1VQ8O

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1vq8O00
3CXCK 3CCRO 3G71O 1YITO 1VQ7O 3G4SO 1YIJO 1M1KM 2QA4L 3CMAL 1VQ5O 1QVFN 3OW2N 1KD1M 1K73M 1Q82P 3CCEL 3CD6L 1VQPL 1YI2L 1Q86P 3CCMO 1K9MM 1VQ8O 1KQSK 1YHQL 3CMAO 1VQML 3CCRL 1S72L 3G71L 1Q7YM 1YITL 3G4SL 3CCEO 3CC4O 3I55L 1VQPO 1Q81M 1VQ5L 1QVGK 3CCQO 1YJWO 1N8RM 1VQMO 1S72O 3CCML 1VQOO 3I55O 1VQ8L 3CPWN 1NJIP 1QVFK 3CC4L 3CC2O 1VQKO 3CCQL 1JJ2K 1YJWL 1K8AP 1Q82M 3CXCN 1VQOL 1K73P 3CCJO 1VQ9O 2OTLO 1M90P 3CC2L 1VQKL 1VQ6O 1VQNL 1YJ9L 1W2BN 1KQSN 3G6EO 1KC8P 1VQ4L 3OW2K 1VQLL 1VQNO 3CCJL 1VQ9L 2OTJO 1QVGN 3CMEO 2OTLL 1YJ9O 1NJIM 1M1KP 1VQ4O 1VQ6L 1Q86M 3CC7O 1KD1P 3CCVO 1YJNO 1VQLO 3G6EL 1K8AM 3I56L 2QEXO 3CCSO 1K9MP 3CCUO 2OTJL 1Q7YP 3CMEL 1JJ2N 3I56O 1M90M 3CCLL 1Q81P 2QA4O 1W2BK 3CC7L 3CPWK 3CCVL 1YJNL 1N8RP 1VQ7L 1YIJL 3CD6O 2QEXL 1KC8M 1YI2O 3CCSL 3CCLO 3CCUL 1YHQO
chains in the Genus database with same CATH superfamily
3CXCK 3CCRO 3G71O 1YITO 1VQ7O 3G4SO 1YIJO 1M1KM 2QA4L 3CMAL 1VQ5O 1QVFN 5DLJA 3OW2N 1KD1M 1K73M 1Q82P 3CCEL 3CD6L 1VQPL 5DQZA 1YI2L 1Q86P 4WJ0A 3CCMO 1K9MM 1VQ8O 1KQSK 1YHQL 3CMAO 1VQML 3CCRL 1S72L 3G71L 1Q7YM 1YITL 3NKDA 3G4SL 3CCEO 3CC4O 3I55L 1VQPO 1Q81M 1VQ5L 1QVGK 4N06A 3CCQO 1YJWO 3GODA 1N8RM 1VQMO 1S72O 4XTKA 3CCML 1VQOO 3I55O 5DS6A 1VQ8L 3CPWN 1NJIP 1QVFK 5DS5A 3CC4L 3CC2O 1VQKO 3CCQL 1JJ2K 1YJWL 1K8AP 1Q82M 3CXCN 5FCLA 1VQOL 1K73P 3CCJO 1VQ9O 2OTLO 1M90P 3CC2L 1VQKL 1VQ6O 1VQNL 1YJ9L 1W2BN 1KQSN 3G6EO 1KC8P 1VQ4L 3OW2K 1VQLL 1VQNO 3CCJL 1VQ9L 2OTJO 1QVGN 4QDLA 3CMEO 2OTLL 1YJ9O 1NJIM 1M1KP 4P6IC 1VQ4O 1VQ6L 3CC7O 1Q86M 1KD1P 3CCVO 1YJNO 1VQLO 3G6EL 1K8AM 3I56L 2QEXO 3CCSO 1K9MP 3CCUO 2YZSA 2OTJL 1Q7YP 3CMEL 1JJ2N 4W8KA 3I56O 1M90M 3CCLL 1Q81P 2QA4O 1W2BK 3CC7L 3CPWK 3CCVL 1YJNL 1N8RP 1VQ7L 5DS4A 1YIJL 5DQTA 3CD6O 2QEXL 1KC8M 1YI2O 3CCSL 3CCLO 3CCUL 1YHQO
chains in the Genus database with same CATH topology
3CXCK 3CCRO 3G71O 1YITO 1VQ7O 3G4SO 1YIJO 1M1KM 2QA4L 3CMAL 1VQ5O 1QVFN 5DLJA 3OW2N 1KD1M 1K73M 1Q82P 3CCEL 3CD6L 1VQPL 5DQZA 1YI2L 1Q86P 4WJ0A 3CCMO 1K9MM 1VQ8O 1KQSK 1YHQL 3CMAO 1VQML 3CCRL 1S72L 3G71L 1Q7YM 1YITL 3NKDA 3G4SL 3CCEO 3CC4O 3I55L 1VQPO 1Q81M 1VQ5L 1QVGK 4N06A 3CCQO 1YJWO 3GODA 1N8RM 1VQMO 1S72O 4XTKA 3CCML 1VQOO 3I55O 5DS6A 1VQ8L 3CPWN 1NJIP 1QVFK 5DS5A 3CC4L 3CC2O 1VQKO 3CCQL 1JJ2K 1YJWL 1K8AP 1Q82M 3CXCN 5FCLA 1VQOL 1K73P 3CCJO 1VQ9O 2OTLO 1M90P 3CC2L 1VQKL 1VQ6O 1VQNL 1YJ9L 1W2BN 1KQSN 3G6EO 1KC8P 1VQ4L 3OW2K 1VQLL 1VQNO 3CCJL 1VQ9L 2OTJO 1QVGN 4QDLA 3CMEO 2OTLL 1YJ9O 1NJIM 1M1KP 4P6IC 1VQ4O 1VQ6L 3CC7O 1Q86M 1KD1P 3CCVO 1YJNO 1VQLO 3G6EL 1K8AM 3I56L 2QEXO 3CCSO 1K9MP 3CCUO 2YZSA 2OTJL 1Q7YP 3CMEL 1JJ2N 4W8KA 3I56O 1M90M 3CCLL 1Q81P 2QA4O 1W2BK 3CC7L 3CPWK 3CCVL 1YJNL 1N8RP 1VQ7L 5DS4A 1YIJL 5DQTA 3CD6O 2QEXL 1KC8M 1YI2O 3CCSL 3CCLO 3CCUL 1YHQO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC K;  3CCR O;  3G71 O;  1YIT O;  1VQ7 O;  3G4S O;  1YIJ O;  1M1K M;  2QA4 L;  3CMA L;  1VQ5 O;  1QVF N;  3OW2 N;  1KD1 M;  1K73 M;  1Q82 P;  3CCE L;  3CD6 L;  1VQP L;  1YI2 L;  1Q86 P;  3CCM O;  1K9M M;  1VQ8 O;  1KQS K;  1YHQ L;  3CMA O;  1VQM L;  3CCR L;  1S72 L;  3G71 L;  1Q7Y M;  1YIT L;  3G4S L;  3CCE O;  3CC4 O;  3I55 L;  1VQP O;  1Q81 M;  1VQ5 L;  1QVG K;  3CCQ O;  1YJW O;  1N8R M;  1VQM O;  1S72 O;  3CCM L;  1VQO O;  3I55 O;  1VQ8 L;  3CPW N;  1NJI P;  1QVF K;  3CC4 L;  3CC2 O;  1VQK O;  3CCQ L;  1JJ2 K;  1YJW L;  1K8A P;  1Q82 M;  3CXC N;  1VQO L;  1K73 P;  3CCJ O;  1VQ9 O;  2OTL O;  1M90 P;  3CC2 L;  1VQK L;  1VQ6 O;  1VQN L;  1YJ9 L;  1W2B N;  1KQS N;  3G6E O;  1KC8 P;  1VQ4 L;  3OW2 K;  1VQL L;  1VQN O;  3CCJ L;  1VQ9 L;  2OTJ O;  1QVG N;  3CME O;  2OTL L;  1YJ9 O;  1NJI M;  1M1K P;  1VQ4 O;  1VQ6 L;  1Q86 M;  3CC7 O;  1KD1 P;  3CCV O;  1YJN O;  1VQL O;  3G6E L;  1K8A M;  3I56 L;  2QEX O;  3CCS O;  1K9M P;  3CCU O;  2OTJ L;  1Q7Y P;  3CME L;  1JJ2 N;  3I56 O;  1M90 M;  3CCL L;  1Q81 P;  2QA4 O;  1W2B K;  3CC7 L;  3CPW K;  3CCV L;  1YJN L;  1N8R P;  1VQ7 L;  1YIJ L;  3CD6 O;  2QEX L;  1KC8 M;  1YI2 O;  3CCS L;  3CCL O;  3CCU L;  1YHQ O; 
#chains in the Genus database with same CATH topology
 3CXC K;  3CCR O;  3G71 O;  1YIT O;  1VQ7 O;  3G4S O;  1YIJ O;  1M1K M;  2QA4 L;  3CMA L;  1VQ5 O;  1QVF N;  5DLJ A;  3OW2 N;  1KD1 M;  1K73 M;  1Q82 P;  3CCE L;  3CD6 L;  1VQP L;  5DQZ A;  1YI2 L;  1Q86 P;  4WJ0 A;  3CCM O;  1K9M M;  1VQ8 O;  1KQS K;  1YHQ L;  3CMA O;  1VQM L;  3CCR L;  1S72 L;  3G71 L;  1Q7Y M;  1YIT L;  3NKD A;  3G4S L;  3CCE O;  3CC4 O;  3I55 L;  1VQP O;  1Q81 M;  1VQ5 L;  1QVG K;  4N06 A;  3CCQ O;  1YJW O;  3GOD A;  1N8R M;  1VQM O;  1S72 O;  4XTK A;  3CCM L;  1VQO O;  3I55 O;  5DS6 A;  1VQ8 L;  3CPW N;  1NJI P;  1QVF K;  5DS5 A;  3CC4 L;  3CC2 O;  1VQK O;  3CCQ L;  1JJ2 K;  1YJW L;  1K8A P;  1Q82 M;  3CXC N;  5FCL A;  1VQO L;  1K73 P;  3CCJ O;  1VQ9 O;  2OTL O;  1M90 P;  3CC2 L;  1VQK L;  1VQ6 O;  1VQN L;  1YJ9 L;  1W2B N;  1KQS N;  3G6E O;  1KC8 P;  1VQ4 L;  3OW2 K;  1VQL L;  1VQN O;  3CCJ L;  1VQ9 L;  2OTJ O;  1QVG N;  4QDL A;  3CME O;  2OTL L;  1YJ9 O;  1NJI M;  1M1K P;  4P6I C;  1VQ4 O;  1VQ6 L;  3CC7 O;  1Q86 M;  1KD1 P;  3CCV O;  1YJN O;  1VQL O;  3G6E L;  1K8A M;  3I56 L;  2QEX O;  3CCS O;  1K9M P;  3CCU O;  2YZS A;  2OTJ L;  1Q7Y P;  3CME L;  1JJ2 N;  4W8K A;  3I56 O;  1M90 M;  3CCL L;  1Q81 P;  2QA4 O;  1W2B K;  3CC7 L;  3CPW K;  3CCV L;  1YJN L;  1N8R P;  1VQ7 L;  5DS4 A;  1YIJ L;  5DQT A;  3CD6 O;  2QEX L;  1KC8 M;  1YI2 O;  3CCS L;  3CCL O;  3CCU L;  1YHQ O; 
#chains in the Genus database with same CATH homology
 3CXC K;  3CCR O;  3G71 O;  1YIT O;  1VQ7 O;  3G4S O;  1YIJ O;  1M1K M;  2QA4 L;  3CMA L;  1VQ5 O;  1QVF N;  5DLJ A;  3OW2 N;  1KD1 M;  1K73 M;  1Q82 P;  3CCE L;  3CD6 L;  1VQP L;  5DQZ A;  1YI2 L;  1Q86 P;  4WJ0 A;  3CCM O;  1K9M M;  1VQ8 O;  1KQS K;  1YHQ L;  3CMA O;  1VQM L;  3CCR L;  1S72 L;  3G71 L;  1Q7Y M;  1YIT L;  3NKD A;  3G4S L;  3CCE O;  3CC4 O;  3I55 L;  1VQP O;  1Q81 M;  1VQ5 L;  1QVG K;  4N06 A;  3CCQ O;  1YJW O;  3GOD A;  1N8R M;  1VQM O;  1S72 O;  4XTK A;  3CCM L;  1VQO O;  3I55 O;  5DS6 A;  1VQ8 L;  3CPW N;  1NJI P;  1QVF K;  5DS5 A;  3CC4 L;  3CC2 O;  1VQK O;  3CCQ L;  1JJ2 K;  1YJW L;  1K8A P;  1Q82 M;  3CXC N;  5FCL A;  1VQO L;  1K73 P;  3CCJ O;  1VQ9 O;  2OTL O;  1M90 P;  3CC2 L;  1VQK L;  1VQ6 O;  1VQN L;  1YJ9 L;  1W2B N;  1KQS N;  3G6E O;  1KC8 P;  1VQ4 L;  3OW2 K;  1VQL L;  1VQN O;  3CCJ L;  1VQ9 L;  2OTJ O;  1QVG N;  4QDL A;  3CME O;  2OTL L;  1YJ9 O;  1NJI M;  1M1K P;  4P6I C;  1VQ4 O;  1VQ6 L;  3CC7 O;  1Q86 M;  1KD1 P;  3CCV O;  1YJN O;  1VQL O;  3G6E L;  1K8A M;  3I56 L;  2QEX O;  3CCS O;  1K9M P;  3CCU O;  2YZS A;  2OTJ L;  1Q7Y P;  3CME L;  1JJ2 N;  4W8K A;  3I56 O;  1M90 M;  3CCL L;  1Q81 P;  2QA4 O;  1W2B K;  3CC7 L;  3CPW K;  3CCV L;  1YJN L;  1N8R P;  1VQ7 L;  5DS4 A;  1YIJ L;  5DQT A;  3CD6 O;  2QEX L;  1KC8 M;  1YI2 O;  3CCS L;  3CCL O;  3CCU L;  1YHQ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...