBB 4BR6A 3SR2C 4TV9B 4YJ3B 3ZRWA 4O4IB 2Q9LA 1XBLA 4DV7B 1XNQO 3C3TA 4DR6B 1JCHA 3A8TA 2DWDC 4FM1A 2QM4A 4WF9V 3OTOB 2VQFO 3BY6A 4DV2B 1K34A 2LGWA 3JD1A 5CBGA 1VQMV 4LWSB 3MAQA 2UXDB 3ASNB 3OAAG 1FFXB 5FL7G 2UU9B 2IBZH 3I5DA 1R6KA 1QLNA 2RNBA 4TWKA 3LSSA 2KB1A 2ZDIA 3E35A 1H2LA 3E8GA 1BS3A 4I4TB 4G28B 2BCCH 5IDJA 4E2LA 1T5EA 1IURA 5JVDA 4LFAO 1IDSA 4JI8O 4ICGA 5KHKA 1KP2A 4OX9B 3LDEA 4DW0A 2Q73A 4NXNB 2Q7HA 4U3JB 3JD3A 1K33A 1OCCC 1JJOA 2PUSA 3BA8A 3ZBHA 1P49A 4NKGB 2EIKB 2GSMB 2F95B 4TSFG 4DV1O 2XASA 4MVOA 1WAZA 1M56B 2V1DA 3JATB 5IJ9A 1N34B 4EKWA 1ZAUA 4FK5C 3ML0A 3CCJV 1GM8A 4UB8Z 4IIJB 2CAZC 1AP5A 4CH6A 3D36C 1Q7YW 2XNDG 2OIGA 3DGEA 2W6JG 1LR1A 2YC0A 3SPJA 2QKSA 1KC8W 2ZCEA 2E75B 1VQPV 3IAYA 1FD9A 5LA6B 4MVUA 1M4UA 2Q8VA 3CJHA 1NTMH 2LP7A 2VS0A 1X59A 3D3QA 1NKDA 1K4DC 2JVDA 5CB4B 3J81N 3M99B 1R3KC 2UU9O 2BE3A 4O4LA 2H94A 2Y0IA 1V55C 4ZHQA 3CPWU 3DSQA 4MT8A 4JGSA 3VQVA 2UUBO 3P32A 5LP6C 1R73A 3RVZA 1ORQC 3TETA 1L8DA 4QPJA 1EM1A 2WAMA 1N36O 1DF5A 5IYCO 3CCVV 4FLUA 5BR8O 1H2SB 1H2MA 5F2VO 1R6NA 3PJSK 5AG2A 1B6QA 3UT5A 2N74A 4EEQA 1GAXA 1NTKH 5L3EA 5LGTA 1N33O 4R6ZA 5B1BC 3ZHQA 3O9OA 3OD4A 3MHSC 3H9VA 3SYCA 2UUCO 4Q20A 3N2GA 3W7TA 1GK9A 4F6RA 3FB8C 1OHHG 3QNEA 1QR9A 4B3RO 3FB6C 1FFTB 3ABUA 3VOUA 5LYJB 3ASOC 3CCSV 3K79A 5H9CA 2EIKC 3D36A 3O65A 3F7VC 4LH6A 1YJWV 1NQTA 3ZCCA 4LBEC 1MZEA 1S3JA 5JJNB 1K7DA 2CTWA 4QE7A 5JH7B 4KHPO 3IFXA 4TQDA 4PI0A 1IBKO 3ZHVA 5JVDB 1XOUA 3BEHA 2YXYA 4TV8B 4HZ3A 3TXSA 3CCLV 3GWOA 1S77D 3ETEA 3K5OA 5FNVA 4PA3A 1WA8B 2WSSG 1F51A 3NR7A 1OCZB 1J5EO 1VIBA 4N23A 4FMTA 2IU0A 4JV5B 4GLXA 3AG1B 3G6BA 3JALB 3JATA 4GT1A 4FFBB 1WN7A 2UXBB 2FYUH 2Q4PA 2PY5A 1L0LH 4X62B 1VF5B 3E22A 1YF2A 1AVMA 1KKDA 5CA0B 3FFQA 4I55B 1SQFA 5BXZA 1NTZH 1MNGA 2LFRA 3F5WC 2ZD9A 4X9QA 4QIWF 1SA0A 3RGBA 2HHHB 1YXBA 2B1IA 2Q67A 4UUJC 5CB4A 3OUSA 4X66O 3ZN0A 3A0BZ 5B1AB 3R65A 2P06A 3OW2U 4XBFA 3CRMA 4H33A 4QJFB 1IBMO 1HWYA 4YY3B 4B3RB 2IJHA 4YJ2B 1F4MA 2EIJC 2KKWA 1U97A 1RFYA 1NVPD 4GKJB 2ZDIC 3CC2V 3U0ZA 3DTUB 1IBLB 5CMUA 3OR6C 1V54C 4DV7O 2UUAO 3K06A 2ZE6A 1H8HG 1K5QA 1N34O 4P30A 4B3TB 4BIOA 2UUAB 3RYIA 3CRAA 2XAQA 2AGAA 1XNRO 4Z1VA 2QA4V 3T1CA 1WPXA 3VBBA 2RN9A 4FFKA 5EIBD 3IGAC 1XI1A 3KCYA 2WLIB 5KAFZ 4PDRA 3W7WA 2DJVA 3HKCB 4JYAB 4JI7B 2Q5ZA 1Y6XA 1R3JC 3CS5A 4HNAB 2YEVA 2BTOA 4LFBO 2HVJC 3HKEB 1N32B 2Y69C 2A0LA 2FKXA 2Y0PA 2LGQA 2UXCB 1R3IC 1FXKC 2Z3YA 2QKCA 5CA3A 3OTFA 1IXMA 2ZE5A 3ABMB 3IC7A 4WFGA 4K3AA 3RBZA 3G80A 2CE4A 4JF3A 5J2UB 5EZYA 5KHJA 2C2AA 4JZGA 2NN4A 4MTXA 1GN6A 4X62O 3FYIB 2YXHA 1WA8A 2ARHA 1NT2B 2DOSA 2VRZA 3CXHF 3CCMV 1ZTEA 1UFIA 4ZOLB 4J7ZA 4B3SB 1SQBH 2F93B 4EB6A 4N21A 5LP6A 1K5SA 2DYRB 3OGCC 2YXLA 2ETNA 2KG7A 5E1AC 3OMAB 3AG2B 3HKDA 4JI5O 2CK3G 3SJCC 2XOKG 1MA1A 4B3TO 4JV5O 1PNLA 1IBMB 3W7XA 2WA4A 4UV8A 4P2ZA 3HKBA 4DR7B 1E1RG 3K04A 1QR8A 3CMAV 3B40A 3A2FA 5LGUA 4FLZA 3N2KB 4B3MB 4OGQB 4Z2WA 1Q81W 1HNXO 3ZHSA 3GVMA 5K1XA 3ZEDA 3ZHTA 3FAVA 3EFFK 1Y67A 1D5AA 1RM1B 3E86A 3Q4HB 4IHJB 3BFRA 4HBNA 1MSDA 1JQ0A 2A79B 2ATKC 4DK1A 3B09A 3ZHUA 1AR5A 4DV3B 3ZJZA 3LSQA 2GTAA 1KQSU 1AR4A 4NVPA 2BSKB 4JI5B 3AK2A 3JD4A 1AI6A 2OIEA 3JAWA 1VQKV 2P4VA 3WB1A 2WLHA 4K8ZA 4IL6Z 3DXRB 3T4ZA 2E74B 3B4SA 1KU9A 1YITV 3ABMC 2K9PA 2X0LA 3AK3A 1QQCA 2MK3A 1BE3H 3OMNB 1EFRG 1H38A 1QCEA 2Q69A 4JYBA 2Q6AA 1SS3A 3N27A 2DQ0A 2ZNJA 2IJKA 4J80A 1LNQA 1ROPA 2Q7EA 1SERA 2R9RB 1SQXH 3QG5A 2IH1C 2CTQA 1RPOA 3CEIA 3K0DA 1QBZA 3F7YC 3SYPA 1KYOF 1FAFA 2ZIOA 4X8AA 3B2EE 2WWWA 3ZMTA
chains in the Genus database with same CATH topology
2EILC 2EINB 5L3BA 3STLC 2Q68A 1Q7YW 1JX9A 5B1AC 2XNDG 1M56C 2Y69B 3DGEA 2W6JG 3AG3B 3SPJA 2DQ3A 1KD1W 4RUFA 3G71V 2QKSA 1MSWD 1KC8W 3T4DA 1VQPV 1PL0A 4PA4A 2ITCC 4MVUA 1YI2V 4PELA 2GHYA 1BMFG 2LP7A 2ZXWC 1NKDA 4QPKA 1ENVA 2WLIA 1K4DC 2JJ1G 2WLNA 3E8FA 4UXNA 3M99B 2AHYA 4GX1A 1OZ0A 1R3KC 2EBOA 4CBCA 4G2KA 3ZMVA 1VQ8V 3LNMB 4MW3A 3SPIA 2H94A 1MG1A 2ZXWB 4WFFA 3OMIB 4MTFA 2YSUB 1V55C 4UVBA 2W6IG 2IJIA 3CPWU 5EBMC 4JAUA 3OEEG 1PNMA 4MT8A 2B5UA 2ITDC 4JGSA 2EIMB 3P32A 1R73A 5IYDO 3E8HA 3D3IA 1ORQC 3RVZA 4F4LA 3TETA 1VQNV 4QPJA 4XDJA 4OXSA 1AI4A 4WFHA 2WAMA 1V55B 1DF5A 4P9PA 5KA5A 1R3LC 5IYCO 3CCVV 1NVPB 4CZZA 3ZRVA 2P7TC 1R6NA 3SPHA 1VQ4V 1S5HC 3PJSK 3E2EA 1JJ2U 2WLKA 1B6QA 2QEXV 1XL4A 2QTOA 1YTFD 2Y48A 2HVKC 3W7SA 5L3EA 5B3SB 4PDVA 3ETGA 5LGTA 2LFSA 4FPPA 1E79G 1KP3A 5EC2C 1YHQV 4BAYA 1F23A 3H01A 4PA9A 4R6ZA 3WG7B 1AJPA 5B1BC 1CP9A 2QE7G 4MW8A 4TT3G 1FXKB 3MHSC 2XAHA 4I5SA 3SYCA 4Q20A 5BZBA 3CP1A 1K4CC 2F43G 3W7TA 4ASUG 5DN6G 1GK9A 3FB8C 2P90A 4H37A 1CPYA 1OHHG 4DXWA 3QNEA 1QR9A 1VQ7V 5KA6A 3NXSA 4HYOA 3FB6C 1FFTB 3ABUA 1M9NA 3VOUA 5L3DA 4BW5A 3ASOC 3CCSV 3K79A 3MD0A 5H9CA 2EIKC 1FXVA 3D36A 2JEUA 3F7VC 3SPGA 1YJWV 1NQTA 2XAJA 3ZCCA 4LBEC 1S3JA 3TK1A 1H8EG 4WFBV 1K7DA 4FIPC 4GX5A 4Z1MG 4QE7A 5GW7A 4QNHB 4JPRA 3ASOB 1DLBA 3OE7G 1GM7A 3IFXA 2OTJV 2EZPA 4MVZA 2OT5A 1JOYA 3JD2A 2OTLV 3BEHA 3B8NA 1OCZC 3ABLB 4UV9A 3QO7A 4FJCC 2X6BA 1QVGU 2NNUA 4HZ3A 5L3GA 3AG1C 3CCLV 3GWOA 1S77D 3OM3B 3ETEA 3ZRWB 5HFMA 4PA3A 1QLEC 1AJNA 1F4NA 2WSSG 3SJQC 4KFMA 1VQOV 1F51A 2H8PC 2K1EA 1NJIW 1OCZB 4JTAB 2M7WA 2YEVB 4N23A 4U7OA 4MVQA 4FMTA 3G4SV 2IU0A 2Z5UA 3E8BA 4P9OA 2P6JA 3AG1B 3P30A 2PI5A 1BHBA 2IU3A 4GT1A 3LDCA 3JYCA 1E1QG 1AI5A 3CCQV 2UXXA 1VQ6V 2WPDG 2ZR3A 3OR7C 2EIJB 3ZRSA 4WFAV 5EK0A 1S76D 3FB5C 1P7BA 1M57B 1UJWB 1L1FA 2ZR2A 1NBMG 1AROP 1KKDA 3CD6V 1V54B 2AHZA 3HPLC 3FB7C 3K03A 2LFRA 3F5WC 2ZD9A 1COWG 4QIWF 3SYOA 1BL8A 3ZRXA 2WLJA 3K3WA 2B1IA 2X6AA 2Q67A 2EZOA 5LHHA 1AJQA 4UUJC 4BIZA 3OUSA 3MHHC 2EINC 3K0GA 3ZN0A 4MS2A 1NH2D 4MTGA 5B1AB 3R65A 3LUTB 3OW2U 3WG7C 4XBFA 3E89A 3ZIAG 4JASA 4HAMA 5CBFA 4H33A 4LC1A 2X6CA 1AI7A 2DYSB 4QJFB 1HWYA 4MTOA 2IJHA 1K73W 4MSWC 4R50A 2ZQMA 4J9ZB 2IJJA 1F4MA 3CCUV 2JIZG 2EIJC 4G27B 2JK5C 1K3EA 1M57C 1NR1A 1NVPD 2ZDIC 4JTDB 5LHIA 4RO2A 2HR3A 5DM6V 3CC2V 3DTUB 5CMUA 3OR6C 5EBWC 1V54C 4JYCA 2HLDG 3CC7V 1MABG 1RPRA 3K06A 1H8HG 1K5QA 1VQ5V 4P30A 1G8MA 4X89A 3ZMUA 4GCZA 2XAQA 3A0RA 3CYOA 2QA4V 2JJ2G 3RW0A 1I5XA 4R8CA 2A9HA 1TUEB 2OCCC 3AG4B 3AEIA 1WPXA 3T1CA 3VBBA 1G4YB 2X7RB 1K97A 3KG2A 3ABLC 3I55V 3SPCA 2IW5A 2QM8A 3IGAC 1DF4A 1SESA 4LCUC 3CXCU 2WLIB 4PA7A 1I5YA 1K8AW 4PDRA 4ZBMA 3OEHG 3W7WA 4QE9A 2DYSC 2WLLB 1QLEB 2OCCB 1BHAA 1R3JC 3TCUA 4DO2A 1CEZA 5C93A 5B1OA 5IY5B 2YEVA 1S72V 2HVJC 3ZMZA 1GMGA 1DTOA 2Y69C 2A0LA 3X2QC 1GTOA 2DYRC 5B1BB 1PKXA 1R3IC 3HB3B 3EHBB 1FXKC 2Z3YA 3FKSG 4RQEA 5CA3A 4WFEA 4BIUA 1VQLV 1IXMA 3QO8A 3B77A 5IY5C 3ABMB 5H6RA 3ZN1A 3ABKB 3IC7A 2UXNA 4WFGA 4MVMA 5B1NA 5H6QA 2BOBC 3RBZA 1VQ9V 4R7CA 3JD0A 3CCRV 1YIJV 3T2MA 1FXHA 4JF3A 5CN0A 5LBQA 3CC4V 2C2AA 1GO3F 5IYBO 4JAVA 1YTFB 2R9IA 1OCRC 4MTXA 1W2BU 1FS0G 2QM7A 3FYIB 5KUKA 3JCZA 5J9PC 1NH2B 1SETA 5CBHA 3CCMV 1SZTA 1GM9A 1Q86W 2EIMC 1YJ9V 2WLLA 4J9YB 1YJNV 3K08A 4GX0A 1OCRB 3CCEV 2BOCC 4X88A 3AG2C 2HG5C 3OFNG 1KECA 4N21A 2EJRA 4RUEA 1K9MW 1K5SA 1JPXA 2DYRB 1YSCA 3GB7C 5L3CA 1Y4MA 2DW4A 3OGCC 5KUMA 1EZJA 3LDDA 1W0JG 3ETDA 3I56V 5E1AC 3STZC 1WLEA 3UM7A 3ZMSA 4RQFA 3OMAB 3AG2B 3G6EV 3ABKC 5LGNA 2CK3G 3SYQA 4PA6A 3AG3C 1Y66A 2D3OW 4GX2A 1M90W 3W7UA 2XOKG 1PNLA 3QO5A 1GKFA 1OCOC 1THZA 5HFLA 3W7XA 4MVSA 4UV8A 1S0VA 1J95A 4P2ZA 2B1GA 1E1RG 3K04A 1QR8A 3ZRWA 3CMAV 5LGUA 2XAGA 2HKOA 1Q81W 1NR7A 3B8MA 2IH3C 4YXWG 1PNKA 3AG4C 1JCHA 3EFFK 4U7NA 4KUMA 1RM1B 2DWDC 3E86A 4JTCB 2JDIG 1FXKA 3UKMA 4WF9V 1JQ0A 2A79B 2ATKC 3BY6A 1PD3A 1K34A 2WLMA 2V7QG 4KP4A 4XDLA 3JD1A 5CBGA 1VQMV 3ZJZA 3OUFA 2PI4A 3LSQA 1KQSU 2HJFC 4UVCA 1XL6A 3ABTA 3ASNB 1RM1C 4UVAA 2NLJC 1ZWIC 1AI6A 2XAFA 3JD4A 3OAAG 1P4RA 5FL7G 4MVRA 1H2GA 3WFVA 3X2QB 1SRYA 1R6KA 1QLNA 1VQKV 5L3FA 4TWKA 3LSSA 2WLHA 4I9WA 2KB1A 1OCOB 2EILB 2ZDIA 3E35A 5B3SC 3E8GA 3T4ZA 3RVYA 2JEXA 4G28B 1YITV 3ABMC 1W0KG 2P67A 1K92A 2X0LA 1Q82W 2MK3A 3OMNB 5IDJA 4E2LA 1EFRG 1EBOA 1QCEA 1H38A 4PDMA 2Q69A 4JYBA 2Q6AA 3E83A 1M1KW 1JVMA 2DQ0A 4WCEV 2IJKA 1KP2A 3SYAA 3LDEA 4RAIA 1QVFU 1AR1B 3FYEB 4PDLA 2W0FC 3JD3A 5EC1C 1K33A 1LNQA 1OCCC 1ROPA 4XDKA 3CMEV 2HFEC 1SERA 4LP8A 4L87A 2R9RB 1N8RW 2EIKB 2GSMB 5LHGA 3ASNC 2IH1C 2XASA 4TSFG 2FTKA 4MVOA 1RPOA 3K0DA 1QBZA 4ZKIA 2V1DA 1M56B 3F7YC 3SYPA 1OCCB 4EKWA 1MOFA 5EBLC 4FK5C 3K9AA 4X8AA 2DWEC 3ML0A 3CCJV 2WWWA 1GM8A 3ZMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN V;  3OW2 U;  1VQO V;  1YJ9 V;  4WFB V;  3CXC U;  3CCV V;  1NJI W;  1M90 W;  1VQ9 V;  3CD6 V;  1K8A W;  1VQ5 V;  3CCR V;  1YIJ V;  3CCE V;  1Q7Y W;  1VQ8 V;  4WF9 V;  3G4S V;  1VQ4 V;  3CME V;  1JJ2 U;  1YIT V;  2OTJ V;  1KD1 W;  2QEX V;  3G71 V;  1N8R W;  3CC4 V;  1Q82 W;  1S72 V;  1KC8 W;  1K9M W;  1VQM V;  3CPW U;  1VQP V;  2OTL V;  1VQ7 V;  2QA4 V;  1K73 W;  1KQS U;  1YI2 V;  1W2B U;  3CCU V;  3CCQ V;  3CMA V;  1QVG U;  3CCS V;  3I56 V;  1YHQ V;  1M1K W;  1VQ6 V;  4WFA V;  1R73 A;  3CCL V;  5DM6 V;  1VQL V;  1YJW V;  3CC2 V;  3G6E V;  3CCM V;  1Q81 W;  1VQN V;  3I55 V;  1QVF U;  1Q86 W;  3CCJ V;  4WCE V;  3CC7 V;  1VQK V;  2D3O W; 
#chains in the Genus database with same CATH topology
 2EIL C;  2EIN B;  2R70 A;  2Q68 A;  5KHH A;  1XNQ B;  1KD1 W;  5IJ0 B;  1I94 O;  4TV8 A;  3T4D A;  5KX5 A;  1YI2 V;  5LMN O;  3ETQ A;  4GKK B;  1NS1 A;  2ZXW C;  4TUY B;  4DRX B;  1VF6 C;  2Q0O C;  4QPK A;  4LFB B;  4GX1 A;  2EBO A;  1D5N A;  4UCR A;  1XRE A;  5EYP A;  4DV4 B;  1VQ8 V;  3SPI A;  2DMX A;  4FFB A;  4NYK A;  3OMI B;  4MTF A;  2YSU B;  4UVB A;  5LMU O;  1VF7 A;  5EBM C;  1XNR B;  2ITD C;  2ZM6 O;  2JS3 A;  2EIM B;  4WBN B;  5LOV B;  1JFF B;  3E8H A;  4FLY A;  1IVS A;  4I0X A;  4OXS A;  1YVW A;  2YIB A;  4FLT A;  4TOI A;  2P5O A;  3ZX6 A;  3E2E A;  1JJ2 U;  2WLK A;  4JI6 B;  1XL4 A;  1YTF D;  2HVK C;  4FZ0 A;  4O4I A;  1I0H A;  3UCS C;  4PDV A;  4YY3 O;  1YHQ V;  4LF5 B;  1FPO A;  3H01 A;  4PA9 A;  3WG7 B;  1H2N A;  1GN3 A;  4I5S A;  1NU1 H;  3CP1 A;  1K4C C;  2F43 G;  2E5L O;  1VF6 A;  1TVK A;  2P90 A;  4I50 B;  1FFX A;  4GZR B;  4EFE A;  2QDO A;  3MD0 A;  1RSO B;  3SPG A;  1XMQ B;  2XAJ A;  1URF A;  1US6 A;  1YEW A;  2GDS A;  2PYL A;  4WFB V;  4FIP C;  2R72 A;  4QNH B;  3OTO O;  5ITZ A;  4JPR A;  4JI4 B;  3AG7 A;  2OT5 A;  4O4J A;  2F66 C;  1JOY A;  2PTM A;  3B8N A;  4UV9 A;  5KLV H;  4FJC C;  2X6B A;  2F4V O;  3A0H Z;  4YJ3 A;  3ZRW B;  2RJZ A;  5J2T A;  3IC9 A;  3BHP A;  2KQX A;  4ZI7 A;  2WA3 A;  4OPA A;  4I7Z B;  2K1E A;  2AZ2 A;  2M7W A;  2YEV B;  4NB5 A;  4MVQ A;  4U7O A;  1WP8 A;  2Z5U A;  2P6J A;  3LDC A;  2UXX A;  1Q6I A;  2WPD G;  3OR7 C;  1FJG B;  2EIJ B;  3ZRS A;  4B7E A;  3L75 H;  5JH7 A;  3F5T A;  2ZR2 A;  2D2C B;  2M6Y A;  1NBM G;  3CD6 V;  1V54 B;  2AHZ A;  1EN6 A;  1N32 O;  3FB7 C;  1VEW A;  4PI2 A;  1WP7 A;  5LA6 A;  1R6T A;  2Y4T A;  1Z5W A;  5KHG A;  2G38 A;  4O2B B;  1N33 B;  4X66 B;  3K3W A;  5A2Q N;  2EZO A;  4TQF A;  3JAS B;  3L71 H;  4J42 A;  3K0G A;  2HHH O;  4D6T H;  2ADP A;  3VQW A;  3WG7 C;  2CGO A;  2Q0A A;  3E89 A;  3ZIA G;  4JAS A;  3JAR A;  4LC1 A;  2X6C A;  2UXB O;  4MTO A;  1FKA O;  1K73 W;  2ZQM A;  3C90 A;  4G27 B;  2FL4 A;  1K3E A;  1M57 C;  1NR1 A;  1TUB A;  2A06 H;  1IXB A;  5EBW C;  1U96 A;  3CC7 V;  2HLD G;  2YIB D;  4X1I A;  2YIA A;  1XIL A;  1VQ5 V;  3G67 A;  5JJJ B;  3CWB H;  1G8M A;  3J80 N;  2OWO A;  3ZMU A;  4CH4 A;  3A0R A;  4LF4 O;  2GUZ A;  2JJ2 G;  3RW0 A;  4DR2 O;  2A9H A;  1JA8 A;  1G4Y B;  3FAV B;  3I55 V;  3SPC A;  2IW5 A;  2QM8 A;  1DF4 A;  2E76 B;  1SES A;  4PA7 A;  1I5Y A;  5KMG B;  4ZBM A;  3OEH G;  4QE9 A;  2WLL B;  2OCC B;  1HNW B;  4JI6 O;  3TCU A;  2QWP B;  2GBO A;  3ZMZ A;  4LFC B;  4JI1 B;  2DYR C;  5B1B B;  4W4K A;  5C8Y B;  3EHB B;  5BMV B;  3K5L A;  4RQE A;  1ZL8 A;  2FML A;  5IY5 C;  4AIL C;  4LNU A;  2BOB C;  4K0K B;  4JI2 O;  3CCR V;  4NR1 A;  1FXH A;  3APO A;  1EZV H;  3CC4 V;  3L72 H;  3T1Y B;  1YZB A;  3RWR D;  1Y76 A;  4LF9 B;  1BT8 A;  4ZI7 B;  5KUK A;  1L0N H;  1NH2 B;  2Y4U A;  1Q5O A;  4CS3 A;  4D7T A;  1YJ9 V;  1YJN V;  2YS8 A;  4NXN O;  2N04 A;  3K08 A;  1OCR B;  3JAK B;  2OYQ A;  1BGY H;  1UPG A;  3OFN G;  2B9Z A;  1YSC A;  4UFZ A;  1EZJ A;  2XT9 A;  4LWS A;  3STZ C;  3BPZ A;  1WLE A;  3ZMS A;  2CH7 B;  4DK0 A;  4GKK O;  4Q6G A;  4PA6 A;  3AG3 C;  2D3O W;  3APQ A;  2UUC B;  1O9G A;  2EX3 A;  3QO5 A;  2YUA A;  1GKF A;  5JQG A;  4MVS A;  1N0J A;  1S0V A;  1J95 A;  2B1G A;  5E79 Z;  4TUY A;  5B66 Z;  4FM0 A;  4DR6 O;  4CH3 A;  3FD9 A;  1P84 F;  4X1Y B;  2XAG A;  4ZOL A;  1PNK A;  2GV9 A;  3WU2 Z;  2JDI G;  1N36 B;  1FXK A;  5LXT B;  4YIO A;  4O4H A;  2N05 A;  1PD3 A;  4LF4 B;  4KP4 A;  4XDL A;  1GN4 A;  3K5N A;  2OCH A;  5LL6 Y;  4DR4 B;  2HJF C;  1JFF A;  3SGI A;  4DV0 O;  4UVA A;  1ZWI C;  1Y74 A;  2XAF A;  4UCO A;  4MVR A;  1H2G A;  1OV9 A;  5L3F A;  5IT9 N;  4I9W A;  1Q6H A;  1OCO B;  2EIL B;  4EFB A;  5B3S C;  4CS4 A;  5BR8 B;  3E22 B;  3RVY A;  2JEX A;  2GUZ B;  2P67 A;  1K92 A;  4NXM O;  4OX9 O;  4PDM A;  1N4C A;  1HNX B;  4DV5 O;  2ZNI A;  4QGP A;  4RAI A;  1QVF U;  2CTP A;  1G6U A;  1A32 A;  3FYE B;  3JSL A;  4O2A B;  5EC1 C;  4HNA A;  2XUM A;  2JRI A;  4XDK A;  2HFE C;  4GYC B;  4L87 A;  5LYJ A;  5FLX N;  3L9D A;  1Z2G A;  2FB5 A;  2FTK A;  1ZL8 B;  4JZ2 A;  4ZKI A;  4DV6 O;  1B06 A;  1OCC B;  4FLV A;  5EBL C;  1CXZ B;  3K9A A;  4I9Q A;  4AI8 A;  5EZY B;  3J7A U;  4I4T A;  5L3B A;  3QF7 A;  4JI7 O;  1JX9 A;  3RYI B;  1M56 C;  2Y69 B;  3U10 A;  3AG3 B;  2DQ3 A;  3ICX A;  4RUF A;  5DEC A;  3G71 V;  2ITC C;  3WB0 A;  2GHY A;  1BMF G;  5FNV B;  4FVM A;  1SZX A;  1SQQ H;  1XHX A;  5GON A;  2JJ1 G;  1SF9 A;  2WLN A;  3L74 H;  2QTS A;  3JAK A;  5K1P A;  1OZ0 A;  4CBC A;  4K0K O;  3ZMV A;  4X65 O;  4AHC A;  3LNM B;  3HKE A;  4WFF A;  3T1Y O;  1HR0 B;  2IJI A;  5IJ9 B;  3OEE G;  1PNM A;  3RYH A;  2RQ6 A;  4JI2 B;  5CA0 A;  4F4L A;  2ZKO A;  1VQN V;  5B5E Z;  1AI4 A;  3L73 H;  1V55 B;  5KA5 A;  2UXC O;  1XMQ O;  4IT5 A;  2AXT Z;  5JCO C;  1NVP B;  4CZZ A;  5IJ0 A;  2P7T C;  2RCV A;  2QEX V;  2QTO A;  2ILM A;  2Y48 A;  3W7S A;  5D5Q A;  5BY1 A;  4H44 B;  5B3S B;  2LFS A;  3N2K A;  1HNZ B;  4FPP A;  1E79 G;  4JI3 B;  2KSD A;  3K57 A;  5EC2 C;  4BAY A;  1F23 A;  4IYH A;  4DV2 O;  1AJP A;  1CP9 A;  2QE7 G;  5CA1 B;  4JI0 B;  2LQT A;  3RYC A;  4X65 B;  2VWK A;  1Q3E A;  5BZB A;  4ASU G;  5DN6 G;  2YID A;  2QGN A;  4X20 A;  3BVO A;  3KKY A;  4DV1 B;  4DXW A;  2ZM6 B;  1VQ7 V;  4LR3 A;  3NXS A;  1M9N A;  5L3D A;  4X1I B;  4DR5 O;  1BZK A;  1H8E G;  4GX5 A;  4Z1M G;  3ASO B;  1S5J A;  2OTJ V;  4MVZ A;  1I7F A;  3VQY A;  1OCZ C;  3ABL B;  5LMN B;  4NTX A;  1IBK B;  4JI0 O;  2F1M A;  2NNU A;  5L3G A;  3AG1 C;  1YCI A;  1XMO B;  2NR5 A;  1AJN A;  3SJQ C;  3C3S A;  2H8P C;  1BQ0 A;  4JTA B;  1IX9 A;  1FYJ A;  3E8B A;  4DW1 A;  5C8Y A;  5TIS Z;  1E1Q G;  3CCQ V;  1QHT A;  2AW9 A;  1XQ8 A;  1Q6U A;  4WFA V;  1S76 D;  3FB5 C;  1NZ6 A;  3L70 H;  1M57 B;  1QU7 A;  1UJW B;  4NXM B;  1ARO P;  1G1X B;  1Y76 B;  3SYO A;  1BL8 A;  2F4V B;  3ZRX A;  2ZE8 A;  3UT5 B;  5IYZ B;  5LHH A;  5J2T B;  3M8A A;  2V4D A;  4BIZ A;  4U3J A;  3MHH C;  1MZF A;  2EIN C;  3LNN A;  1NH2 D;  3LUT B;  4UCT A;  1GRJ A;  4DR5 B;  4HAM A;  1N0N A;  1TAE A;  4B3S O;  1AI7 A;  2HEP A;  4WBN A;  4MSW C;  4JI4 O;  2IJJ A;  2A7W A;  2JIZ G;  2ADQ B;  2ZE7 A;  4DUZ B;  4RO2 A;  2ZIN A;  4FLW A;  2E5L B;  3TGU H;  2RMK B;  1R1B A;  4GKJ O;  2QSA A;  1RPR A;  3BA9 A;  4RWU A;  4LF8 O;  4IIJ A;  4K35 A;  2CUG A;  4X89 A;  3CJH B;  4GCZ A;  1YDX A;  5J2U A;  4DR1 O;  1H2K A;  4R8C A;  1TUE B;  5KAI Z;  3AG4 B;  2X7R B;  1K97 A;  2CGN A;  4LF7 O;  3KG2 A;  4DR1 B;  3ABL C;  4LF6 B;  4O4L B;  1TVK B;  4O4H B;  4LCU C;  3CXC U;  2QWO B;  1K8A W;  2DYS C;  1BHA A;  4B7K A;  5C93 A;  5B1O A;  3FX7 A;  1GMG A;  2BSK A;  4B3M O;  3R66 A;  3X2Q C;  1PKX A;  4DUZ O;  4LF5 O;  3HB3 B;  2GTS A;  1IBL O;  4U3F H;  5D5P A;  3ZN1 A;  2UXN A;  5H6Q A;  2PZS A;  1VQ9 V;  3T1H O;  2JS5 A;  4R7C A;  3CRR A;  3T2M A;  4DV4 O;  1F7Y A;  4JAV A;  1YTF B;  1KB9 F;  1FS0 G;  2QM7 A;  4YHH O;  5J9P C;  5KHI A;  2QWR B;  2E3C A;  5CBH A;  4DV6 B;  3CX5 F;  1GM9 A;  2WLL A;  4J9Y B;  1HNZ O;  4I50 A;  2BOC C;  3ZHR A;  3AG2 C;  2HG5 C;  4RUE A;  2EJR A;  3GB7 C;  1Y4M A;  4J41 A;  2JGU A;  1IZ3 A;  3LDD A;  1W0J G;  4YIP A;  2PGG A;  3RFR A;  2H3O A;  4RQF A;  3G6E V;  3ABK C;  3SYQ A;  1SC5 B;  1P7G A;  1M90 W;  4FM2 A;  4O2B A;  3SJA C;  4ZIB A;  2BTQ B;  1KKC A;  3SDL A;  4C7U A;  1OCO C;  1THZ A;  5IYZ A;  1V9P A;  3DC5 A;  4OPH A;  3LSU A;  2EJ7 A;  4A5U B;  1GH6 A;  1ZX3 A;  4J7K A;  3CB2 A;  1BQZ A;  2HKO A;  1NR7 A;  3B8M A;  1DGS A;  2F23 A;  5EYP B;  2IH3 C;  4YXW G;  3JAR B;  3AG4 C;  4U7N A;  2YIC A;  4KUM A;  1B04 A;  4JTC B;  5IE9 A;  3JAL A;  3UKM A;  1LUW A;  2WLM A;  2V7Q G;  1GN2 A;  2KG7 B;  3OUF A;  2PI4 A;  5LMU B;  1TGO A;  4UVC A;  4F6E A;  1XL6 A;  3ABT A;  4J11 A;  1RM1 C;  2NLJ C;  2HJD A;  1WB8 A;  1P4R A;  3WFV A;  3X2Q B;  1SRY A;  2UXD O;  4JAA A;  4UCV A;  3JSN A;  1W0K G;  1Z5V A;  4JYY A;  2VQE B;  1Q82 W;  1EBO A;  5GTH Z;  3THO A;  1SA0 B;  2VQE O;  3E83 A;  1M1K W;  1JVM A;  2YI8 A;  4CS2 A;  3BAB A;  1WJZ A;  3JAM N;  4LFC O;  3JAS A;  3SYA A;  3Q4H A;  4IHJ A;  1AR1 B;  3UO2 A;  4PDL A;  1PL4 A;  2W0F C;  1BCC H;  1AIL A;  3CME V;  1RP3 B;  4LP8 A;  2L6L A;  4YJ2 A;  1N8R W;  1O9H A;  4DV0 B;  5LHG A;  3ASN C;  4PV1 B;  2QJ1 A;  4CC6 A;  1M93 A;  1MOF A;  4H0L B;  4DR3 O;  3WB2 A;  2DWE C;  3CE2 A;  3DXR A;  4WCE V;  5ITZ B;  4W4L A;  3U11 A;  3STL C;  4LH7 A;  5B1A C;  3D8C A;  1MSW D;  1TA8 A;  1PL0 A;  2QKA A;  3JCU Z;  4PA4 A;  2L35 A;  4PEL A;  1W59 A;  4UB6 Z;  4X64 B;  4TV9 A;  1ENV A;  2WLI A;  5KMG A;  1KUQ A;  3E8F A;  4UXN A;  2VWJ A;  2AHY A;  2CTR A;  4G2K A;  3RT3 C;  1J5E B;  1SQG A;  4MW3 A;  5DED A;  1MG1 A;  2ZXW B;  4DYL A;  3N2G B;  4LF6 O;  5A9G A;  5EIB C;  2W6I G;  3P3P A;  1XDC A;  5BMV A;  4JAU A;  4F6R B;  4J7J A;  2B5U A;  1Q8I A;  1HR0 O;  3K58 A;  2YI9 A;  5IYD O;  1FJG O;  3D3I A;  4XDJ A;  1RSO A;  3H1K H;  4WFH A;  4P9P A;  2AZ0 A;  1R3L C;  1HDJ A;  3ZRV A;  2YDE A;  3UQ8 A;  3OT7 A;  1VAR A;  3SPH A;  1M5I A;  1S5H C;  1VQ4 V;  1VMG A;  3EXA A;  3ZS8 C;  3RYF A;  2ODM A;  4BWA A;  3ETG A;  1KP3 A;  3TXQ A;  5JWP A;  4KL1 A;  4DV5 B;  3KCX A;  1AP6 A;  4MW8 A;  1I08 A;  4TT3 G;  1Q90 D;  1FXK B;  2XAH A;  2LJ2 A;  4DR3 B;  5FPR A;  1BSM A;  4H37 A;  1CPY A;  1NI8 A;  3UO3 A;  5KA6 A;  1SQV H;  4HYO A;  3H1J H;  2CH7 A;  4BW5 A;  5LP6 B;  1I94 B;  4LF9 O;  1FXV A;  2JEU A;  2HP8 A;  1HP8 A;  4PJ0 Z;  2Z0A A;  3TJT A;  3AK1 A;  4GUN A;  3TK1 A;  4UCS A;  5JQG B;  1SQP H;  4L8J A;  5GW7 A;  1LUV A;  3HKB B;  3CHX A;  1DLB A;  3OE7 G;  1GM7 A;  1ZUQ A;  2EZP A;  1DK1 A;  3HR0 A;  3JD2 A;  2OTL V;  4DUY B;  3QO7 A;  3DC6 A;  2MW2 B;  1QVG U;  4X1K B;  4JI1 O;  2VQF B;  3S3X A;  3OM3 B;  1D2D A;  5HFM A;  1EN4 A;  1QLE C;  4J10 A;  1F4N A;  5LXT A;  4KFM A;  4DRX A;  2JGD A;  1VQO V;  3H1I H;  1NJI W;  3MDS A;  4PHZ A;  3G4S V;  4K8X A;  4JYA O;  4P9O A;  4YHH B;  1XUQ A;  3P30 A;  2PI5 A;  1BHB A;  2IU3 A;  3BCC H;  5JCO A;  3JYC A;  4EB6 B;  1AI5 A;  4BW9 A;  3P3N A;  4ZHQ B;  1VQ6 V;  2ZR3 A;  5EK0 A;  3GWK C;  1P7B A;  3CSX A;  1L1F A;  3JAW B;  1WPB A;  3K59 A;  4DR4 O;  4FZ1 A;  5LOV A;  1S5L Z;  3HPL C;  1XEQ A;  4O4J B;  3K03 A;  4I0X B;  3T1H B;  2R9A A;  4JI8 B;  3H1H H;  1COW G;  4ABM A;  1QNM A;  3S3W A;  4KXR A;  5H5N A;  2WLJ A;  3QVN A;  2LO1 A;  2X6A A;  5H2F Z;  1AJQ A;  2RDC A;  3SJB C;  1PV0 A;  4IYI A;  4MS2 A;  4MTG A;  3K9S A;  1Q43 A;  1VP7 A;  2LW1 A;  3EVK A;  1KMI Z;  1AB3 A;  5IWA B;  4LFA B;  5CBF A;  2DYS B;  4JI3 O;  3HKC A;  2CDY A;  4R50 A;  4J9Z B;  4KHP B;  3CCU V;  2O57 A;  2JK5 C;  3BAA A;  4PD4 F;  1EN5 A;  4JTD B;  5LHI A;  3M7M X;  1ZLZ A;  2HR3 A;  5DM6 V;  4LF8 B;  4DUY O;  1X4T A;  2BTQ A;  4JYC A;  1MAB G;  1XHZ A;  4LNU B;  2P22 C;  4X64 O;  3RN4 A;  3RYF B;  4FLX A;  3KZI Z;  2A3Q A;  4CH5 A;  3CYO A;  1I5X A;  3PN1 A;  5GON B;  5CA1 A;  4IGG A;  2OCC C;  5KX5 B;  2DN9 A;  1JMK C;  3AEI A;  3OGI B;  3QTC A;  4DR2 B;  1JR9 A;  5JJE B;  2IM9 A;  2ZIM A;  1ZSP A;  1QLE B;  4DO2 A;  1CEZ A;  5IY5 B;  1S72 V;  4H13 B;  1DTO A;  1GTO A;  4NTW A;  1B3Q A;  1WNS A;  5FPO A;  2Q7G A;  3FKS G;  1SKV A;  3RYH B;  4WFE A;  3H1L H;  4BIU A;  2EUL A;  1VQL V;  2QWQ B;  2LW7 A;  3B77 A;  3QO8 A;  3IJ4 A;  1PM9 A;  1PP9 H;  5H6R A;  2DE0 X;  3ABK B;  4AQY O;  4MVM A;  5B1N A;  1KBH A;  4UCU A;  3HKD B;  4DV3 O;  1HW7 A;  3JD0 A;  1YIJ V;  2P4K A;  4E4E A;  4D7S A;  5CN0 A;  3BRC A;  3CRQ A;  5LBQ A;  1XMO O;  4I55 A;  1GO3 F;  5IYB O;  5IWA O;  4X1K A;  2R9I A;  1OCR C;  1W2B U;  4LF7 B;  2XHB A;  4DR7 O;  2ZT9 B;  5GTI Z;  2JGD B;  3JCZ A;  2PF4 E;  1SET A;  4O2A A;  1SZT A;  1Q86 W;  2EIM C;  4X1Y A;  1HNW O;  4GX0 A;  3RYC B;  3CCE V;  4X20 B;  4X88 A;  2QWN B;  2PYJ A;  1KEC A;  1K9M W;  1JPX A;  1PPJ H;  4NTY A;  5L3C A;  2DW4 A;  1OJH A;  5KUM A;  3K5M A;  3ETD A;  3I56 V;  3UM7 A;  1WB7 A;  4AQY B;  3VQX A;  1MMM A;  2W0X A;  4B08 A;  2QR4 A;  3CRC A;  5LGN A;  1Y74 B;  1Y66 A;  4GX2 A;  1TUB B;  3W7U A;  4CC5 A;  2XTA A;  5HFL A;  2UUB B;  4BR6 A;  3SR2 C;  4TV9 B;  4YJ3 B;  3ZRW A;  4O4I B;  2Q9L A;  1XBL A;  4DV7 B;  1XNQ O;  3C3T A;  4DR6 B;  1JCH A;  3A8T A;  2DWD C;  4FM1 A;  2QM4 A;  4WF9 V;  3OTO B;  2VQF O;  3BY6 A;  4DV2 B;  1K34 A;  2LGW A;  3JD1 A;  5CBG A;  1VQM V;  4LWS B;  3MAQ A;  2UXD B;  3ASN B;  3OAA G;  1FFX B;  5FL7 G;  2UU9 B;  2IBZ H;  3I5D A;  1R6K A;  1QLN A;  2RNB A;  4TWK A;  3LSS A;  2KB1 A;  2ZDI A;  3E35 A;  1H2L A;  3E8G A;  1BS3 A;  4I4T B;  4G28 B;  2BCC H;  5IDJ A;  4E2L A;  1T5E A;  1IUR A;  5JVD A;  4LFA O;  1IDS A;  4JI8 O;  4ICG A;  5KHK A;  1KP2 A;  4OX9 B;  3LDE A;  4DW0 A;  2Q73 A;  4NXN B;  2Q7H A;  4U3J B;  3JD3 A;  1K33 A;  1OCC C;  1JJO A;  2PUS A;  3BA8 A;  3ZBH A;  1P49 A;  4NKG B;  2EIK B;  2GSM B;  2F95 B;  4TSF G;  4DV1 O;  2XAS A;  4MVO A;  1WAZ A;  1M56 B;  2V1D A;  3JAT B;  5IJ9 A;  1N34 B;  4EKW A;  1ZAU A;  4FK5 C;  3ML0 A;  3CCJ V;  1GM8 A;  4UB8 Z;  4IIJ B;  2CAZ C;  1AP5 A;  4CH6 A;  3D36 C;  1Q7Y W;  2XND G;  2OIG A;  3DGE A;  2W6J G;  1LR1 A;  2YC0 A;  3SPJ A;  2QKS A;  1KC8 W;  2ZCE A;  2E75 B;  1VQP V;  3IAY A;  1FD9 A;  5LA6 B;  4MVU A;  1M4U A;  2Q8V A;  3CJH A;  1NTM H;  2LP7 A;  2VS0 A;  1X59 A;  3D3Q A;  1NKD A;  1K4D C;  2JVD A;  5CB4 B;  3J81 N;  3M99 B;  1R3K C;  2UU9 O;  2BE3 A;  4O4L A;  2H94 A;  2Y0I A;  1V55 C;  4ZHQ A;  3CPW U;  3DSQ A;  4MT8 A;  4JGS A;  3VQV A;  2UUB O;  3P32 A;  5LP6 C;  1R73 A;  3RVZ A;  1ORQ C;  3TET A;  1L8D A;  4QPJ A;  1EM1 A;  2WAM A;  1N36 O;  1DF5 A;  5IYC O;  3CCV V;  4FLU A;  5BR8 O;  1H2S B;  1H2M A;  5F2V O;  1R6N A;  3PJS K;  5AG2 A;  1B6Q A;  3UT5 A;  2N74 A;  4EEQ A;  1GAX A;  1NTK H;  5L3E A;  5LGT A;  1N33 O;  4R6Z A;  5B1B C;  3ZHQ A;  3O9O A;  3OD4 A;  3MHS C;  3H9V A;  3SYC A;  2UUC O;  4Q20 A;  3N2G A;  3W7T A;  1GK9 A;  4F6R A;  3FB8 C;  1OHH G;  3QNE A;  1QR9 A;  4B3R O;  3FB6 C;  1FFT B;  3ABU A;  3VOU A;  5LYJ B;  3ASO C;  3CCS V;  3K79 A;  5H9C A;  2EIK C;  3D36 A;  3O65 A;  3F7V C;  4LH6 A;  1YJW V;  1NQT A;  3ZCC A;  4LBE C;  1MZE A;  1S3J A;  5JJN B;  1K7D A;  2CTW A;  4QE7 A;  5JH7 B;  4KHP O;  3IFX A;  4TQD A;  4PI0 A;  1IBK O;  3ZHV A;  5JVD B;  1XOU A;  3BEH A;  2YXY A;  4TV8 B;  4HZ3 A;  3TXS A;  3CCL V;  3GWO A;  1S77 D;  3ETE A;  3K5O A;  5FNV A;  4PA3 A;  1WA8 B;  2WSS G;  1F51 A;  3NR7 A;  1OCZ B;  1J5E O;  1VIB A;  4N23 A;  4FMT A;  2IU0 A;  4JV5 B;  4GLX A;  3AG1 B;  3G6B A;  3JAL B;  3JAT A;  4GT1 A;  4FFB B;  1WN7 A;  2UXB B;  2FYU H;  2Q4P A;  2PY5 A;  1L0L H;  4X62 B;  1VF5 B;  3E22 A;  1YF2 A;  1AVM A;  1KKD A;  5CA0 B;  3FFQ A;  4I55 B;  1SQF A;  5BXZ A;  1NTZ H;  1MNG A;  2LFR A;  3F5W C;  2ZD9 A;  4X9Q A;  4QIW F;  1SA0 A;  3RGB A;  2HHH B;  1YXB A;  2B1I A;  2Q67 A;  4UUJ C;  5CB4 A;  3OUS A;  4X66 O;  3ZN0 A;  3A0B Z;  5B1A B;  3R65 A;  2P06 A;  3OW2 U;  4XBF A;  3CRM A;  4H33 A;  4QJF B;  1IBM O;  1HWY A;  4YY3 B;  4B3R B;  2IJH A;  4YJ2 B;  1F4M A;  2EIJ C;  2KKW A;  1U97 A;  1RFY A;  1NVP D;  4GKJ B;  2ZDI C;  3CC2 V;  3U0Z A;  3DTU B;  1IBL B;  5CMU A;  3OR6 C;  1V54 C;  4DV7 O;  2UUA O;  3K06 A;  2ZE6 A;  1H8H G;  1K5Q A;  1N34 O;  4P30 A;  4B3T B;  4BIO A;  2UUA B;  3RYI A;  3CRA A;  2XAQ A;  2AGA A;  1XNR O;  4Z1V A;  2QA4 V;  3T1C A;  1WPX A;  3VBB A;  2RN9 A;  4FFK A;  5EIB D;  3IGA C;  1XI1 A;  3KCY A;  2WLI B;  5KAF Z;  4PDR A;  3W7W A;  2DJV A;  3HKC B;  4JYA B;  4JI7 B;  2Q5Z A;  1Y6X A;  1R3J C;  3CS5 A;  4HNA B;  2YEV A;  2BTO A;  4LFB O;  2HVJ C;  3HKE B;  1N32 B;  2Y69 C;  2A0L A;  2FKX A;  2Y0P A;  2LGQ A;  2UXC B;  1R3I C;  1FXK C;  2Z3Y A;  2QKC A;  5CA3 A;  3OTF A;  1IXM A;  2ZE5 A;  3ABM B;  3IC7 A;  4WFG A;  4K3A A;  3RBZ A;  3G80 A;  2CE4 A;  4JF3 A;  5J2U B;  5EZY A;  5KHJ A;  2C2A A;  4JZG A;  2NN4 A;  4MTX A;  1GN6 A;  4X62 O;  3FYI B;  2YXH A;  1WA8 A;  2ARH A;  1NT2 B;  2DOS A;  2VRZ A;  3CXH F;  3CCM V;  1ZTE A;  1UFI A;  4ZOL B;  4J7Z A;  4B3S B;  1SQB H;  2F93 B;  4EB6 A;  4N21 A;  5LP6 A;  1K5S A;  2DYR B;  3OGC C;  2YXL A;  2ETN A;  2KG7 A;  5E1A C;  3OMA B;  3AG2 B;  3HKD A;  4JI5 O;  2CK3 G;  3SJC C;  2XOK G;  1MA1 A;  4B3T O;  4JV5 O;  1PNL A;  1IBM B;  3W7X A;  2WA4 A;  4UV8 A;  4P2Z A;  3HKB A;  4DR7 B;  1E1R G;  3K04 A;  1QR8 A;  3CMA V;  3B40 A;  3A2F A;  5LGU A;  4FLZ A;  3N2K B;  4B3M B;  4OGQ B;  4Z2W A;  1Q81 W;  1HNX O;  3ZHS A;  3GVM A;  5K1X A;  3ZED A;  3ZHT A;  3FAV A;  3EFF K;  1Y67 A;  1D5A A;  1RM1 B;  3E86 A;  3Q4H B;  4IHJ B;  3BFR A;  4HBN A;  1MSD A;  1JQ0 A;  2A79 B;  2ATK C;  4DK1 A;  3B09 A;  3ZHU A;  1AR5 A;  4DV3 B;  3ZJZ A;  3LSQ A;  2GTA A;  1KQS U;  1AR4 A;  4NVP A;  2BSK B;  4JI5 B;  3AK2 A;  3JD4 A;  1AI6 A;  2OIE A;  3JAW A;  1VQK V;  2P4V A;  3WB1 A;  2WLH A;  4K8Z A;  4IL6 Z;  3DXR B;  3T4Z A;  2E74 B;  3B4S A;  1KU9 A;  1YIT V;  3ABM C;  2K9P A;  2X0L A;  3AK3 A;  1QQC A;  2MK3 A;  1BE3 H;  3OMN B;  1EFR G;  1H38 A;  1QCE A;  2Q69 A;  4JYB A;  2Q6A A;  1SS3 A;  3N27 A;  2DQ0 A;  2ZNJ A;  2IJK A;  4J80 A;  1LNQ A;  1ROP A;  2Q7E A;  1SER A;  2R9R B;  1SQX H;  3QG5 A;  2IH1 C;  2CTQ A;  1RPO A;  3CEI A;  3K0D A;  1QBZ A;  3F7Y C;  3SYP A;  1KYO F;  1FAF A;  2ZIO A;  4X8A A;  3B2E E;  2WWW A;  3ZMT A; 
#chains in the Genus database with same CATH homology
 2EIL C;  2EIN B;  5L3B A;  3STL C;  2Q68 A;  1Q7Y W;  1JX9 A;  5B1A C;  2XND G;  1M56 C;  2Y69 B;  3DGE A;  2W6J G;  3AG3 B;  3SPJ A;  2DQ3 A;  1KD1 W;  4RUF A;  3G71 V;  2QKS A;  1MSW D;  1KC8 W;  3T4D A;  1VQP V;  1PL0 A;  4PA4 A;  2ITC C;  4MVU A;  1YI2 V;  4PEL A;  2GHY A;  1BMF G;  2LP7 A;  2ZXW C;  1NKD A;  4QPK A;  1ENV A;  2WLI A;  1K4D C;  2JJ1 G;  2WLN A;  3E8F A;  4UXN A;  3M99 B;  2AHY A;  4GX1 A;  1OZ0 A;  1R3K C;  2EBO A;  4CBC A;  4G2K A;  3ZMV A;  1VQ8 V;  3LNM B;  4MW3 A;  3SPI A;  2H94 A;  1MG1 A;  2ZXW B;  4WFF A;  3OMI B;  4MTF A;  2YSU B;  1V55 C;  4UVB A;  2W6I G;  2IJI A;  3CPW U;  5EBM C;  4JAU A;  3OEE G;  1PNM A;  4MT8 A;  2B5U A;  2ITD C;  4JGS A;  2EIM B;  3P32 A;  1R73 A;  5IYD O;  3E8H A;  3D3I A;  1ORQ C;  3RVZ A;  4F4L A;  3TET A;  1VQN V;  4QPJ A;  4XDJ A;  4OXS A;  1AI4 A;  4WFH A;  2WAM A;  1V55 B;  1DF5 A;  4P9P A;  5KA5 A;  1R3L C;  5IYC O;  3CCV V;  1NVP B;  4CZZ A;  3ZRV A;  2P7T C;  1R6N A;  3SPH A;  1VQ4 V;  1S5H C;  3PJS K;  3E2E A;  1JJ2 U;  2WLK A;  1B6Q A;  2QEX V;  1XL4 A;  2QTO A;  1YTF D;  2Y48 A;  2HVK C;  3W7S A;  5L3E A;  5B3S B;  4PDV A;  3ETG A;  5LGT A;  2LFS A;  4FPP A;  1E79 G;  1KP3 A;  5EC2 C;  1YHQ V;  4BAY A;  1F23 A;  3H01 A;  4PA9 A;  4R6Z A;  3WG7 B;  1AJP A;  5B1B C;  1CP9 A;  2QE7 G;  4MW8 A;  4TT3 G;  1FXK B;  3MHS C;  2XAH A;  4I5S A;  3SYC A;  4Q20 A;  5BZB A;  3CP1 A;  1K4C C;  2F43 G;  3W7T A;  4ASU G;  5DN6 G;  1GK9 A;  3FB8 C;  2P90 A;  4H37 A;  1CPY A;  1OHH G;  4DXW A;  3QNE A;  1QR9 A;  1VQ7 V;  5KA6 A;  3NXS A;  4HYO A;  3FB6 C;  1FFT B;  3ABU A;  1M9N A;  3VOU A;  5L3D A;  4BW5 A;  3ASO C;  3CCS V;  3K79 A;  3MD0 A;  5H9C A;  2EIK C;  1FXV A;  3D36 A;  2JEU A;  3F7V C;  3SPG A;  1YJW V;  1NQT A;  2XAJ A;  3ZCC A;  4LBE C;  1S3J A;  3TK1 A;  1H8E G;  4WFB V;  1K7D A;  4FIP C;  4GX5 A;  4Z1M G;  4QE7 A;  5GW7 A;  4QNH B;  4JPR A;  3ASO B;  1DLB A;  3OE7 G;  1GM7 A;  3IFX A;  2OTJ V;  2EZP A;  4MVZ A;  2OT5 A;  1JOY A;  3JD2 A;  2OTL V;  3BEH A;  3B8N A;  1OCZ C;  3ABL B;  4UV9 A;  3QO7 A;  4FJC C;  2X6B A;  1QVG U;  2NNU A;  4HZ3 A;  5L3G A;  3AG1 C;  3CCL V;  3GWO A;  1S77 D;  3OM3 B;  3ETE A;  3ZRW B;  5HFM A;  4PA3 A;  1QLE C;  1AJN A;  1F4N A;  2WSS G;  3SJQ C;  4KFM A;  1VQO V;  1F51 A;  2H8P C;  2K1E A;  1NJI W;  1OCZ B;  4JTA B;  2M7W A;  2YEV B;  4N23 A;  4U7O A;  4MVQ A;  4FMT A;  3G4S V;  2IU0 A;  2Z5U A;  3E8B A;  4P9O A;  2P6J A;  3AG1 B;  3P30 A;  2PI5 A;  1BHB A;  2IU3 A;  4GT1 A;  3LDC A;  3JYC A;  1E1Q G;  1AI5 A;  3CCQ V;  2UXX A;  1VQ6 V;  2WPD G;  2ZR3 A;  3OR7 C;  2EIJ B;  3ZRS A;  4WFA V;  5EK0 A;  1S76 D;  3FB5 C;  1P7B A;  1M57 B;  1UJW B;  1L1F A;  2ZR2 A;  1NBM G;  1ARO P;  1KKD A;  3CD6 V;  1V54 B;  2AHZ A;  3HPL C;  3FB7 C;  3K03 A;  2LFR A;  3F5W C;  2ZD9 A;  1COW G;  4QIW F;  3SYO A;  1BL8 A;  3ZRX A;  2WLJ A;  3K3W A;  2B1I A;  2X6A A;  2Q67 A;  2EZO A;  5LHH A;  1AJQ A;  4UUJ C;  4BIZ A;  3OUS A;  3MHH C;  2EIN C;  3K0G A;  3ZN0 A;  4MS2 A;  1NH2 D;  4MTG A;  5B1A B;  3R65 A;  3LUT B;  3OW2 U;  3WG7 C;  4XBF A;  3E89 A;  3ZIA G;  4JAS A;  4HAM A;  5CBF A;  4H33 A;  4LC1 A;  2X6C A;  1AI7 A;  2DYS B;  4QJF B;  1HWY A;  4MTO A;  2IJH A;  1K73 W;  4MSW C;  4R50 A;  2ZQM A;  4J9Z B;  2IJJ A;  1F4M A;  3CCU V;  2JIZ G;  2EIJ C;  4G27 B;  2JK5 C;  1K3E A;  1M57 C;  1NR1 A;  1NVP D;  2ZDI C;  4JTD B;  5LHI A;  4RO2 A;  2HR3 A;  5DM6 V;  3CC2 V;  3DTU B;  5CMU A;  3OR6 C;  5EBW C;  1V54 C;  4JYC A;  2HLD G;  3CC7 V;  1MAB G;  1RPR A;  3K06 A;  1H8H G;  1K5Q A;  1VQ5 V;  4P30 A;  1G8M A;  4X89 A;  3ZMU A;  4GCZ A;  2XAQ A;  3A0R A;  3CYO A;  2QA4 V;  2JJ2 G;  3RW0 A;  1I5X A;  4R8C A;  2A9H A;  1TUE B;  2OCC C;  3AG4 B;  3AEI A;  1WPX A;  3T1C A;  3VBB A;  1G4Y B;  2X7R B;  1K97 A;  3KG2 A;  3ABL C;  3I55 V;  3SPC A;  2IW5 A;  2QM8 A;  3IGA C;  1DF4 A;  1SES A;  4LCU C;  3CXC U;  2WLI B;  4PA7 A;  1I5Y A;  1K8A W;  4PDR A;  4ZBM A;  3OEH G;  3W7W A;  4QE9 A;  2DYS C;  2WLL B;  1QLE B;  2OCC B;  1BHA A;  1R3J C;  3TCU A;  4DO2 A;  1CEZ A;  5C93 A;  5B1O A;  5IY5 B;  2YEV A;  1S72 V;  2HVJ C;  3ZMZ A;  1GMG A;  1DTO A;  2Y69 C;  2A0L A;  3X2Q C;  1GTO A;  2DYR C;  5B1B B;  1PKX A;  1R3I C;  3HB3 B;  3EHB B;  1FXK C;  2Z3Y A;  3FKS G;  4RQE A;  5CA3 A;  4WFE A;  4BIU A;  1VQL V;  1IXM A;  3QO8 A;  3B77 A;  5IY5 C;  3ABM B;  5H6R A;  3ZN1 A;  3ABK B;  3IC7 A;  2UXN A;  4WFG A;  4MVM A;  5B1N A;  5H6Q A;  2BOB C;  3RBZ A;  1VQ9 V;  4R7C A;  3JD0 A;  3CCR V;  1YIJ V;  3T2M A;  1FXH A;  4JF3 A;  5CN0 A;  5LBQ A;  3CC4 V;  2C2A A;  1GO3 F;  5IYB O;  4JAV A;  1YTF B;  2R9I A;  1OCR C;  4MTX A;  1W2B U;  1FS0 G;  2QM7 A;  3FYI B;  5KUK A;  3JCZ A;  5J9P C;  1NH2 B;  1SET A;  5CBH A;  3CCM V;  1SZT A;  1GM9 A;  1Q86 W;  2EIM C;  1YJ9 V;  2WLL A;  4J9Y B;  1YJN V;  3K08 A;  4GX0 A;  1OCR B;  3CCE V;  2BOC C;  4X88 A;  3AG2 C;  2HG5 C;  3OFN G;  1KEC A;  4N21 A;  2EJR A;  4RUE A;  1K9M W;  1K5S A;  1JPX A;  2DYR B;  1YSC A;  3GB7 C;  5L3C A;  1Y4M A;  2DW4 A;  3OGC C;  5KUM A;  1EZJ A;  3LDD A;  1W0J G;  3ETD A;  3I56 V;  5E1A C;  3STZ C;  1WLE A;  3UM7 A;  3ZMS A;  4RQF A;  3OMA B;  3AG2 B;  3G6E V;  3ABK C;  5LGN A;  2CK3 G;  3SYQ A;  4PA6 A;  3AG3 C;  1Y66 A;  2D3O W;  4GX2 A;  1M90 W;  3W7U A;  2XOK G;  1PNL A;  3QO5 A;  1GKF A;  1OCO C;  1THZ A;  5HFL A;  3W7X A;  4MVS A;  4UV8 A;  1S0V A;  1J95 A;  4P2Z A;  2B1G A;  1E1R G;  3K04 A;  1QR8 A;  3ZRW A;  3CMA V;  5LGU A;  2XAG A;  2HKO A;  1Q81 W;  1NR7 A;  3B8M A;  2IH3 C;  4YXW G;  1PNK A;  3AG4 C;  1JCH A;  3EFF K;  4U7N A;  4KUM A;  1RM1 B;  2DWD C;  3E86 A;  4JTC B;  2JDI G;  1FXK A;  3UKM A;  4WF9 V;  1JQ0 A;  2A79 B;  2ATK C;  3BY6 A;  1PD3 A;  1K34 A;  2WLM A;  2V7Q G;  4KP4 A;  4XDL A;  3JD1 A;  5CBG A;  1VQM V;  3ZJZ A;  3OUF A;  2PI4 A;  3LSQ A;  1KQS U;  2HJF C;  4UVC A;  1XL6 A;  3ABT A;  3ASN B;  1RM1 C;  4UVA A;  2NLJ C;  1ZWI C;  1AI6 A;  2XAF A;  3JD4 A;  3OAA G;  1P4R A;  5FL7 G;  4MVR A;  1H2G A;  3WFV A;  3X2Q B;  1SRY A;  1R6K A;  1QLN A;  1VQK V;  5L3F A;  4TWK A;  3LSS A;  2WLH A;  4I9W A;  2KB1 A;  1OCO B;  2EIL B;  2ZDI A;  3E35 A;  5B3S C;  3E8G A;  3T4Z A;  3RVY A;  2JEX A;  4G28 B;  1YIT V;  3ABM C;  1W0K G;  2P67 A;  1K92 A;  2X0L A;  1Q82 W;  2MK3 A;  3OMN B;  5IDJ A;  4E2L A;  1EFR G;  1EBO A;  1QCE A;  1H38 A;  4PDM A;  2Q69 A;  4JYB A;  2Q6A A;  3E83 A;  1M1K W;  1JVM A;  2DQ0 A;  4WCE V;  2IJK A;  1KP2 A;  3SYA A;  3LDE A;  4RAI A;  1QVF U;  1AR1 B;  3FYE B;  4PDL A;  2W0F C;  3JD3 A;  5EC1 C;  1K33 A;  1LNQ A;  1OCC C;  1ROP A;  4XDK A;  3CME V;  2HFE C;  1SER A;  4LP8 A;  4L87 A;  2R9R B;  1N8R W;  2EIK B;  2GSM B;  5LHG A;  3ASN C;  2IH1 C;  2XAS A;  4TSF G;  2FTK A;  4MVO A;  1RPO A;  3K0D A;  1QBZ A;  4ZKI A;  2V1D A;  1M56 B;  3F7Y C;  3SYP A;  1OCC B;  4EKW A;  1MOF A;  5EBL C;  4FK5 C;  3K9A A;  4X8A A;  2DWE C;  3ML0 A;  3CCJ V;  2WWW A;  1GM8 A;  3ZMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...