1VQ7V

The structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq7V00
1VQ5V 3G4SV 3CCLV 1YHQV 3G71V 1M1KW 3CCEV 1W2BU 1S72V 1VQ7V 1NJIW 3I56V 3CC2V 3CD6V 1VQLV 1VQ4V 1VQ8V 1YITV 3CC7V 1VQ9V 4WF9V 3CCQV 3I55V 1KD1W 2OTLV 1YJ9V 1M90W 3CMAV 1R73A 1VQKV 1YJNV 1YJWV 1N8RW 3CCRV 1KC8W 3CMEV 3CXCU 3CPWU 2QA4V 3CCSV 1Q86W 1K73W 1KQSU 1JJ2U 1VQMV 3CC4V 2D3OW 2QEXV 3CCUV 1Q82W 1YI2V 3CCVV 1YIJV 1Q81W 1VQOV 3OW2U 1QVGU 1Q7YW 1VQPV 3G6EV 4WCEV 3CCMV 4WFBV 1K9MW 2OTJV 1K8AW 5DM6V 1QVFU 1VQNV 1VQ6V 3CCJV 4WFAV
chains in the Genus database with same CATH superfamily
1WA8B 4JI0B 2ZE5A 1I94B 2HHHB 1XDCA 3TGUH 3QVNA 1XMQB 1FFTB 4JTAB 2ZXWB 2AHYA 1KU9A 1VF6A 2BOCC 3E8HA 1PP9H 5CBFA 2Z0AA 1XL6A 2XUMA 4J42A 3HKCB 5GTIZ 4QNHB 2HP8A 5BXZA 5HFMA 1HR0B 4JI7O 1IVSA 3LSSA 3L70H 5EBMC 2Q68A 4B3SB 3SYQA 4YJ3B 4I9QA 2Q6AA 5LMNO 1DGSA 3H1IH 4FM2A 4B3MB 3K9SA 5EBLC 2GUZB 1YTFB 5FNVB 1K4DC 4QJFB 1H2MA 1GTOA 1IXBA 5H6RA 3ABLB 1YXBA 2DYSB 4JAVA 2X0LA 3TJTA 3N27A 4DUYO 3H9VA 1NTKH 4PV1B 1K34A 3JCUZ 2N74A 4XDLA 2ZM6O 5IJ0A 3QO8A 5KHKA 2ZE7A 1XL4A 4X1IA 4ZI7B 2D3OW 4CC6A 3OEEG 2PYLA 4OXSA 3Q4HB 4WBNA 4TSFG 4ZOLA 3W7WA 1SQFA 4I50B 4GX2A 1JFFA 5KHIA 4DO2A 4PA7A 1ZLZA 3ZBHA 1E1QG 3K57A 3ICXA 2AHZA 2YC0A 2LP7A 5KAIZ 3ZMVA 4J9ZB 4K0KB 2QJ1A 5L3DA 1AR1B 1X59A 3E8GA 4TQDA 1KMIZ 2WLMA 5H5NA 3UT5B 1SRYA 3CCVV 4YIOA 1FXVA 1FXKB 1SKVA 1OCOC 4TUYB 4Q6GA 2ZDIA 1Y66A 4X1KA 4DV1O 3K5MA 3E8FA 3KKYA 1ZX3A 5LGNA 5BZBA 1N34O 4Z2WA 2EJ7A 2LGWA 1VQMV 4JI8O 1WB8A 3ABMC 2IBZH 5LP6B 5IWAO 2XAHA 1K9MW 4N21A 3SYAA 5GTHZ 2RN9A 4H33A 2Y69B 1Q5OA 5CB4A 4ZOLB 2AXTZ 1F51A 1VQLV 2ZR2A 2E75B 4TUYA 2A79B 3RFRA 2QDOA 4I4TB 3QO5A 3A0RA 1WN7A 2YIBA 2F4VO 4LFAB 1M57B 3MD0A 4YY3O 4WFEA 3OMNB 1QQCA 3CJHA 5FNVA 1S5HC 2CGOA 4B3SO 3FYEB 2ZINA 2EILC 1AI6A 2F43G 4DV2O 2JJ2G 3CMAV 2JGUA 5IYDO 3SYPA 1IBKO 2VWKA 1NT2B 1OCZC 1B06A 1G1XB 1FD9A 5JCOC 2OIEA 1JOYA 1Q8IA 1R6TA 4OGQB 2R70A 4JI6O 4JYAB 4UCUA 3RVYA 3SGIA 3P30A 4JV5O 1DTOA 1T5EA 1Y74B 2EZOA 2B5UA 1UFIA 1IXMA 4U3JA 1MZEA 2FKXA 2L35A 3TETA 4CS4A 1EZVH 4LNUA 4HNAA 4R7CA 3ZCCA 1H2KA 4Z1MG 1EN5A 3OE7G 4AILC 3CJHB 4B7EA 4DW0A 4G2KA 5KUMA 1BCCH 4I7ZB 2ZR3A 3A2FA 4RQEA 1XUQA 3JALA 3TXQA 1V54C 4LFAO 3ETDA 2MK3A 2JS3A 2W0FC 1SA0B 1YJNV 1LR1A 4DR6B 4JASA 1IURA 2QM8A 2Q4PA 2ZT9B 5A9GA 1P84F 2Y0IA 3SJAC 3T2MA 4C7UA 4I0XA 4LF9B 4D6TH 2YXHA 5L3EA 2DYRB 1W2BU 2LFRA 3WG7B 4I5SA 5KX5A 4F6EA 1PNKA 5LYJA 5IYCO 3ABUA 2RNBA 1FFXA 1ZAUA 4B08A 5IY5B 3AK3A 3OW2U 1BHAA 1WB7A 2DYRC 4JYYA 2IM9A 2Y4TA 1RM1C 2YI8A 1M1KW 1DK1A 1QR8A 4DV7O 3ABKC 1PV0A 1GH6A 1W59A 3T1HO 5J9PC 2R9RB 4MT8A 3ABKB 3JD3A 1GAXA 1S3JA 4JI5O 3VOUA 4DK0A 4O2BA 5A2QN 2NNUA 4FVMA 2FB5A 5DECA 5IE9A 2UU9B 3DC5A 3AG3C 3T4ZA 3P3PA 2UXDO 2WLLB 2P67A 2DQ3A 2NLJC 4B3TB 4Z1VA 4X9QA 1XNQO 2GSMB 2JGDA 1TVKA 2Z3YA 5DM6V 1RSOA 3RYIA 2ATKC 1XNRO 2UUCO 1J5EB 5L3CA 3IGAC 4N23A 5GONA 3RYHB 5D5PA 2FYUH 5IJ9A 1NBMG 4X62B 5AG2A 4GKJO 2CTQA 3ZN0A 1SQQH 1LUWA 1AJNA 1PL4A 4JPRA 1SF9A 1M9NA 1BL8A 3K5OA 4DR3O 4J80A 4FM1A 3K9AA 5IWAB 4LFCO 3R66A 4FLUA 4K3AA 3P32A 4G28B 5JQGA 1YVWA 3T1YO 3W7SA 3E35A 3VQXA 3SJQC 2XASA 2ZNJA 4MTGA 3S3WA 4JI0O 2WWWA 1KB9F 1CEZA 4HNAB 4CZZA 1EM1A 1SETA 1GO3F 4DV5O 3LDEA 1KKDA 4X65O 5LL6Y 1X4TA 1BMFG 2WAMA 3TCUA 4ABMA 3WB1A 1M93A 3CX5F 3FB8C 2P6JA 4MTOA 2VQEB 2WSSG 2EILB 3VQYA 3AEIA 5JJNB 2EINC 4X65B 2UXCO 3BPZA 2DJVA 2HJDA 3UO3A 5D5QA 3CRCA 2ZNIA 2RQ6A 1FXKC 1E79G 1D5AA 1BGYH 3ZN1A 5KA6A 3DXRB 4UVCA 4JI3B 4IHJA 4MVRA 4GT1A 5EYPB 4LFCB 1WLEA 2EIKC 4FLZA 4DUYB 5JWPA 1IDSA 3K03A 4DYLA 1D5NA 1QLEB 4XDKA 3AG2C 2QWNB 3A8TA 2QR4A 4X1YB 4NVPA 4X62O 3I55V 3AK1A 1HNWO 1HDJA 3IJ4A 4JTDB 2LGQA 5EK0A 1GM8A 1DLBA 4LWSA 2QWOB 3J81N 1N32O 3CCLV 4JI3O 2ZDIC 2ZIOA 3CRMA 3RYFB 3JASA 5IYBO 4ZHQB 1Q86W 1KBHA 5LA6B 1W0KG 2HFEC 1Q82W 5CA3A 1NH2D 1KYOF 2PYJA 4X8AA 3BRCA 2ZE6A 1U96A 1DF5A 1Q90D 4Q20A 4EKWA 2QTSA 2R9AA 4MTXA 2DW4A 4LF6O 2F4VB 1EBOA 5TISZ 2QKCA 1DF4A 2Y4UA 1AI4A 3I56V 2QTOA 2WPDG 5JCOA 1YJWV 1VP7A 2IJJA 5FPOA 1TGOA 3OEHG 1JPXA 4L87A 4WBNB 2LQTA 2PGGA 4JI8B 3DC6A 4GCZA 1VQKV 4OPHA 3ETGA 2IJHA 4KHPB 2JS5A 4MVMA 4DR4O 5CA0A 5EZYA 3CMEV 4DR7O 4O4IA 1O9HA 4TV8B 1S76D 1JCHA 3RYIB 5B1AB 1HNXO 3CE2A 3WU2Z 2X6CA 2JEXA 3ZHRA 1MG1A 2E74B 4TWKA 1WPBA 1CPYA 2MW2B 2NR5A 4JZ2A 3CEIA 1H2GA 1TUBB 3LDDA 2LJ2A 5KAFZ 3BHPA 3RT3C 3KG2A 1N4CA 1Y4MA 5KUKA 2JGDB 4J10A 4NTXA 4LR3A 2XAQA 1Z2GA 1SZXA 4CH5A 3K04A 1YTFD 4AQYB 1N32B 3CCUV 4O2AB 1G6UA 3FAVA 2GHYA 3M99B 1BT8A 3RBZA 4GKKB 1QBZA 5B3SC 2UUAB 2GV9A 4KXRA 4FJCC 1OCCB 3WB2A 4BW5A 1S0VA 2OCHA 1D2DA 1M90W 5B66Z 2P06A 4FFBA 4KP4A 1YEWA 2PTMA 4HZ3A 1PM9A 2Q8VA 3CB2A 3JD1A 2A0LA 3OMAB 4WFFA 1H8EG 2EIKB 4JV5B 4FZ0A 1FS0G 1ZUQA 2KG7B 2YUAA 4MVUA 5KHGA 3K59A 3PJSK 2DN9A 4IIJB 3H1LH 4DV0O 4GKKO 1P7GA 1IBLO 1YCIA 1QLNA 1HR0O 2QWRB 2ILMA 5BY1A 2IH3C 1GN4A 1V55C 3C3TA 1GKFA 2OT5A 3SPCA 4P9PA 4UV9A 4ZI7A 1PPJH 4QE9A 1NR7A 4LF8O 5KA5A 4LWSB 5IJ0B 1IZ3A 1YITV 1SA0A 4NXNB 2KG7A 5EIBC 5BR8B 3JYCA 2CH7A 1N0JA 1NQTA 4CH4A 3D3IA 4I55B 3JARA 2B1IA 1ZSPA 4J7ZA 5LA6A 2RJZA 4MS2A 3U10A 2H3OA 5BR8O 1US6A 2YS8A 2Q5ZA 4DR4B 2WLNA 1S72V 2DMXA 4NR1A 1I5XA 2IJIA 2F1MA 3IC7A 2EIJC 4L8JA 3VQWA 2YEVA 2ITCC 1N33O 4UCTA 1N36B 1M5IA 1Y76B 1V55B 2NN4A 3ZHVA 2YIBD 3ZMTA 4U3FH 4O4HA 1WPXA 5LBQA 2VQFO 4JGSA 2PI4A 1B3QA 1OCOB 1YIJV 1HNZB 2HVJC 2XTAA 4PI2A 1R1BA 1ORQC 1IBKB 3SJBC 1Y74A 3DGEA 1H2SB 3F7VC 2EZPA 3AG3B 4PI0A 2UXDB 4I4TA 4DR2O 4FFKA 4J7JA 3SYOA 4K8XA 4IL6Z 2WLHA 4JAAA 1H2NA 3GWKC 1KP2A 3HKDB 3M7MX 5CA1A 3EXAA 5CA1B 4OX9B 5LOVA 3ZMSA 3J80N 3SPGA 1HNWB 4J7KA 4RUEA 4AQYO 4NTYA 3S3XA 1JMKC 5E79Z 2X6AA 1VEWA 1MA1A 3RWRD 2DYSC 4J11A 5LP6A 1B04A 2B9ZA 2HHHO 4P2ZA 3G6BA 1OHHG 4NXMO 1K8AW 1K7DA 4FM0A 2BTQB 1ZL8A 3UM7A 3JATA 5K1PA 1R3JC 4UVAA 4DW1A 3ASOC 3ZRVA 1KC8W 4LF9O 3ZMZA 3ZEDA 4JYBA 1XMOB 3ABTA 3ETQA 4ASUG 2ITDC 2OTJV 3IAYA 1YSCA 1KKCA 2ZXWC 1QHTA 4I50A 3OR6C 5IYZA 4RUFA 2H94A 3OR7C 5LMUO 2XNDG 3QTCA 4D7SA 3H1JH 4OPAA 1P4RA 3ASNC 1B6QA 4J41A 5CN0A 2BOBC 4DV0B 3OTOO 3VBBA 1BQZA 3B09A 2LW1A 4AI8A 4JI4O 1FFXB 1AR4A 5KX5B 1KD1W 3EHBB 1Q6UA 2WLIB 1S77D 4E2LA 3CP1A 3ETEA 1WJZA 3B40A 3ZJZA 2VQFB 1AROP 1CXZB 2UXBB 3QF7A 5LGUA 3F7YC 1AI7A 1GM7A 4O2AA 3BA8A 2EIJB 1N36O 2QWQB 1O9GA 4JZGA 3DSQA 5JH7A 4CC5A 4DV7B 2HG5C 3CCMV 4WFBV 1MZFA 2F93B 1KECA 1QLEC 2KSDA 5JQGB 4JI5B 4R6ZA 3SYCA 2Y69C 4DK1A 1W0JG 1E1RG 2YIDA 4HBNA 2DE0X 4TV8A 4JAUA 1XQ8A 3B8NA 1VIBA 3J7AU 5LOVB 2VQEO 3CHXA 3LNNA 4KHPO 2PZSA 1H2LA 5IJ9B 3HB3B 3RGBA 1MMMA 4YXWG 2WA3A 2WLJA 2Y0PA 1NJIW 2EINB 2B1GA 4BAYA 2HLDG 2FMLA 4HYOA 5KHJA 2PUSA 4LF6B 1N34B 5FPRA 3JAWA 3K79A 1NS1A 1JJOA 1XHZA 3E22B 4LBEC 4LP8A 1JQ0A 4H13B 5FL7G 4U7OA 3D36C 4DV4O 3MHSC 3RW0A 3JAKB 5H9CA 1Q6IA 5F2VO 3RYFA 2L6LA 3HKBB 2AW9A 3E89A 4ZBMA 3TXSA 1R3IC 4WCEV 1YF2A 5BMVA 1J95A 2IJKA 3G4SV 2LFSA 1SQBH 1SESA 4NB5A 1BQ0A 4DR1B 1S5LZ 1IBMO 4JYAO 1H38A 3JD4A 1RPOA 4JI6B 1OJHA 5EC1C 2Q7EA 2RDCA 4EB6B 3VQVA 5LXTB 4QIWF 4LF5O 1F23A 4YJ2B 2JK5C 4LH7A 1RPRA 5CBHA 2ZKOA 4JTCB 1XNQB 1Q43A 2AZ0A 3ASOB 5LYJB 2A7WA 5B1AC 1ZTEA 1VQ9V 1UPGA 3H01A 4YY3B 1N0NA 1NH2B 3CC4V 5J2UB 3ASNB 3WB0A 1L0LH 4U3JB 1Q7YW 1K97A 3KZIZ 3OAAG 1VQ5V 3OTFA 1SQPH 4DV2B 1N33B 2EBOA 2QSAA 1Z5VA 1OZ0A 1YJ9V 1I0HA 3OTOB 2Q9LA 5KHHA 4DV5B 4LC1A 2QEXV 3FKSG 1YZBA 4DUZO 1I94O 1XILA 5LGTA 2EULA 3CSXA 1JR9A 3NXSA 4DR7B 4EEQA 4O4IB 1AP6A 2XAFA 1IX9A 4IHJB 4FFBB 2F23A 4LF4O 2UXXA 5C8YB 3ZHQA 1RP3B 2YXLA 1UJWB 3W7UA 4DR3B 1TA8A 2VWJA 3L72H 3ZRWA 3T4DA 5JJEB 3P3NA 3BY6A 3HKDA 1AR5A 4WFAV 2YIAA 2ZE8A 4UFZA 3STZC 5FLXN 3BCCH 1VQ4V 3OMIB 1GN2A 4GKJB 1M4UA 4RWUA 4DV1B 3CWBH 2CTRA 3JAWB 2XHBA 4JI2B 1KUQA 3SPHA 2OIGA 2KQXA 1YDXA 1FJGB 2A9HA 2HVKC 4H0LB 2ZM6B 1NR1A 5B1BC 4P30A 4DV6O 1BS3A 2P22C 1MSDA 1ZWIC 4GUNA 1URFA 3K0DA 5L3FA 3KCYA 4GLXA 4UCSA 1VF7A 1FXKA 5CBGA 1AJPA 1QCEA 4UB6Z 1VARA 3JARB 1AB3A 1JJ2U 4NYKA 4XDJA 4JF3A 1WAZA 3IC9A 4YHHB 4PA9A 3OGCC 1VQPV 3W7XA 1GRJA 4BIUA 4CS2A 1QU7A 1ROPA 3BVOA 5J2TA 1WA8A 1Z5WA 1Q3EA 1AVMA 1PL0A 2BCCH 4X1KB 2X7RB 2PY5A 2XAJA 2ZCEA 2P5OA 2DWEC 2E5LB 4J9YB 3D3QA 2CTWA 4QPJA 1Q81W 2OYQA 4GX0A 3ZRSA 3FYIB 3EVKA 3UO2A 4U7NA 4YJ2A 3U11A 4DV4B 4CH6A 4ZIBA 3CYOA 2GDSA 2IU3A 2CDYA 3AG7A 2QM7A 2CH7B 3BABA 3I5DA 1AJQA 1V9PA 1M57C 2N05A 4ZHQA 1HNXB 2Q67A 3JSNA 1A32A 3BEHA 3K0GA 2BTOA 1GM9A 3OUSA 3JASB 2F66C 1K73W 3B8MA 3SPJA 5J2TB 3LDCA 3RYCA 5LHIA 2HKOA 2FL4A 5B1BB 4YIPA 2Q0OC 3SDLA 2YICA 2O57A 1L1FA 1JA8A 4PA3A 2EJRA 1PD3A 4MVQA 1MABG 4R50A 3BA9A 4IYHA 2D2CB 5B3SB 2P90A 2ZIMA 1VF6C 1IBLB 2BTQA 1NZ6A 4D7TA 5EZYB 3QG5A 2W6IG 3GVMA 2CE4A 4LNUB 4OX9O 1G4YB 3K5NA 1NVPB 4K8ZA 3ML0A 4W4KA 1TUEB 1NTMH 2DWDC 1WP7A 3RN4A 3R65A 4IYIA 2JIZG 3FX7A 3THOA 1VQNV 4DV3B 5L3GA 3JATB 1LNQA 3GB7C 2EIMC 1NI8A 3LUTB 4UB8Z 1Q6HA 5LHGA 2R9IA 1RFYA 5ITZB 1XNRB 4DXWA 2QA4V 2A06H 4RO2A 1K5SA 3QNEA 4B7KA 1ENVA 3SR2C 1AI5A 1RM1B 2ZQMA 3N2KB 1VQ8V 4G27B 4KUMA 2K9PA 2YSUB 3ABLC 1YHQV 2E5LO 3ZX6A 4DR5O 1FJGO 2AGAA 4LF5B 4PJ0Z 3W7TA 3F5TA 4WFHA 4JI7B 3CXHF 2UUAO 4F4LA 3WG7C 3APQA 1SQVH 1K4CC 1GMGA 4EFEA 3JD0A 5JVDB 5C8YA 4F6RA 1F4NA 4GX1A 4PA4A 3JAMN 1K3EA 2K1EA 1Y6XA 4MTFA 1P7BA 4YHHO 2UXCB 3AK2A 3C3SA 5GW7A 2WLKA 4WF9V 1NU1H 1WP8A 4B3RO 3QO7A 4GYCB 4CH3A 3FB7C 1V54B 4RQFA 2FTKA 3HKEA 1SQGA 3NR7A 2JRIA 3H1HH 5CMUA 2XT9A 2Q0AA 4X1YA 1M56B 4FLYA 1COWG 4JI1O 2HEPA 3O9OA 4FIPC 3G80A 3N2GB 5DEDA 2E76B 2QKAA 3DXRA 4LH6A 3JD2A 5HFLA 5IDJA 2RMKB 3HR0A 3AG2B 3CRRA 5K1XA 3BFRA 1FXHA 4O2BB 1XBLA 2IW5A 3ZRXA 2UUBB 1BSMA 4NKGB 1EN6A 1OCZB 4BIOA 4BW9A 2R72A 1AP5A 2IU0A 1HWYA 3APOA 5JJJB 4H44B 2LW7A 4QPKA 2IH1C 1L8DA 2UUCB 2CK3G 3OT7A 1PNMA 5H6QA 4MVOA 4AHCA 3H1KH 1NVPD 1BE3H 3HKEB 4B3TO 1GN6A 3E86A 4DUZB 1R6KA 1F7YA 1GK9A 4FLVA 3BAAA 4LF7O 4NXMB 5EBWC 2ODMA 4FZ1A 3CRAA 2UU9O 3Q4HA 4PD4F 4DRXA 4DR1O 2YDEA 4X64O 2GBOA 2QE7G 1AILA 3X2QB 5E1AC 4QGPA 5JVDA 5B1OA 1THZA 2F95B 1MOFA 2JJ1G 2OWOA 1R6NA 4TT3G 2P7TC 3ABMB 5LP6C 3CD6V 5H2FZ 1FKAO 2Q7HA 2OTLV 3EFFK 3SPIA 1PNLA 1XI1A 5L3BA 3TK1A 4BIZA 3JALB 3MAQA 3D8CA 1RSOB 4GZRB 1KP3A 1F4MA 4JI4B 3G6EV 3ZHUA 1K92A 2HR3A 2LO1A 3LNMB 4IT5A 3SJCC 4XBFA 1R3LC 4W4LA 4X88A 2DQ0A 4E4EA 4PDRA 1VMGA 5JH7B 1N8RW 3CXCU 3FAVB 1KQSU 1Y76A 1I08A 2WLLA 4DV3O 4FMTA 4QE7A 2W0XA 3HKCA 4NXNO 4BWAA 3ZHSA 1MNGA 2C2AA 2GTSA 3ZIAG 3RYCB 1EFRG 5J2UA 3T1HB 4UUJC 4NTWA 3UQ8A 1TUBA 5GONB 2WLIA 4H37A 4PDMA 1I7FA 2XOKG 1M56C 2QKSA 1R73A 2X6BA 3E8BA 5LMUB 4MSWC 3WFVA 1TAEA 1VQ6V 2QGNA 4IIJA 5C93A 4FLXA 2YI9A 4O4LA 4O4LB 3OD4A 4X66B 3CS5A 3C90A 3K08A 4UCVA 1FYJA 4GX5A 1S5JA 4PELA 3AG4C 3L9DA 2KKWA 1SQXH 1BZKA 3MDSA 3UKMA 3D36A 4CS3A 2JEUA 4MW8A 3HKBA 1SERA 2WA4A 5KMGA 2Q69A 4X64B 2M6YA 2P4KA 2ZD9A 3MHHC 3L74H 1EN4A 3E2EA 3FD9A 4UXNA 3DTUB 2JVDA 1LUVA 1ZL8B 2V4DA 1VQOV 3JCZA 2BE3A 3N2GA 3M8AA 2VRZA 2XAGA 2GUZA 4PDLA 2OCCB 4EB6A 2Y48A 2EIMB 5EC2C 3UCSC 4PA6A 1WNSA 4DV6B 2UXBO 3IFXA 2JDIG 4UV8A 3AG1B 5EYPA 2VS0A 2A3QA 3L73H 4FPPA 1SC5B 5CA0B 5IY5C 1NTZH 4LF7B 5BMVB 4DR2B 1QNMA 5DN6G 4EFBA 4ZKIA 2M7WA 3ZRWB 3G71V 2Q73A 3CRQA 1OCRB 2CTPA 2P4VA 3ZS8C 1VQ7V 1MSWD 1XMOO 5LHHA 1JVMA 3AG4B 2EX3A 1HNZO 2GTAA 3OUFA 2QM4A 3CCRV 5B1NA 1VF5B 1PKXA 2CAZC 1G8MA 4X66O 1SS3A 2UXNA 1XHXA 4DR6O 1XREA 4TV9A 4FLTA 4LFBB 2Z5UA 2V1DA 4TQFA 3CCEV 2H8PC 3K58A 4RAIA 3G67A 5KLVH 3CCQV 4YJ3A 2PI5A 5CB4B 1JX9A 3OM3B 2W6JG 2N04A 4LF8B 4X20B 4B3RB 3KCXA 3STLC 2CUGA 4O4JA 3LSQA 4HAMA 4FK5C 4LF4B 1HP8A 4PHZA 4DRXB 4A5UB 2YEVB 5EIBD 1NKDA 4UCRA 3OGIB 4WFGA 1CP9A 3RYHA 1L0NH 2YXYA 3HPLC 3PN1A 4TV9B 4DR5B 2KB1A 2E3CA 3K06A 3T1YB 1TVKB 3JSLA 5ITZA 2HJFC 4O4HB 3K5LA 4X89A 4B3MO 2V7QG 4PDVA 1BHBA 4I55A 3RVZA 5LMNB 4I9WA 3L71H 3B4SA 5LXTA 3OFNG 4TOIA 3T1CA 4KFMA 3CCSV 2QWPB 3FFQA 1XEQA 1OV9A 4ICGA 2AZ2A 4P9OA 3FB5C 4KL1A 4MVZA 4BR6A 4K35A 2DOSA 3X2QC 3LSUA 3CC2V 3E83A 4F6RB 5B5EZ 3GWOA 1FAFA 4LCUC 3CPWU 1EZJA 3FB6C 3B77A 2BSKB 3UT5A 3A0BZ 1YI2V 4MVSA 3F5WC 1R3KC 1H8HG 4UCOA 1HW7A 4UVBA 1IBMB 3ZHTA 4JI2O 2CGNA 3B2EE 2BSKA 1Y67A 5KMGB 3N2KA 3CC7V 1JFFB 4IGGA 4R8CA 3O65A 3K3WA 1K5QA 2ADPA 2UUBO 5IYZB 2G38A 4LFBO 1U97A 2ARHA 3L75H 1SZTA 3A0HZ 4X1IB 1I5YA 4I0XB 4O4JB 1OCRC 4K0KO 4X20A 1QVFU 3JAKA 3CCJV 1QR9A 1P49A 4CBCA 1XMQO 2ADQB 1FPOA 1XOUA 2PF4E 1GN3A 3AG1C 3ZMUA 3E22A 3U0ZA 5IT9N 2RCVA 2Q7GA 4JI1B 1QVGU 4MW3A 1OCCC 1J5EO 1K33A 4JYCA 2ETNA 2OCCC 4FLWA
chains in the Genus database with same CATH topology
1QLEC 1M56B 1COWG 4FIPC 4R6ZA 3SYCA 2Y69C 1W0JG 3I55V 1E1RG 1FFTB 4JTAB 3JD2A 4JTDB 2ZXWB 2AHYA 5HFLA 5IDJA 3AG2B 2BOCC 5EK0A 4JAUA 3E8HA 1FXHA 1GM8A 3B8NA 1DLBA 5CBFA 1XL6A 2IW5A 3ZRXA 4QNHB 5HFMA 3CCLV 3LSSA 2ZDIC 3HB3B 4YXWG 2WLJA 1NJIW 5EBMC 2EINB 2B1GA 2Q68A 1OCZB 2HLDG 4BAYA 3SYQA 5IYBO 2Q6AA 2IU0A 1HWYA 1Q86W 1W0KG 4HYOA 4QPKA 2IH1C 2HFEC 5EBLC 1Q82W 2CK3G 1YTFB 1PNMA 5CA3A 5H6QA 4MVOA 1NH2D 1NVPD 1K4DC 3K79A 4X8AA 4QJFB 1GTOA 5H6RA 3ABLB 1DF5A 4Q20A 4EKWA 3E86A 4LBEC 4LP8A 4MTXA 2DYSB 2DW4A 2X0LA 4JAVA 1JQ0A 1R6KA 1EBOA 5FL7G 4U7OA 3MHSC 1DF4A 1K34A 1AI4A 3RW0A 1GK9A 3I56V 4XDLA 5EBWC 3QO8A 5H9CA 2QTOA 2WPDG 1YJWV 2IJJA 1XL4A 2D3OW 3OEHG 3E89A 1JPXA 3OEEG 4OXSA 2QE7G 4ZBMA 4L87A 3X2QB 5E1AC 1R3IC 4WCEV 4TSFG 1J95A 5B1OA 3W7WA 1THZA 2IJKA 4GX2A 4GCZA 1VQKV 3G4SV 2LFSA 1MOFA 2JJ1G 4DO2A 4PA7A 3ETGA 1R6NA 1SESA 4TT3G 2IJHA 2P7TC 3ABMB 4MVMA 3CD6V 1E1QG 2AHZA 2OTLV 2LP7A 3EFFK 3SPIA 1H38A 3JD4A 1PNLA 1RPOA 3ZMVA 4J9ZB 5L3BA 3CMEV 5L3DA 1AR1B 3TK1A 5EC1C 1S76D 3E8GA 1JCHA 2WLMA 4BIZA 1SRYA 5B1AB 4QIWF 2X6CA 3CCVV 1KP3A 1F4MA 2JEXA 1FXVA 1F23A 1MG1A 1FXKB 3G6EV 1K92A 2HR3A 4TWKA 2JK5C 1CPYA 1OCOC 1RPRA 2ZDIA 1Y66A 5CBHA 4JTCB 3E8FA 3LNMB 1H2GA 4XBFA 1R3LC 3ASOB 3LDDA 5LGNA 5BZBA 4X88A 2DQ0A 5B1AC 3KG2A 1VQ9V 1Y4MA 5KUKA 4PDRA 2XAQA 3H01A 1N8RW 3CXCU 3K04A 1KQSU 1YTFD 1NH2B 1VQMV 3CC4V 2WLLA 3ABMC 3CCUV 3ASNB 4FMTA 4QE7A 2XAHA 1Q7YW 2GHYA 3M99B 1K97A 2C2AA 3ZIAG 1K9MW 3RBZA 4N21A 1QBZA 3OAAG 3SYAA 5B3SC 4H33A 1VQ5V 1EFRG 4FJCC 4UUJC 2EBOA 2Y69B 1OCCB 4BW5A 1S0VA 1F51A 1VQLV 2WLIA 2ZR2A 4H37A 4PDMA 2XOKG 1OZ0A 1YJ9V 1M56C 2QKSA 1M90W 1R73A 4KP4A 2A79B 2X6BA 4HZ3A 3QO5A 3A0RA 4LC1A 2QEXV 3JD1A 2A0LA 3OMAB 4WFFA 3FKSG 3E8BA 1H8EG 1M57B 2EIKB 3MD0A 5LGTA 4MSWC 4WFEA 3OMNB 3WFVA 1FS0G 1VQ6V 5C93A 4MVUA 1S5HC 3FYEB 3NXSA 3PJSK 2XAFA 2EILC 1AI6A 2F43G 2JJ2G 3CMAV 2UXXA 3K08A 5IYDO 3SYPA 1QLNA 1OCZC 1UJWB 3W7UA 4GX5A 2IH3C 4PELA 3AG4C 3ZRWA 1JOYA 3T4DA 3BY6A 1V55C 1GKFA 3UKMA 3D36A 4WFAV 2OT5A 3SPCA 4P9PA 4UV9A 3RVYA 2JEUA 4MW8A 3P30A 1SERA 3STZC 1DTOA 4QE9A 1NR7A 5KA5A 2Q69A 1VQ4V 2EZOA 2B5UA 1YITV 1IXMA 2ZD9A 3MHHC 3OMIB 3E2EA 4UXNA 3DTUB 3JYCA 3TETA 1NQTA 3D3IA 4R7CA 3ZCCA 3SPHA 2B1IA 4Z1MG 1VQOV 3JCZA 3OE7G 2A9HA 4MS2A 2HVKC 4G2KA 2XAGA 5KUMA 1NR1A 4PDLA 2OCCB 5B1BC 4P30A 2WLNA 2ZR3A 4RQEA 1ZWIC 1S72V 2Y48A 3K0DA 2EIMB 5L3FA 1V54C 5EC2C 1FXKA 1I5XA 3ETDA 5CBGA 4PA6A 2MK3A 2W0FC 2IJIA 1AJPA 1QCEA 3IC7A 1YJNV 2EIJC 4JASA 3IFXA 2JDIG 2QM8A 4UV8A 3AG1B 1JJ2U 2YEVA 4XDJA 4FPPA 4JF3A 4PA9A 2ITCC 3OGCC 1VQPV 3T2MA 5IY5C 3W7XA 5DN6G 4ZKIA 4BIUA 2M7WA 3ZRWB 3G71V 5L3EA 1OCRB 1ROPA 2DYRB 1V55B 1W2BU 2LFRA 1VQ7V 1MSWD 3ZMTA 1PL0A 5LHHA 1JVMA 3AG4B 2X7RB 3WG7B 2XAJA 4I5SA 3OUFA 2DWEC 1WPXA 5LBQA 1PNKA 4J9YB 4JGSA 3CCRV 5IYCO 3ABUA 2PI4A 5B1NA 5IY5B 1OCOB 1PKXA 1G8MA 4QPJA 1YIJV 1Q81W 3OW2U 4GX0A 2UXNA 3ZRSA 3FYIB 2HVJC 4U7NA 1BHAA 2DYRC 3CYOA 1ORQC 2Z5UA 2IU3A 1RM1C 2V1DA 3DGEA 1M1KW 1QR8A 3F7VC 2QM7A 3CCEV 2EZPA 2H8PC 3AG3B 4RAIA 3ABKC 1AJQA 1M57C 2Q67A 3BEHA 3CCQV 3K0GA 2PI5A 1GM9A 3OUSA 3SYOA 5J9PC 2WLHA 2R9RB 1K73W 3B8MA 3SPJA 4MT8A 1JX9A 3OM3B 2W6JG 3ABKB 3JD3A 3LDCA 1KP2A 5LHIA 2HKOA 3STLC 1S3JA 3ZMSA 3LSQA 5B1BB 4HAMA 4FK5C 3VOUA 2NNUA 3SPGA 4RUEA 2YEVB 1L1FA 1NKDA 3AG3C 4PA3A 2EJRA 2X6AA 3T4ZA 1PD3A 2DYSC 2WLLB 4MVQA 1MABG 4WFGA 1CP9A 4R50A 2P67A 2DQ3A 2NLJC 5B3SB 4P2ZA 1OHHG 2P90A 3HPLC 2GSMB 2KB1A 3K06A 2Z3YA 1K8AW 5DM6V 2HJFC 1K7DA 4X89A 2V7QG 4PDVA 1BHBA 3RVZA 2ATKC 4I9WA 3UM7A 2W6IG 1R3JC 4UVAA 5L3CA 3ASOC 3IGAC 3OFNG 4N23A 3ZRVA 1KC8W 3T1CA 4KFMA 3CCSV 1G4YB 1NBMG 3ZMZA 1NVPB 4JYBA 3ML0A 1TUEB 3ABTA 2DWDC 3ZN0A 4ASUG 2ITDC 4P9OA 3R65A 3FB5C 2OTJV 1AJNA 2JIZG 4JPRA 4MVZA 1VQNV 1YSCA 5L3GA 1M9NA 2ZXWC 1LNQA 1BL8A 3GB7C 2EIMC 3K9AA 3OR6C 3X2QC 3CC2V 3LUTB 3E83A 4RUFA 2H94A 3OR7C 5LHGA 2R9IA 3GWOA 3P32A 4G28B 4DXWA 2XNDG 4LCUC 3W7SA 3CPWU 2QA4V 1EZJA 3FB6C 3E35A 4RO2A 1K5SA 3SJQC 2XASA 3B77A 3QNEA 1YI2V 1P4RA 3ASNC 4MTGA 4MVSA 1B6QA 1ENVA 5CN0A 3F5WC 1AI5A 1R3KC 2BOBC 1RM1B 1H8HG 2ZQMA 2WWWA 4UVBA 1VQ8V 1CEZA 4G27B 4KUMA 2YSUB 3VBBA 3ABLC 4CZZA 1YHQV 1SETA 1GO3F 3LDEA 1KKDA 2WAMA 1BMFG 3TCUA 4R8CA 3CC7V 3W7TA 1KD1W 3K3WA 1K5QA 4WFHA 3EHBB 2WLIB 3FB8C 1S77D 2P6JA 4F4LA 4MTOA 4E2LA 3CP1A 3WG7C 2WSSG 2EILB 1K4CC 1GMGA 3AEIA 2EINC 1SZTA 3ETEA 1I5YA 3JD0A 1OCRC 1F4NA 4GX1A 4PA4A 3ZJZA 1QVFU 3CCJV 1QR9A 4CBCA 1K3EA 1AROP 2K1EA 4MTFA 5LGUA 1P7BA 1FXKC 1E79G 3F7YC 1AI7A 3ZN1A 5GW7A 2WLKA 1GM7A 5KA6A 3AG1C 3ZMUA 4WF9V 4UVCA 2EIJB 4MVRA 4GT1A 3QO7A 3FB7C 1V54B 4RQFA 1WLEA 2FTKA 2EIKC 1QVGU 4MW3A 1OCCC 5CMUA 1K33A 2HG5C 3CCMV 4WFBV 4JYCA 2OCCC 3K03A 1QLEB 4XDKA 3AG2C 1KECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 V;  3G4S V;  3CCL V;  1YHQ V;  3G71 V;  1M1K W;  3CCE V;  1W2B U;  1S72 V;  1VQ7 V;  1NJI W;  3I56 V;  3CC2 V;  3CD6 V;  1VQL V;  1VQ4 V;  1VQ8 V;  1YIT V;  3CC7 V;  1VQ9 V;  4WF9 V;  3CCQ V;  3I55 V;  1KD1 W;  2OTL V;  1YJ9 V;  1M90 W;  3CMA V;  1R73 A;  1VQK V;  1YJN V;  1YJW V;  1N8R W;  3CCR V;  1KC8 W;  3CME V;  3CXC U;  3CPW U;  2QA4 V;  3CCS V;  1Q86 W;  1K73 W;  1KQS U;  1JJ2 U;  1VQM V;  3CC4 V;  2D3O W;  2QEX V;  3CCU V;  1Q82 W;  1YI2 V;  3CCV V;  1YIJ V;  1Q81 W;  1VQO V;  3OW2 U;  1QVG U;  1Q7Y W;  1VQP V;  3G6E V;  4WCE V;  3CCM V;  4WFB V;  1K9M W;  2OTJ V;  1K8A W;  5DM6 V;  1QVF U;  1VQN V;  1VQ6 V;  3CCJ V;  4WFA V; 
#chains in the Genus database with same CATH topology
 1WA8 B;  4JI0 B;  2ZE5 A;  1I94 B;  2HHH B;  1XDC A;  3TGU H;  3QVN A;  1XMQ B;  1FFT B;  4JTA B;  2ZXW B;  2AHY A;  1KU9 A;  1VF6 A;  2BOC C;  3E8H A;  1PP9 H;  5CBF A;  2Z0A A;  1XL6 A;  2XUM A;  4J42 A;  3HKC B;  5GTI Z;  4QNH B;  2HP8 A;  5BXZ A;  5HFM A;  1HR0 B;  4JI7 O;  1IVS A;  3LSS A;  3L70 H;  5EBM C;  2Q68 A;  4B3S B;  3SYQ A;  4YJ3 B;  4I9Q A;  2Q6A A;  5LMN O;  1DGS A;  3H1I H;  4FM2 A;  4B3M B;  3K9S A;  5EBL C;  2GUZ B;  1YTF B;  5FNV B;  1K4D C;  4QJF B;  1H2M A;  1GTO A;  1IXB A;  5H6R A;  3ABL B;  1YXB A;  2DYS B;  4JAV A;  2X0L A;  3TJT A;  3N27 A;  4DUY O;  3H9V A;  1NTK H;  4PV1 B;  1K34 A;  3JCU Z;  2N74 A;  4XDL A;  2ZM6 O;  5IJ0 A;  3QO8 A;  5KHK A;  2ZE7 A;  1XL4 A;  4X1I A;  4ZI7 B;  2D3O W;  4CC6 A;  3OEE G;  2PYL A;  4OXS A;  3Q4H B;  4WBN A;  4TSF G;  4ZOL A;  3W7W A;  1SQF A;  4I50 B;  4GX2 A;  1JFF A;  5KHI A;  4DO2 A;  4PA7 A;  1ZLZ A;  3ZBH A;  1E1Q G;  3K57 A;  3ICX A;  2AHZ A;  2YC0 A;  2LP7 A;  5KAI Z;  3ZMV A;  4J9Z B;  4K0K B;  2QJ1 A;  5L3D A;  1AR1 B;  1X59 A;  3E8G A;  4TQD A;  1KMI Z;  2WLM A;  5H5N A;  3UT5 B;  1SRY A;  3CCV V;  4YIO A;  1FXV A;  1FXK B;  1SKV A;  1OCO C;  4TUY B;  4Q6G A;  2ZDI A;  1Y66 A;  4X1K A;  4DV1 O;  3K5M A;  3E8F A;  3KKY A;  1ZX3 A;  5LGN A;  5BZB A;  1N34 O;  4Z2W A;  2EJ7 A;  2LGW A;  1VQM V;  4JI8 O;  1WB8 A;  3ABM C;  2IBZ H;  5LP6 B;  5IWA O;  2XAH A;  1K9M W;  4N21 A;  3SYA A;  5GTH Z;  2RN9 A;  4H33 A;  2Y69 B;  1Q5O A;  5CB4 A;  4ZOL B;  2AXT Z;  1F51 A;  1VQL V;  2ZR2 A;  2E75 B;  4TUY A;  2A79 B;  3RFR A;  2QDO A;  4I4T B;  3QO5 A;  3A0R A;  1WN7 A;  2YIB A;  2F4V O;  4LFA B;  1M57 B;  3MD0 A;  4YY3 O;  4WFE A;  3OMN B;  1QQC A;  3CJH A;  5FNV A;  1S5H C;  2CGO A;  4B3S O;  3FYE B;  2ZIN A;  2EIL C;  1AI6 A;  2F43 G;  4DV2 O;  2JJ2 G;  3CMA V;  2JGU A;  5IYD O;  3SYP A;  1IBK O;  2VWK A;  1NT2 B;  1OCZ C;  1B06 A;  1G1X B;  1FD9 A;  5JCO C;  2OIE A;  1JOY A;  1Q8I A;  1R6T A;  4OGQ B;  2R70 A;  4JI6 O;  4JYA B;  4UCU A;  3RVY A;  3SGI A;  3P30 A;  4JV5 O;  1DTO A;  1T5E A;  1Y74 B;  2EZO A;  2B5U A;  1UFI A;  1IXM A;  4U3J A;  1MZE A;  2FKX A;  2L35 A;  3TET A;  4CS4 A;  1EZV H;  4LNU A;  4HNA A;  4R7C A;  3ZCC A;  1H2K A;  4Z1M G;  1EN5 A;  3OE7 G;  4AIL C;  3CJH B;  4B7E A;  4DW0 A;  4G2K A;  5KUM A;  1BCC H;  4I7Z B;  2ZR3 A;  3A2F A;  4RQE A;  1XUQ A;  3JAL A;  3TXQ A;  1V54 C;  4LFA O;  3ETD A;  2MK3 A;  2JS3 A;  2W0F C;  1SA0 B;  1YJN V;  1LR1 A;  4DR6 B;  4JAS A;  1IUR A;  2QM8 A;  2Q4P A;  2ZT9 B;  5A9G A;  1P84 F;  2Y0I A;  3SJA C;  3T2M A;  4C7U A;  4I0X A;  4LF9 B;  4D6T H;  2YXH A;  5L3E A;  2DYR B;  1W2B U;  2LFR A;  3WG7 B;  4I5S A;  5KX5 A;  4F6E A;  1PNK A;  5LYJ A;  5IYC O;  3ABU A;  2RNB A;  1FFX A;  1ZAU A;  4B08 A;  5IY5 B;  3AK3 A;  3OW2 U;  1BHA A;  1WB7 A;  2DYR C;  4JYY A;  2IM9 A;  2Y4T A;  1RM1 C;  2YI8 A;  1M1K W;  1DK1 A;  1QR8 A;  4DV7 O;  3ABK C;  1PV0 A;  1GH6 A;  1W59 A;  3T1H O;  5J9P C;  2R9R B;  4MT8 A;  3ABK B;  3JD3 A;  1GAX A;  1S3J A;  4JI5 O;  3VOU A;  4DK0 A;  4O2B A;  5A2Q N;  2NNU A;  4FVM A;  2FB5 A;  5DEC A;  5IE9 A;  2UU9 B;  3DC5 A;  3AG3 C;  3T4Z A;  3P3P A;  2UXD O;  2WLL B;  2P67 A;  2DQ3 A;  2NLJ C;  4B3T B;  4Z1V A;  4X9Q A;  1XNQ O;  2GSM B;  2JGD A;  1TVK A;  2Z3Y A;  5DM6 V;  1RSO A;  3RYI A;  2ATK C;  1XNR O;  2UUC O;  1J5E B;  5L3C A;  3IGA C;  4N23 A;  5GON A;  3RYH B;  5D5P A;  2FYU H;  5IJ9 A;  1NBM G;  4X62 B;  5AG2 A;  4GKJ O;  2CTQ A;  3ZN0 A;  1SQQ H;  1LUW A;  1AJN A;  1PL4 A;  4JPR A;  1SF9 A;  1M9N A;  1BL8 A;  3K5O A;  4DR3 O;  4J80 A;  4FM1 A;  3K9A A;  5IWA B;  4LFC O;  3R66 A;  4FLU A;  4K3A A;  3P32 A;  4G28 B;  5JQG A;  1YVW A;  3T1Y O;  3W7S A;  3E35 A;  3VQX A;  3SJQ C;  2XAS A;  2ZNJ A;  4MTG A;  3S3W A;  4JI0 O;  2WWW A;  1KB9 F;  1CEZ A;  4HNA B;  4CZZ A;  1EM1 A;  1SET A;  1GO3 F;  4DV5 O;  3LDE A;  1KKD A;  4X65 O;  5LL6 Y;  1X4T A;  1BMF G;  2WAM A;  3TCU A;  4ABM A;  3WB1 A;  1M93 A;  3CX5 F;  3FB8 C;  2P6J A;  4MTO A;  2VQE B;  2WSS G;  2EIL B;  3VQY A;  3AEI A;  5JJN B;  2EIN C;  4X65 B;  2UXC O;  3BPZ A;  2DJV A;  2HJD A;  3UO3 A;  5D5Q A;  3CRC A;  2ZNI A;  2RQ6 A;  1FXK C;  1E79 G;  1D5A A;  1BGY H;  3ZN1 A;  5KA6 A;  3DXR B;  4UVC A;  4JI3 B;  4IHJ A;  4MVR A;  4GT1 A;  5EYP B;  4LFC B;  1WLE A;  2EIK C;  4FLZ A;  4DUY B;  5JWP A;  1IDS A;  3K03 A;  4DYL A;  1D5N A;  1QLE B;  4XDK A;  3AG2 C;  2QWN B;  3A8T A;  2QR4 A;  4X1Y B;  4NVP A;  4X62 O;  3I55 V;  3AK1 A;  1HNW O;  1HDJ A;  3IJ4 A;  4JTD B;  2LGQ A;  5EK0 A;  1GM8 A;  1DLB A;  4LWS A;  2QWO B;  3J81 N;  1N32 O;  3CCL V;  4JI3 O;  2ZDI C;  2ZIO A;  3CRM A;  3RYF B;  3JAS A;  5IYB O;  4ZHQ B;  1Q86 W;  1KBH A;  5LA6 B;  1W0K G;  2HFE C;  1Q82 W;  5CA3 A;  1NH2 D;  1KYO F;  2PYJ A;  4X8A A;  3BRC A;  2ZE6 A;  1U96 A;  1DF5 A;  1Q90 D;  4Q20 A;  4EKW A;  2QTS A;  2R9A A;  4MTX A;  2DW4 A;  4LF6 O;  2F4V B;  1EBO A;  5TIS Z;  2QKC A;  1DF4 A;  2Y4U A;  1AI4 A;  3I56 V;  2QTO A;  2WPD G;  5JCO A;  1YJW V;  1VP7 A;  2IJJ A;  5FPO A;  1TGO A;  3OEH G;  1JPX A;  4L87 A;  4WBN B;  2LQT A;  2PGG A;  4JI8 B;  3DC6 A;  4GCZ A;  1VQK V;  4OPH A;  3ETG A;  2IJH A;  4KHP B;  2JS5 A;  4MVM A;  4DR4 O;  5CA0 A;  5EZY A;  3CME V;  4DR7 O;  4O4I A;  1O9H A;  4TV8 B;  1S76 D;  1JCH A;  3RYI B;  5B1A B;  1HNX O;  3CE2 A;  3WU2 Z;  2X6C A;  2JEX A;  3ZHR A;  1MG1 A;  2E74 B;  4TWK A;  1WPB A;  1CPY A;  2MW2 B;  2NR5 A;  4JZ2 A;  3CEI A;  1H2G A;  1TUB B;  3LDD A;  2LJ2 A;  5KAF Z;  3BHP A;  3RT3 C;  3KG2 A;  1N4C A;  1Y4M A;  5KUK A;  2JGD B;  4J10 A;  4NTX A;  4LR3 A;  2XAQ A;  1Z2G A;  1SZX A;  4CH5 A;  3K04 A;  1YTF D;  4AQY B;  1N32 B;  3CCU V;  4O2A B;  1G6U A;  3FAV A;  2GHY A;  3M99 B;  1BT8 A;  3RBZ A;  4GKK B;  1QBZ A;  5B3S C;  2UUA B;  2GV9 A;  4KXR A;  4FJC C;  1OCC B;  3WB2 A;  4BW5 A;  1S0V A;  2OCH A;  1D2D A;  1M90 W;  5B66 Z;  2P06 A;  4FFB A;  4KP4 A;  1YEW A;  2PTM A;  4HZ3 A;  1PM9 A;  2Q8V A;  3CB2 A;  3JD1 A;  2A0L A;  3OMA B;  4WFF A;  1H8E G;  2EIK B;  4JV5 B;  4FZ0 A;  1FS0 G;  1ZUQ A;  2KG7 B;  2YUA A;  4MVU A;  5KHG A;  3K59 A;  3PJS K;  2DN9 A;  4IIJ B;  3H1L H;  4DV0 O;  4GKK O;  1P7G A;  1IBL O;  1YCI A;  1QLN A;  1HR0 O;  2QWR B;  2ILM A;  5BY1 A;  2IH3 C;  1GN4 A;  1V55 C;  3C3T A;  1GKF A;  2OT5 A;  3SPC A;  4P9P A;  4UV9 A;  4ZI7 A;  1PPJ H;  4QE9 A;  1NR7 A;  4LF8 O;  5KA5 A;  4LWS B;  5IJ0 B;  1IZ3 A;  1YIT V;  1SA0 A;  4NXN B;  2KG7 A;  5EIB C;  5BR8 B;  3JYC A;  2CH7 A;  1N0J A;  1NQT A;  4CH4 A;  3D3I A;  4I55 B;  3JAR A;  2B1I A;  1ZSP A;  4J7Z A;  5LA6 A;  2RJZ A;  4MS2 A;  3U10 A;  2H3O A;  5BR8 O;  1US6 A;  2YS8 A;  2Q5Z A;  4DR4 B;  2WLN A;  1S72 V;  2DMX A;  4NR1 A;  1I5X A;  2IJI A;  2F1M A;  3IC7 A;  2EIJ C;  4L8J A;  3VQW A;  2YEV A;  2ITC C;  1N33 O;  4UCT A;  1N36 B;  1M5I A;  1Y76 B;  1V55 B;  2NN4 A;  3ZHV A;  2YIB D;  3ZMT A;  4U3F H;  4O4H A;  1WPX A;  5LBQ A;  2VQF O;  4JGS A;  2PI4 A;  1B3Q A;  1OCO B;  1YIJ V;  1HNZ B;  2HVJ C;  2XTA A;  4PI2 A;  1R1B A;  1ORQ C;  1IBK B;  3SJB C;  1Y74 A;  3DGE A;  1H2S B;  3F7V C;  2EZP A;  3AG3 B;  4PI0 A;  2UXD B;  4I4T A;  4DR2 O;  4FFK A;  4J7J A;  3SYO A;  4K8X A;  4IL6 Z;  2WLH A;  4JAA A;  1H2N A;  3GWK C;  1KP2 A;  3HKD B;  3M7M X;  5CA1 A;  3EXA A;  5CA1 B;  4OX9 B;  5LOV A;  3ZMS A;  3J80 N;  3SPG A;  1HNW B;  4J7K A;  4RUE A;  4AQY O;  4NTY A;  3S3X A;  1JMK C;  5E79 Z;  2X6A A;  1VEW A;  1MA1 A;  3RWR D;  2DYS C;  4J11 A;  5LP6 A;  1B04 A;  2B9Z A;  2HHH O;  4P2Z A;  3G6B A;  1OHH G;  4NXM O;  1K8A W;  1K7D A;  4FM0 A;  2BTQ B;  1ZL8 A;  3UM7 A;  3JAT A;  5K1P A;  1R3J C;  4UVA A;  4DW1 A;  3ASO C;  3ZRV A;  1KC8 W;  4LF9 O;  3ZMZ A;  3ZED A;  4JYB A;  1XMO B;  3ABT A;  3ETQ A;  4ASU G;  2ITD C;  2OTJ V;  3IAY A;  1YSC A;  1KKC A;  2ZXW C;  1QHT A;  4I50 A;  3OR6 C;  5IYZ A;  4RUF A;  2H94 A;  3OR7 C;  5LMU O;  2XND G;  3QTC A;  4D7S A;  3H1J H;  4OPA A;  1P4R A;  3ASN C;  1B6Q A;  4J41 A;  5CN0 A;  2BOB C;  4DV0 B;  3OTO O;  3VBB A;  1BQZ A;  3B09 A;  2LW1 A;  4AI8 A;  4JI4 O;  1FFX B;  1AR4 A;  5KX5 B;  1KD1 W;  3EHB B;  1Q6U A;  2WLI B;  1S77 D;  4E2L A;  3CP1 A;  3ETE A;  1WJZ A;  3B40 A;  3ZJZ A;  2VQF B;  1ARO P;  1CXZ B;  2UXB B;  3QF7 A;  5LGU A;  3F7Y C;  1AI7 A;  1GM7 A;  4O2A A;  3BA8 A;  2EIJ B;  1N36 O;  2QWQ B;  1O9G A;  4JZG A;  3DSQ A;  5JH7 A;  4CC5 A;  4DV7 B;  2HG5 C;  3CCM V;  4WFB V;  1MZF A;  2F93 B;  1KEC A;  1QLE C;  2KSD A;  5JQG B;  4JI5 B;  4R6Z A;  3SYC A;  2Y69 C;  4DK1 A;  1W0J G;  1E1R G;  2YID A;  4HBN A;  2DE0 X;  4TV8 A;  4JAU A;  1XQ8 A;  3B8N A;  1VIB A;  3J7A U;  5LOV B;  2VQE O;  3CHX A;  3LNN A;  4KHP O;  2PZS A;  1H2L A;  5IJ9 B;  3HB3 B;  3RGB A;  1MMM A;  4YXW G;  2WA3 A;  2WLJ A;  2Y0P A;  1NJI W;  2EIN B;  2B1G A;  4BAY A;  2HLD G;  2FML A;  4HYO A;  5KHJ A;  2PUS A;  4LF6 B;  1N34 B;  5FPR A;  3JAW A;  3K79 A;  1NS1 A;  1JJO A;  1XHZ A;  3E22 B;  4LBE C;  4LP8 A;  1JQ0 A;  4H13 B;  5FL7 G;  4U7O A;  3D36 C;  4DV4 O;  3MHS C;  3RW0 A;  3JAK B;  5H9C A;  1Q6I A;  5F2V O;  3RYF A;  2L6L A;  3HKB B;  2AW9 A;  3E89 A;  4ZBM A;  3TXS A;  1R3I C;  4WCE V;  1YF2 A;  5BMV A;  1J95 A;  2IJK A;  3G4S V;  2LFS A;  1SQB H;  1SES A;  4NB5 A;  1BQ0 A;  4DR1 B;  1S5L Z;  1IBM O;  4JYA O;  1H38 A;  3JD4 A;  1RPO A;  4JI6 B;  1OJH A;  5EC1 C;  2Q7E A;  2RDC A;  4EB6 B;  3VQV A;  5LXT B;  4QIW F;  4LF5 O;  1F23 A;  4YJ2 B;  2JK5 C;  4LH7 A;  1RPR A;  5CBH A;  2ZKO A;  4JTC B;  1XNQ B;  1Q43 A;  2AZ0 A;  3ASO B;  5LYJ B;  2A7W A;  5B1A C;  1ZTE A;  1VQ9 V;  1UPG A;  3H01 A;  4YY3 B;  1N0N A;  1NH2 B;  3CC4 V;  5J2U B;  3ASN B;  3WB0 A;  1L0L H;  4U3J B;  1Q7Y W;  1K97 A;  3KZI Z;  3OAA G;  1VQ5 V;  3OTF A;  1SQP H;  4DV2 B;  1N33 B;  2EBO A;  2QSA A;  1Z5V A;  1OZ0 A;  1YJ9 V;  1I0H A;  3OTO B;  2Q9L A;  5KHH A;  4DV5 B;  4LC1 A;  2QEX V;  3FKS G;  1YZB A;  4DUZ O;  1I94 O;  1XIL A;  5LGT A;  2EUL A;  3CSX A;  1JR9 A;  3NXS A;  4DR7 B;  4EEQ A;  4O4I B;  1AP6 A;  2XAF A;  1IX9 A;  4IHJ B;  4FFB B;  2F23 A;  4LF4 O;  2UXX A;  5C8Y B;  3ZHQ A;  1RP3 B;  2YXL A;  1UJW B;  3W7U A;  4DR3 B;  1TA8 A;  2VWJ A;  3L72 H;  3ZRW A;  3T4D A;  5JJE B;  3P3N A;  3BY6 A;  3HKD A;  1AR5 A;  4WFA V;  2YIA A;  2ZE8 A;  4UFZ A;  3STZ C;  5FLX N;  3BCC H;  1VQ4 V;  3OMI B;  1GN2 A;  4GKJ B;  1M4U A;  4RWU A;  4DV1 B;  3CWB H;  2CTR A;  3JAW B;  2XHB A;  4JI2 B;  1KUQ A;  3SPH A;  2OIG A;  2KQX A;  1YDX A;  1FJG B;  2A9H A;  2HVK C;  4H0L B;  2ZM6 B;  1NR1 A;  5B1B C;  4P30 A;  4DV6 O;  1BS3 A;  2P22 C;  1MSD A;  1ZWI C;  4GUN A;  1URF A;  3K0D A;  5L3F A;  3KCY A;  4GLX A;  4UCS A;  1VF7 A;  1FXK A;  5CBG A;  1AJP A;  1QCE A;  4UB6 Z;  1VAR A;  3JAR B;  1AB3 A;  1JJ2 U;  4NYK A;  4XDJ A;  4JF3 A;  1WAZ A;  3IC9 A;  4YHH B;  4PA9 A;  3OGC C;  1VQP V;  3W7X A;  1GRJ A;  4BIU A;  4CS2 A;  1QU7 A;  1ROP A;  3BVO A;  5J2T A;  1WA8 A;  1Z5W A;  1Q3E A;  1AVM A;  1PL0 A;  2BCC H;  4X1K B;  2X7R B;  2PY5 A;  2XAJ A;  2ZCE A;  2P5O A;  2DWE C;  2E5L B;  4J9Y B;  3D3Q A;  2CTW A;  4QPJ A;  1Q81 W;  2OYQ A;  4GX0 A;  3ZRS A;  3FYI B;  3EVK A;  3UO2 A;  4U7N A;  4YJ2 A;  3U11 A;  4DV4 B;  4CH6 A;  4ZIB A;  3CYO A;  2GDS A;  2IU3 A;  2CDY A;  3AG7 A;  2QM7 A;  2CH7 B;  3BAB A;  3I5D A;  1AJQ A;  1V9P A;  1M57 C;  2N05 A;  4ZHQ A;  1HNX B;  2Q67 A;  3JSN A;  1A32 A;  3BEH A;  3K0G A;  2BTO A;  1GM9 A;  3OUS A;  3JAS B;  2F66 C;  1K73 W;  3B8M A;  3SPJ A;  5J2T B;  3LDC A;  3RYC A;  5LHI A;  2HKO A;  2FL4 A;  5B1B B;  4YIP A;  2Q0O C;  3SDL A;  2YIC A;  2O57 A;  1L1F A;  1JA8 A;  4PA3 A;  2EJR A;  1PD3 A;  4MVQ A;  1MAB G;  4R50 A;  3BA9 A;  4IYH A;  2D2C B;  5B3S B;  2P90 A;  2ZIM A;  1VF6 C;  1IBL B;  2BTQ A;  1NZ6 A;  4D7T A;  5EZY B;  3QG5 A;  2W6I G;  3GVM A;  2CE4 A;  4LNU B;  4OX9 O;  1G4Y B;  3K5N A;  1NVP B;  4K8Z A;  3ML0 A;  4W4K A;  1TUE B;  1NTM H;  2DWD C;  1WP7 A;  3RN4 A;  3R65 A;  4IYI A;  2JIZ G;  3FX7 A;  3THO A;  1VQN V;  4DV3 B;  5L3G A;  3JAT B;  1LNQ A;  3GB7 C;  2EIM C;  1NI8 A;  3LUT B;  4UB8 Z;  1Q6H A;  5LHG A;  2R9I A;  1RFY A;  5ITZ B;  1XNR B;  4DXW A;  2QA4 V;  2A06 H;  4RO2 A;  1K5S A;  3QNE A;  4B7K A;  1ENV A;  3SR2 C;  1AI5 A;  1RM1 B;  2ZQM A;  3N2K B;  1VQ8 V;  4G27 B;  4KUM A;  2K9P A;  2YSU B;  3ABL C;  1YHQ V;  2E5L O;  3ZX6 A;  4DR5 O;  1FJG O;  2AGA A;  4LF5 B;  4PJ0 Z;  3W7T A;  3F5T A;  4WFH A;  4JI7 B;  3CXH F;  2UUA O;  4F4L A;  3WG7 C;  3APQ A;  1SQV H;  1K4C C;  1GMG A;  4EFE A;  3JD0 A;  5JVD B;  5C8Y A;  4F6R A;  1F4N A;  4GX1 A;  4PA4 A;  3JAM N;  1K3E A;  2K1E A;  1Y6X A;  4MTF A;  1P7B A;  4YHH O;  2UXC B;  3AK2 A;  3C3S A;  5GW7 A;  2WLK A;  4WF9 V;  1NU1 H;  1WP8 A;  4B3R O;  3QO7 A;  4GYC B;  4CH3 A;  3FB7 C;  1V54 B;  4RQF A;  2FTK A;  3HKE A;  1SQG A;  3NR7 A;  2JRI A;  3H1H H;  5CMU A;  2XT9 A;  2Q0A A;  4X1Y A;  1M56 B;  4FLY A;  1COW G;  4JI1 O;  2HEP A;  3O9O A;  4FIP C;  3G80 A;  3N2G B;  5DED A;  2E76 B;  2QKA A;  3DXR A;  4LH6 A;  3JD2 A;  5HFL A;  5IDJ A;  2RMK B;  3HR0 A;  3AG2 B;  3CRR A;  5K1X A;  3BFR A;  1FXH A;  4O2B B;  1XBL A;  2IW5 A;  3ZRX A;  2UUB B;  1BSM A;  4NKG B;  1EN6 A;  1OCZ B;  4BIO A;  4BW9 A;  2R72 A;  1AP5 A;  2IU0 A;  1HWY A;  3APO A;  5JJJ B;  4H44 B;  2LW7 A;  4QPK A;  2IH1 C;  1L8D A;  2UUC B;  2CK3 G;  3OT7 A;  1PNM A;  5H6Q A;  4MVO A;  4AHC A;  3H1K H;  1NVP D;  1BE3 H;  3HKE B;  4B3T O;  1GN6 A;  3E86 A;  4DUZ B;  1R6K A;  1F7Y A;  1GK9 A;  4FLV A;  3BAA A;  4LF7 O;  4NXM B;  5EBW C;  2ODM A;  4FZ1 A;  3CRA A;  2UU9 O;  3Q4H A;  4PD4 F;  4DRX A;  4DR1 O;  2YDE A;  4X64 O;  2GBO A;  2QE7 G;  1AIL A;  3X2Q B;  5E1A C;  4QGP A;  5JVD A;  5B1O A;  1THZ A;  2F95 B;  1MOF A;  2JJ1 G;  2OWO A;  1R6N A;  4TT3 G;  2P7T C;  3ABM B;  5LP6 C;  3CD6 V;  5H2F Z;  1FKA O;  2Q7H A;  2OTL V;  3EFF K;  3SPI A;  1PNL A;  1XI1 A;  5L3B A;  3TK1 A;  4BIZ A;  3JAL B;  3MAQ A;  3D8C A;  1RSO B;  4GZR B;  1KP3 A;  1F4M A;  4JI4 B;  3G6E V;  3ZHU A;  1K92 A;  2HR3 A;  2LO1 A;  3LNM B;  4IT5 A;  3SJC C;  4XBF A;  1R3L C;  4W4L A;  4X88 A;  2DQ0 A;  4E4E A;  4PDR A;  1VMG A;  5JH7 B;  1N8R W;  3CXC U;  3FAV B;  1KQS U;  1Y76 A;  1I08 A;  2WLL A;  4DV3 O;  4FMT A;  4QE7 A;  2W0X A;  3HKC A;  4NXN O;  4BWA A;  3ZHS A;  1MNG A;  2C2A A;  2GTS A;  3ZIA G;  3RYC B;  1EFR G;  5J2U A;  3T1H B;  4UUJ C;  4NTW A;  3UQ8 A;  1TUB A;  5GON B;  2WLI A;  4H37 A;  4PDM A;  1I7F A;  2XOK G;  1M56 C;  2QKS A;  1R73 A;  2X6B A;  3E8B A;  5LMU B;  4MSW C;  3WFV A;  1TAE A;  1VQ6 V;  2QGN A;  4IIJ A;  5C93 A;  4FLX A;  2YI9 A;  4O4L A;  4O4L B;  3OD4 A;  4X66 B;  3CS5 A;  3C90 A;  3K08 A;  4UCV A;  1FYJ A;  4GX5 A;  1S5J A;  4PEL A;  3AG4 C;  3L9D A;  2KKW A;  1SQX H;  1BZK A;  3MDS A;  3UKM A;  3D36 A;  4CS3 A;  2JEU A;  4MW8 A;  3HKB A;  1SER A;  2WA4 A;  5KMG A;  2Q69 A;  4X64 B;  2M6Y A;  2P4K A;  2ZD9 A;  3MHH C;  3L74 H;  1EN4 A;  3E2E A;  3FD9 A;  4UXN A;  3DTU B;  2JVD A;  1LUV A;  1ZL8 B;  2V4D A;  1VQO V;  3JCZ A;  2BE3 A;  3N2G A;  3M8A A;  2VRZ A;  2XAG A;  2GUZ A;  4PDL A;  2OCC B;  4EB6 A;  2Y48 A;  2EIM B;  5EC2 C;  3UCS C;  4PA6 A;  1WNS A;  4DV6 B;  2UXB O;  3IFX A;  2JDI G;  4UV8 A;  3AG1 B;  5EYP A;  2VS0 A;  2A3Q A;  3L73 H;  4FPP A;  1SC5 B;  5CA0 B;  5IY5 C;  1NTZ H;  4LF7 B;  5BMV B;  4DR2 B;  1QNM A;  5DN6 G;  4EFB A;  4ZKI A;  2M7W A;  3ZRW B;  3G71 V;  2Q73 A;  3CRQ A;  1OCR B;  2CTP A;  2P4V A;  3ZS8 C;  1VQ7 V;  1MSW D;  1XMO O;  5LHH A;  1JVM A;  3AG4 B;  2EX3 A;  1HNZ O;  2GTA A;  3OUF A;  2QM4 A;  3CCR V;  5B1N A;  1VF5 B;  1PKX A;  2CAZ C;  1G8M A;  4X66 O;  1SS3 A;  2UXN A;  1XHX A;  4DR6 O;  1XRE A;  4TV9 A;  4FLT A;  4LFB B;  2Z5U A;  2V1D A;  4TQF A;  3CCE V;  2H8P C;  3K58 A;  4RAI A;  3G67 A;  5KLV H;  3CCQ V;  4YJ3 A;  2PI5 A;  5CB4 B;  1JX9 A;  3OM3 B;  2W6J G;  2N04 A;  4LF8 B;  4X20 B;  4B3R B;  3KCX A;  3STL C;  2CUG A;  4O4J A;  3LSQ A;  4HAM A;  4FK5 C;  4LF4 B;  1HP8 A;  4PHZ A;  4DRX B;  4A5U B;  2YEV B;  5EIB D;  1NKD A;  4UCR A;  3OGI B;  4WFG A;  1CP9 A;  3RYH A;  1L0N H;  2YXY A;  3HPL C;  3PN1 A;  4TV9 B;  4DR5 B;  2KB1 A;  2E3C A;  3K06 A;  3T1Y B;  1TVK B;  3JSL A;  5ITZ A;  2HJF C;  4O4H B;  3K5L A;  4X89 A;  4B3M O;  2V7Q G;  4PDV A;  1BHB A;  4I55 A;  3RVZ A;  5LMN B;  4I9W A;  3L71 H;  3B4S A;  5LXT A;  3OFN G;  4TOI A;  3T1C A;  4KFM A;  3CCS V;  2QWP B;  3FFQ A;  1XEQ A;  1OV9 A;  4ICG A;  2AZ2 A;  4P9O A;  3FB5 C;  4KL1 A;  4MVZ A;  4BR6 A;  4K35 A;  2DOS A;  3X2Q C;  3LSU A;  3CC2 V;  3E83 A;  4F6R B;  5B5E Z;  3GWO A;  1FAF A;  4LCU C;  3CPW U;  1EZJ A;  3FB6 C;  3B77 A;  2BSK B;  3UT5 A;  3A0B Z;  1YI2 V;  4MVS A;  3F5W C;  1R3K C;  1H8H G;  4UCO A;  1HW7 A;  4UVB A;  1IBM B;  3ZHT A;  4JI2 O;  2CGN A;  3B2E E;  2BSK A;  1Y67 A;  5KMG B;  3N2K A;  3CC7 V;  1JFF B;  4IGG A;  4R8C A;  3O65 A;  3K3W A;  1K5Q A;  2ADP A;  2UUB O;  5IYZ B;  2G38 A;  4LFB O;  1U97 A;  2ARH A;  3L75 H;  1SZT A;  3A0H Z;  4X1I B;  1I5Y A;  4I0X B;  4O4J B;  1OCR C;  4K0K O;  4X20 A;  1QVF U;  3JAK A;  3CCJ V;  1QR9 A;  1P49 A;  4CBC A;  1XMQ O;  2ADQ B;  1FPO A;  1XOU A;  2PF4 E;  1GN3 A;  3AG1 C;  3ZMU A;  3E22 A;  3U0Z A;  5IT9 N;  2RCV A;  2Q7G A;  4JI1 B;  1QVG U;  4MW3 A;  1OCC C;  1J5E O;  1K33 A;  4JYC A;  2ETN A;  2OCC C;  4FLW A; 
#chains in the Genus database with same CATH homology
 1QLE C;  1M56 B;  1COW G;  4FIP C;  4R6Z A;  3SYC A;  2Y69 C;  1W0J G;  3I55 V;  1E1R G;  1FFT B;  4JTA B;  3JD2 A;  4JTD B;  2ZXW B;  2AHY A;  5HFL A;  5IDJ A;  3AG2 B;  2BOC C;  5EK0 A;  4JAU A;  3E8H A;  1FXH A;  1GM8 A;  3B8N A;  1DLB A;  5CBF A;  1XL6 A;  2IW5 A;  3ZRX A;  4QNH B;  5HFM A;  3CCL V;  3LSS A;  2ZDI C;  3HB3 B;  4YXW G;  2WLJ A;  1NJI W;  5EBM C;  2EIN B;  2B1G A;  2Q68 A;  1OCZ B;  2HLD G;  4BAY A;  3SYQ A;  5IYB O;  2Q6A A;  2IU0 A;  1HWY A;  1Q86 W;  1W0K G;  4HYO A;  4QPK A;  2IH1 C;  2HFE C;  5EBL C;  1Q82 W;  2CK3 G;  1YTF B;  1PNM A;  5CA3 A;  5H6Q A;  4MVO A;  1NH2 D;  1NVP D;  1K4D C;  3K79 A;  4X8A A;  4QJF B;  1GTO A;  5H6R A;  3ABL B;  1DF5 A;  4Q20 A;  4EKW A;  3E86 A;  4LBE C;  4LP8 A;  4MTX A;  2DYS B;  2DW4 A;  2X0L A;  4JAV A;  1JQ0 A;  1R6K A;  1EBO A;  5FL7 G;  4U7O A;  3MHS C;  1DF4 A;  1K34 A;  1AI4 A;  3RW0 A;  1GK9 A;  3I56 V;  4XDL A;  5EBW C;  3QO8 A;  5H9C A;  2QTO A;  2WPD G;  1YJW V;  2IJJ A;  1XL4 A;  2D3O W;  3OEH G;  3E89 A;  1JPX A;  3OEE G;  4OXS A;  2QE7 G;  4ZBM A;  4L87 A;  3X2Q B;  5E1A C;  1R3I C;  4WCE V;  4TSF G;  1J95 A;  5B1O A;  3W7W A;  1THZ A;  2IJK A;  4GX2 A;  4GCZ A;  1VQK V;  3G4S V;  2LFS A;  1MOF A;  2JJ1 G;  4DO2 A;  4PA7 A;  3ETG A;  1R6N A;  1SES A;  4TT3 G;  2IJH A;  2P7T C;  3ABM B;  4MVM A;  3CD6 V;  1E1Q G;  2AHZ A;  2OTL V;  2LP7 A;  3EFF K;  3SPI A;  1H38 A;  3JD4 A;  1PNL A;  1RPO A;  3ZMV A;  4J9Z B;  5L3B A;  3CME V;  5L3D A;  1AR1 B;  3TK1 A;  5EC1 C;  1S76 D;  3E8G A;  1JCH A;  2WLM A;  4BIZ A;  1SRY A;  5B1A B;  4QIW F;  2X6C A;  3CCV V;  1KP3 A;  1F4M A;  2JEX A;  1FXV A;  1F23 A;  1MG1 A;  1FXK B;  3G6E V;  1K92 A;  2HR3 A;  4TWK A;  2JK5 C;  1CPY A;  1OCO C;  1RPR A;  2ZDI A;  1Y66 A;  5CBH A;  4JTC B;  3E8F A;  3LNM B;  1H2G A;  4XBF A;  1R3L C;  3ASO B;  3LDD A;  5LGN A;  5BZB A;  4X88 A;  2DQ0 A;  5B1A C;  3KG2 A;  1VQ9 V;  1Y4M A;  5KUK A;  4PDR A;  2XAQ A;  3H01 A;  1N8R W;  3CXC U;  3K04 A;  1KQS U;  1YTF D;  1NH2 B;  1VQM V;  3CC4 V;  2WLL A;  3ABM C;  3CCU V;  3ASN B;  4FMT A;  4QE7 A;  2XAH A;  1Q7Y W;  2GHY A;  3M99 B;  1K97 A;  2C2A A;  3ZIA G;  1K9M W;  3RBZ A;  4N21 A;  1QBZ A;  3OAA G;  3SYA A;  5B3S C;  4H33 A;  1VQ5 V;  1EFR G;  4FJC C;  4UUJ C;  2EBO A;  2Y69 B;  1OCC B;  4BW5 A;  1S0V A;  1F51 A;  1VQL V;  2WLI A;  2ZR2 A;  4H37 A;  4PDM A;  2XOK G;  1OZ0 A;  1YJ9 V;  1M56 C;  2QKS A;  1M90 W;  1R73 A;  4KP4 A;  2A79 B;  2X6B A;  4HZ3 A;  3QO5 A;  3A0R A;  4LC1 A;  2QEX V;  3JD1 A;  2A0L A;  3OMA B;  4WFF A;  3FKS G;  3E8B A;  1H8E G;  1M57 B;  2EIK B;  3MD0 A;  5LGT A;  4MSW C;  4WFE A;  3OMN B;  3WFV A;  1FS0 G;  1VQ6 V;  5C93 A;  4MVU A;  1S5H C;  3FYE B;  3NXS A;  3PJS K;  2XAF A;  2EIL C;  1AI6 A;  2F43 G;  2JJ2 G;  3CMA V;  2UXX A;  3K08 A;  5IYD O;  3SYP A;  1QLN A;  1OCZ C;  1UJW B;  3W7U A;  4GX5 A;  2IH3 C;  4PEL A;  3AG4 C;  3ZRW A;  1JOY A;  3T4D A;  3BY6 A;  1V55 C;  1GKF A;  3UKM A;  3D36 A;  4WFA V;  2OT5 A;  3SPC A;  4P9P A;  4UV9 A;  3RVY A;  2JEU A;  4MW8 A;  3P30 A;  1SER A;  3STZ C;  1DTO A;  4QE9 A;  1NR7 A;  5KA5 A;  2Q69 A;  1VQ4 V;  2EZO A;  2B5U A;  1YIT V;  1IXM A;  2ZD9 A;  3MHH C;  3OMI B;  3E2E A;  4UXN A;  3DTU B;  3JYC A;  3TET A;  1NQT A;  3D3I A;  4R7C A;  3ZCC A;  3SPH A;  2B1I A;  4Z1M G;  1VQO V;  3JCZ A;  3OE7 G;  2A9H A;  4MS2 A;  2HVK C;  4G2K A;  2XAG A;  5KUM A;  1NR1 A;  4PDL A;  2OCC B;  5B1B C;  4P30 A;  2WLN A;  2ZR3 A;  4RQE A;  1ZWI C;  1S72 V;  2Y48 A;  3K0D A;  2EIM B;  5L3F A;  1V54 C;  5EC2 C;  1FXK A;  1I5X A;  3ETD A;  5CBG A;  4PA6 A;  2MK3 A;  2W0F C;  2IJI A;  1AJP A;  1QCE A;  3IC7 A;  1YJN V;  2EIJ C;  4JAS A;  3IFX A;  2JDI G;  2QM8 A;  4UV8 A;  3AG1 B;  1JJ2 U;  2YEV A;  4XDJ A;  4FPP A;  4JF3 A;  4PA9 A;  2ITC C;  3OGC C;  1VQP V;  3T2M A;  5IY5 C;  3W7X A;  5DN6 G;  4ZKI A;  4BIU A;  2M7W A;  3ZRW B;  3G71 V;  5L3E A;  1OCR B;  1ROP A;  2DYR B;  1V55 B;  1W2B U;  2LFR A;  1VQ7 V;  1MSW D;  3ZMT A;  1PL0 A;  5LHH A;  1JVM A;  3AG4 B;  2X7R B;  3WG7 B;  2XAJ A;  4I5S A;  3OUF A;  2DWE C;  1WPX A;  5LBQ A;  1PNK A;  4J9Y B;  4JGS A;  3CCR V;  5IYC O;  3ABU A;  2PI4 A;  5B1N A;  5IY5 B;  1OCO B;  1PKX A;  1G8M A;  4QPJ A;  1YIJ V;  1Q81 W;  3OW2 U;  4GX0 A;  2UXN A;  3ZRS A;  3FYI B;  2HVJ C;  4U7N A;  1BHA A;  2DYR C;  3CYO A;  1ORQ C;  2Z5U A;  2IU3 A;  1RM1 C;  2V1D A;  3DGE A;  1M1K W;  1QR8 A;  3F7V C;  2QM7 A;  3CCE V;  2EZP A;  2H8P C;  3AG3 B;  4RAI A;  3ABK C;  1AJQ A;  1M57 C;  2Q67 A;  3BEH A;  3CCQ V;  3K0G A;  2PI5 A;  1GM9 A;  3OUS A;  3SYO A;  5J9P C;  2WLH A;  2R9R B;  1K73 W;  3B8M A;  3SPJ A;  4MT8 A;  1JX9 A;  3OM3 B;  2W6J G;  3ABK B;  3JD3 A;  3LDC A;  1KP2 A;  5LHI A;  2HKO A;  3STL C;  1S3J A;  3ZMS A;  3LSQ A;  5B1B B;  4HAM A;  4FK5 C;  3VOU A;  2NNU A;  3SPG A;  4RUE A;  2YEV B;  1L1F A;  1NKD A;  3AG3 C;  4PA3 A;  2EJR A;  2X6A A;  3T4Z A;  1PD3 A;  2DYS C;  2WLL B;  4MVQ A;  1MAB G;  4WFG A;  1CP9 A;  4R50 A;  2P67 A;  2DQ3 A;  2NLJ C;  5B3S B;  4P2Z A;  1OHH G;  2P90 A;  3HPL C;  2GSM B;  2KB1 A;  3K06 A;  2Z3Y A;  1K8A W;  5DM6 V;  2HJF C;  1K7D A;  4X89 A;  2V7Q G;  4PDV A;  1BHB A;  3RVZ A;  2ATK C;  4I9W A;  3UM7 A;  2W6I G;  1R3J C;  4UVA A;  5L3C A;  3ASO C;  3IGA C;  3OFN G;  4N23 A;  3ZRV A;  1KC8 W;  3T1C A;  4KFM A;  3CCS V;  1G4Y B;  1NBM G;  3ZMZ A;  1NVP B;  4JYB A;  3ML0 A;  1TUE B;  3ABT A;  2DWD C;  3ZN0 A;  4ASU G;  2ITD C;  4P9O A;  3R65 A;  3FB5 C;  2OTJ V;  1AJN A;  2JIZ G;  4JPR A;  4MVZ A;  1VQN V;  1YSC A;  5L3G A;  1M9N A;  2ZXW C;  1LNQ A;  1BL8 A;  3GB7 C;  2EIM C;  3K9A A;  3OR6 C;  3X2Q C;  3CC2 V;  3LUT B;  3E83 A;  4RUF A;  2H94 A;  3OR7 C;  5LHG A;  2R9I A;  3GWO A;  3P32 A;  4G28 B;  4DXW A;  2XND G;  4LCU C;  3W7S A;  3CPW U;  2QA4 V;  1EZJ A;  3FB6 C;  3E35 A;  4RO2 A;  1K5S A;  3SJQ C;  2XAS A;  3B77 A;  3QNE A;  1YI2 V;  1P4R A;  3ASN C;  4MTG A;  4MVS A;  1B6Q A;  1ENV A;  5CN0 A;  3F5W C;  1AI5 A;  1R3K C;  2BOB C;  1RM1 B;  1H8H G;  2ZQM A;  2WWW A;  4UVB A;  1VQ8 V;  1CEZ A;  4G27 B;  4KUM A;  2YSU B;  3VBB A;  3ABL C;  4CZZ A;  1YHQ V;  1SET A;  1GO3 F;  3LDE A;  1KKD A;  2WAM A;  1BMF G;  3TCU A;  4R8C A;  3CC7 V;  3W7T A;  1KD1 W;  3K3W A;  1K5Q A;  4WFH A;  3EHB B;  2WLI B;  3FB8 C;  1S77 D;  2P6J A;  4F4L A;  4MTO A;  4E2L A;  3CP1 A;  3WG7 C;  2WSS G;  2EIL B;  1K4C C;  1GMG A;  3AEI A;  2EIN C;  1SZT A;  3ETE A;  1I5Y A;  3JD0 A;  1OCR C;  1F4N A;  4GX1 A;  4PA4 A;  3ZJZ A;  1QVF U;  3CCJ V;  1QR9 A;  4CBC A;  1K3E A;  1ARO P;  2K1E A;  4MTF A;  5LGU A;  1P7B A;  1FXK C;  1E79 G;  3F7Y C;  1AI7 A;  3ZN1 A;  5GW7 A;  2WLK A;  1GM7 A;  5KA6 A;  3AG1 C;  3ZMU A;  4WF9 V;  4UVC A;  2EIJ B;  4MVR A;  4GT1 A;  3QO7 A;  3FB7 C;  1V54 B;  4RQF A;  1WLE A;  2FTK A;  2EIK C;  1QVG U;  4MW3 A;  1OCC C;  5CMU A;  1K33 A;  2HG5 C;  3CCM V;  4WFB V;  4JYC A;  2OCC C;  3K03 A;  1QLE B;  4XDK A;  3AG2 C;  1KEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...