1VQ7V

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq7V00
3G4SV 3CC2V 1M90W 1NJIW 3G71V 3OW2U 1YITV 2QA4V 1VQKV 3CMEV 3G6EV 4WFBV 3I55V 1QVGU 1K9MW 3CPWU 1YJWV 3CCUV 5DM6V 1KD1W 1Q86W 3CCQV 3CC7V 1VQ4V 1VQ9V 1K8AW 2QEXV 1YHQV 3CCLV 1K73W 1VQNV 3CC4V 1Q82W 1M1KW 4WF9V 1KQSU 1YJNV 1R73A 2OTLV 2OTJV 1VQ7V 1VQPV 3CXCU 1W2BU 1VQ6V 1YI2V 3CCVV 1VQOV 1KC8W 4WCEV 3CD6V 1QVFU 3I56V 3CMAV 3CCSV 1VQMV 1YJ9V 3CCJV 3CCMV 1N8RW 1Q81W 1YIJV 1VQ5V 3CCRV 2D3OW 3CCEV 1VQ8V 1Q7YW 4WFAV 1VQLV 1JJ2U 1S72V
chains in the Genus database with same CATH superfamily
4LR3A 4LCUC 2WLNA 2YXYA 2BOBC 3W7UA 1BHBA 4RQEA 4U3JA 3K06A 5IJ0A 3SJCC 4LWSA 2V4DA 4B3RO 4DV5B 2UUBO 3GWOA 4YHHO 4PJ0Z 3BABA 1KC8W 4ABMA 4JI1O 4DRXB 2DJVA 4Q6GA 1IZ3A 3SJAC 4LF8B 2W0FC 4IHJB 3E89A 4X20A 4K0KB 2F4VO 1QVGU 3L9DA 2YXLA 1UJWB 2E5LO 1VQPV 3SGIA 4DUYB 4JAAA 1N8RW 1ZSPA 2WLIA 3E22B 3ETDA 5FLXN 2NR5A 4G2KA 1GRJA 1FS0G 5KX5B 2CE4A 1EM1A 3TCUA 4DR3B 2JGDA 1I94B 4Q20A 3JAWA 4QPJA 4DR1O 1X59A 3RYHA 3QO7A 2PI5A 3OTFA 5KMGB 2Y69C 3ZEDA 2UXCB 4DUZO 4HZ3A 5CA1A 2JGUA 2QKAA 1K4DC 2DWEC 2L35A 3DC6A 1MZFA 1JJOA 1JPXA 2EBOA 4UCRA 3ZHVA 3AG4B 2DW4A 2YICA 3A0RA 3RW0A 5LXTA 3H9VA 4FLYA 3LDDA 2UUCO 4DXWA 3IJ4A 4DR2O 4PA7A 3MDSA 3JD1A 3HKEA 3FB8C 4H44B 2QWQB 3CXHF 4DR7B 3AK3A 3T1YB 4UB8Z 4WFFA 3KCXA 5J2UA 4X62B 4YIPA 1OJHA 1V54B 1RSOA 3CC2V 1B6QA 3JATB 5KHKA 3AG3C 5LMNB 3I55V 1JFFB 4JI7O 3U10A 4WF9V 1JX9A 2R9RB 2WLKA 2XAJA 3JASB 4DR6B 3DSQA 2JIZG 3ABLC 2LGQA 2IJHA 1AI5A 1RFYA 2E3CA 1S77D 5E79Z 2EJ7A 3W7XA 4GKJO 5E1AC 4J9YB 2ILMA 1Q90D 2O57A 1FFXB 5KAFZ 4J80A 1RM1C 2PZSA 4NTYA 5IJ9A 2WPDG 4PHZA 3RFRA 2QWNB 1B06A 1M56B 5B1AC 5BY1A 1K92A 2AHYA 2LW1A 2D2CB 4KUMA 4E4EA 5LP6B 3WB0A 2FYUH 4LFAO 4L87A 4I9WA 1COWG 1DTOA 3LNNA 1NH2D 1WN7A 4Z1MG 1YVWA 3LUTB 4IL6Z 1SC5B 2BOCC 4X1YB 1XNQO 2FKXA 4U3FH 1P84F 2RJZA 5IYDO 1BL8A 3JD3A 4X66B 3T1HB 2VRZA 4JI8B 2K1EA 1DF4A 1AILA 3HKCB 1ZTEA 1AJPA 3RYCB 1R3IC 4OPAA 3P3NA 1YF2A 4FPPA 1SS3A 1V55B 1FXKA 5J2TB 5FPOA 1GK9A 4DV5O 4MVZA 4X1IA 3CCVV 2MW2B 1I7FA 2EZOA 1HNZB 3AK2A 1VQ8V 5LHHA 4LF8O 4PA4A 2KQXA 1W0JG 1BE3H 4K0KO 3WG7B 1I08A 5JQGA 1BHAA 3UM7A 3CCUV 5CB4A 2Y0PA 4FZ1A 2EIKC 4P9PA 5IY5B 4JV5O 2HVKC 1J5EO 2XAFA 2QR4A 1S76D 1JJ2U 2QKSA 2ZXWC 3FB6C 3EHBB 3K5MA 3ML0A 1NVPD 3CYOA 1OCCC 1KB9F 2CGOA 1FXHA 4DR3O 1I94O 2QM8A 4FM1A 2RCVA 3BCCH 1H8HG 1O9HA 2A9HA 3OE7G 1K33A 1GN2A 1Y66A 3ABKB 3R65A 4G28B 1YIJV 3WFVA 4X1KB 3JD4A 3ZHQA 1YXBA 4J7JA 2YEVA 3ABUA 3MHHC 4NB5A 1FAFA 1QR9A 4B08A 2P22C 3OR7C 4DR7O 1XDCA 3T1YO 3CCMV 3CEIA 3QTCA 4F6RA 2HLDG 5JJEB 2Q69A 5H6RA 4AI8A 4DR4B 3OFNG 5LMNO 2XAQA 2XT9A 2A7WA 3A8TA 2CH7B 4ZHQA 3UQ8A 1KECA 4DW1A 3U0ZA 1IBMO 5IYZA 5JVDB 3ZJZA 1CEZA 5B3SC 3JALB 4FK5C 4DR6O 2EULA 1IBKB 1FXVA 5EIBD 4ZI7A 2ITDC 4XDLA 1D2DA 1R6NA 4PV1B 4GCZA 2Q7HA 2K9PA 2YIAA 4FJCC 4O2BA 3DXRA 1KU9A 1CP9A 5B66Z 3A2FA 1R73A 2Y69B 4PDMA 2Q68A 1F7YA 4MS2A 2G38A 2ZE8A 4EEQA 2YSUB 1S0VA 2W6JG 1TVKA 4J11A 5CBHA 2GV9A 5D5QA 3VOUA 3LNMB 1X4TA 1NI8A 4GUNA 2Z3YA 1VEWA 4X65B 4JYCA 4TV9A 1AP6A 2P6JA 1HNXB 3EXAA 3RYIA 1MG1A 3SR2C 1M57B 4FLZA 1H2SB 5L3GA 4WCEV 1S5LZ 3E8BA 4X66O 3CCSV 1AB3A 4JI8O 4JTDB 1DLBA 5FNVA 2FL4A 1S3JA 1N33O 4WBNB 1SESA 1WPBA 4GKKB 3FX7A 4DR5O 4JI0B 4WFEA 1FFTB 1LNQA 2XAGA 3L72H 5LGTA 3SPJA 5FPRA 3UT5B 1P7GA 4DYLA 2EIJC 5AG2A 5IDJA 3AEIA 1XUQA 4LF6B 3HR0A 3CCJV 5LYJB 2LO1A 3CRRA 3ZRWB 5D5PA 4MW8A 3CMEV 1KUQA 2BSKA 3WB1A 3K08A 3K57A 4CS4A 2P4KA 3ABTA 1PKXA 3JARB 3M7MX 3B09A 1MABG 2EIMC 1K7DA 1VQ7V 1RM1B 4EKWA 1YCIA 4DV7B 1OCRC 1OCZC 3OUFA 2YIBD 2UU9O 4HNAA 3T1CA 4FFKA 1M93A 1K3EA 1VF5B 4EB6A 3L75H 4PA6A 2P7TC 4P2ZA 3ZHRA 1HR0B 3C3TA 5GONB 4K8XA 2HP8A 5A2QN 2HJDA 1WA8B 2B9ZA 1G1XB 4X64B 2CAZC 3BY6A 1FXKC 1R3LC 1ZL8A 1L8DA 3AG1B 2DMXA 2A06H 3BA8A 1QHTA 2R9AA 1Q7YW 2CTRA 4DV3O 3IFXA 4I0XB 3ZHUA 1GTOA 4PD4F 1TAEA 5ITZA 2PF4E 3IAYA 3Q4HA 2UXBO 3K04A 4PDVA 1HW7A 2JJ1G 4J42A 1AR1B 4UVAA 5CBGA 2V1DA 4MVUA 4MVMA 3J81N 2RNBA 1N34B 4JTCB 4MVSA 2JJ2G 3HKDA 3N2GA 1HDJA 1EZVH 3CRMA 3FFQA 4CH3A 1JQ0A 3M8AA 2XASA 1U97A 4OX9O 3AG2B 1Q82W 2ETNA 2HHHB 2RQ6A 2YIDA 3K03A 3CJHB 4ZOLA 1IBKO 4MVQA 2ZXWB 2LFSA 3HKBA 2YI8A 1E79G 4FM2A 2Q0OC 1OZ0A 3N27A 1Q6UA 1NTMH 2ITCC 1KBHA 4I4TA 2B1GA 4U3JB 1TUBA 1Y74A 4NYKA 5IJ0B 3K9AA 5L3BA 4YJ2A 2P06A 1I5XA 1PL4A 1VF7A 2BTQA 5IYBO 2NN4A 2IBZH 4UFZA 4YY3O 3E8HA 1NTKH 4BAYA 2CK3G 1HNXO 1XREA 1PM9A 4KP4A 2M7WA 4J10A 5CA3A 4RUEA 4O4HA 2OCCC 1R1BA 3L74H 3X2QC 3CCRV 5KLVH 1XNRB 2DYSC 4WFAV 4ICGA 1H2NA 3K59A 2OT5A 4GKKO 4JI0O 1ORQC 4DV1B 1Q86W 2HVJC 3U11A 3KKYA 3OR6C 3ZS8C 1SF9A 1V9PA 3JAWB 4QE9A 2HFEC 2UXDB 1Z5VA 2FMLA 4I9QA 3OMAB 2UXXA 3D36A 4TUYA 3OMIB 5KHJA 3SPGA 5CA1B 1SQVH 3LSSA 4Z2WA 3DTUB 4RWUA 4X8AA 2DOSA 3E8GA 1BMFG 2WLMA 4UCVA 1MNGA 4DV7O 1G8MA 1VQMV 1JA8A 1Q5OA 4A5UB 4I55A 2N05A 3HKEB 3IC7A 2XHBA 1M90W 3UO3A 3RGBA 3WU2Z 5J2UB 2WLLA 2XTAA 1QLEC 3W7SA 2JS3A 1FYJA 2KG7A 1QQCA 1HR0O 1EN4A 2LGWA 3VQYA 1NBMG 4CS3A 1YTFD 2WA3A 3R66A 1L0LH 2UUAB 3OEHG 4ZKIA 3BPZA 3ASOB 1P7BA 1AJQA 2PY5A 3TXSA 4DRXA 3K5NA 5B1BC 3QG5A 4DV2B 3JYCA 4JI2O 1M1KW 2EIJB 4LFBO 2Q6AA 4YJ3A 2Y4UA 4K35A 4QIWF 4NXMO 2KB1A 5C93A 3JSNA 1NT2B 1S5HC 4YIOA 5IJ9B 1PNLA 2CTPA 1R6KA 3CWBH 1OCOB 1THZA 1JCHA 5EBMC 1JVMA 2EINB 2Q73A 3RVYA 1OCZB 4JI5B 5GW7A 5KX5A 1SQBH 1NQTA 3FKSG 3L73H 2GDSA 4O4IA 3W7WA 2ZM6O 2GHYA 1IBLO 1RPRA 1Z2GA 2ZDIA 2ZE5A 2AZ2A 5C8YA 4TOIA 1PD3A 2CTQA 4CC5A 1NZ6A 3GWKC 1W59A 1FXKB 3JCUZ 3I5DA 4B3TB 2Q7EA 4NKGB 1XL4A 1BS3A 4LF5O 4QNHB 4F4LA 4X1IB 2P67A 1IXBA 4IIJA 3K3WA 3OW2U 1YTFB 4OGQB 4NR1A 4DW0A 1UPGA 5EIBC 4PA3A 1SZTA 2A79B 1Y76A 1GAXA 2JDIG 4JI4B 3CX5F 3AK1A 2ADPA 4FLVA 2ATKC 2ZD9A 3FB7C 1JFFA 3S3WA 1XNRO 4I50B 1TA8A 2Q7GA 3SYOA 3NXSA 1AROP 4UVCA 1BT8A 2X0LA 2UXNA 3SYQA 2XUMA 3H1IH 4TQFA 4B3SB 1JR9A 2E76B 3ZIAG 3D3IA 2UXDO 2LJ2A 5LOVB 3DC5A 3IGAC 5CBFA 2WSSG 1FJGB 3G80A 2JRIA 3B4SA 1HP8A 2R70A 4MT8A 2H8PC 2RMKB 5L3FA 2F43G 1YDXA 2PTMA 2YDEA 4CS2A 3FD9A 1ZX3A 3CMAV 1SA0A 4DUYO 2A0LA 4UCUA 3KG2A 3EVKA 2NNUA 1XMOB 1UFIA 4CZZA 1XI1A 4PI0A 3FAVA 4FFBA 1EN5A 1XBLA 5CN0A 2YC0A 2IJKA 1YZBA 1G6UA 4BR6A 4F6RB 4LP8A 5BR8B 2OTLV 2LFRA 3SYCA 4OXSA 2OCCB 3CE2A 3X2QB 3J7AU 4JAVA 2UXCO 1Q81W 4ZHQB 2W6IG 2D3OW 2CGNA 2UUAO 3B8MA 5IYZB 4WFGA 3RYFA 5EBWC 4DV2O 1QU7A 3KZIZ 3C3SA 3D36C 3STZC 1AR5A 3ABMC 2EILC 1WAZA 3GB7C 4O2BB 1JOYA 5KUMA 4U7NA 5H5NA 2HKOA 4X62O 1DGSA 4W4LA 4H37A 1K9MW 3A0HZ 1AVMA 4K3AA 2Q5ZA 4CH4A 1R6TA 1KQSU 4IYIA 1QBZA 4FLTA 1Q3EA 3CP1A 2E75B 4GX2A 4TV9B 5DN6G 3RYIB 3H01A 4NTXA 4B7EA 1G4YB 4AQYB 5FNVB 4JF3A 4TV8A 1YJNV 2JEXA 3QO8A 2GTSA 4CH5A 1PP9H 1IX9A 4KHPB 4B3TO 4UUJC 1QLNA 4BWAA 1VARA 4NTWA 4B3MB 5JJNB 3E83A 2F93B 4I5SA 2YUAA 3JAKB 3JAMN 4AILC 2MK3A 3PJSK 4RO2A 3QO5A 1H2GA 4JI4O 3K58A 2BSKB 2WA4A 3B77A 1Q6IA 2OIGA 3T1HO 3A0BZ 1KP3A 1SKVA 4D6TH 2ZIMA 1N36B 1F4NA 3AG3B 3K0DA 4HAMA 2NLJC 5KA5A 4HNAB 1EZJA 3P32A 2X7RB 3VQXA 3TK1A 3GVMA 3OD4A 4PI2A 4HYOA 2HEPA 3MAQA 1H2LA 2R72A 3ZHTA 5EYPA 1Z5WA 4B3SO 3F5TA 1ROPA 2ZDIC 3ABLB 2L6LA 3T4DA 2CDYA 5BMVB 1HNZO 2DYRC 1N0NA 3BAAA 2AHZA 4X9QA 1ZL8B 3AG4C 3UKMA 1F51A 5HFMA 2GUZB 1YHQV 4YHHB 4DV6B 3QF7A 4FVMA 3ASNC 4MTOA 5ITZB 1WB8A 5TISZ 4IGGA 3TETA 1VQLV 1V54C 5B1AB 2DE0X 4AHCA 2PI4A 1JMKC 2F4VB 2AXTZ 3ZX6A 1KKCA 1KP2A 2E74B 3FB5C 4UV8A 5KHIA 1KD1W 1XOUA 1H38A 4GX0A 4P30A 4FLXA 3N2GB 1SQXH 3VBBA 5BR8O 1Y4MA 3RVZA 1SERA 2RN9A 4JYAB 1M5IA 2P90A 3CS5A 1S72V 4O4LB 3H1JH 3C90A 5KAIZ 1WPXA 1QNMA 1GH6A 2BE3A 4DR1B 4MVOA 5LYJA 1SQPH 5FL7G 4XBFA 3KCYA 4O2AA 4TWKA 4J41A 4LBEC 2ZKOA 4I4TB 1BQZA 1TUBB 1Y74B 2M6YA 3P3PA 4J7KA 4DR4O 4KXRA 4YJ2B 2UUCB 5KUKA 4DR2B 4JI6B 2OIEA 2GTAA 2H3OA 4BW5A 1E1RG 2BTQB 1EBOA 2EIKB 3B40A 3RBZA 1M4UA 3ZHSA 3JD0A 4OPHA 2Q0AA 3AG7A 5LA6B 3S3XA 1ENVA 4DO2A 2CTWA 5B1NA 3ZN1A 4AQYO 1OCCB 4PDRA 4F6EA 3CC7V 1B04A 3BRCA 4CBCA 2RDCA 4I7ZB 2IH1C 3SDLA 4QE7A 3WB2A 4R50A 1ZAUA 3FYEB 2A3QA 4KHPO 3CRAA 4LWSB 2VWKA 4LC1A 1TGOA 4U7OA 5CA0A 1WNSA 3G6BA 1GKFA 3H1LH 3WG7C 1XMQB 4GX5A 4H13B 1IDSA 3JSLA 3D8CA 3K5LA 2Z0AA 3UCSC 2ZT9B 5JH7A 3ETEA 4X65O 4TUYB 5EC2C 2OTJV 2QWRB 5IE9A 4X20B 1YI2V 2QE7G 1L0NH 4JZGA 5EZYA 1PNMA 4IYHA 3CCEV 1PL0A 1N36O 1KKDA 1BZKA 2B1IA 4PELA 1URFA 2WLIB 1DK1A 4EFBA 3IC9A 3ZMTA 3CJHA 1E1QG 1NR1A 1P49A 2GBOA 1XHXA 2WLLB 2LQTA 2YIBA 2F95B 4RUFA 4XDJA 5B3SB 2JGDB 4LNUA 5DEDA 4LF6O 4W4KA 1CXZB 3SPCA 1VIBA 3RYHB 1W0KG 4J9ZB 3G6EV 4FZ0A 2ZE6A 5CMUA 1ZWIC 3OUSA 3H1HH 2KSDA 2OCHA 1RP3B 2P4VA 1F4MA 4WFHA 4DV6O 2X6AA 3EFFK 1N4CA 3N2KA 4O4JA 2ZR3A 3ZRXA 4JYBA 4BIUA 5LL6Y 2QTSA 3OGIB 5LXTB 4EFEA 3RWRD 1H2MA 2ZIOA 4YJ3B 4ASUG 2WWWA 1AI7A 1QCEA 1XQ8A 2QEXV 1RSOB 3QVNA 4FLUA 4JV5B 3THOA 1GO3F 4JYAO 5KA6A 1WJZA 1WP7A 1HNWB 1J5EB 4PDLA 4X64O 1QR8A 3ZCCA 1US6A 1OHHG 3VQVA 1BCCH 5BXZA 4UV9A 2QTOA 1NR7A 5K1XA 1AR4A 2DQ0A 4O4IB 2QJ1A 1KYOF 1AI6A 4IHJA 5C8YB 4LF7B 1XL6A 1WB7A 3OM3B 2DYRB 2BCCH 1MSWD 1N34O 3LSQA 2ZINA 2W0XA 4B7KA 2IW5A 1VP7A 2QDOA 4IIJB 3E22A 1GN4A 4JI6O 4NVPA 2EIMB 1T5EA 3M99B 3ASNB 1M57C 2HHHO 1OCRB 4RQFA 4JZ2A 5H2FZ 2PYLA 1Y76B 2YS8A 4TQDA 5H6QA 1GM9A 2Z5UA 2PGGA 5KMGA 1EN6A 4UXNA 1BSMA 4X89A 2Q9LA 1IBMB 1P4RA 4MVRA 4PA9A 2WLJA 5IYCO 3CRCA 4DV4B 2ZNIA 3CB2A 4JPRA 1VF6A 1M9NA 3APQA 3T4ZA 1NJIW 4N23A 4H0LB 2QA4V 3F7VC 2AZ0A 4QGPA 4JTAB 5LGNA 2V7QG 2IU0A 2OWOA 4TSFG 1XMQO 2ADQB 5JJJB 5K1PA 3K5OA 1A32A 3CCLV 1K73W 1NKDA 3JATA 3TXQA 2VQFB 5JQGB 3B2EE 5CB4B 3L71H 3OTOB 5BZBA 1SA0B 2F1MA 5IT9N 3OAAG 3JASA 3CHXA 4DV1O 5KHHA 5J9PC 1DF5A 2F23A 3FAVB 4FFBB 1BGYH 2IU3A 4JGSA 3SYAA 1XHZA 1SRYA 1MZEA 1CPYA 1N33B 3AG1C 4MTFA 3G4SV 4DR5B 1MMMA 2JS5A 2Y4TA 1GN6A 1Q6HA 3NR7A 1FFXA 4GX1A 4IT5A 4DV0B 1PV0A 3LDCA 2GSMB 2FTKA 2BTOA 3APOA 1VQOV 2ZCEA 1QVFU 3RYFB 5LP6A 4J7ZA 1SQGA 2IJIA 2YEVB 4LF4B 4LF9B 2ZR2A 1GN3A 2HR3A 3UO2A 1N32B 1GM7A 2YI9A 4QPKA 4ZIBA 4X1YA 2DN9A 3OEEG 5JWPA 3CCQV 1SZXA 3RT3C 3AG2C 4I50A 3T2MA 3E2EA 3HKCA 4JI3B 5LHIA 4FMTA 2UU9B 3RYCA 4MTXA 1S5JA 3K9SA 2OYQA 1HNWO 2DYSB 1IVSA 2QSAA 5J2TA 4FM0A 2QM7A 2X6CA 3K79A 3QNEA 4XDKA 5IWAB 2H94A 4BW9A 4CH6A 5DECA 5KHGA 1SETA 4R8CA 4ZI7B 5LOVA 2EX3A 2VWJA 1VQNV 1WLEA 1VQ6V 3ICXA 1NH2B 3I56V 2JK5C 3DXRB 2QGNA 4TV8B 4DV3B 4LF7O 3B8NA 5JCOA 2R9IA 1LUVA 2XAHA 1PPJH 2WLHA 3ETGA 3LSUA 4JYYA 4UCSA 3MHSC 4D7TA 2Q4PA 2UXBB 2C2AA 1K4CC 3L70H 3CC4V 4E2LA 1TVKB 3ZMUA 5L3DA 2ZNJA 3ZMSA 1AI4A 3F7YC 1BQ0A 4GYCB 4JI5O 3O9OA 4HBNA 1AP5A 1ZLZA 3J80N 2PYJA 4X88A 4R6ZA 3F5WC 2B5UA 1QLEB 3HB3B 1VQ4V 1IXMA 4OX9B 1K8AW 1I0HA 4GT1A 1LR1A 3SJQC 4X1KA 3W7TA 3MD0A 3SYPA 3E86A 1H2KA 5LMUB 4DV4O 5B5EZ 1WP8A 5EYPB 4GLXA 2AW9A 1D5AA 1U96A 4RAIA 5B1BB 4LFCB 4NXNB 1NVPB 1K97A 1FD9A 1FKAO 4K8ZA 3OT7A 4CC6A 3CXCU 1AJNA 2CUGA 3ZBHA 2Q67A 4KL1A 2FB5A 2VQFO 3STLC 2F66C 1LUWA 1GMGA 2VQEB 2CH7A 1YITV 3D3QA 3SPHA 3OTOO 4LH6A 1Y67A 3JCZA 1NU1H 2AGAA 4YY3B 3FYIB 4FLWA 5JVDA 1K5SA 3JALA 1K34A 4YXWG 2XNDG 1F23A 5EBLC 2N04A 4JAUA 1IURA 4EB6B 5A9GA 2DQ3A 4BIZA 3RN4A 2ODMA 3JD2A 3G71V 1FJGO 3ASOC 4UVBA 1VMGA 1OV9A 4DV0O 1Q43A 1VF6C 4B3RB 4C7UA 1XEQA 2UUBB 2WAMA 2ZQMA 1FPOA 2QM4A 4JI1B 2IH3C 3VQWA 1XILA 3JAKA 1D5NA 1VQ5V 3O65A 3Q4HB 3LDEA 4L8JA 2QKCA 3TJTA 4LF4O 4LF9O 4Z1VA 1XMOO 4UCTA 4O2AB 1N32O 3SJBC 1VQKV 3DGEA 4G27B 3BHPA 3HPLC 3ZN0A 1OCOC 1O9GA 5H9CA 2E5LB 3E35A 2ZE7A 3HKDB 3ZMZA 1EFRG 2EINC 1GM8A 4R7CA 5EC1C 4WBNA 1PNKA 4P9OA 4JI3O 4TT3G 1R3KC 4MSWC 2Y48A 3TGUH 3P30A 1J95A 5B1OA 3UT5A 5IWAO 2XOKG 2QWPB 4MTGA 4ZOLB 3ZRSA 4DK1A 3BFRA 2N74A 1ZUQA 5BMVA 4LH7A 1L1FA 3ZMVA 1YEWA 1Y6XA 2X6BA 3HKBB 5L3CA 4DUZB 3ZRWA 1Q8IA 4DK0A 1MOFA 4UB6Z 3K0GA 2GUZA 3JARA 1M56C 4ZBMA 3ZRVA 2LW7A 3BEHA 5LP6C 3OMNB 2YXHA 1TUEB 1MA1A 4KFMA 1SQFA 4JI2B 5CA0B 2HG5C 2KKWA 4LFBB 4FIPC 2IJJA 1HWYA 2JVDA 3CD6V 3BVOA 4NXMB 2LP7A 3CRQA 5JH7B 2DWDC 5GONA 1I5YA 2P5OA 2Q8VA 2EZPA 4O4HB 1SQQH 1WA8A 5EZYB 4JI7B 1YJWV 5DM6V 1V55C 1MSDA 1H8EG 3ETQA 2ARHA 4O4LA 4I0XA 5LHGA 4GZRB 5HFLA 5LBQA 4H33A 1YJ9V 5LMUO 4B3MO 5GTHZ 3PN1A 2IM9A 5L3EA 1RPOA 1KMIZ 2ZM6B 1IBLB 4LNUB 4WFBV 5F2VO 4GKJB 5EK0A 5JCOC 3E8FA 1N0JA 4LFCO 4NXNO 1K5QA 2HJFC 3G67A 1NTZH 3ABMB 2EILB 2PUSA 5IY5C 4LF5B 1R3JC 4N21A 1B3QA 3N2KB 3OGCC 4O4JB 5GTIZ 4BIOA 4JASA 4QJFB 2QWOB 2VQEO 3CSXA 3H1KH 4LFAB 4MW3A 2Y0IA 3CPWU 4I55B 1VQ9V 4UCOA 5LA6A 1XNQB 3BA9A 1YSCA 5LGUA 1W2BU 4D7SA 2VS0A 1NS1A 3ABKC 2KG7B 2EJRA 3SPIA 2JEUA
chains in the Genus database with same CATH topology
3T4ZA 4LCUC 1NJIW 1K3EA 4N23A 2WLNA 2QA4V 3F7VC 4PA6A 4JTAB 2BOBC 2P7TC 5LGNA 3W7UA 2V7QG 4H37A 1K9MW 4P2ZA 2IU0A 1BHBA 4TSFG 4RQEA 3K06A 3CCLV 1K73W 1NKDA 1KQSU 3GWOA 1QBZA 1KC8W 3CP1A 3BY6A 1FXKC 1R3LC 4GX2A 5DN6G 3AG1B 1Q7YW 2W0FC 3IFXA 3H01A 1G4YB 5BZBA 3E89A 1GTOA 1QVGU 3OAAG 4JF3A 1UJWB 5J9PC 1DF5A 3K04A 4PDVA 2JJ1G 1YJNV 1AR1B 1VQPV 2JEXA 3QO8A 4UVAA 2IU3A 5CBGA 4JGSA 3SYAA 2V1DA 1SRYA 4MVUA 4UUJC 1N8RW 2WLIA 4MVMA 1QLNA 1CPYA 3ETDA 3AG1C 4JTCB 4MVSA 2JJ2G 3E83A 4MTFA 4G2KA 3G4SV 4I5SA 1FS0G 4GX1A 2MK3A 3PJSK 3TCUA 3LDCA 2GSMB 1JQ0A 4Q20A 2XASA 4QPJA 2FTKA 4RO2A 3AG2B 3QO5A 1H2GA 3QO7A 1Q82W 2PI5A 2Y69C 3B77A 1VQOV 1QVFU 4HZ3A 3K03A 1K4DC 2IJIA 1KP3A 2YEVB 2DWEC 4MVQA 2ZR2A 2ZXWB 2HR3A 2LFSA 1GM7A 1F4NA 4QPKA 3AG3B 3K0DA 4HAMA 2NLJC 1JPXA 5KA5A 2EBOA 3AG4B 1EZJA 1E79G 2DW4A 3P32A 2X7RB 3A0RA 3OEEG 3TK1A 1OZ0A 3CCQV 3RW0A 3LDDA 4DXWA 4HYOA 4PA7A 3AG2C 3JD1A 3T2MA 2ITCC 3E2EA 3FB8C 5LHIA 4FMTA 2B1GA 4MTXA 1ROPA 2ZDIC 4WFFA 3ABLB 3K9AA 5L3BA 3T4DA 2DYSB 1I5XA 1V54B 2DYRC 3CC2V 1B6QA 2QM7A 2X6CA 3K79A 3QNEA 5IYBO 4XDKA 3AG3C 2AHZA 3I55V 2H94A 3AG4C 3UKMA 1F51A 1SETA 4R8CA 3E8HA 5HFMA 1YHQV 4BAYA 2CK3G 1VQNV 1WLEA 4WF9V 1JX9A 2R9RB 2WLKA 4KP4A 2M7WA 2XAJA 1VQ6V 3ASNC 5CA3A 4MTOA 4RUEA 1NH2B 2JIZG 3I56V 2JK5C 2OCCC 3ABLC 3X2QC 3CCRV 3B8NA 2IJHA 2R9IA 2DYSC 3TETA 4WFAV 2XAHA 1V54C 1VQLV 5B1AB 1AI5A 2WLHA 2OT5A 2PI4A 3ETGA 1S77D 1ORQC 1KP2A 3MHSC 3FB5C 4UV8A 2C2AA 1KD1W 1Q86W 2HVJC 3W7XA 5E1AC 4J9YB 1K4CC 4GX0A 4P30A 1H38A 3CC4V 4E2LA 3VBBA 3OR6C 3ZMUA 5L3DA 1Y4MA 3RVZA 3ZMSA 1SERA 1RM1C 1AI4A 3F7YC 2WPDG 4QE9A 2HFEC 2P90A 1S72V 3OMAB 1M56B 2UXXA 5B1AC 3D36A 1K92A 3OMIB 4X88A 1WPXA 2AHYA 4KUMA 4R6ZA 3SPGA 3F5WC 2B5UA 1QLEB 3HB3B 4L87A 3LSSA 4I9WA 1VQ4V 1IXMA 1COWG 3DTUB 1DTOA 4X8AA 1NH2D 1K8AW 4GT1A 4MVOA 4Z1MG 3LUTB 5FL7G 4XBFA 2BOCC 3E8GA 1BMFG 3SJQC 2WLMA 3W7TA 3MD0A 4TWKA 3SYPA 5IYDO 1BL8A 3JD3A 3E86A 1G8MA 1VQMV 2K1EA 1DF4A 4LBEC 3IC7A 1M90W 1AJPA 1R3IC 2WLLA 4FPPA 1QLEC 1V55B 5B1BB 4RAIA 1FXKA 3W7SA 5KUKA 4BW5A 1E1RG 1K97A 1GK9A 1NVPB 1EBOA 2EIKB 3RBZA 4MVZA 3CXCU 1AJNA 3JD0A 3CCVV 2Q67A 1NBMG 2EZOA 3STLC 1YTFD 1VQ8V 1GMGA 3OEHG 1ENVA 4ZKIA 5LHHA 4DO2A 3ASOB 4PA4A 1P7BA 5B1NA 1YITV 1AJQA 3SPHA 3JCZA 3ZN1A 1W0JG 1OCCB 4PDRA 3WG7B 3FYIB 1BHAA 3UM7A 5B1BC 1K5SA 3CCUV 3CC7V 4CBCA 1K34A 4YXWG 2IH1C 3JYCA 2XNDG 1F23A 5EBLC 1M1KW 2EIJB 2EIKC 4JAUA 4QE7A 4P9PA 2Q6AA 2DQ3A 5IY5B 4R50A 3FYEB 2HVKC 4BIZA 4QIWF 2KB1A 5C93A 2XAFA 4LC1A 1S76D 1JJ2U 2QKSA 1S5HC 4U7OA 3JD2A 3G71V 2ZXWC 3ASOC 4UVBA 3FB6C 1PNLA 3EHBB 3ML0A 1NVPD 1GKFA 1R6KA 1OCCC 3CYOA 1OCOB 3WG7C 4GX5A 1THZA 1FXHA 2QM8A 1JCHA 1H8HG 5EBMC 2WAMA 2ZQMA 3ETEA 5EC2C 1JVMA 2EINB 2OTJV 2A9HA 3OE7G 3RVYA 1YI2V 1K33A 1OCZB 1Y66A 2IH3C 2QE7G 5GW7A 3ABKB 3R65A 4G28B 1VQ5V 1NQTA 1YIJV 1PNMA 3CCEV 3LDEA 3FKSG 3WFVA 1PL0A 3JD4A 1VQKV 3DGEA 4G27B 1KKDA 3HPLC 2B1IA 4PELA 3ZN0A 3W7WA 2GHYA 1RPRA 1OCOC 2WLIB 2ZDIA 5H9CA 3ZMTA 3E35A 1PD3A 2YEVA 3ABUA 3ZMZA 1EFRG 3MHHC 1E1QG 1QR9A 1NR1A 2EINC 1GM8A 3OR7C 4R7CA 5EC1C 2WLLB 1PNKA 4P9OA 4TT3G 1R3KC 1FXKB 4MSWC 4RUFA 4XDJA 5B3SB 3CCMV 2Y48A 1XL4A 3SPCA 4QNHB 1W0KG 4F4LA 2P67A 3K3WA 2HLDG 3P30A 3OW2U 1J95A 5B1OA 2Q69A 4J9ZB 5H6RA 1YTFB 3G6EV 3OFNG 2XOKG 4PA3A 1SZTA 5CMUA 1ZWIC 4MTGA 3ZRSA 2XAQA 3OUSA 2A79B 2JDIG 1F4MA 4WFHA 1KECA 2X6AA 3EFFK 1L1FA 3ZMVA 2ZR3A 2X6BA 3ZRXA 2ATKC 5L3CA 4JYBA 3ZJZA 3ZRWA 2ZD9A 4BIUA 1CEZA 5B3SC 4FK5C 3FB7C 1MOFA 1FXVA 3K0GA 2ITDC 4XDLA 1R6NA 3SYOA 1M56C 4ZBMA 3NXSA 1AROP 3ZRVA 4GCZA 4UVCA 3BEHA 3OMNB 4ASUG 1TUEB 2X0LA 2WWWA 4FJCC 4KFMA 2UXNA 1AI7A 1QCEA 1CP9A 2QEXV 3SYQA 2HG5C 1R73A 2Y69B 4PDMA 4FIPC 2Q68A 3ZIAG 2IJJA 1HWYA 1GO3F 4MS2A 5KA6A 3CD6V 3D3IA 2LP7A 4PDLA 1QR8A 3ZCCA 1OHHG 2YSUB 3IGAC 5CBFA 2WSSG 1S0VA 2DWDC 2W6JG 1I5YA 2EZPA 4MT8A 2H8PC 5L3FA 4UV9A 5CBHA 2QTOA 1NR7A 3VOUA 3LNMB 2F43G 2Z3YA 5DM6V 1YJWV 1V55C 4JYCA 1H8EG 2P6JA 1MG1A 2DQ0A 1M57B 5LHGA 5HFLA 5LBQA 1AI6A 5L3GA 4WCEV 4H33A 3CMAV 3E8BA 3CCSV 1YJ9V 2A0LA 3KG2A 1XL6A 3OM3B 4JTDB 1DLBA 2DYRB 2NNUA 1MSWD 1S3JA 4CZZA 3LSQA 5L3EA 1SESA 1RPOA 4WFEA 4WFBV 5CN0A 1FFTB 1LNQA 2XAGA 2IW5A 2IJKA 5EK0A 5LGTA 3E8FA 3SPJA 1K5QA 4LP8A 2OTLV 2EIMB 3M99B 3ASNB 2HJFC 2EIJC 2LFRA 3SYCA 3ABMB 1M57C 2EILB 5IDJA 1OCRB 3AEIA 4OXSA 2OCCB 5IY5C 3X2QB 4RQFA 4JAVA 3CCJV 1Q81W 1R3JC 4N21A 2W6IG 2D3OW 3OGCC 3B8MA 4JASA 5H6QA 4QJFB 1GM9A 3ZRWB 2Z5UA 4MW8A 3CMEV 4WFGA 4MW3A 3K08A 3CPWU 4UXNA 3ABTA 4X89A 1VQ9V 1PKXA 5EBWC 1P4RA 1MABG 4MVRA 4PA9A 1YSCA 2EIMC 1K7DA 2WLJA 5IYCO 1VQ7V 5LGUA 4EKWA 3STZC 1RM1B 1W2BU 3ABMC 2EILC 3GB7C 1OCRC 1JOYA 1OCZC 3OUFA 5KUMA 4U7NA 3ABKC 4JPRA 2EJRA 3T1CA 3SPIA 2HKOA 1M9NA 2JEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S V;  3CC2 V;  1M90 W;  1NJI W;  3G71 V;  3OW2 U;  1YIT V;  2QA4 V;  1VQK V;  3CME V;  3G6E V;  4WFB V;  3I55 V;  1QVG U;  1K9M W;  3CPW U;  1YJW V;  3CCU V;  5DM6 V;  1KD1 W;  1Q86 W;  3CCQ V;  3CC7 V;  1VQ4 V;  1VQ9 V;  1K8A W;  2QEX V;  1YHQ V;  3CCL V;  1K73 W;  1VQN V;  3CC4 V;  1Q82 W;  1M1K W;  4WF9 V;  1KQS U;  1YJN V;  1R73 A;  2OTL V;  2OTJ V;  1VQ7 V;  1VQP V;  3CXC U;  1W2B U;  1VQ6 V;  1YI2 V;  3CCV V;  1VQO V;  1KC8 W;  4WCE V;  3CD6 V;  1QVF U;  3I56 V;  3CMA V;  3CCS V;  1VQM V;  1YJ9 V;  3CCJ V;  3CCM V;  1N8R W;  1Q81 W;  1YIJ V;  1VQ5 V;  3CCR V;  2D3O W;  3CCE V;  1VQ8 V;  1Q7Y W;  4WFA V;  1VQL V;  1JJ2 U;  1S72 V; 
#chains in the Genus database with same CATH topology
 4LR3 A;  4LCU C;  2WLN A;  2YXY A;  2BOB C;  3W7U A;  1BHB A;  4RQE A;  4U3J A;  3K06 A;  5IJ0 A;  3SJC C;  4LWS A;  2V4D A;  4B3R O;  4DV5 B;  2UUB O;  3GWO A;  4YHH O;  4PJ0 Z;  3BAB A;  1KC8 W;  4ABM A;  4JI1 O;  4DRX B;  2DJV A;  4Q6G A;  1IZ3 A;  3SJA C;  4LF8 B;  2W0F C;  4IHJ B;  3E89 A;  4X20 A;  4K0K B;  2F4V O;  1QVG U;  3L9D A;  2YXL A;  1UJW B;  2E5L O;  1VQP V;  3SGI A;  4DUY B;  4JAA A;  1N8R W;  1ZSP A;  2WLI A;  3E22 B;  3ETD A;  5FLX N;  2NR5 A;  4G2K A;  1GRJ A;  1FS0 G;  5KX5 B;  2CE4 A;  1EM1 A;  3TCU A;  4DR3 B;  2JGD A;  1I94 B;  4Q20 A;  3JAW A;  4QPJ A;  4DR1 O;  1X59 A;  3RYH A;  3QO7 A;  2PI5 A;  3OTF A;  5KMG B;  2Y69 C;  3ZED A;  2UXC B;  4DUZ O;  4HZ3 A;  5CA1 A;  2JGU A;  2QKA A;  1K4D C;  2DWE C;  2L35 A;  3DC6 A;  1MZF A;  1JJO A;  1JPX A;  2EBO A;  4UCR A;  3ZHV A;  3AG4 B;  2DW4 A;  2YIC A;  3A0R A;  3RW0 A;  5LXT A;  3H9V A;  4FLY A;  3LDD A;  2UUC O;  4DXW A;  3IJ4 A;  4DR2 O;  4PA7 A;  3MDS A;  3JD1 A;  3HKE A;  3FB8 C;  4H44 B;  2QWQ B;  3CXH F;  4DR7 B;  3AK3 A;  3T1Y B;  4UB8 Z;  4WFF A;  3KCX A;  5J2U A;  4X62 B;  4YIP A;  1OJH A;  1V54 B;  1RSO A;  3CC2 V;  1B6Q A;  3JAT B;  5KHK A;  3AG3 C;  5LMN B;  3I55 V;  1JFF B;  4JI7 O;  3U10 A;  4WF9 V;  1JX9 A;  2R9R B;  2WLK A;  2XAJ A;  3JAS B;  4DR6 B;  3DSQ A;  2JIZ G;  3ABL C;  2LGQ A;  2IJH A;  1AI5 A;  1RFY A;  2E3C A;  1S77 D;  5E79 Z;  2EJ7 A;  3W7X A;  4GKJ O;  5E1A C;  4J9Y B;  2ILM A;  1Q90 D;  2O57 A;  1FFX B;  5KAF Z;  4J80 A;  1RM1 C;  2PZS A;  4NTY A;  5IJ9 A;  2WPD G;  4PHZ A;  3RFR A;  2QWN B;  1B06 A;  1M56 B;  5B1A C;  5BY1 A;  1K92 A;  2AHY A;  2LW1 A;  2D2C B;  4KUM A;  4E4E A;  5LP6 B;  3WB0 A;  2FYU H;  4LFA O;  4L87 A;  4I9W A;  1COW G;  1DTO A;  3LNN A;  1NH2 D;  1WN7 A;  4Z1M G;  1YVW A;  3LUT B;  4IL6 Z;  1SC5 B;  2BOC C;  4X1Y B;  1XNQ O;  2FKX A;  4U3F H;  1P84 F;  2RJZ A;  5IYD O;  1BL8 A;  3JD3 A;  4X66 B;  3T1H B;  2VRZ A;  4JI8 B;  2K1E A;  1DF4 A;  1AIL A;  3HKC B;  1ZTE A;  1AJP A;  3RYC B;  1R3I C;  4OPA A;  3P3N A;  1YF2 A;  4FPP A;  1SS3 A;  1V55 B;  1FXK A;  5J2T B;  5FPO A;  1GK9 A;  4DV5 O;  4MVZ A;  4X1I A;  3CCV V;  2MW2 B;  1I7F A;  2EZO A;  1HNZ B;  3AK2 A;  1VQ8 V;  5LHH A;  4LF8 O;  4PA4 A;  2KQX A;  1W0J G;  1BE3 H;  4K0K O;  3WG7 B;  1I08 A;  5JQG A;  1BHA A;  3UM7 A;  3CCU V;  5CB4 A;  2Y0P A;  4FZ1 A;  2EIK C;  4P9P A;  5IY5 B;  4JV5 O;  2HVK C;  1J5E O;  2XAF A;  2QR4 A;  1S76 D;  1JJ2 U;  2QKS A;  2ZXW C;  3FB6 C;  3EHB B;  3K5M A;  3ML0 A;  1NVP D;  3CYO A;  1OCC C;  1KB9 F;  2CGO A;  1FXH A;  4DR3 O;  1I94 O;  2QM8 A;  4FM1 A;  2RCV A;  3BCC H;  1H8H G;  1O9H A;  2A9H A;  3OE7 G;  1K33 A;  1GN2 A;  1Y66 A;  3ABK B;  3R65 A;  4G28 B;  1YIJ V;  3WFV A;  4X1K B;  3JD4 A;  3ZHQ A;  1YXB A;  4J7J A;  2YEV A;  3ABU A;  3MHH C;  4NB5 A;  1FAF A;  1QR9 A;  4B08 A;  2P22 C;  3OR7 C;  4DR7 O;  1XDC A;  3T1Y O;  3CCM V;  3CEI A;  3QTC A;  4F6R A;  2HLD G;  5JJE B;  2Q69 A;  5H6R A;  4AI8 A;  4DR4 B;  3OFN G;  5LMN O;  2XAQ A;  2XT9 A;  2A7W A;  3A8T A;  2CH7 B;  4ZHQ A;  3UQ8 A;  1KEC A;  4DW1 A;  3U0Z A;  1IBM O;  5IYZ A;  5JVD B;  3ZJZ A;  1CEZ A;  5B3S C;  3JAL B;  4FK5 C;  4DR6 O;  2EUL A;  1IBK B;  1FXV A;  5EIB D;  4ZI7 A;  2ITD C;  4XDL A;  1D2D A;  1R6N A;  4PV1 B;  4GCZ A;  2Q7H A;  2K9P A;  2YIA A;  4FJC C;  4O2B A;  3DXR A;  1KU9 A;  1CP9 A;  5B66 Z;  3A2F A;  1R73 A;  2Y69 B;  4PDM A;  2Q68 A;  1F7Y A;  4MS2 A;  2G38 A;  2ZE8 A;  4EEQ A;  2YSU B;  1S0V A;  2W6J G;  1TVK A;  4J11 A;  5CBH A;  2GV9 A;  5D5Q A;  3VOU A;  3LNM B;  1X4T A;  1NI8 A;  4GUN A;  2Z3Y A;  1VEW A;  4X65 B;  4JYC A;  4TV9 A;  1AP6 A;  2P6J A;  1HNX B;  3EXA A;  3RYI A;  1MG1 A;  3SR2 C;  1M57 B;  4FLZ A;  1H2S B;  5L3G A;  4WCE V;  1S5L Z;  3E8B A;  4X66 O;  3CCS V;  1AB3 A;  4JI8 O;  4JTD B;  1DLB A;  5FNV A;  2FL4 A;  1S3J A;  1N33 O;  4WBN B;  1SES A;  1WPB A;  4GKK B;  3FX7 A;  4DR5 O;  4JI0 B;  4WFE A;  1FFT B;  1LNQ A;  2XAG A;  3L72 H;  5LGT A;  3SPJ A;  5FPR A;  3UT5 B;  1P7G A;  4DYL A;  2EIJ C;  5AG2 A;  5IDJ A;  3AEI A;  1XUQ A;  4LF6 B;  3HR0 A;  3CCJ V;  5LYJ B;  2LO1 A;  3CRR A;  3ZRW B;  5D5P A;  4MW8 A;  3CME V;  1KUQ A;  2BSK A;  3WB1 A;  3K08 A;  3K57 A;  4CS4 A;  2P4K A;  3ABT A;  1PKX A;  3JAR B;  3M7M X;  3B09 A;  1MAB G;  2EIM C;  1K7D A;  1VQ7 V;  1RM1 B;  4EKW A;  1YCI A;  4DV7 B;  1OCR C;  1OCZ C;  3OUF A;  2YIB D;  2UU9 O;  4HNA A;  3T1C A;  4FFK A;  1M93 A;  1K3E A;  1VF5 B;  4EB6 A;  3L75 H;  4PA6 A;  2P7T C;  4P2Z A;  3ZHR A;  1HR0 B;  3C3T A;  5GON B;  4K8X A;  2HP8 A;  5A2Q N;  2HJD A;  1WA8 B;  2B9Z A;  1G1X B;  4X64 B;  2CAZ C;  3BY6 A;  1FXK C;  1R3L C;  1ZL8 A;  1L8D A;  3AG1 B;  2DMX A;  2A06 H;  3BA8 A;  1QHT A;  2R9A A;  1Q7Y W;  2CTR A;  4DV3 O;  3IFX A;  4I0X B;  3ZHU A;  1GTO A;  4PD4 F;  1TAE A;  5ITZ A;  2PF4 E;  3IAY A;  3Q4H A;  2UXB O;  3K04 A;  4PDV A;  1HW7 A;  2JJ1 G;  4J42 A;  1AR1 B;  4UVA A;  5CBG A;  2V1D A;  4MVU A;  4MVM A;  3J81 N;  2RNB A;  1N34 B;  4JTC B;  4MVS A;  2JJ2 G;  3HKD A;  3N2G A;  1HDJ A;  1EZV H;  3CRM A;  3FFQ A;  4CH3 A;  1JQ0 A;  3M8A A;  2XAS A;  1U97 A;  4OX9 O;  3AG2 B;  1Q82 W;  2ETN A;  2HHH B;  2RQ6 A;  2YID A;  3K03 A;  3CJH B;  4ZOL A;  1IBK O;  4MVQ A;  2ZXW B;  2LFS A;  3HKB A;  2YI8 A;  1E79 G;  4FM2 A;  2Q0O C;  1OZ0 A;  3N27 A;  1Q6U A;  1NTM H;  2ITC C;  1KBH A;  4I4T A;  2B1G A;  4U3J B;  1TUB A;  1Y74 A;  4NYK A;  5IJ0 B;  3K9A A;  5L3B A;  4YJ2 A;  2P06 A;  1I5X A;  1PL4 A;  1VF7 A;  2BTQ A;  5IYB O;  2NN4 A;  2IBZ H;  4UFZ A;  4YY3 O;  3E8H A;  1NTK H;  4BAY A;  2CK3 G;  1HNX O;  1XRE A;  1PM9 A;  4KP4 A;  2M7W A;  4J10 A;  5CA3 A;  4RUE A;  4O4H A;  2OCC C;  1R1B A;  3L74 H;  3X2Q C;  3CCR V;  5KLV H;  1XNR B;  2DYS C;  4WFA V;  4ICG A;  1H2N A;  3K59 A;  2OT5 A;  4GKK O;  4JI0 O;  1ORQ C;  4DV1 B;  1Q86 W;  2HVJ C;  3U11 A;  3KKY A;  3OR6 C;  3ZS8 C;  1SF9 A;  1V9P A;  3JAW B;  4QE9 A;  2HFE C;  2UXD B;  1Z5V A;  2FML A;  4I9Q A;  3OMA B;  2UXX A;  3D36 A;  4TUY A;  3OMI B;  5KHJ A;  3SPG A;  5CA1 B;  1SQV H;  3LSS A;  4Z2W A;  3DTU B;  4RWU A;  4X8A A;  2DOS A;  3E8G A;  1BMF G;  2WLM A;  4UCV A;  1MNG A;  4DV7 O;  1G8M A;  1VQM V;  1JA8 A;  1Q5O A;  4A5U B;  4I55 A;  2N05 A;  3HKE B;  3IC7 A;  2XHB A;  1M90 W;  3UO3 A;  3RGB A;  3WU2 Z;  5J2U B;  2WLL A;  2XTA A;  1QLE C;  3W7S A;  2JS3 A;  1FYJ A;  2KG7 A;  1QQC A;  1HR0 O;  1EN4 A;  2LGW A;  3VQY A;  1NBM G;  4CS3 A;  1YTF D;  2WA3 A;  3R66 A;  1L0L H;  2UUA B;  3OEH G;  4ZKI A;  3BPZ A;  3ASO B;  1P7B A;  1AJQ A;  2PY5 A;  3TXS A;  4DRX A;  3K5N A;  5B1B C;  3QG5 A;  4DV2 B;  3JYC A;  4JI2 O;  1M1K W;  2EIJ B;  4LFB O;  2Q6A A;  4YJ3 A;  2Y4U A;  4K35 A;  4QIW F;  4NXM O;  2KB1 A;  5C93 A;  3JSN A;  1NT2 B;  1S5H C;  4YIO A;  5IJ9 B;  1PNL A;  2CTP A;  1R6K A;  3CWB H;  1OCO B;  1THZ A;  1JCH A;  5EBM C;  1JVM A;  2EIN B;  2Q73 A;  3RVY A;  1OCZ B;  4JI5 B;  5GW7 A;  5KX5 A;  1SQB H;  1NQT A;  3FKS G;  3L73 H;  2GDS A;  4O4I A;  3W7W A;  2ZM6 O;  2GHY A;  1IBL O;  1RPR A;  1Z2G A;  2ZDI A;  2ZE5 A;  2AZ2 A;  5C8Y A;  4TOI A;  1PD3 A;  2CTQ A;  4CC5 A;  1NZ6 A;  3GWK C;  1W59 A;  1FXK B;  3JCU Z;  3I5D A;  4B3T B;  2Q7E A;  4NKG B;  1XL4 A;  1BS3 A;  4LF5 O;  4QNH B;  4F4L A;  4X1I B;  2P67 A;  1IXB A;  4IIJ A;  3K3W A;  3OW2 U;  1YTF B;  4OGQ B;  4NR1 A;  4DW0 A;  1UPG A;  5EIB C;  4PA3 A;  1SZT A;  2A79 B;  1Y76 A;  1GAX A;  2JDI G;  4JI4 B;  3CX5 F;  3AK1 A;  2ADP A;  4FLV A;  2ATK C;  2ZD9 A;  3FB7 C;  1JFF A;  3S3W A;  1XNR O;  4I50 B;  1TA8 A;  2Q7G A;  3SYO A;  3NXS A;  1ARO P;  4UVC A;  1BT8 A;  2X0L A;  2UXN A;  3SYQ A;  2XUM A;  3H1I H;  4TQF A;  4B3S B;  1JR9 A;  2E76 B;  3ZIA G;  3D3I A;  2UXD O;  2LJ2 A;  5LOV B;  3DC5 A;  3IGA C;  5CBF A;  2WSS G;  1FJG B;  3G80 A;  2JRI A;  3B4S A;  1HP8 A;  2R70 A;  4MT8 A;  2H8P C;  2RMK B;  5L3F A;  2F43 G;  1YDX A;  2PTM A;  2YDE A;  4CS2 A;  3FD9 A;  1ZX3 A;  3CMA V;  1SA0 A;  4DUY O;  2A0L A;  4UCU A;  3KG2 A;  3EVK A;  2NNU A;  1XMO B;  1UFI A;  4CZZ A;  1XI1 A;  4PI0 A;  3FAV A;  4FFB A;  1EN5 A;  1XBL A;  5CN0 A;  2YC0 A;  2IJK A;  1YZB A;  1G6U A;  4BR6 A;  4F6R B;  4LP8 A;  5BR8 B;  2OTL V;  2LFR A;  3SYC A;  4OXS A;  2OCC B;  3CE2 A;  3X2Q B;  3J7A U;  4JAV A;  2UXC O;  1Q81 W;  4ZHQ B;  2W6I G;  2D3O W;  2CGN A;  2UUA O;  3B8M A;  5IYZ B;  4WFG A;  3RYF A;  5EBW C;  4DV2 O;  1QU7 A;  3KZI Z;  3C3S A;  3D36 C;  3STZ C;  1AR5 A;  3ABM C;  2EIL C;  1WAZ A;  3GB7 C;  4O2B B;  1JOY A;  5KUM A;  4U7N A;  5H5N A;  2HKO A;  4X62 O;  1DGS A;  4W4L A;  4H37 A;  1K9M W;  3A0H Z;  1AVM A;  4K3A A;  2Q5Z A;  4CH4 A;  1R6T A;  1KQS U;  4IYI A;  1QBZ A;  4FLT A;  1Q3E A;  3CP1 A;  2E75 B;  4GX2 A;  4TV9 B;  5DN6 G;  3RYI B;  3H01 A;  4NTX A;  4B7E A;  1G4Y B;  4AQY B;  5FNV B;  4JF3 A;  4TV8 A;  1YJN V;  2JEX A;  3QO8 A;  2GTS A;  4CH5 A;  1PP9 H;  1IX9 A;  4KHP B;  4B3T O;  4UUJ C;  1QLN A;  4BWA A;  1VAR A;  4NTW A;  4B3M B;  5JJN B;  3E83 A;  2F93 B;  4I5S A;  2YUA A;  3JAK B;  3JAM N;  4AIL C;  2MK3 A;  3PJS K;  4RO2 A;  3QO5 A;  1H2G A;  4JI4 O;  3K58 A;  2BSK B;  2WA4 A;  3B77 A;  1Q6I A;  2OIG A;  3T1H O;  3A0B Z;  1KP3 A;  1SKV A;  4D6T H;  2ZIM A;  1N36 B;  1F4N A;  3AG3 B;  3K0D A;  4HAM A;  2NLJ C;  5KA5 A;  4HNA B;  1EZJ A;  3P32 A;  2X7R B;  3VQX A;  3TK1 A;  3GVM A;  3OD4 A;  4PI2 A;  4HYO A;  2HEP A;  3MAQ A;  1H2L A;  2R72 A;  3ZHT A;  5EYP A;  1Z5W A;  4B3S O;  3F5T A;  1ROP A;  2ZDI C;  3ABL B;  2L6L A;  3T4D A;  2CDY A;  5BMV B;  1HNZ O;  2DYR C;  1N0N A;  3BAA A;  2AHZ A;  4X9Q A;  1ZL8 B;  3AG4 C;  3UKM A;  1F51 A;  5HFM A;  2GUZ B;  1YHQ V;  4YHH B;  4DV6 B;  3QF7 A;  4FVM A;  3ASN C;  4MTO A;  5ITZ B;  1WB8 A;  5TIS Z;  4IGG A;  3TET A;  1VQL V;  1V54 C;  5B1A B;  2DE0 X;  4AHC A;  2PI4 A;  1JMK C;  2F4V B;  2AXT Z;  3ZX6 A;  1KKC A;  1KP2 A;  2E74 B;  3FB5 C;  4UV8 A;  5KHI A;  1KD1 W;  1XOU A;  1H38 A;  4GX0 A;  4P30 A;  4FLX A;  3N2G B;  1SQX H;  3VBB A;  5BR8 O;  1Y4M A;  3RVZ A;  1SER A;  2RN9 A;  4JYA B;  1M5I A;  2P90 A;  3CS5 A;  1S72 V;  4O4L B;  3H1J H;  3C90 A;  5KAI Z;  1WPX A;  1QNM A;  1GH6 A;  2BE3 A;  4DR1 B;  4MVO A;  5LYJ A;  1SQP H;  5FL7 G;  4XBF A;  3KCY A;  4O2A A;  4TWK A;  4J41 A;  4LBE C;  2ZKO A;  4I4T B;  1BQZ A;  1TUB B;  1Y74 B;  2M6Y A;  3P3P A;  4J7K A;  4DR4 O;  4KXR A;  4YJ2 B;  2UUC B;  5KUK A;  4DR2 B;  4JI6 B;  2OIE A;  2GTA A;  2H3O A;  4BW5 A;  1E1R G;  2BTQ B;  1EBO A;  2EIK B;  3B40 A;  3RBZ A;  1M4U A;  3ZHS A;  3JD0 A;  4OPH A;  2Q0A A;  3AG7 A;  5LA6 B;  3S3X A;  1ENV A;  4DO2 A;  2CTW A;  5B1N A;  3ZN1 A;  4AQY O;  1OCC B;  4PDR A;  4F6E A;  3CC7 V;  1B04 A;  3BRC A;  4CBC A;  2RDC A;  4I7Z B;  2IH1 C;  3SDL A;  4QE7 A;  3WB2 A;  4R50 A;  1ZAU A;  3FYE B;  2A3Q A;  4KHP O;  3CRA A;  4LWS B;  2VWK A;  4LC1 A;  1TGO A;  4U7O A;  5CA0 A;  1WNS A;  3G6B A;  1GKF A;  3H1L H;  3WG7 C;  1XMQ B;  4GX5 A;  4H13 B;  1IDS A;  3JSL A;  3D8C A;  3K5L A;  2Z0A A;  3UCS C;  2ZT9 B;  5JH7 A;  3ETE A;  4X65 O;  4TUY B;  5EC2 C;  2OTJ V;  2QWR B;  5IE9 A;  4X20 B;  1YI2 V;  2QE7 G;  1L0N H;  4JZG A;  5EZY A;  1PNM A;  4IYH A;  3CCE V;  1PL0 A;  1N36 O;  1KKD A;  1BZK A;  2B1I A;  4PEL A;  1URF A;  2WLI B;  1DK1 A;  4EFB A;  3IC9 A;  3ZMT A;  3CJH A;  1E1Q G;  1NR1 A;  1P49 A;  2GBO A;  1XHX A;  2WLL B;  2LQT A;  2YIB A;  2F95 B;  4RUF A;  4XDJ A;  5B3S B;  2JGD B;  4LNU A;  5DED A;  4LF6 O;  4W4K A;  1CXZ B;  3SPC A;  1VIB A;  3RYH B;  1W0K G;  4J9Z B;  3G6E V;  4FZ0 A;  2ZE6 A;  5CMU A;  1ZWI C;  3OUS A;  3H1H H;  2KSD A;  2OCH A;  1RP3 B;  2P4V A;  1F4M A;  4WFH A;  4DV6 O;  2X6A A;  3EFF K;  1N4C A;  3N2K A;  4O4J A;  2ZR3 A;  3ZRX A;  4JYB A;  4BIU A;  5LL6 Y;  2QTS A;  3OGI B;  5LXT B;  4EFE A;  3RWR D;  1H2M A;  2ZIO A;  4YJ3 B;  4ASU G;  2WWW A;  1AI7 A;  1QCE A;  1XQ8 A;  2QEX V;  1RSO B;  3QVN A;  4FLU A;  4JV5 B;  3THO A;  1GO3 F;  4JYA O;  5KA6 A;  1WJZ A;  1WP7 A;  1HNW B;  1J5E B;  4PDL A;  4X64 O;  1QR8 A;  3ZCC A;  1US6 A;  1OHH G;  3VQV A;  1BCC H;  5BXZ A;  4UV9 A;  2QTO A;  1NR7 A;  5K1X A;  1AR4 A;  2DQ0 A;  4O4I B;  2QJ1 A;  1KYO F;  1AI6 A;  4IHJ A;  5C8Y B;  4LF7 B;  1XL6 A;  1WB7 A;  3OM3 B;  2DYR B;  2BCC H;  1MSW D;  1N34 O;  3LSQ A;  2ZIN A;  2W0X A;  4B7K A;  2IW5 A;  1VP7 A;  2QDO A;  4IIJ B;  3E22 A;  1GN4 A;  4JI6 O;  4NVP A;  2EIM B;  1T5E A;  3M99 B;  3ASN B;  1M57 C;  2HHH O;  1OCR B;  4RQF A;  4JZ2 A;  5H2F Z;  2PYL A;  1Y76 B;  2YS8 A;  4TQD A;  5H6Q A;  1GM9 A;  2Z5U A;  2PGG A;  5KMG A;  1EN6 A;  4UXN A;  1BSM A;  4X89 A;  2Q9L A;  1IBM B;  1P4R A;  4MVR A;  4PA9 A;  2WLJ A;  5IYC O;  3CRC A;  4DV4 B;  2ZNI A;  3CB2 A;  4JPR A;  1VF6 A;  1M9N A;  3APQ A;  3T4Z A;  1NJI W;  4N23 A;  4H0L B;  2QA4 V;  3F7V C;  2AZ0 A;  4QGP A;  4JTA B;  5LGN A;  2V7Q G;  2IU0 A;  2OWO A;  4TSF G;  1XMQ O;  2ADQ B;  5JJJ B;  5K1P A;  3K5O A;  1A32 A;  3CCL V;  1K73 W;  1NKD A;  3JAT A;  3TXQ A;  2VQF B;  5JQG B;  3B2E E;  5CB4 B;  3L71 H;  3OTO B;  5BZB A;  1SA0 B;  2F1M A;  5IT9 N;  3OAA G;  3JAS A;  3CHX A;  4DV1 O;  5KHH A;  5J9P C;  1DF5 A;  2F23 A;  3FAV B;  4FFB B;  1BGY H;  2IU3 A;  4JGS A;  3SYA A;  1XHZ A;  1SRY A;  1MZE A;  1CPY A;  1N33 B;  3AG1 C;  4MTF A;  3G4S V;  4DR5 B;  1MMM A;  2JS5 A;  2Y4T A;  1GN6 A;  1Q6H A;  3NR7 A;  1FFX A;  4GX1 A;  4IT5 A;  4DV0 B;  1PV0 A;  3LDC A;  2GSM B;  2FTK A;  2BTO A;  3APO A;  1VQO V;  2ZCE A;  1QVF U;  3RYF B;  5LP6 A;  4J7Z A;  1SQG A;  2IJI A;  2YEV B;  4LF4 B;  4LF9 B;  2ZR2 A;  1GN3 A;  2HR3 A;  3UO2 A;  1N32 B;  1GM7 A;  2YI9 A;  4QPK A;  4ZIB A;  4X1Y A;  2DN9 A;  3OEE G;  5JWP A;  3CCQ V;  1SZX A;  3RT3 C;  3AG2 C;  4I50 A;  3T2M A;  3E2E A;  3HKC A;  4JI3 B;  5LHI A;  4FMT A;  2UU9 B;  3RYC A;  4MTX A;  1S5J A;  3K9S A;  2OYQ A;  1HNW O;  2DYS B;  1IVS A;  2QSA A;  5J2T A;  4FM0 A;  2QM7 A;  2X6C A;  3K79 A;  3QNE A;  4XDK A;  5IWA B;  2H94 A;  4BW9 A;  4CH6 A;  5DEC A;  5KHG A;  1SET A;  4R8C A;  4ZI7 B;  5LOV A;  2EX3 A;  2VWJ A;  1VQN V;  1WLE A;  1VQ6 V;  3ICX A;  1NH2 B;  3I56 V;  2JK5 C;  3DXR B;  2QGN A;  4TV8 B;  4DV3 B;  4LF7 O;  3B8N A;  5JCO A;  2R9I A;  1LUV A;  2XAH A;  1PPJ H;  2WLH A;  3ETG A;  3LSU A;  4JYY A;  4UCS A;  3MHS C;  4D7T A;  2Q4P A;  2UXB B;  2C2A A;  1K4C C;  3L70 H;  3CC4 V;  4E2L A;  1TVK B;  3ZMU A;  5L3D A;  2ZNJ A;  3ZMS A;  1AI4 A;  3F7Y C;  1BQ0 A;  4GYC B;  4JI5 O;  3O9O A;  4HBN A;  1AP5 A;  1ZLZ A;  3J80 N;  2PYJ A;  4X88 A;  4R6Z A;  3F5W C;  2B5U A;  1QLE B;  3HB3 B;  1VQ4 V;  1IXM A;  4OX9 B;  1K8A W;  1I0H A;  4GT1 A;  1LR1 A;  3SJQ C;  4X1K A;  3W7T A;  3MD0 A;  3SYP A;  3E86 A;  1H2K A;  5LMU B;  4DV4 O;  5B5E Z;  1WP8 A;  5EYP B;  4GLX A;  2AW9 A;  1D5A A;  1U96 A;  4RAI A;  5B1B B;  4LFC B;  4NXN B;  1NVP B;  1K97 A;  1FD9 A;  1FKA O;  4K8Z A;  3OT7 A;  4CC6 A;  3CXC U;  1AJN A;  2CUG A;  3ZBH A;  2Q67 A;  4KL1 A;  2FB5 A;  2VQF O;  3STL C;  2F66 C;  1LUW A;  1GMG A;  2VQE B;  2CH7 A;  1YIT V;  3D3Q A;  3SPH A;  3OTO O;  4LH6 A;  1Y67 A;  3JCZ A;  1NU1 H;  2AGA A;  4YY3 B;  3FYI B;  4FLW A;  5JVD A;  1K5S A;  3JAL A;  1K34 A;  4YXW G;  2XND G;  1F23 A;  5EBL C;  2N04 A;  4JAU A;  1IUR A;  4EB6 B;  5A9G A;  2DQ3 A;  4BIZ A;  3RN4 A;  2ODM A;  3JD2 A;  3G71 V;  1FJG O;  3ASO C;  4UVB A;  1VMG A;  1OV9 A;  4DV0 O;  1Q43 A;  1VF6 C;  4B3R B;  4C7U A;  1XEQ A;  2UUB B;  2WAM A;  2ZQM A;  1FPO A;  2QM4 A;  4JI1 B;  2IH3 C;  3VQW A;  1XIL A;  3JAK A;  1D5N A;  1VQ5 V;  3O65 A;  3Q4H B;  3LDE A;  4L8J A;  2QKC A;  3TJT A;  4LF4 O;  4LF9 O;  4Z1V A;  1XMO O;  4UCT A;  4O2A B;  1N32 O;  3SJB C;  1VQK V;  3DGE A;  4G27 B;  3BHP A;  3HPL C;  3ZN0 A;  1OCO C;  1O9G A;  5H9C A;  2E5L B;  3E35 A;  2ZE7 A;  3HKD B;  3ZMZ A;  1EFR G;  2EIN C;  1GM8 A;  4R7C A;  5EC1 C;  4WBN A;  1PNK A;  4P9O A;  4JI3 O;  4TT3 G;  1R3K C;  4MSW C;  2Y48 A;  3TGU H;  3P30 A;  1J95 A;  5B1O A;  3UT5 A;  5IWA O;  2XOK G;  2QWP B;  4MTG A;  4ZOL B;  3ZRS A;  4DK1 A;  3BFR A;  2N74 A;  1ZUQ A;  5BMV A;  4LH7 A;  1L1F A;  3ZMV A;  1YEW A;  1Y6X A;  2X6B A;  3HKB B;  5L3C A;  4DUZ B;  3ZRW A;  1Q8I A;  4DK0 A;  1MOF A;  4UB6 Z;  3K0G A;  2GUZ A;  3JAR A;  1M56 C;  4ZBM A;  3ZRV A;  2LW7 A;  3BEH A;  5LP6 C;  3OMN B;  2YXH A;  1TUE B;  1MA1 A;  4KFM A;  1SQF A;  4JI2 B;  5CA0 B;  2HG5 C;  2KKW A;  4LFB B;  4FIP C;  2IJJ A;  1HWY A;  2JVD A;  3CD6 V;  3BVO A;  4NXM B;  2LP7 A;  3CRQ A;  5JH7 B;  2DWD C;  5GON A;  1I5Y A;  2P5O A;  2Q8V A;  2EZP A;  4O4H B;  1SQQ H;  1WA8 A;  5EZY B;  4JI7 B;  1YJW V;  5DM6 V;  1V55 C;  1MSD A;  1H8E G;  3ETQ A;  2ARH A;  4O4L A;  4I0X A;  5LHG A;  4GZR B;  5HFL A;  5LBQ A;  4H33 A;  1YJ9 V;  5LMU O;  4B3M O;  5GTH Z;  3PN1 A;  2IM9 A;  5L3E A;  1RPO A;  1KMI Z;  2ZM6 B;  1IBL B;  4LNU B;  4WFB V;  5F2V O;  4GKJ B;  5EK0 A;  5JCO C;  3E8F A;  1N0J A;  4LFC O;  4NXN O;  1K5Q A;  2HJF C;  3G67 A;  1NTZ H;  3ABM B;  2EIL B;  2PUS A;  5IY5 C;  4LF5 B;  1R3J C;  4N21 A;  1B3Q A;  3N2K B;  3OGC C;  4O4J B;  5GTI Z;  4BIO A;  4JAS A;  4QJF B;  2QWO B;  2VQE O;  3CSX A;  3H1K H;  4LFA B;  4MW3 A;  2Y0I A;  3CPW U;  4I55 B;  1VQ9 V;  4UCO A;  5LA6 A;  1XNQ B;  3BA9 A;  1YSC A;  5LGU A;  1W2B U;  4D7S A;  2VS0 A;  1NS1 A;  3ABK C;  2KG7 B;  2EJR A;  3SPI A;  2JEU A; 
#chains in the Genus database with same CATH homology
 3T4Z A;  4LCU C;  1NJI W;  1K3E A;  4N23 A;  2WLN A;  2QA4 V;  3F7V C;  4PA6 A;  4JTA B;  2BOB C;  2P7T C;  5LGN A;  3W7U A;  2V7Q G;  4H37 A;  1K9M W;  4P2Z A;  2IU0 A;  1BHB A;  4TSF G;  4RQE A;  3K06 A;  3CCL V;  1K73 W;  1NKD A;  1KQS U;  3GWO A;  1QBZ A;  1KC8 W;  3CP1 A;  3BY6 A;  1FXK C;  1R3L C;  4GX2 A;  5DN6 G;  3AG1 B;  1Q7Y W;  2W0F C;  3IFX A;  3H01 A;  1G4Y B;  5BZB A;  3E89 A;  1GTO A;  1QVG U;  3OAA G;  4JF3 A;  1UJW B;  5J9P C;  1DF5 A;  3K04 A;  4PDV A;  2JJ1 G;  1YJN V;  1AR1 B;  1VQP V;  2JEX A;  3QO8 A;  4UVA A;  2IU3 A;  5CBG A;  4JGS A;  3SYA A;  2V1D A;  1SRY A;  4MVU A;  4UUJ C;  1N8R W;  2WLI A;  4MVM A;  1QLN A;  1CPY A;  3ETD A;  3AG1 C;  4JTC B;  4MVS A;  2JJ2 G;  3E83 A;  4MTF A;  4G2K A;  3G4S V;  4I5S A;  1FS0 G;  4GX1 A;  2MK3 A;  3PJS K;  3TCU A;  3LDC A;  2GSM B;  1JQ0 A;  4Q20 A;  2XAS A;  4QPJ A;  2FTK A;  4RO2 A;  3AG2 B;  3QO5 A;  1H2G A;  3QO7 A;  1Q82 W;  2PI5 A;  2Y69 C;  3B77 A;  1VQO V;  1QVF U;  4HZ3 A;  3K03 A;  1K4D C;  2IJI A;  1KP3 A;  2YEV B;  2DWE C;  4MVQ A;  2ZR2 A;  2ZXW B;  2HR3 A;  2LFS A;  1GM7 A;  1F4N A;  4QPK A;  3AG3 B;  3K0D A;  4HAM A;  2NLJ C;  1JPX A;  5KA5 A;  2EBO A;  3AG4 B;  1EZJ A;  1E79 G;  2DW4 A;  3P32 A;  2X7R B;  3A0R A;  3OEE G;  3TK1 A;  1OZ0 A;  3CCQ V;  3RW0 A;  3LDD A;  4DXW A;  4HYO A;  4PA7 A;  3AG2 C;  3JD1 A;  3T2M A;  2ITC C;  3E2E A;  3FB8 C;  5LHI A;  4FMT A;  2B1G A;  4MTX A;  1ROP A;  2ZDI C;  4WFF A;  3ABL B;  3K9A A;  5L3B A;  3T4D A;  2DYS B;  1I5X A;  1V54 B;  2DYR C;  3CC2 V;  1B6Q A;  2QM7 A;  2X6C A;  3K79 A;  3QNE A;  5IYB O;  4XDK A;  3AG3 C;  2AHZ A;  3I55 V;  2H94 A;  3AG4 C;  3UKM A;  1F51 A;  1SET A;  4R8C A;  3E8H A;  5HFM A;  1YHQ V;  4BAY A;  2CK3 G;  1VQN V;  1WLE A;  4WF9 V;  1JX9 A;  2R9R B;  2WLK A;  4KP4 A;  2M7W A;  2XAJ A;  1VQ6 V;  3ASN C;  5CA3 A;  4MTO A;  4RUE A;  1NH2 B;  2JIZ G;  3I56 V;  2JK5 C;  2OCC C;  3ABL C;  3X2Q C;  3CCR V;  3B8N A;  2IJH A;  2R9I A;  2DYS C;  3TET A;  4WFA V;  2XAH A;  1V54 C;  1VQL V;  5B1A B;  1AI5 A;  2WLH A;  2OT5 A;  2PI4 A;  3ETG A;  1S77 D;  1ORQ C;  1KP2 A;  3MHS C;  3FB5 C;  4UV8 A;  2C2A A;  1KD1 W;  1Q86 W;  2HVJ C;  3W7X A;  5E1A C;  4J9Y B;  1K4C C;  4GX0 A;  4P30 A;  1H38 A;  3CC4 V;  4E2L A;  3VBB A;  3OR6 C;  3ZMU A;  5L3D A;  1Y4M A;  3RVZ A;  3ZMS A;  1SER A;  1RM1 C;  1AI4 A;  3F7Y C;  2WPD G;  4QE9 A;  2HFE C;  2P90 A;  1S72 V;  3OMA B;  1M56 B;  2UXX A;  5B1A C;  3D36 A;  1K92 A;  3OMI B;  4X88 A;  1WPX A;  2AHY A;  4KUM A;  4R6Z A;  3SPG A;  3F5W C;  2B5U A;  1QLE B;  3HB3 B;  4L87 A;  3LSS A;  4I9W A;  1VQ4 V;  1IXM A;  1COW G;  3DTU B;  1DTO A;  4X8A A;  1NH2 D;  1K8A W;  4GT1 A;  4MVO A;  4Z1M G;  3LUT B;  5FL7 G;  4XBF A;  2BOC C;  3E8G A;  1BMF G;  3SJQ C;  2WLM A;  3W7T A;  3MD0 A;  4TWK A;  3SYP A;  5IYD O;  1BL8 A;  3JD3 A;  3E86 A;  1G8M A;  1VQM V;  2K1E A;  1DF4 A;  4LBE C;  3IC7 A;  1M90 W;  1AJP A;  1R3I C;  2WLL A;  4FPP A;  1QLE C;  1V55 B;  5B1B B;  4RAI A;  1FXK A;  3W7S A;  5KUK A;  4BW5 A;  1E1R G;  1K97 A;  1GK9 A;  1NVP B;  1EBO A;  2EIK B;  3RBZ A;  4MVZ A;  3CXC U;  1AJN A;  3JD0 A;  3CCV V;  2Q67 A;  1NBM G;  2EZO A;  3STL C;  1YTF D;  1VQ8 V;  1GMG A;  3OEH G;  1ENV A;  4ZKI A;  5LHH A;  4DO2 A;  3ASO B;  4PA4 A;  1P7B A;  5B1N A;  1YIT V;  1AJQ A;  3SPH A;  3JCZ A;  3ZN1 A;  1W0J G;  1OCC B;  4PDR A;  3WG7 B;  3FYI B;  1BHA A;  3UM7 A;  5B1B C;  1K5S A;  3CCU V;  3CC7 V;  4CBC A;  1K34 A;  4YXW G;  2IH1 C;  3JYC A;  2XND G;  1F23 A;  5EBL C;  1M1K W;  2EIJ B;  2EIK C;  4JAU A;  4QE7 A;  4P9P A;  2Q6A A;  2DQ3 A;  5IY5 B;  4R50 A;  3FYE B;  2HVK C;  4BIZ A;  4QIW F;  2KB1 A;  5C93 A;  2XAF A;  4LC1 A;  1S76 D;  1JJ2 U;  2QKS A;  1S5H C;  4U7O A;  3JD2 A;  3G71 V;  2ZXW C;  3ASO C;  4UVB A;  3FB6 C;  1PNL A;  3EHB B;  3ML0 A;  1NVP D;  1GKF A;  1R6K A;  1OCC C;  3CYO A;  1OCO B;  3WG7 C;  4GX5 A;  1THZ A;  1FXH A;  2QM8 A;  1JCH A;  1H8H G;  5EBM C;  2WAM A;  2ZQM A;  3ETE A;  5EC2 C;  1JVM A;  2EIN B;  2OTJ V;  2A9H A;  3OE7 G;  3RVY A;  1YI2 V;  1K33 A;  1OCZ B;  1Y66 A;  2IH3 C;  2QE7 G;  5GW7 A;  3ABK B;  3R65 A;  4G28 B;  1VQ5 V;  1NQT A;  1YIJ V;  1PNM A;  3CCE V;  3LDE A;  3FKS G;  3WFV A;  1PL0 A;  3JD4 A;  1VQK V;  3DGE A;  4G27 B;  1KKD A;  3HPL C;  2B1I A;  4PEL A;  3ZN0 A;  3W7W A;  2GHY A;  1RPR A;  1OCO C;  2WLI B;  2ZDI A;  5H9C A;  3ZMT A;  3E35 A;  1PD3 A;  2YEV A;  3ABU A;  3ZMZ A;  1EFR G;  3MHH C;  1E1Q G;  1QR9 A;  1NR1 A;  2EIN C;  1GM8 A;  3OR7 C;  4R7C A;  5EC1 C;  2WLL B;  1PNK A;  4P9O A;  4TT3 G;  1R3K C;  1FXK B;  4MSW C;  4RUF A;  4XDJ A;  5B3S B;  3CCM V;  2Y48 A;  1XL4 A;  3SPC A;  4QNH B;  1W0K G;  4F4L A;  2P67 A;  3K3W A;  2HLD G;  3P30 A;  3OW2 U;  1J95 A;  5B1O A;  2Q69 A;  4J9Z B;  5H6R A;  1YTF B;  3G6E V;  3OFN G;  2XOK G;  4PA3 A;  1SZT A;  5CMU A;  1ZWI C;  4MTG A;  3ZRS A;  2XAQ A;  3OUS A;  2A79 B;  2JDI G;  1F4M A;  4WFH A;  1KEC A;  2X6A A;  3EFF K;  1L1F A;  3ZMV A;  2ZR3 A;  2X6B A;  3ZRX A;  2ATK C;  5L3C A;  4JYB A;  3ZJZ A;  3ZRW A;  2ZD9 A;  4BIU A;  1CEZ A;  5B3S C;  4FK5 C;  3FB7 C;  1MOF A;  1FXV A;  3K0G A;  2ITD C;  4XDL A;  1R6N A;  3SYO A;  1M56 C;  4ZBM A;  3NXS A;  1ARO P;  3ZRV A;  4GCZ A;  4UVC A;  3BEH A;  3OMN B;  4ASU G;  1TUE B;  2X0L A;  2WWW A;  4FJC C;  4KFM A;  2UXN A;  1AI7 A;  1QCE A;  1CP9 A;  2QEX V;  3SYQ A;  2HG5 C;  1R73 A;  2Y69 B;  4PDM A;  4FIP C;  2Q68 A;  3ZIA G;  2IJJ A;  1HWY A;  1GO3 F;  4MS2 A;  5KA6 A;  3CD6 V;  3D3I A;  2LP7 A;  4PDL A;  1QR8 A;  3ZCC A;  1OHH G;  2YSU B;  3IGA C;  5CBF A;  2WSS G;  1S0V A;  2DWD C;  2W6J G;  1I5Y A;  2EZP A;  4MT8 A;  2H8P C;  5L3F A;  4UV9 A;  5CBH A;  2QTO A;  1NR7 A;  3VOU A;  3LNM B;  2F43 G;  2Z3Y A;  5DM6 V;  1YJW V;  1V55 C;  4JYC A;  1H8E G;  2P6J A;  1MG1 A;  2DQ0 A;  1M57 B;  5LHG A;  5HFL A;  5LBQ A;  1AI6 A;  5L3G A;  4WCE V;  4H33 A;  3CMA V;  3E8B A;  3CCS V;  1YJ9 V;  2A0L A;  3KG2 A;  1XL6 A;  3OM3 B;  4JTD B;  1DLB A;  2DYR B;  2NNU A;  1MSW D;  1S3J A;  4CZZ A;  3LSQ A;  5L3E A;  1SES A;  1RPO A;  4WFE A;  4WFB V;  5CN0 A;  1FFT B;  1LNQ A;  2XAG A;  2IW5 A;  2IJK A;  5EK0 A;  5LGT A;  3E8F A;  3SPJ A;  1K5Q A;  4LP8 A;  2OTL V;  2EIM B;  3M99 B;  3ASN B;  2HJF C;  2EIJ C;  2LFR A;  3SYC A;  3ABM B;  1M57 C;  2EIL B;  5IDJ A;  1OCR B;  3AEI A;  4OXS A;  2OCC B;  5IY5 C;  3X2Q B;  4RQF A;  4JAV A;  3CCJ V;  1Q81 W;  1R3J C;  4N21 A;  2W6I G;  2D3O W;  3OGC C;  3B8M A;  4JAS A;  5H6Q A;  4QJF B;  1GM9 A;  3ZRW B;  2Z5U A;  4MW8 A;  3CME V;  4WFG A;  4MW3 A;  3K08 A;  3CPW U;  4UXN A;  3ABT A;  4X89 A;  1VQ9 V;  1PKX A;  5EBW C;  1P4R A;  1MAB G;  4MVR A;  4PA9 A;  1YSC A;  2EIM C;  1K7D A;  2WLJ A;  5IYC O;  1VQ7 V;  5LGU A;  4EKW A;  3STZ C;  1RM1 B;  1W2B U;  3ABM C;  2EIL C;  3GB7 C;  1OCR C;  1JOY A;  1OCZ C;  3OUF A;  5KUM A;  4U7N A;  3ABK C;  4JPR A;  2EJR A;  3T1C A;  3SPI A;  2HKO A;  1M9N A;  2JEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...