1VQ7V

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq7V00
3CPWU 3CCLV 3CMEV 4WFBV 1VQLV 1R73A 3CXCU 3CCUV 2QEXV 1YHQV 1YJ9V 3G71V 1QVFU 1Q82W 1VQ7V 3CCJV 3I55V 3CCQV 3CCEV 3CC7V 1YI2V 1YITV 1VQPV 3CCVV 1VQ8V 3CC4V 1YJNV 3CC2V 3G6EV 3CCMV 3I56V 1N8RW 1YJWV 1VQNV 1VQ6V 2OTLV 1VQOV 1VQ4V 1Q7YW 1NJIW 3OW2U 1KC8W 1VQ5V 4WFAV 1Q86W 1VQ9V 1VQKV 5DM6V 1M90W 3G4SV 4WCEV 2D3OW 1YIJV 1Q81W 2OTJV 1QVGU 4WF9V 1M1KW 1KD1W 3CD6V 3CCSV 2QA4V 1K9MW 3CMAV 1W2BU 1K8AW 1JJ2U 1S72V 3CCRV 1K73W 1KQSU 1VQMV
chains in the Genus database with same CATH superfamily
2UXXA 4FM2A 4GKKO 3H01A 1CEZA 3ABKC 3OGCC 1KUQA 5EZYA 2XAJA 2NNUA 4PA9A 5L3FA 2CTRA 1PP9H 3W7TA 4UVAA 2E74B 3A0RA 3STZC 5KHKA 2KSDA 2N05A 2M7WA 3SYAA 1R6TA 1EZVH 2XAFA 2F66C 5LHHA 2IJHA 4LNUA 2YXLA 3CC7V 2ARHA 1K3EA 4MT8A 4R6ZA 4J9YB 3ZEDA 2FYUH 1QLEC 5JJNB 4YJ3A 4TQFA 1FFXA 4FM1A 4OGQB 5IJ0B 1IURA 3K9AA 3CRMA 4RQFA 5LL6Y 2QE7G 3EXAA 5JH7B 3ASOB 2ETNA 1SKVA 1Q6UA 3L73H 2OCCC 5TISZ 2JVDA 4UCTA 5D5QA 3ZMSA 3LUTB 1JOYA 2WLLA 3E86A 2R72A 4LFBO 3T1HO 2LQTA 2Y69C 4YHHB 3DXRB 2Q0OC 1M9NA 2RMKB 1FXKB 5B1BC 3DSQA 2JIZG 3JD0A 1M4UA 4PDMA 2HR3A 1JCHA 2QR4A 3CCMV 3TETA 1QNMA 3M8AA 4R50A 5H5NA 1OCCC 4X89A 2WLKA 4BW9A 3G80A 2RCVA 2DYSC 3ABKB 1NTZH 3ABUA 4EFEA 1JX9A 2ZINA 4IHJB 5LYJB 4MVOA 4YJ2A 2CAZC 5BMVA 5IY5B 2XOKG 1BE3H 2Y48A 1PL4A 3ABMC 4IGGA 3JATA 3JSLA 4LF9B 3L9DA 4JYYA 3SR2C 1QR9A 3HKDB 2DE0X 1B3QA 2KB1A 1RSOA 1QHTA 2ZE7A 2Y4TA 3SDLA 1OCRB 4RO2A 2NR5A 5LHIA 2P4VA 4H33A 1XQ8A 3K5MA 5IJ9B 3JAKB 2A3QA 4AQYB 2N74A 4QGPA 1QLEB 3MAQA 1S5LZ 4GYCB 4UV9A 5ITZA 2UXDB 1R3LC 2ZD9A 1CXZB 4X1YB 1HDJA 1KBHA 4YHHO 3ZHUA 3CRQA 4PA7A 2XUMA 1GN2A 2OCCB 5LOVB 3RYFB 3K9SA 3QTCA 3S3XA 1YTFD 3W7UA 4JI8B 1BGYH 4DV0B 4LP8A 4RUEA 3D36C 2PGGA 1NR1A 2P22C 3SYPA 3JALB 4TT3G 2WA3A 4KHPB 3GVMA 2GHYA 3VQXA 1AB3A 5J2TB 2BE3A 3LSQA 1VEWA 1SZXA 4DW0A 4LF9O 4CH3A 2WLNA 2YIBA 3I56V 3SPJA 2DYSB 2ZXWB 4QNHB 1GRJA 1P49A 4JGSA 3ASNB 2YI8A 2XTAA 2YEVA 3G4SV 1Q81W 3OR6C 4X1IA 4MVMA 3ABTA 4ASUG 1K34A 4QPKA 4PDRA 5KHGA 2XNDG 4AQYO 3SGIA 1MABG 1SQXH 2R9RB 3KG2A 2UXDO 1AVMA 2ADPA 5L3BA 3FX7A 2IU0A 2ODMA 4JTCB 2WLIB 1GM8A 1VP7A 4QIWF 4K8XA 2KG7A 5B1AC 4H44B 4MVQA 1RP3B 2IW5A 5GW7A 1XL4A 5F2VO 2HP8A 3PN1A 2CTQA 1K8AW 1XNQB 3JASA 1OCOC 1WAZA 3X2QB 5LA6A 2GBOA 2QKSA 1THZA 3G71V 2X0LA 1YI2V 4JI8O 3IC9A 2V1DA 1YDXA 1YJWV 2JGDB 3J80N 2O57A 1WP8A 1GTOA 2F1MA 2AXTZ 4KHPO 4XDJA 3QO8A 3SPIA 3K58A 1FPOA 1S5HC 1FAFA 3TGUH 1VQLV 2EX3A 1N33B 2EZPA 3BA9A 4DK1A 3JAMN 3FB5C 1GAXA 5KA6A 4U7OA 3T1CA 1G8MA 1DLBA 4TV8A 1K5SA 2CTPA 4LFAO 2ZE5A 3RYIA 5B1OA 2JEXA 3WG7C 2MW2B 4K8ZA 4N21A 2WSSG 4CC6A 2DW4A 3KZIZ 1V55C 5LXTB 4MTFA 5LP6C 1QLNA 4FLTA 3O9OA 1OJHA 4LBEC 4DR6B 1ORQC 4TUYB 3WU2Z 1AI4A 1XOUA 4G2KA 3FYIB 3BCCH 1XNQO 1XMOB 2OYQA 2F95B 4NXNB 3CMEV 1NZ6A 1NR7A 3WB2A 5B1AB 3OD4A 3JD2A 3J7AU 1Y76B 2BTQA 3OAAG 2D2CB 4KXRA 1K7DA 4UXNA 2E76B 2JGUA 5FPRA 2JJ2G 3FAVB 2PYJA 2BOCC 2Q8VA 3F5TA 2VWKA 4GX1A 2QM4A 5KA5A 1N33O 2RN9A 2CGOA 1I5XA 4LF4B 3APQA 3CC4V 4X20B 3FB8C 4PD4F 2LJ2A 1HNZB 1ZX3A 1SQFA 4DO2A 5LMNB 2YS8A 1JFFB 4P9PA 4LWSB 1AJQA 4IYHA 4YXWG 4FLUA 5JQGA 3ZRWA 1M56C 1KYOF 3F5WC 4FFKA 5EYPA 2DQ0A 2Q73A 3CCUV 3K5LA 3AG1C 4B7KA 4J7ZA 4O4HA 4DR6O 2KKWA 3WG7B 4DRXA 1S76D 2VQEB 5GONB 3BRCA 3OW2U 1T5EA 5JVDA 3F7YC 1XMOO 4BIZA 3K5OA 4NXNO 4PJ0Z 2F93B 3MDSA 5LP6B 2IJJA 2WA4A 2OT5A 3UM7A 4ZI7A 3JAWB 1TAEA 3EVKA 4CBCA 1IBKB 5FPOA 1LUVA 2RNBA 2Q4PA 1BSMA 4FLWA 5J2UA 3JYCA 1KECA 1JQ0A 3J81N 2OWOA 4X9QA 1Y74A 2GUZB 5FLXN 4O2AA 4U3FH 1H8HG 4UB6Z 2Q67A 3KKYA 4P9OA 1MSWD 4LF4O 1F7YA 4DV1B 1N34B 2BTOA 3N2KB 5IYZB 5CA1B 1U97A 5LMNO 2ZKOA 1GK9A 5C8YB 4OPAA 1Y67A 1H8EG 1YVWA 3L70H 4ZBMA 3OR7C 4DW1A 3CMAV 3OEEG 2ZCEA 1S72V 5IYCO 1WB8A 3HKEB 3CCJV 2DOSA 2Q0AA 2VQEO 1M56B 4FFBB 3MHHC 1WPXA 1I7FA 2ZE8A 3VQYA 3W7WA 1EM1A 4J10A 1MSDA 1NH2B 1XNRB 1XDCA 1IBKO 5BY1A 1AR5A 2NN4A 4PELA 1Y6XA 1VQ8V 4PDLA 3HKBA 2H94A 4JYCA 5EIBD 2WLHA 1IVSA 2W0XA 2QA4V 3THOA 1N36B 1E1QG 1H2MA 2Z3YA 5JJEB 4DV1O 1K97A 2Q68A 3CE2A 1EN6A 3E83A 1N34O 1R6NA 1IXMA 3IFXA 2QWRB 3A0BZ 1SQGA 1FJGB 5KAIZ 3SYQA 1SC5B 4B3TB 1DF5A 4WF9V 1JA8A 1F4MA 4WFGA 4OPHA 2QM8A 1BS3A 3CPWU 3HKCB 4CH6A 4DXWA 1SA0A 3AG7A 1ZTEA 4TV9B 4LF8B 3RVZA 5KUMA 5DEDA 1FXKC 3CJHA 1BMFG 1WA8B 3U10A 4X64B 1Y66A 1EN4A 3ZCCA 1WP7A 4GX2A 1XNRO 3AG3C 2Q5ZA 4TWKA 3CD6V 1YTFB 3DC6A 3GWKC 1FXVA 3GB7C 1L0LH 4O4IB 3QNEA 2ZQMA 1AILA 1ROPA 1VIBA 5LGUA 3ZHVA 3LDCA 4GZRB 5LGTA 2L35A 3BVOA 2UUBB 3HPLC 5IY5C 2LW7A 2W6IG 1SRYA 4RAIA 1N36O 2Y0IA 4GLXA 3QO7A 5IT9N 5B3SB 1Z5VA 2JDIG 2Z0AA 1OCRC 2XASA 1XBLA 2UU9B 2PUSA 5EZYB 3E22A 4DV5B 2EIMC 3KCYA 4E4EA 1FJGO 3GWOA 2CE4A 1L1FA 4JI4B 4B3TO 2YSUB 2PI4A 2JEUA 3QVNA 2RDCA 2ZIMA 3RT3C 3CCSV 2BCCH 2X6CA 4LNUB 2UXNA 3NXSA 2E75B 4LF8O 3U11A 4I7ZB 3RYHA 5KMGA 2WAMA 5LGNA 3L75H 3K04A 4X64O 4JASA 4YJ3B 1B04A 1FFXB 2EULA 3A0HZ 3MHSC 4K0KB 4PV1B 1IZ3A 2HFEC 2QEXV 1UFIA 3CCVV 1XREA 3TJTA 1NH2D 4GUNA 3AG3B 2UUBO 2XAHA 1F23A 3ZMUA 4BAYA 5FNVA 3JD3A 2ZIOA 2WLLB 2ITDC 3ZIAG 2ZXWC 3VOUA 1N0JA 1HR0B 4FVMA 4MVZA 1R3KC 3ASNC 4ZOLA 4FLYA 4KUMA 2UU9O 1YJ9V 2LGQA 4DV5O 1F51A 4FM0A 4I50A 2ZR3A 4JI4O 3P3NA 3OTOB 2HVJC 4DR4B 5L3GA 4F4LA 3AG2C 5EBMC 3T1YB 3E8HA 3CP1A 3CRCA 4DR7B 4NXMB 2UXBO 4HBNA 3MD0A 4NB5A 4I9QA 2EIMB 3RWRD 2W6JG 1GM7A 1BT8A 3QO5A 3CXCU 4YJ2B 5BMVB 5CA3A 1ZAUA 1HNWB 2CK3G 1K4CC 1E1RG 2H8PC 3JATB 1Q5OA 1SQPH 2QWOB 3X2QC 1BHAA 4JZ2A 2BSKA 4K0KO 1RSOB 3ZBHA 5C93A 1F4NA 4FMTA 1GN3A 4QPJA 3TCUA 4Q6GA 1SZTA 3OMAB 4MTXA 1B06A 2EBOA 5ITZB 3G6BA 2OIGA 4RUFA 1IDSA 1DTOA 2ZR2A 3SPCA 3CSXA 4X1KA 5CMUA 1GN4A 3LDDA 1HR0O 2PYLA 3UO3A 1EBOA 3OEHG 1QR8A 1Q3EA 1J5EB 3LNMB 4JI7B 3OMIB 4FLZA 4B3RB 2EINC 4MS2A 1SESA 3AK3A 1RPRA 3OTOO 2DYRC 4UCUA 4G27B 2PI5A 2HJFC 4DR4O 1VQ6V 3T1YO 3O65A 1HNXO 4ZHQA 4U7NA 4DR7O 4NXMO 4LFAB 1GH6A 4UCVA 1FYJA 3DC5A 1IXBA 3H9VA 1HNWO 3AG2B 3M7MX 1TVKA 2HHHB 5IYBO 4O2BA 3SJQC 1UJWB 2KQXA 1EZJA 2EZOA 4BIUA 4LF5B 5EIBC 4JI3B 1XMQB 4W4KA 2YEVB 2A0LA 3JCZA 4J7KA 5DM6V 3APOA 4Z1MG 4J9ZB 2DWEC 4X1IB 4B3MB 3ETQA 1JJOA 3HB3B 1MZEA 4PA4A 1SS3A 5BXZA 4JI5B 4B08A 3AEIA 4CS4A 1BZKA 3T4ZA 1KMIZ 1QQCA 3H1JH 3UKMA 2KG7B 3H1HH 4FZ1A 1PM9A 1J5EO 1MZFA 4DUYB 4JI7O 1AI5A 1FD9A 3JASB 4B3RO 5EC1C 5LA6B 3D36A 4X8AA 5EBLC 5D5PA 2QKAA 3CCQV 3BPZA 4MTGA 4UCRA 1VF6C 2R9IA 4JI2B 2P4KA 2QWQB 4PHZA 1KC8W 5IDJA 3L71H 2LW1A 2EINB 4NTXA 2D3OW 3OUFA 2AW9A 3CRRA 1OZ0A 2DYRB 4HNAA 2YXHA 1JMKC 2QSAA 2HHHO 4AILC 4DR2B 4FJCC 2CDYA 3OTFA 3ETDA 2Q7EA 4YY3B 4HYOA 4LF5O 1KB9F 4TV8B 4JI3O 1XMQO 2FL4A 3RYIB 5B5EZ 4WCEV 4B3MO 1GMGA 4DYLA 1IBMB 4EB6A 4QE7A 4IT5A 3ZHTA 1XEQA 5LBQA 4JI5O 3N2GA 1N8RW 5LMUB 3D3IA 1CP9A 3K57A 1BQ0A 4K35A 2EJ7A 4I4TA 2Q7GA 4EEQA 4DUYO 3JD4A 5B66Z 3E2EA 1NVPD 2FMLA 2WPDG 1YF2A 3RFRA 1I0HA 4P30A 3B77A 4JI2O 2GDSA 2XT9A 3VQWA 2BTQB 4JI6B 3S3WA 3ZMTA 2P5OA 4DV4B 4U3JA 3CHXA 4QJFB 1HWYA 1R6KA 1KP2A 2Y4UA 1K9MW 3HR0A 3SJAC 4DR2O 1KQSU 1PKXA 3P30A 4FK5C 1TUBA 4X65B 1HW7A 4YY3O 1TUEB 2PF4E 1LUWA 1P7BA 2IH3C 3ZHQA 3CS5A 3STLC 4DR1B 4IL6Z 2VWJA 2M6YA 1TA8A 1XHZA 1Z2GA 3UT5A 3RYCA 4MW8A 1IBMO 5JQGB 3ZRWB 1WLEA 2YIBD 1N4CA 1IX9A 2LO1A 3W7SA 5EYPB 4Z2WA 1OHHG 4B7EA 1TGOA 1JVMA 1N32B 2YC0A 5LMUO 5BZBA 4EKWA 4O4HB 3Q4HA 3KCXA 2F4VB 4DRXB 2QTOA 1JR9A 4O4LA 3K0DA 1SERA 2LFRA 4WBNA 2Q6AA 3B40A 5JVDB 4PI2A 4ZI7B 2QM7A 5CA0A 5FL7G 4RWUA 5J2UB 4P2ZA 1YSCA 4NYKA 4JI6O 4PA6A 1SQQH 4ZIBA 4DV4O 4I0XA 1Y74B 5CB4A 4DR3B 3BEHA 4GKJO 4O2AB 4UFZA 4UB8Z 4JTAB 2AZ2A 3NR7A 1M5IA 2YIDA 1BL8A 1P84F 4F6RA 2NLJC 5IE9A 4X65O 1XL6A 1AJPA 1NKDA 2EIKB 1R73A 2JS5A 4CH4A 4DR1O 4L8JA 3ZJZA 4H13B 4I5SA 1ZWIC 1QCEA 1M93A 1G6UA 4AHCA 4IIJA 1FS0G 3SYCA 2UXCB 4O4JA 1MNGA 2ZDIA 2HJDA 4X66B 1NU1H 2LFSA 2B1GA 3IAYA 3CYOA 4MSWC 1N32O 4JPRA 3U0ZA 1VQ7V 4LF6B 4UUJC 2CGNA 2F4VO 2HEPA 2CH7A 1ZSPA 2WLMA 5JCOC 3G6EV 2IJKA 3ETGA 5B3SC 4JV5B 1OCZB 2LGWA 3R65A 2IJIA 4J42A 3BFRA 2AZ0A 3ETEA 3ZMVA 3FFQA 3B8NA 3OUSA 1ZUQA 3ML0A 1ZLZA 1ZL8A 5KX5A 3HKBB 1VF5B 3ZX6A 1W0KG 4DR3O 1PNKA 5JJJB 5KHHA 4UCSA 2YICA 3IGAC 2ZNIA 4TOIA 4MVUA 1NQTA 1MA1A 3ABLB 5GTHZ 2AHYA 4DV2B 2FKXA 1PNMA 2CUGA 3D3QA 1B6QA 4R8CA 4B3SB 2WWWA 2UXCO 5A9GA 1BCCH 1SQVH 3JARA 4X66O 3K5NA 3C3TA 4NVPA 4YIOA 1S5JA 3ZS8C 4TSFG 4LF6O 1AI6A 1SA0B 3I55V 3VQVA 1K4DC 4OXSA 4Q20A 3SPHA 3E8GA 4CH5A 4JV5O 1WN7A 3K03A 3CJHB 2IBZH 5L3CA 4OX9O 1US6A 2R70A 2H3OA 4X88A 3ZHRA 4BWAA 4LH6A 1HP8A 1U96A 1YZBA 4LH7A 2JK5C 1VARA 3CCEV 1VQPV 1O9HA 1QU7A 4GCZA 2EILC 2EIJB 2ZE6A 1KKDA 4XBFA 1VQ9V 3R66A 3BABA 3M99B 3B09A 5IJ0A 3BAAA 3VBBA 3RVYA 3D8CA 3E8FA 2UXBB 4DV2O 1H2GA 2GSMB 4LFCB 2Q69A 3LSSA 1GKFA 5JH7A 1NTMH 2RJZA 3K06A 2GV9A 3E22B 2P06A 1FXHA 3W7XA 1X4TA 4B3SO 1VQ4V 1Q8IA 4JAAA 4NTYA 2XAQA 2P90A 4FLXA 2UUCB 3DXRA 4KP4A 2X6AA 3SJBC 1FXKA 4J80A 4NKGB 3FB7C 3CX5F 4MW3A 2YDEA 3RYHB 5KMGB 3F7VC 1VQOV 2UUAB 1SETA 3ZRSA 5CBGA 2E5LB 1XHXA 3E89A 3N27A 2Q7HA 1YIJV 3C3SA 3LNNA 2CTWA 2A06H 4IHJA 1VQMV 3TXSA 3BHPA 4EFBA 5LYJA 5IYDO 1KU9A 4JYAB 2A9HA 3JSNA 5FNVB 1PV0A 2ADQB 3HKDA 1DK1A 4XDLA 1VQ5V 4WFAV 3A8TA 4LC1A 1R1BA 1O9GA 2FTKA 1HNXB 3WB1A 4HZ3A 1LNQA 3RGBA 1RFYA 4LFCO 5IJ9A 4J41A 3EFFK 4WFBV 3JAKA 4ZOLB 3DTUB 3QF7A 4ABMA 2EILB 1QVFU 1J95A 4E2LA 2IU3A 2EJRA 4C7UA 4I50B 4UV8A 4FPPA 1I5YA 2B1IA 4X1YA 2VS0A 5L3DA 2UUCO 3OM3B 1QVGU 4D7SA 5H6RA 1I94B 5A2QN 5LOVA 3RYFA 3CXHF 2AHZA 4DUZB 1BQZA 4CS3A 4LF7B 1SF9A 3CC2V 2UUAO 1LR1A 1KP3A 1NVPB 3RW0A 3TK1A 1Q7YW 2E5LO 3G67A 2BSKB 3E8BA 4N23A 1PL0A 3JALA 2LP7A 4PI0A 2OIEA 1VMGA 4JAUA 1Q43A 1PNLA 3OMNB 2GTAA 2RQ6A 3OE7G 2XHBA 5EK0A 5J2TA 2YI9A 1I08A 4GT1A 4DR5B 3L72H 4JYAO 4QE9A 4AI8A 1R3JC 2Y69B 1VQNV 4X1KB 1L8DA 3CB2A 5B1BB 4FLVA 1AROP 2MK3A 2QKCA 1COWG 3AG4C 2PZSA 1OCCB 4MVRA 1YITV 3CRAA 5BR8B 1L0NH 1GN6A 2JRIA 3B2EE 2WLIA 3K08A 4ZHQB 1G1XB 1VQKV 1Q6HA 1I94O 3ABMB 3ZRXA 2W0FC 1V54C 4YIPA 4DUZO 4LF7O 1TVKB 1S3JA 1P7GA 3T4DA 4O2BB 3UQ8A 2DWDC 1IBLB 2PY5A 3B4SA 1Y4MA 3IJ4A 4NR1A 2JGDA 3AK1A 3SPGA 1NJIW 4JI0B 2YXYA 4JI1B 3FB6C 1FFTB 3H1LH 3BA8A 4BR6A 1BHBA 1FKAO 5H2FZ 1XI1A 3ICXA 4DR5O 1JPXA 4JAVA 1NT2B 1URFA 2QJ1A 1Z5WA 5K1PA 4DV0O 1YXBA 2DMXA 2OTLV 1N0NA 4LR3A 2V4DA 2PTMA 1WJZA 3K79A 3I5DA 1NBMG 2ZT9B 1D2DA 5EC2C 4D6TH 1RM1C 1YEWA 2IM9A 2N04A 4JF3A 4H0LB 5LXTA 2B9ZA 5BR8O 3EHBB 2YIAA 4DV7B 1MMMA 1YJNV 1NI8A 2F43G 2DN9A 3AG4B 3B8MA 4TUYA 2VQFB 3JCUZ 1AR4A 4I55A 3H1KH 5CN0A 2K9PA 4HNAB 4JYBA 3CWBH 1AI7A 4NTWA 5JWPA 3T2MA 4W4LA 4DV6B 2ZNJA 2JJ1G 4MTOA 1M57C 3UCSC 1IBLO 1AP5A 4G28B 2DJVA 5L3EA 4TQDA 4K3AA 4JI0O 1Y76A 1P4RA 3K3WA 3AK2A 4JI1O 1A32A 3FD9A 5J9PC 1V54B 4I55B 4H37A 2XAGA 3FYEB 1EFRG 1PPJH 4D7TA 2OTJV 3FAVA 3C90A 2P67A 3JD1A 4EB6B 4BIOA 4ICGA 1W59A 1YCIA 2HG5C 3N2GB 3ZRVA 4X20A 2ILMA 5GTIZ 2L6LA 1OCOB 2EIKC 4I4TB 2B5UA 4I9WA 3IC7A 1JFFA 4LWSA 4PA3A 2DQ3A 4GKJB 4UVCA 1VF6A 5DN6G 4DV7O 1G4YB 3OGIB 1H2SB 1MOFA 3UO2A 1ENVA 2VQFO 1RM1B 1K5QA 1MG1A 5GONA 4U3JB 1AP6A 2HKOA 4KFMA 4ZKIA 1NTKH 4FZ0A 5LP6A 1W0JG 4DV6O 5DECA 3CCRV 3JAWA 4JTDB 2HVKC 1TUBB 1OCZC 2AGAA 5KHIA 2ATKC 1H2KA 5K1XA 1D5AA 2ZDIC 1Q6IA 5E79Z 3SJCC 1Q90D 3ZHSA 1CPYA 3WFVA 5H6QA 1V55B 2GUZA 3UT5B 1PD3A 3QG5A 3RYCB 2JS3A 1M57B 2OCHA 4R7CA 1JJ2U 2WLJA 4WFEA 1AR1B 3N2KA 5B1NA 2QDOA 5IYZA 3Q4HB 5CA1A 1RPOA 5C8YA 4O4LB 3ABLC 4WBNB 4XDKA 5E1AC 1WNSA 3LSUA 2GTSA 5IWAB 2ZM6B 3ZMZA 4CC5A 3K59A 1NS1A 1OV9A 1M1KW 5HFMA 1XILA 2K1EA 4UVBA 3FKSG 2C2AA 5CA0B 5KUKA 5KLVH 1WPBA 4GX0A 1EN5A 1K92A 1HNZO 3TXQA 3HKEA 1H2LA 4FFBA 1GM9A 4F6EA 2R9AA 4I0XB 3RN4A 2P6JA 5CB4B 1DF4A 1V9PA 1R3IC 4F6RB 1W2BU 4X62B 4DV3B 4GX5A 2FB5A 1S77D 3P32A 1YHQV 2E3CA 2V7QG 4CZZA 1QBZA 1SQBH 1DGSA 2QTSA 2X6BA 4IIJB 3BY6A 3LDEA 4O4JB 5HFLA 3AG1B 4OX9B 2QWNB 2Y0PA 2HLDG 2EIJC 4J11A 3WB0A 1X59A 3CEIA 2QGNA 1Q82W 3K0GA 4GKKB 3ZN0A 2CH7B 2BOBC 5LHGA 4KL1A 1H38A 4FIPC 4CS2A 2YUAA 3OFNG 1XUQA 4BW5A 5CBFA 3RBZA 5H9CA 5IWAO 2ZM6O 2G38A 4Z1VA 4LCUC 3A2FA 2A79B 3P3PA 1WB7A 1GO3F 1S0VA 4UCOA 3CCLV 4DK0A 4A5UB 5KAFZ 3HKCA 2A7WA 4MVSA 4JZGA 3H1IH 3DGEA 4L87A 4J7JA 1ZL8B 5KX5B 4TV9A 1E79G 3PJSK 1AJNA 3E35A 1WA8A 3ASOC 1D5NA 4IYIA 3L74H 2F23A 1UPGA 3ZN1A 5CBHA 4WFFA 4X62O 4DV3O 3SYOA 2Z5UA 4RQEA 2ITCC 4WFHA 4O4IA 4HAMA 2IH1C 2X7RB 2Q9LA 1KKCA 2QWPB 3OT7A 2P7TC 5AG2A 1Q86W 5EBWC 1VF7A 1M90W 5KHJA 4PDVA 1K33A 3JARB 1KD1W 2VRZA 4LFBB 5JCOA 3T1HB 1K73W 1H2NA
chains in the Genus database with same CATH topology
2UXXA 1MSWD 4FJCC 3H01A 1CEZA 3ETDA 2AHZA 3ABKC 3OGCC 4HYOA 3CC2V 1KP3A 2XAJA 2NNUA 1GK9A 4PA9A 5L3FA 3RW0A 1NVPB 3TK1A 1Q7YW 3E8BA 4N23A 1PL0A 3W7TA 4UVAA 2LP7A 1H8EG 4WCEV 3A0RA 4JAUA 4ZBMA 3STZC 1GMGA 3OR7C 1PNLA 3OMNB 3OE7G 3CMAV 3OEEG 4QE7A 5EK0A 1S72V 2M7WA 3SYAA 4GT1A 2XAFA 5LHHA 5IYCO 5LBQA 2IJHA 3CCJV 3CC7V 4QE9A 1R3JC 1K3EA 4MT8A 1M56B 4R6ZA 2Y69B 1N8RW 3D3IA 1VQNV 1CP9A 3MHHC 4J9YB 1WPXA 5B1BB 1QLEC 1AROP 2MK3A 1COWG 3JD4A 3E2EA 3W7WA 3AG4C 1NVPD 1NH2B 3K9AA 2WPDG 1OCCB 4RQFA 2QE7G 4P30A 4PELA 4MVRA 1VQ8V 3B77A 3ASOB 1YITV 4PDLA 2OCCC 3ZMTA 2H94A 2WLIA 3K08A 4JYCA 3ZMSA 3LUTB 4QJFB 1VQKV 1HWYA 1R6KA 2WLLA 1KP2A 3E86A 1JOYA 2WLHA 2Y69C 2QA4V 3ABMB 3ZRXA 1K9MW 1E1QG 2Z3YA 2W0FC 1M9NA 1V54C 1KQSU 1PKXA 1FXKB 3P30A 1K97A 2Q68A 3E83A 4FK5C 5B1BC 2JIZG 1R6NA 1IXMA 3IFXA 1TUEB 1S3JA 3JD0A 3T4DA 4PDMA 2DWDC 1P7BA 2HR3A 1JCHA 2IH3C 1Y4MA 3STLC 3TETA 3CCMV 4R50A 1OCCC 4X89A 3SPGA 1NJIW 2WLKA 3SYQA 3FB6C 1FFTB 4MW8A 3ZRWB 1BHBA 1DF5A 2DYSC 1WLEA 3ABKB 4WF9V 3ABUA 1F4MA 3W7SA 1JX9A 4WFGA 2QM8A 3CPWU 1OHHG 1JPXA 4JAVA 4MVOA 4DXWA 5IY5B 1JVMA 2XOKG 2Y48A 5BZBA 4EKWA 3ABMC 2QTOA 2OTLV 3K0DA 3RVZA 2LFRA 5KUMA 1FXKC 1SERA 1QR9A 1BMFG 3K79A 2Q6AA 1NBMG 2KB1A 5EC2C 1Y66A 3ZCCA 4GX2A 1OCRB 4RO2A 3AG3C 4TWKA 5LHIA 3CD6V 1RM1C 4H33A 2QM7A 1YTFB 4JF3A 1FXVA 3GB7C 5FL7G 3QNEA 2ZQMA 1ROPA 1QLEB 3EHBB 4P2ZA 4UV9A 5LGUA 1YSCA 3LDCA 1YJNV 4PA6A 2F43G 5LGTA 3AG4B 3B8MA 1R3LC 2ZD9A 3BEHA 3HPLC 5IY5C 2W6IG 1SRYA 4JTAB 5CN0A 4RAIA 1BL8A 3QO7A 4PA7A 4JYBA 1AI7A 2OCCB 5B3SB 2NLJC 3T2MA 2JDIG 1XL6A 1AJPA 1NKDA 2EIKB 1R73A 2JJ1G 4MTOA 1M57C 1OCRC 2XASA 4G28B 3ZJZA 4I5SA 2EIMC 1ZWIC 1QCEA 5L3EA 1YTFD 3GWOA 3W7UA 1L1FA 4LP8A 4RUEA 1P4RA 3K3WA 5J9PC 1NR1A 2YSUB 1V54B 3SYPA 1FS0G 4H37A 2PI4A 2XAGA 3SYCA 3FYEB 4TT3G 1EFRG 2JEUA 2OTJV 2GHYA 3CCSV 2P67A 3JD1A 2ZDIA 2LFSA 2B1GA 3CYOA 4MSWC 2X6CA 4JPRA 1VQ7V 2HG5C 3LSQA 2UXNA 4UUJC 3ZRVA 3NXSA 2WLMA 3G6EV 2WLNA 2IJKA 3I56V 3SPJA 2DYSB 2ZXWB 3ETGA 5B3SC 2WAMA 5LGNA 4QNHB 1OCOB 2EIKC 3K04A 4JGSA 2B5UA 3ASNB 4I9WA 1OCZB 3IC7A 4JASA 2YEVA 3G4SV 3MHSC 1Q81W 4PA3A 2DQ3A 3OR6C 3R65A 3ABTA 2IJIA 4MVMA 4UVCA 4ASUG 1K34A 5DN6G 3ETEA 4QPKA 4PDRA 2XNDG 1MABG 3ZMVA 2R9RB 2HFEC 2QEXV 3KG2A 1G4YB 1MOFA 5L3BA 3B8NA 3OUSA 3CCVV 3ML0A 2IU0A 1NH2D 3AG3B 1ENVA 2XAHA 1F23A 3ZMUA 1W0KG 1RM1B 1K5QA 1PNKA 4JTCB 4BAYA 2WLIB 1MG1A 1GM8A 3JD3A 4QIWF 5B1AC 2WLLB 2HKOA 4KFMA 4ZKIA 4MVQA 2ITDC 2IW5A 5GW7A 1XL4A 3ZIAG 3IGAC 2ZXWC 3VOUA 1W0JG 1K8AW 1OCOC 4MVUA 3X2QB 1NQTA 3ABLB 4MVZA 4JTDB 1R3KC 2HVKC 3ASNC 3CCRV 1OCZC 2AHYA 2QKSA 4KUMA 1THZA 1YJ9V 3G71V 2ATKC 2X0LA 1YI2V 1F51A 1PNMA 2ZDIC 2ZR3A 2V1DA 1YJWV 1B6QA 1CPYA 3WFVA 2HVJC 4R8CA 5L3GA 4F4LA 3AG2C 5EBMC 2WWWA 5H6QA 1V55B 1GTOA 3E8HA 3CP1A 1PD3A 4XDJA 1M57B 3QO8A 3SPIA 3MD0A 4R7CA 1JJ2U 1S5HC 2EIMB 2WLJA 4WFEA 2W6JG 1GM7A 4TSFG 1VQLV 3QO5A 1AI6A 3CXCU 5CA3A 2EZPA 3I55V 1AR1B 5B1NA 1K4DC 2CK3G 3FB5C 4OXSA 5KA6A 4Q20A 1K4CC 3SPHA 1E1RG 4U7OA 2H8PC 3T1CA 1G8MA 3E8GA 1DLBA 1RPOA 3K03A 3X2QC 1BHAA 3ABLC 1K5SA 4XDKA 5E1AC 5L3CA 3ZMZA 5B1OA 2JEXA 5C93A 1F4NA 1M1KW 4FMTA 3WG7C 4X88A 5HFMA 4N21A 4QPJA 2WSSG 2K1EA 4UVBA 3FKSG 2C2AA 3TCUA 5KUKA 2DW4A 4GX0A 1V55C 1SZTA 3OMAB 1K92A 4MTXA 2JK5C 3CCEV 1VQPV 2EBOA 4MTFA 4RUFA 1QLNA 1DTOA 2ZR2A 1GM9A 4LBEC 4GCZA 1ORQC 3SPCA 2EILC 2EIJB 2P6JA 1KKDA 1DF4A 5CMUA 1AI4A 4XBFA 1VQ9V 4G2KA 3LDDA 1R3IC 3M99B 3FYIB 1EBOA 3OEHG 3VBBA 3RVYA 1W2BU 1QR8A 3E8FA 3LNMB 4GX5A 3OMIB 3CMEV 1H2GA 2GSMB 1S77D 1NR7A 2EINC 2Q69A 3P32A 1YHQV 3LSSA 1GKFA 4MS2A 1SESA 5B1AB 3K06A 2V7QG 4CZZA 1RPRA 1QBZA 2DYRC 1FXHA 4G27B 3JD2A 3W7XA 2PI5A 2HJFC 1VQ6V 1VQ4V 2X6BA 3OAAG 4U7NA 1K7DA 4UXNA 2XAQA 3BY6A 3LDEA 2P90A 5HFLA 3AG1B 2JJ2G 2BOCC 4GX1A 4KP4A 5KA5A 2X6AA 2HLDG 2EIJC 1FXKA 1I5XA 3AG2B 1Q82W 3FB7C 3K0GA 3CC4V 5IYBO 3SJQC 3ZN0A 2BOBC 3FB8C 1UJWB 5LHGA 4MW3A 1H38A 4FIPC 3OFNG 4BW5A 5CBFA 1EZJA 2EZOA 3F7VC 4BIUA 4DO2A 1SETA 3RBZA 5H9CA 3ZRSA 1VQOV 4LCUC 5CBGA 4P9PA 2YEVB 2A0LA 3JCZA 5DM6V 3E89A 1AJQA 4YXWG 2A79B 4J9ZB 4Z1MG 1YIJV 3ZRWA 1M56C 1GO3F 2DWEC 1S0VA 3F5WC 3HB3B 4PA4A 2DQ0A 1VQMV 3CCLV 3CCUV 4MVSA 5IYDO 3DGEA 3AG1C 4L87A 3AEIA 1E79G 2A9HA 3T4ZA 3WG7B 1S76D 3PJSK 3OW2U 3UKMA 1AJNA 3E35A 4XDLA 1VQ5V 4WFAV 3ASOC 4LC1A 3F7YC 4BIZA 2FTKA 3ZN1A 4HZ3A 5CBHA 4WFFA 1LNQA 2IJJA 3SYOA 1AI5A 2OT5A 2Z5UA 3UM7A 4RQEA 5EC1C 2ITCC 4CBCA 3D36A 3EFFK 4WFBV 4WFHA 3DTUB 2EILB 4X8AA 1QVFU 1J95A 4HAMA 5EBLC 4E2LA 3CCQV 2IU3A 2EJRA 4MTGA 2IH1C 3JYCA 1KECA 2X7RB 4UV8A 1JQ0A 2R9IA 4FPPA 1I5YA 2B1IA 2P7TC 1KC8W 5IDJA 1Q86W 5EBWC 2EINB 1M90W 5L3DA 2D3OW 3OUFA 3OM3B 4PDVA 1H8HG 1K33A 1QVGU 1KD1W 2Q67A 1OZ0A 2DYRB 5H6RA 4P9OA 1K73W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW U;  3CCL V;  3CME V;  4WFB V;  1VQL V;  1R73 A;  3CXC U;  3CCU V;  2QEX V;  1YHQ V;  1YJ9 V;  3G71 V;  1QVF U;  1Q82 W;  1VQ7 V;  3CCJ V;  3I55 V;  3CCQ V;  3CCE V;  3CC7 V;  1YI2 V;  1YIT V;  1VQP V;  3CCV V;  1VQ8 V;  3CC4 V;  1YJN V;  3CC2 V;  3G6E V;  3CCM V;  3I56 V;  1N8R W;  1YJW V;  1VQN V;  1VQ6 V;  2OTL V;  1VQO V;  1VQ4 V;  1Q7Y W;  1NJI W;  3OW2 U;  1KC8 W;  1VQ5 V;  4WFA V;  1Q86 W;  1VQ9 V;  1VQK V;  5DM6 V;  1M90 W;  3G4S V;  4WCE V;  2D3O W;  1YIJ V;  1Q81 W;  2OTJ V;  1QVG U;  4WF9 V;  1M1K W;  1KD1 W;  3CD6 V;  3CCS V;  2QA4 V;  1K9M W;  3CMA V;  1W2B U;  1K8A W;  1JJ2 U;  1S72 V;  3CCR V;  1K73 W;  1KQS U;  1VQM V; 
#chains in the Genus database with same CATH topology
 2UXX A;  4FM2 A;  4GKK O;  3H01 A;  1CEZ A;  3ABK C;  3OGC C;  1KUQ A;  5EZY A;  2XAJ A;  2NNU A;  4PA9 A;  5L3F A;  2CTR A;  1PP9 H;  3W7T A;  4UVA A;  2E74 B;  3A0R A;  3STZ C;  5KHK A;  2KSD A;  2N05 A;  2M7W A;  3SYA A;  1R6T A;  1EZV H;  2XAF A;  2F66 C;  5LHH A;  2IJH A;  4LNU A;  2YXL A;  3CC7 V;  2ARH A;  1K3E A;  4MT8 A;  4R6Z A;  4J9Y B;  3ZED A;  2FYU H;  1QLE C;  5JJN B;  4YJ3 A;  4TQF A;  1FFX A;  4FM1 A;  4OGQ B;  5IJ0 B;  1IUR A;  3K9A A;  3CRM A;  4RQF A;  5LL6 Y;  2QE7 G;  3EXA A;  5JH7 B;  3ASO B;  2ETN A;  1SKV A;  1Q6U A;  3L73 H;  2OCC C;  5TIS Z;  2JVD A;  4UCT A;  5D5Q A;  3ZMS A;  3LUT B;  1JOY A;  2WLL A;  3E86 A;  2R72 A;  4LFB O;  3T1H O;  2LQT A;  2Y69 C;  4YHH B;  3DXR B;  2Q0O C;  1M9N A;  2RMK B;  1FXK B;  5B1B C;  3DSQ A;  2JIZ G;  3JD0 A;  1M4U A;  4PDM A;  2HR3 A;  1JCH A;  2QR4 A;  3CCM V;  3TET A;  1QNM A;  3M8A A;  4R50 A;  5H5N A;  1OCC C;  4X89 A;  2WLK A;  4BW9 A;  3G80 A;  2RCV A;  2DYS C;  3ABK B;  1NTZ H;  3ABU A;  4EFE A;  1JX9 A;  2ZIN A;  4IHJ B;  5LYJ B;  4MVO A;  4YJ2 A;  2CAZ C;  5BMV A;  5IY5 B;  2XOK G;  1BE3 H;  2Y48 A;  1PL4 A;  3ABM C;  4IGG A;  3JAT A;  3JSL A;  4LF9 B;  3L9D A;  4JYY A;  3SR2 C;  1QR9 A;  3HKD B;  2DE0 X;  1B3Q A;  2KB1 A;  1RSO A;  1QHT A;  2ZE7 A;  2Y4T A;  3SDL A;  1OCR B;  4RO2 A;  2NR5 A;  5LHI A;  2P4V A;  4H33 A;  1XQ8 A;  3K5M A;  5IJ9 B;  3JAK B;  2A3Q A;  4AQY B;  2N74 A;  4QGP A;  1QLE B;  3MAQ A;  1S5L Z;  4GYC B;  4UV9 A;  5ITZ A;  2UXD B;  1R3L C;  2ZD9 A;  1CXZ B;  4X1Y B;  1HDJ A;  1KBH A;  4YHH O;  3ZHU A;  3CRQ A;  4PA7 A;  2XUM A;  1GN2 A;  2OCC B;  5LOV B;  3RYF B;  3K9S A;  3QTC A;  3S3X A;  1YTF D;  3W7U A;  4JI8 B;  1BGY H;  4DV0 B;  4LP8 A;  4RUE A;  3D36 C;  2PGG A;  1NR1 A;  2P22 C;  3SYP A;  3JAL B;  4TT3 G;  2WA3 A;  4KHP B;  3GVM A;  2GHY A;  3VQX A;  1AB3 A;  5J2T B;  2BE3 A;  3LSQ A;  1VEW A;  1SZX A;  4DW0 A;  4LF9 O;  4CH3 A;  2WLN A;  2YIB A;  3I56 V;  3SPJ A;  2DYS B;  2ZXW B;  4QNH B;  1GRJ A;  1P49 A;  4JGS A;  3ASN B;  2YI8 A;  2XTA A;  2YEV A;  3G4S V;  1Q81 W;  3OR6 C;  4X1I A;  4MVM A;  3ABT A;  4ASU G;  1K34 A;  4QPK A;  4PDR A;  5KHG A;  2XND G;  4AQY O;  3SGI A;  1MAB G;  1SQX H;  2R9R B;  3KG2 A;  2UXD O;  1AVM A;  2ADP A;  5L3B A;  3FX7 A;  2IU0 A;  2ODM A;  4JTC B;  2WLI B;  1GM8 A;  1VP7 A;  4QIW F;  4K8X A;  2KG7 A;  5B1A C;  4H44 B;  4MVQ A;  1RP3 B;  2IW5 A;  5GW7 A;  1XL4 A;  5F2V O;  2HP8 A;  3PN1 A;  2CTQ A;  1K8A W;  1XNQ B;  3JAS A;  1OCO C;  1WAZ A;  3X2Q B;  5LA6 A;  2GBO A;  2QKS A;  1THZ A;  3G71 V;  2X0L A;  1YI2 V;  4JI8 O;  3IC9 A;  2V1D A;  1YDX A;  1YJW V;  2JGD B;  3J80 N;  2O57 A;  1WP8 A;  1GTO A;  2F1M A;  2AXT Z;  4KHP O;  4XDJ A;  3QO8 A;  3SPI A;  3K58 A;  1FPO A;  1S5H C;  1FAF A;  3TGU H;  1VQL V;  2EX3 A;  1N33 B;  2EZP A;  3BA9 A;  4DK1 A;  3JAM N;  3FB5 C;  1GAX A;  5KA6 A;  4U7O A;  3T1C A;  1G8M A;  1DLB A;  4TV8 A;  1K5S A;  2CTP A;  4LFA O;  2ZE5 A;  3RYI A;  5B1O A;  2JEX A;  3WG7 C;  2MW2 B;  4K8Z A;  4N21 A;  2WSS G;  4CC6 A;  2DW4 A;  3KZI Z;  1V55 C;  5LXT B;  4MTF A;  5LP6 C;  1QLN A;  4FLT A;  3O9O A;  1OJH A;  4LBE C;  4DR6 B;  1ORQ C;  4TUY B;  3WU2 Z;  1AI4 A;  1XOU A;  4G2K A;  3FYI B;  3BCC H;  1XNQ O;  1XMO B;  2OYQ A;  2F95 B;  4NXN B;  3CME V;  1NZ6 A;  1NR7 A;  3WB2 A;  5B1A B;  3OD4 A;  3JD2 A;  3J7A U;  1Y76 B;  2BTQ A;  3OAA G;  2D2C B;  4KXR A;  1K7D A;  4UXN A;  2E76 B;  2JGU A;  5FPR A;  2JJ2 G;  3FAV B;  2PYJ A;  2BOC C;  2Q8V A;  3F5T A;  2VWK A;  4GX1 A;  2QM4 A;  5KA5 A;  1N33 O;  2RN9 A;  2CGO A;  1I5X A;  4LF4 B;  3APQ A;  3CC4 V;  4X20 B;  3FB8 C;  4PD4 F;  2LJ2 A;  1HNZ B;  1ZX3 A;  1SQF A;  4DO2 A;  5LMN B;  2YS8 A;  1JFF B;  4P9P A;  4LWS B;  1AJQ A;  4IYH A;  4YXW G;  4FLU A;  5JQG A;  3ZRW A;  1M56 C;  1KYO F;  3F5W C;  4FFK A;  5EYP A;  2DQ0 A;  2Q73 A;  3CCU V;  3K5L A;  3AG1 C;  4B7K A;  4J7Z A;  4O4H A;  4DR6 O;  2KKW A;  3WG7 B;  4DRX A;  1S76 D;  2VQE B;  5GON B;  3BRC A;  3OW2 U;  1T5E A;  5JVD A;  3F7Y C;  1XMO O;  4BIZ A;  3K5O A;  4NXN O;  4PJ0 Z;  2F93 B;  3MDS A;  5LP6 B;  2IJJ A;  2WA4 A;  2OT5 A;  3UM7 A;  4ZI7 A;  3JAW B;  1TAE A;  3EVK A;  4CBC A;  1IBK B;  5FPO A;  1LUV A;  2RNB A;  2Q4P A;  1BSM A;  4FLW A;  5J2U A;  3JYC A;  1KEC A;  1JQ0 A;  3J81 N;  2OWO A;  4X9Q A;  1Y74 A;  2GUZ B;  5FLX N;  4O2A A;  4U3F H;  1H8H G;  4UB6 Z;  2Q67 A;  3KKY A;  4P9O A;  1MSW D;  4LF4 O;  1F7Y A;  4DV1 B;  1N34 B;  2BTO A;  3N2K B;  5IYZ B;  5CA1 B;  1U97 A;  5LMN O;  2ZKO A;  1GK9 A;  5C8Y B;  4OPA A;  1Y67 A;  1H8E G;  1YVW A;  3L70 H;  4ZBM A;  3OR7 C;  4DW1 A;  3CMA V;  3OEE G;  2ZCE A;  1S72 V;  5IYC O;  1WB8 A;  3HKE B;  3CCJ V;  2DOS A;  2Q0A A;  2VQE O;  1M56 B;  4FFB B;  3MHH C;  1WPX A;  1I7F A;  2ZE8 A;  3VQY A;  3W7W A;  1EM1 A;  4J10 A;  1MSD A;  1NH2 B;  1XNR B;  1XDC A;  1IBK O;  5BY1 A;  1AR5 A;  2NN4 A;  4PEL A;  1Y6X A;  1VQ8 V;  4PDL A;  3HKB A;  2H94 A;  4JYC A;  5EIB D;  2WLH A;  1IVS A;  2W0X A;  2QA4 V;  3THO A;  1N36 B;  1E1Q G;  1H2M A;  2Z3Y A;  5JJE B;  4DV1 O;  1K97 A;  2Q68 A;  3CE2 A;  1EN6 A;  3E83 A;  1N34 O;  1R6N A;  1IXM A;  3IFX A;  2QWR B;  3A0B Z;  1SQG A;  1FJG B;  5KAI Z;  3SYQ A;  1SC5 B;  4B3T B;  1DF5 A;  4WF9 V;  1JA8 A;  1F4M A;  4WFG A;  4OPH A;  2QM8 A;  1BS3 A;  3CPW U;  3HKC B;  4CH6 A;  4DXW A;  1SA0 A;  3AG7 A;  1ZTE A;  4TV9 B;  4LF8 B;  3RVZ A;  5KUM A;  5DED A;  1FXK C;  3CJH A;  1BMF G;  1WA8 B;  3U10 A;  4X64 B;  1Y66 A;  1EN4 A;  3ZCC A;  1WP7 A;  4GX2 A;  1XNR O;  3AG3 C;  2Q5Z A;  4TWK A;  3CD6 V;  1YTF B;  3DC6 A;  3GWK C;  1FXV A;  3GB7 C;  1L0L H;  4O4I B;  3QNE A;  2ZQM A;  1AIL A;  1ROP A;  1VIB A;  5LGU A;  3ZHV A;  3LDC A;  4GZR B;  5LGT A;  2L35 A;  3BVO A;  2UUB B;  3HPL C;  5IY5 C;  2LW7 A;  2W6I G;  1SRY A;  4RAI A;  1N36 O;  2Y0I A;  4GLX A;  3QO7 A;  5IT9 N;  5B3S B;  1Z5V A;  2JDI G;  2Z0A A;  1OCR C;  2XAS A;  1XBL A;  2UU9 B;  2PUS A;  5EZY B;  3E22 A;  4DV5 B;  2EIM C;  3KCY A;  4E4E A;  1FJG O;  3GWO A;  2CE4 A;  1L1F A;  4JI4 B;  4B3T O;  2YSU B;  2PI4 A;  2JEU A;  3QVN A;  2RDC A;  2ZIM A;  3RT3 C;  3CCS V;  2BCC H;  2X6C A;  4LNU B;  2UXN A;  3NXS A;  2E75 B;  4LF8 O;  3U11 A;  4I7Z B;  3RYH A;  5KMG A;  2WAM A;  5LGN A;  3L75 H;  3K04 A;  4X64 O;  4JAS A;  4YJ3 B;  1B04 A;  1FFX B;  2EUL A;  3A0H Z;  3MHS C;  4K0K B;  4PV1 B;  1IZ3 A;  2HFE C;  2QEX V;  1UFI A;  3CCV V;  1XRE A;  3TJT A;  1NH2 D;  4GUN A;  3AG3 B;  2UUB O;  2XAH A;  1F23 A;  3ZMU A;  4BAY A;  5FNV A;  3JD3 A;  2ZIO A;  2WLL B;  2ITD C;  3ZIA G;  2ZXW C;  3VOU A;  1N0J A;  1HR0 B;  4FVM A;  4MVZ A;  1R3K C;  3ASN C;  4ZOL A;  4FLY A;  4KUM A;  2UU9 O;  1YJ9 V;  2LGQ A;  4DV5 O;  1F51 A;  4FM0 A;  4I50 A;  2ZR3 A;  4JI4 O;  3P3N A;  3OTO B;  2HVJ C;  4DR4 B;  5L3G A;  4F4L A;  3AG2 C;  5EBM C;  3T1Y B;  3E8H A;  3CP1 A;  3CRC A;  4DR7 B;  4NXM B;  2UXB O;  4HBN A;  3MD0 A;  4NB5 A;  4I9Q A;  2EIM B;  3RWR D;  2W6J G;  1GM7 A;  1BT8 A;  3QO5 A;  3CXC U;  4YJ2 B;  5BMV B;  5CA3 A;  1ZAU A;  1HNW B;  2CK3 G;  1K4C C;  1E1R G;  2H8P C;  3JAT B;  1Q5O A;  1SQP H;  2QWO B;  3X2Q C;  1BHA A;  4JZ2 A;  2BSK A;  4K0K O;  1RSO B;  3ZBH A;  5C93 A;  1F4N A;  4FMT A;  1GN3 A;  4QPJ A;  3TCU A;  4Q6G A;  1SZT A;  3OMA B;  4MTX A;  1B06 A;  2EBO A;  5ITZ B;  3G6B A;  2OIG A;  4RUF A;  1IDS A;  1DTO A;  2ZR2 A;  3SPC A;  3CSX A;  4X1K A;  5CMU A;  1GN4 A;  3LDD A;  1HR0 O;  2PYL A;  3UO3 A;  1EBO A;  3OEH G;  1QR8 A;  1Q3E A;  1J5E B;  3LNM B;  4JI7 B;  3OMI B;  4FLZ A;  4B3R B;  2EIN C;  4MS2 A;  1SES A;  3AK3 A;  1RPR A;  3OTO O;  2DYR C;  4UCU A;  4G27 B;  2PI5 A;  2HJF C;  4DR4 O;  1VQ6 V;  3T1Y O;  3O65 A;  1HNX O;  4ZHQ A;  4U7N A;  4DR7 O;  4NXM O;  4LFA B;  1GH6 A;  4UCV A;  1FYJ A;  3DC5 A;  1IXB A;  3H9V A;  1HNW O;  3AG2 B;  3M7M X;  1TVK A;  2HHH B;  5IYB O;  4O2B A;  3SJQ C;  1UJW B;  2KQX A;  1EZJ A;  2EZO A;  4BIU A;  4LF5 B;  5EIB C;  4JI3 B;  1XMQ B;  4W4K A;  2YEV B;  2A0L A;  3JCZ A;  4J7K A;  5DM6 V;  3APO A;  4Z1M G;  4J9Z B;  2DWE C;  4X1I B;  4B3M B;  3ETQ A;  1JJO A;  3HB3 B;  1MZE A;  4PA4 A;  1SS3 A;  5BXZ A;  4JI5 B;  4B08 A;  3AEI A;  4CS4 A;  1BZK A;  3T4Z A;  1KMI Z;  1QQC A;  3H1J H;  3UKM A;  2KG7 B;  3H1H H;  4FZ1 A;  1PM9 A;  1J5E O;  1MZF A;  4DUY B;  4JI7 O;  1AI5 A;  1FD9 A;  3JAS B;  4B3R O;  5EC1 C;  5LA6 B;  3D36 A;  4X8A A;  5EBL C;  5D5P A;  2QKA A;  3CCQ V;  3BPZ A;  4MTG A;  4UCR A;  1VF6 C;  2R9I A;  4JI2 B;  2P4K A;  2QWQ B;  4PHZ A;  1KC8 W;  5IDJ A;  3L71 H;  2LW1 A;  2EIN B;  4NTX A;  2D3O W;  3OUF A;  2AW9 A;  3CRR A;  1OZ0 A;  2DYR B;  4HNA A;  2YXH A;  1JMK C;  2QSA A;  2HHH O;  4AIL C;  4DR2 B;  4FJC C;  2CDY A;  3OTF A;  3ETD A;  2Q7E A;  4YY3 B;  4HYO A;  4LF5 O;  1KB9 F;  4TV8 B;  4JI3 O;  1XMQ O;  2FL4 A;  3RYI B;  5B5E Z;  4WCE V;  4B3M O;  1GMG A;  4DYL A;  1IBM B;  4EB6 A;  4QE7 A;  4IT5 A;  3ZHT A;  1XEQ A;  5LBQ A;  4JI5 O;  3N2G A;  1N8R W;  5LMU B;  3D3I A;  1CP9 A;  3K57 A;  1BQ0 A;  4K35 A;  2EJ7 A;  4I4T A;  2Q7G A;  4EEQ A;  4DUY O;  3JD4 A;  5B66 Z;  3E2E A;  1NVP D;  2FML A;  2WPD G;  1YF2 A;  3RFR A;  1I0H A;  4P30 A;  3B77 A;  4JI2 O;  2GDS A;  2XT9 A;  3VQW A;  2BTQ B;  4JI6 B;  3S3W A;  3ZMT A;  2P5O A;  4DV4 B;  4U3J A;  3CHX A;  4QJF B;  1HWY A;  1R6K A;  1KP2 A;  2Y4U A;  1K9M W;  3HR0 A;  3SJA C;  4DR2 O;  1KQS U;  1PKX A;  3P30 A;  4FK5 C;  1TUB A;  4X65 B;  1HW7 A;  4YY3 O;  1TUE B;  2PF4 E;  1LUW A;  1P7B A;  2IH3 C;  3ZHQ A;  3CS5 A;  3STL C;  4DR1 B;  4IL6 Z;  2VWJ A;  2M6Y A;  1TA8 A;  1XHZ A;  1Z2G A;  3UT5 A;  3RYC A;  4MW8 A;  1IBM O;  5JQG B;  3ZRW B;  1WLE A;  2YIB D;  1N4C A;  1IX9 A;  2LO1 A;  3W7S A;  5EYP B;  4Z2W A;  1OHH G;  4B7E A;  1TGO A;  1JVM A;  1N32 B;  2YC0 A;  5LMU O;  5BZB A;  4EKW A;  4O4H B;  3Q4H A;  3KCX A;  2F4V B;  4DRX B;  2QTO A;  1JR9 A;  4O4L A;  3K0D A;  1SER A;  2LFR A;  4WBN A;  2Q6A A;  3B40 A;  5JVD B;  4PI2 A;  4ZI7 B;  2QM7 A;  5CA0 A;  5FL7 G;  4RWU A;  5J2U B;  4P2Z A;  1YSC A;  4NYK A;  4JI6 O;  4PA6 A;  1SQQ H;  4ZIB A;  4DV4 O;  4I0X A;  1Y74 B;  5CB4 A;  4DR3 B;  3BEH A;  4GKJ O;  4O2A B;  4UFZ A;  4UB8 Z;  4JTA B;  2AZ2 A;  3NR7 A;  1M5I A;  2YID A;  1BL8 A;  1P84 F;  4F6R A;  2NLJ C;  5IE9 A;  4X65 O;  1XL6 A;  1AJP A;  1NKD A;  2EIK B;  1R73 A;  2JS5 A;  4CH4 A;  4DR1 O;  4L8J A;  3ZJZ A;  4H13 B;  4I5S A;  1ZWI C;  1QCE A;  1M93 A;  1G6U A;  4AHC A;  4IIJ A;  1FS0 G;  3SYC A;  2UXC B;  4O4J A;  1MNG A;  2ZDI A;  2HJD A;  4X66 B;  1NU1 H;  2LFS A;  2B1G A;  3IAY A;  3CYO A;  4MSW C;  1N32 O;  4JPR A;  3U0Z A;  1VQ7 V;  4LF6 B;  4UUJ C;  2CGN A;  2F4V O;  2HEP A;  2CH7 A;  1ZSP A;  2WLM A;  5JCO C;  3G6E V;  2IJK A;  3ETG A;  5B3S C;  4JV5 B;  1OCZ B;  2LGW A;  3R65 A;  2IJI A;  4J42 A;  3BFR A;  2AZ0 A;  3ETE A;  3ZMV A;  3FFQ A;  3B8N A;  3OUS A;  1ZUQ A;  3ML0 A;  1ZLZ A;  1ZL8 A;  5KX5 A;  3HKB B;  1VF5 B;  3ZX6 A;  1W0K G;  4DR3 O;  1PNK A;  5JJJ B;  5KHH A;  4UCS A;  2YIC A;  3IGA C;  2ZNI A;  4TOI A;  4MVU A;  1NQT A;  1MA1 A;  3ABL B;  5GTH Z;  2AHY A;  4DV2 B;  2FKX A;  1PNM A;  2CUG A;  3D3Q A;  1B6Q A;  4R8C A;  4B3S B;  2WWW A;  2UXC O;  5A9G A;  1BCC H;  1SQV H;  3JAR A;  4X66 O;  3K5N A;  3C3T A;  4NVP A;  4YIO A;  1S5J A;  3ZS8 C;  4TSF G;  4LF6 O;  1AI6 A;  1SA0 B;  3I55 V;  3VQV A;  1K4D C;  4OXS A;  4Q20 A;  3SPH A;  3E8G A;  4CH5 A;  4JV5 O;  1WN7 A;  3K03 A;  3CJH B;  2IBZ H;  5L3C A;  4OX9 O;  1US6 A;  2R70 A;  2H3O A;  4X88 A;  3ZHR A;  4BWA A;  4LH6 A;  1HP8 A;  1U96 A;  1YZB A;  4LH7 A;  2JK5 C;  1VAR A;  3CCE V;  1VQP V;  1O9H A;  1QU7 A;  4GCZ A;  2EIL C;  2EIJ B;  2ZE6 A;  1KKD A;  4XBF A;  1VQ9 V;  3R66 A;  3BAB A;  3M99 B;  3B09 A;  5IJ0 A;  3BAA A;  3VBB A;  3RVY A;  3D8C A;  3E8F A;  2UXB B;  4DV2 O;  1H2G A;  2GSM B;  4LFC B;  2Q69 A;  3LSS A;  1GKF A;  5JH7 A;  1NTM H;  2RJZ A;  3K06 A;  2GV9 A;  3E22 B;  2P06 A;  1FXH A;  3W7X A;  1X4T A;  4B3S O;  1VQ4 V;  1Q8I A;  4JAA A;  4NTY A;  2XAQ A;  2P90 A;  4FLX A;  2UUC B;  3DXR A;  4KP4 A;  2X6A A;  3SJB C;  1FXK A;  4J80 A;  4NKG B;  3FB7 C;  3CX5 F;  4MW3 A;  2YDE A;  3RYH B;  5KMG B;  3F7V C;  1VQO V;  2UUA B;  1SET A;  3ZRS A;  5CBG A;  2E5L B;  1XHX A;  3E89 A;  3N27 A;  2Q7H A;  1YIJ V;  3C3S A;  3LNN A;  2CTW A;  2A06 H;  4IHJ A;  1VQM V;  3TXS A;  3BHP A;  4EFB A;  5LYJ A;  5IYD O;  1KU9 A;  4JYA B;  2A9H A;  3JSN A;  5FNV B;  1PV0 A;  2ADQ B;  3HKD A;  1DK1 A;  4XDL A;  1VQ5 V;  4WFA V;  3A8T A;  4LC1 A;  1R1B A;  1O9G A;  2FTK A;  1HNX B;  3WB1 A;  4HZ3 A;  1LNQ A;  3RGB A;  1RFY A;  4LFC O;  5IJ9 A;  4J41 A;  3EFF K;  4WFB V;  3JAK A;  4ZOL B;  3DTU B;  3QF7 A;  4ABM A;  2EIL B;  1QVF U;  1J95 A;  4E2L A;  2IU3 A;  2EJR A;  4C7U A;  4I50 B;  4UV8 A;  4FPP A;  1I5Y A;  2B1I A;  4X1Y A;  2VS0 A;  5L3D A;  2UUC O;  3OM3 B;  1QVG U;  4D7S A;  5H6R A;  1I94 B;  5A2Q N;  5LOV A;  3RYF A;  3CXH F;  2AHZ A;  4DUZ B;  1BQZ A;  4CS3 A;  4LF7 B;  1SF9 A;  3CC2 V;  2UUA O;  1LR1 A;  1KP3 A;  1NVP B;  3RW0 A;  3TK1 A;  1Q7Y W;  2E5L O;  3G67 A;  2BSK B;  3E8B A;  4N23 A;  1PL0 A;  3JAL A;  2LP7 A;  4PI0 A;  2OIE A;  1VMG A;  4JAU A;  1Q43 A;  1PNL A;  3OMN B;  2GTA A;  2RQ6 A;  3OE7 G;  2XHB A;  5EK0 A;  5J2T A;  2YI9 A;  1I08 A;  4GT1 A;  4DR5 B;  3L72 H;  4JYA O;  4QE9 A;  4AI8 A;  1R3J C;  2Y69 B;  1VQN V;  4X1K B;  1L8D A;  3CB2 A;  5B1B B;  4FLV A;  1ARO P;  2MK3 A;  2QKC A;  1COW G;  3AG4 C;  2PZS A;  1OCC B;  4MVR A;  1YIT V;  3CRA A;  5BR8 B;  1L0N H;  1GN6 A;  2JRI A;  3B2E E;  2WLI A;  3K08 A;  4ZHQ B;  1G1X B;  1VQK V;  1Q6H A;  1I94 O;  3ABM B;  3ZRX A;  2W0F C;  1V54 C;  4YIP A;  4DUZ O;  4LF7 O;  1TVK B;  1S3J A;  1P7G A;  3T4D A;  4O2B B;  3UQ8 A;  2DWD C;  1IBL B;  2PY5 A;  3B4S A;  1Y4M A;  3IJ4 A;  4NR1 A;  2JGD A;  3AK1 A;  3SPG A;  1NJI W;  4JI0 B;  2YXY A;  4JI1 B;  3FB6 C;  1FFT B;  3H1L H;  3BA8 A;  4BR6 A;  1BHB A;  1FKA O;  5H2F Z;  1XI1 A;  3ICX A;  4DR5 O;  1JPX A;  4JAV A;  1NT2 B;  1URF A;  2QJ1 A;  1Z5W A;  5K1P A;  4DV0 O;  1YXB A;  2DMX A;  2OTL V;  1N0N A;  4LR3 A;  2V4D A;  2PTM A;  1WJZ A;  3K79 A;  3I5D A;  1NBM G;  2ZT9 B;  1D2D A;  5EC2 C;  4D6T H;  1RM1 C;  1YEW A;  2IM9 A;  2N04 A;  4JF3 A;  4H0L B;  5LXT A;  2B9Z A;  5BR8 O;  3EHB B;  2YIA A;  4DV7 B;  1MMM A;  1YJN V;  1NI8 A;  2F43 G;  2DN9 A;  3AG4 B;  3B8M A;  4TUY A;  2VQF B;  3JCU Z;  1AR4 A;  4I55 A;  3H1K H;  5CN0 A;  2K9P A;  4HNA B;  4JYB A;  3CWB H;  1AI7 A;  4NTW A;  5JWP A;  3T2M A;  4W4L A;  4DV6 B;  2ZNJ A;  2JJ1 G;  4MTO A;  1M57 C;  3UCS C;  1IBL O;  1AP5 A;  4G28 B;  2DJV A;  5L3E A;  4TQD A;  4K3A A;  4JI0 O;  1Y76 A;  1P4R A;  3K3W A;  3AK2 A;  4JI1 O;  1A32 A;  3FD9 A;  5J9P C;  1V54 B;  4I55 B;  4H37 A;  2XAG A;  3FYE B;  1EFR G;  1PPJ H;  4D7T A;  2OTJ V;  3FAV A;  3C90 A;  2P67 A;  3JD1 A;  4EB6 B;  4BIO A;  4ICG A;  1W59 A;  1YCI A;  2HG5 C;  3N2G B;  3ZRV A;  4X20 A;  2ILM A;  5GTI Z;  2L6L A;  1OCO B;  2EIK C;  4I4T B;  2B5U A;  4I9W A;  3IC7 A;  1JFF A;  4LWS A;  4PA3 A;  2DQ3 A;  4GKJ B;  4UVC A;  1VF6 A;  5DN6 G;  4DV7 O;  1G4Y B;  3OGI B;  1H2S B;  1MOF A;  3UO2 A;  1ENV A;  2VQF O;  1RM1 B;  1K5Q A;  1MG1 A;  5GON A;  4U3J B;  1AP6 A;  2HKO A;  4KFM A;  4ZKI A;  1NTK H;  4FZ0 A;  5LP6 A;  1W0J G;  4DV6 O;  5DEC A;  3CCR V;  3JAW A;  4JTD B;  2HVK C;  1TUB B;  1OCZ C;  2AGA A;  5KHI A;  2ATK C;  1H2K A;  5K1X A;  1D5A A;  2ZDI C;  1Q6I A;  5E79 Z;  3SJC C;  1Q90 D;  3ZHS A;  1CPY A;  3WFV A;  5H6Q A;  1V55 B;  2GUZ A;  3UT5 B;  1PD3 A;  3QG5 A;  3RYC B;  2JS3 A;  1M57 B;  2OCH A;  4R7C A;  1JJ2 U;  2WLJ A;  4WFE A;  1AR1 B;  3N2K A;  5B1N A;  2QDO A;  5IYZ A;  3Q4H B;  5CA1 A;  1RPO A;  5C8Y A;  4O4L B;  3ABL C;  4WBN B;  4XDK A;  5E1A C;  1WNS A;  3LSU A;  2GTS A;  5IWA B;  2ZM6 B;  3ZMZ A;  4CC5 A;  3K59 A;  1NS1 A;  1OV9 A;  1M1K W;  5HFM A;  1XIL A;  2K1E A;  4UVB A;  3FKS G;  2C2A A;  5CA0 B;  5KUK A;  5KLV H;  1WPB A;  4GX0 A;  1EN5 A;  1K92 A;  1HNZ O;  3TXQ A;  3HKE A;  1H2L A;  4FFB A;  1GM9 A;  4F6E A;  2R9A A;  4I0X B;  3RN4 A;  2P6J A;  5CB4 B;  1DF4 A;  1V9P A;  1R3I C;  4F6R B;  1W2B U;  4X62 B;  4DV3 B;  4GX5 A;  2FB5 A;  1S77 D;  3P32 A;  1YHQ V;  2E3C A;  2V7Q G;  4CZZ A;  1QBZ A;  1SQB H;  1DGS A;  2QTS A;  2X6B A;  4IIJ B;  3BY6 A;  3LDE A;  4O4J B;  5HFL A;  3AG1 B;  4OX9 B;  2QWN B;  2Y0P A;  2HLD G;  2EIJ C;  4J11 A;  3WB0 A;  1X59 A;  3CEI A;  2QGN A;  1Q82 W;  3K0G A;  4GKK B;  3ZN0 A;  2CH7 B;  2BOB C;  5LHG A;  4KL1 A;  1H38 A;  4FIP C;  4CS2 A;  2YUA A;  3OFN G;  1XUQ A;  4BW5 A;  5CBF A;  3RBZ A;  5H9C A;  5IWA O;  2ZM6 O;  2G38 A;  4Z1V A;  4LCU C;  3A2F A;  2A79 B;  3P3P A;  1WB7 A;  1GO3 F;  1S0V A;  4UCO A;  3CCL V;  4DK0 A;  4A5U B;  5KAF Z;  3HKC A;  2A7W A;  4MVS A;  4JZG A;  3H1I H;  3DGE A;  4L87 A;  4J7J A;  1ZL8 B;  5KX5 B;  4TV9 A;  1E79 G;  3PJS K;  1AJN A;  3E35 A;  1WA8 A;  3ASO C;  1D5N A;  4IYI A;  3L74 H;  2F23 A;  1UPG A;  3ZN1 A;  5CBH A;  4WFF A;  4X62 O;  4DV3 O;  3SYO A;  2Z5U A;  4RQE A;  2ITC C;  4WFH A;  4O4I A;  4HAM A;  2IH1 C;  2X7R B;  2Q9L A;  1KKC A;  2QWP B;  3OT7 A;  2P7T C;  5AG2 A;  1Q86 W;  5EBW C;  1VF7 A;  1M90 W;  5KHJ A;  4PDV A;  1K33 A;  3JAR B;  1KD1 W;  2VRZ A;  4LFB B;  5JCO A;  3T1H B;  1K73 W;  1H2N A; 
#chains in the Genus database with same CATH homology
 2UXX A;  1MSW D;  4FJC C;  3H01 A;  1CEZ A;  3ETD A;  2AHZ A;  3ABK C;  3OGC C;  4HYO A;  3CC2 V;  1KP3 A;  2XAJ A;  2NNU A;  1GK9 A;  4PA9 A;  5L3F A;  3RW0 A;  1NVP B;  3TK1 A;  1Q7Y W;  3E8B A;  4N23 A;  1PL0 A;  3W7T A;  4UVA A;  2LP7 A;  1H8E G;  4WCE V;  3A0R A;  4JAU A;  4ZBM A;  3STZ C;  1GMG A;  3OR7 C;  1PNL A;  3OMN B;  3OE7 G;  3CMA V;  3OEE G;  4QE7 A;  5EK0 A;  1S72 V;  2M7W A;  3SYA A;  4GT1 A;  2XAF A;  5LHH A;  5IYC O;  5LBQ A;  2IJH A;  3CCJ V;  3CC7 V;  4QE9 A;  1R3J C;  1K3E A;  4MT8 A;  1M56 B;  4R6Z A;  2Y69 B;  1N8R W;  3D3I A;  1VQN V;  1CP9 A;  3MHH C;  4J9Y B;  1WPX A;  5B1B B;  1QLE C;  1ARO P;  2MK3 A;  1COW G;  3JD4 A;  3E2E A;  3W7W A;  3AG4 C;  1NVP D;  1NH2 B;  3K9A A;  2WPD G;  1OCC B;  4RQF A;  2QE7 G;  4P30 A;  4PEL A;  4MVR A;  1VQ8 V;  3B77 A;  3ASO B;  1YIT V;  4PDL A;  2OCC C;  3ZMT A;  2H94 A;  2WLI A;  3K08 A;  4JYC A;  3ZMS A;  3LUT B;  4QJF B;  1VQK V;  1HWY A;  1R6K A;  2WLL A;  1KP2 A;  3E86 A;  1JOY A;  2WLH A;  2Y69 C;  2QA4 V;  3ABM B;  3ZRX A;  1K9M W;  1E1Q G;  2Z3Y A;  2W0F C;  1M9N A;  1V54 C;  1KQS U;  1PKX A;  1FXK B;  3P30 A;  1K97 A;  2Q68 A;  3E83 A;  4FK5 C;  5B1B C;  2JIZ G;  1R6N A;  1IXM A;  3IFX A;  1TUE B;  1S3J A;  3JD0 A;  3T4D A;  4PDM A;  2DWD C;  1P7B A;  2HR3 A;  1JCH A;  2IH3 C;  1Y4M A;  3STL C;  3TET A;  3CCM V;  4R50 A;  1OCC C;  4X89 A;  3SPG A;  1NJI W;  2WLK A;  3SYQ A;  3FB6 C;  1FFT B;  4MW8 A;  3ZRW B;  1BHB A;  1DF5 A;  2DYS C;  1WLE A;  3ABK B;  4WF9 V;  3ABU A;  1F4M A;  3W7S A;  1JX9 A;  4WFG A;  2QM8 A;  3CPW U;  1OHH G;  1JPX A;  4JAV A;  4MVO A;  4DXW A;  5IY5 B;  1JVM A;  2XOK G;  2Y48 A;  5BZB A;  4EKW A;  3ABM C;  2QTO A;  2OTL V;  3K0D A;  3RVZ A;  2LFR A;  5KUM A;  1FXK C;  1SER A;  1QR9 A;  1BMF G;  3K79 A;  2Q6A A;  1NBM G;  2KB1 A;  5EC2 C;  1Y66 A;  3ZCC A;  4GX2 A;  1OCR B;  4RO2 A;  3AG3 C;  4TWK A;  5LHI A;  3CD6 V;  1RM1 C;  4H33 A;  2QM7 A;  1YTF B;  4JF3 A;  1FXV A;  3GB7 C;  5FL7 G;  3QNE A;  2ZQM A;  1ROP A;  1QLE B;  3EHB B;  4P2Z A;  4UV9 A;  5LGU A;  1YSC A;  3LDC A;  1YJN V;  4PA6 A;  2F43 G;  5LGT A;  3AG4 B;  3B8M A;  1R3L C;  2ZD9 A;  3BEH A;  3HPL C;  5IY5 C;  2W6I G;  1SRY A;  4JTA B;  5CN0 A;  4RAI A;  1BL8 A;  3QO7 A;  4PA7 A;  4JYB A;  1AI7 A;  2OCC B;  5B3S B;  2NLJ C;  3T2M A;  2JDI G;  1XL6 A;  1AJP A;  1NKD A;  2EIK B;  1R73 A;  2JJ1 G;  4MTO A;  1M57 C;  1OCR C;  2XAS A;  4G28 B;  3ZJZ A;  4I5S A;  2EIM C;  1ZWI C;  1QCE A;  5L3E A;  1YTF D;  3GWO A;  3W7U A;  1L1F A;  4LP8 A;  4RUE A;  1P4R A;  3K3W A;  5J9P C;  1NR1 A;  2YSU B;  1V54 B;  3SYP A;  1FS0 G;  4H37 A;  2PI4 A;  2XAG A;  3SYC A;  3FYE B;  4TT3 G;  1EFR G;  2JEU A;  2OTJ V;  2GHY A;  3CCS V;  2P67 A;  3JD1 A;  2ZDI A;  2LFS A;  2B1G A;  3CYO A;  4MSW C;  2X6C A;  4JPR A;  1VQ7 V;  2HG5 C;  3LSQ A;  2UXN A;  4UUJ C;  3ZRV A;  3NXS A;  2WLM A;  3G6E V;  2WLN A;  2IJK A;  3I56 V;  3SPJ A;  2DYS B;  2ZXW B;  3ETG A;  5B3S C;  2WAM A;  5LGN A;  4QNH B;  1OCO B;  2EIK C;  3K04 A;  4JGS A;  2B5U A;  3ASN B;  4I9W A;  1OCZ B;  3IC7 A;  4JAS A;  2YEV A;  3G4S V;  3MHS C;  1Q81 W;  4PA3 A;  2DQ3 A;  3OR6 C;  3R65 A;  3ABT A;  2IJI A;  4MVM A;  4UVC A;  4ASU G;  1K34 A;  5DN6 G;  3ETE A;  4QPK A;  4PDR A;  2XND G;  1MAB G;  3ZMV A;  2R9R B;  2HFE C;  2QEX V;  3KG2 A;  1G4Y B;  1MOF A;  5L3B A;  3B8N A;  3OUS A;  3CCV V;  3ML0 A;  2IU0 A;  1NH2 D;  3AG3 B;  1ENV A;  2XAH A;  1F23 A;  3ZMU A;  1W0K G;  1RM1 B;  1K5Q A;  1PNK A;  4JTC B;  4BAY A;  2WLI B;  1MG1 A;  1GM8 A;  3JD3 A;  4QIW F;  5B1A C;  2WLL B;  2HKO A;  4KFM A;  4ZKI A;  4MVQ A;  2ITD C;  2IW5 A;  5GW7 A;  1XL4 A;  3ZIA G;  3IGA C;  2ZXW C;  3VOU A;  1W0J G;  1K8A W;  1OCO C;  4MVU A;  3X2Q B;  1NQT A;  3ABL B;  4MVZ A;  4JTD B;  1R3K C;  2HVK C;  3ASN C;  3CCR V;  1OCZ C;  2AHY A;  2QKS A;  4KUM A;  1THZ A;  1YJ9 V;  3G71 V;  2ATK C;  2X0L A;  1YI2 V;  1F51 A;  1PNM A;  2ZDI C;  2ZR3 A;  2V1D A;  1YJW V;  1B6Q A;  1CPY A;  3WFV A;  2HVJ C;  4R8C A;  5L3G A;  4F4L A;  3AG2 C;  5EBM C;  2WWW A;  5H6Q A;  1V55 B;  1GTO A;  3E8H A;  3CP1 A;  1PD3 A;  4XDJ A;  1M57 B;  3QO8 A;  3SPI A;  3MD0 A;  4R7C A;  1JJ2 U;  1S5H C;  2EIM B;  2WLJ A;  4WFE A;  2W6J G;  1GM7 A;  4TSF G;  1VQL V;  3QO5 A;  1AI6 A;  3CXC U;  5CA3 A;  2EZP A;  3I55 V;  1AR1 B;  5B1N A;  1K4D C;  2CK3 G;  3FB5 C;  4OXS A;  5KA6 A;  4Q20 A;  1K4C C;  3SPH A;  1E1R G;  4U7O A;  2H8P C;  3T1C A;  1G8M A;  3E8G A;  1DLB A;  1RPO A;  3K03 A;  3X2Q C;  1BHA A;  3ABL C;  1K5S A;  4XDK A;  5E1A C;  5L3C A;  3ZMZ A;  5B1O A;  2JEX A;  5C93 A;  1F4N A;  1M1K W;  4FMT A;  3WG7 C;  4X88 A;  5HFM A;  4N21 A;  4QPJ A;  2WSS G;  2K1E A;  4UVB A;  3FKS G;  2C2A A;  3TCU A;  5KUK A;  2DW4 A;  4GX0 A;  1V55 C;  1SZT A;  3OMA B;  1K92 A;  4MTX A;  2JK5 C;  3CCE V;  1VQP V;  2EBO A;  4MTF A;  4RUF A;  1QLN A;  1DTO A;  2ZR2 A;  1GM9 A;  4LBE C;  4GCZ A;  1ORQ C;  3SPC A;  2EIL C;  2EIJ B;  2P6J A;  1KKD A;  1DF4 A;  5CMU A;  1AI4 A;  4XBF A;  1VQ9 V;  4G2K A;  3LDD A;  1R3I C;  3M99 B;  3FYI B;  1EBO A;  3OEH G;  3VBB A;  3RVY A;  1W2B U;  1QR8 A;  3E8F A;  3LNM B;  4GX5 A;  3OMI B;  3CME V;  1H2G A;  2GSM B;  1S77 D;  1NR7 A;  2EIN C;  2Q69 A;  3P32 A;  1YHQ V;  3LSS A;  1GKF A;  4MS2 A;  1SES A;  5B1A B;  3K06 A;  2V7Q G;  4CZZ A;  1RPR A;  1QBZ A;  2DYR C;  1FXH A;  4G27 B;  3JD2 A;  3W7X A;  2PI5 A;  2HJF C;  1VQ6 V;  1VQ4 V;  2X6B A;  3OAA G;  4U7N A;  1K7D A;  4UXN A;  2XAQ A;  3BY6 A;  3LDE A;  2P90 A;  5HFL A;  3AG1 B;  2JJ2 G;  2BOC C;  4GX1 A;  4KP4 A;  5KA5 A;  2X6A A;  2HLD G;  2EIJ C;  1FXK A;  1I5X A;  3AG2 B;  1Q82 W;  3FB7 C;  3K0G A;  3CC4 V;  5IYB O;  3SJQ C;  3ZN0 A;  2BOB C;  3FB8 C;  1UJW B;  5LHG A;  4MW3 A;  1H38 A;  4FIP C;  3OFN G;  4BW5 A;  5CBF A;  1EZJ A;  2EZO A;  3F7V C;  4BIU A;  4DO2 A;  1SET A;  3RBZ A;  5H9C A;  3ZRS A;  1VQO V;  4LCU C;  5CBG A;  4P9P A;  2YEV B;  2A0L A;  3JCZ A;  5DM6 V;  3E89 A;  1AJQ A;  4YXW G;  2A79 B;  4J9Z B;  4Z1M G;  1YIJ V;  3ZRW A;  1M56 C;  1GO3 F;  2DWE C;  1S0V A;  3F5W C;  3HB3 B;  4PA4 A;  2DQ0 A;  1VQM V;  3CCL V;  3CCU V;  4MVS A;  5IYD O;  3DGE A;  3AG1 C;  4L87 A;  3AEI A;  1E79 G;  2A9H A;  3T4Z A;  3WG7 B;  1S76 D;  3PJS K;  3OW2 U;  3UKM A;  1AJN A;  3E35 A;  4XDL A;  1VQ5 V;  4WFA V;  3ASO C;  4LC1 A;  3F7Y C;  4BIZ A;  2FTK A;  3ZN1 A;  4HZ3 A;  5CBH A;  4WFF A;  1LNQ A;  2IJJ A;  3SYO A;  1AI5 A;  2OT5 A;  2Z5U A;  3UM7 A;  4RQE A;  5EC1 C;  2ITC C;  4CBC A;  3D36 A;  3EFF K;  4WFB V;  4WFH A;  3DTU B;  2EIL B;  4X8A A;  1QVF U;  1J95 A;  4HAM A;  5EBL C;  4E2L A;  3CCQ V;  2IU3 A;  2EJR A;  4MTG A;  2IH1 C;  3JYC A;  1KEC A;  2X7R B;  4UV8 A;  1JQ0 A;  2R9I A;  4FPP A;  1I5Y A;  2B1I A;  2P7T C;  1KC8 W;  5IDJ A;  1Q86 W;  5EBW C;  2EIN B;  1M90 W;  5L3D A;  2D3O W;  3OUF A;  3OM3 B;  4PDV A;  1H8H G;  1K33 A;  1QVG U;  1KD1 W;  2Q67 A;  1OZ0 A;  2DYR B;  5H6R A;  4P9O A;  1K73 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...