1VQ9S

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vq9S00
4QQBA 2M4MA 2MGZB 2MXYA 2RUGA 3G8TA 2OTJS 1WHYA 3CCUS 2RS2A 1KQSR 5DDQC 1B7FA 5GMKa 4W92B 2DGXA 2DHSA 1YJ9S 1FJCA 3DLLQ 3UE2A 2MQQA 4TU9A 3S8SA 3BO3A 4UY8T 1YITS 3G4SS 3BO4A 3IRWP 1YIJS 2CPIA 1M5OC 1NJIT 2EK6A 1S72S 4RU2A 1U1MA 3ZZYA 2CQIA 3N9UC 2YWKA 2DO4A 2NZ4A 2ZJPQ 2RQ4A 3NS6A 5IQQA 2PEHA 2FC8A 2KXFA 3MD1A 2XS7A 3US5A 2DGSA 2E5IA 2MQOA 1M1KT 5H1SV 3EX7B 1YTYA 3PIOQ 4V19X 2MQMA 1QM9A 1UFWA 2DNRA 1OO0B 3CTRA 3VAKA 2LXIA 2M88A 4IOCQ 3NNCA 2K3KA 4WFBQ 3I56S 1U1OA 2DIVA 2KVIA 3G9CA 2ADCA 2DH7A 2DITA 1JJHA 1F9FA 2RVJA 1D9AA 1ZH5A 2VOOA 2E5JA 2E5GA 2KU7A 2MZRA 3VALA 2DH9A 2AYMA 3SMZA 1YJNS 4PR6A 1JMTA 2LECA 3NMRA 3H2VE 1X4EA 2CQ4A 3B4MA 1K8AT 1KOOA 2L08A 1VC5A 2DISA 2DNMA 2HGLA 4C0OC 2LKZA 2N3LA 2ADBA 2A3JA 5GAHU 3V4MA 1D8ZA 1FJ7A 2DNLA 1VC0A 2MY8A 2MQPA 5D78A 2HGMA 3CMAS 1N52B 4Y00A 2MY7A 1S79A 2OJ3A 2M8HA 5GADU 1VQ9S 1N8RT 2CPYA 4YOEA 2CPXA 1WHXA 2Q79A 4J5OA 3CCQS 4OZ0A 5IM0B 2PE8A 2N82B 3UWTA 3PIPQ 2LQ5A 1U1PA 1WG1A 2MZJA 1R8HA 1WEZA 1WHWA 3S01A 2B0GA 2MZTA 1WTBA 5D77A 1KC8T 2MQLA 1X4FA 2KG0A 3NNAA 2FHOB 5LSLA 2CPDA 5FJ4A 1VQPS 2KRRA 2JRSA 3THTA 1JJ4A 1SJRA 4IO9Q 2MYFA 2DNNA 1M5PC 3CUNA 1UP1A 1SJFA 3BS9A 2E44A 2MGZA 2VODA 2OSQA 2AYBA 1FXLA 2MJNA 2MKSA 3MOJB 3OW2R 2LA6A 2DGVA 2HZCA 4WIIA 1ZZFA 4ERDA 1H2TZ 1WF2A 3FEYB 5JVHQ 1VQOS 4Y0FA 1UAWA 3S6EA 3SDEA 3U1LA 1X4CA 3CCLS 2LMIA 2L41A 2K8GA 1WEXA 1VQ7S 2XS5A 2E5HA 4PKDB 3G8SA 3I55S 1Q82T 3BO2A 2QFJA 3P49B 2MQNA 3SDEB 1SJ4P 2CQ3A 2HGNA 2D9PA 2LXUA 4CIOA 1SJ3P 3VF0B 1U6BA 3J7YU 2DNQA 3MXHP 2YH0A 3EGNA 2CQBA 2J0QD 5CA5A 2J0SD 2KM8B 2XS2A 3R1LA 2RRBA 3CCES 1VC6A 3EGZA 2MMYA 2GO9A 1FHTA 1URNA 1UW4A 2DGQA 1PO6A 1VBZA 4QU7A 3NNHA 1VQLS 3TP2A 3Q2SC 1VQ5S 2ERRA 1WHVA 2X1BA 3UCUP 2DO0A 2SXLA 1NO8A 3MUVP 3VAHA 3CCMS 4P6QA 1WWHA 4WFNQ 5IM0A 3LPYA 1DZ5A 5IFMA 2M2BA 2M70A 2DGWA 3D2WA 1P27B 4WKRA 1HD1A 5HL7Q 2LCWA 3HHNB 1Q86T 2XSFA 3Q2TC 3CC4S 3J7ZT 5ITHA 3VAGA 4QU6A 1WELA 2XB2D 2I2YA 1N88A 3K0JA 2CQ0A 2MZQA 1VQ8S 2MKIA 2DNZA 3IWNC 1RK8A 3FEXB 3G6ES 4YB1P 1HL6A 2KHCA 4WF9Q 5LSOA 5JVGQ 4LMZA 2MKHA 1U2FA 1XN9A 1FT8A 4CH1A 3CPWR 3R27A 1RKJA 2QEXS 2HYIB 1FO1A 1H6KX 5DDOC 1HD0A 4TLQA 1IQTA 1YI2S 4YUDA 3CCRS 4CQ1A 1Q81T 1NU4A 2YH1A 2M52A 2X1GA 4F25A 1OWXA 3UCZP 1U1RA 2CJKA 2YKAA 2N7CA 2D9OA 3CULA 5DDRC 1YHQS 2ZJQQ 5DM7Q 2CQPA 2DNYA 4CH0S 1VQKS 3G71S 3BEGB 4LIRA 2KXHA 2DB1A 2MHNA 2JX2A 1QVGR 2DNGA 1WG5A 4WFAQ 1M5KC 2RQCA 3CCSS 1L3KA 1W2BR 1WI8A 4PRFA 4WCEQ 2I38A 4FXWA 1X4GA 5LXRA 4OZ1A 2OSRA 5BJRA 4F02A 1U1QA 1VBYA 5GAEU 4IUFA 2CPZA 2AYEA 2WBRA 2KRBA 3ZZZA 3THPA 3CF5Q 3ULHA 1K9MT 2DGUA 3MUMP 2YTCA 3JB9k 2DK2A 1U1LA 1PGZA 2NLWA 5EN1A 5DM6Q 3MD3A 2M9KA 2AD9A 1X5SA 2FY1A 2QA4S 1DBDA 1X4AA 1SXLA 2U1AA 4FXVA 5HO4A 2CPJA 2F9DA 4ED5A 3TO8A 1OPIA 1QVFR 2KN4A 1AUDA 2BZ2A 1X5TA 1DRZA 2CQ1A 2LEBA 1VQNS 2G1DA 4Z2XA 2MPUA 1P1TA 1X4DA 2RNEA 1A9NB 3MDFA 2KFYA 4F26A 1WF1A 1FJEB 3VAMA 2V94A 5LXYA 4W90B 3TYTA 1Q7YT 2CQDA 3B4DA 3P5TL 2LA4A 2DNKA 5GAGU 1YWXA 2DH8A 3VAFA 3R1HA 1M5VC 2RRAA 2F9JA 2CPHA 2DNPA 4TU7A 2LYVA 4BS2A 2KI2A 1G2EA 2RS8A 2N3OA 2M0GB 2J76E 2G0CA 2DHGA 2KT5A 3DXBA 1JJ2R 2OTLS 1FNXH 2J8AA 1X4BA 2UP1A 4ZKAA 2KYXA 1K73T 5DDPC 2CQ2A 1X4HA 2MSTA 4UQTA 5LJ3Y 2JVRA 1M90T 2CPEA 4LJMA 3UD3P 5GVQA 3U1MA 3MI7X 3CC7S 3VAJA 3CXCR 1N54B 4U67Q 1YJWS 2JVOA 2MKCA 2D3OR 2FPHX 1KD1T 1H2UX 2CQCA 4EGLA 5CYJA 1BY9A 1VBXA 3MURP 2MZSA 3P3DA 2X1AA 2KG1A 3CC2S 3VAIA 1X0FA 3L3CA 2XNQA 2MB0B 1WF0A 2KXNB 2MJUA 1HA1A 2LEAA 3NS5A 2L9WA 1WEYA 4M5DB 2O3DA 1SJQA 1U1KA 1CVJA 1OIAA 3LQVA 3RW6A 3HI9A 1X5PA 2RT3A 3CMES 3UCGA 2GHPA 2MKJA 1U1NA 2AYGA 4TU8A 2M7SA 3P6YC 1X5OA 2U2FA 1U6FA 2MSSA 3CCVS 1VQ6S 3SXLA 2F3JA 1DHMA 2ZJRQ 2XNRA 3CD6S 1WI6A 3UD4P 1O0PA 1WG4A 1R8PA 2OIHA 2HVZA 3G96A 5DETA 2DNHA 2MZ1A 2RU3A 2JWNA 1H2VZ 5LJ5Y 2FC9A 1A7GE 2G4BA 2CPFA 1KOHA 2VONA 3CCJS 2KM8C 2EVZA 1VQMS 2KH9A 2X1FA 2DHXA 2BOPA 3MUTP 3H2UB 3S7RA 2CQGA 4A8XA 5CXTA 2MKKA 2EK1A 4IOAQ 2DIUA 3RW7A 5MLCV 2DGTA 4C7QA 2VOPA 2M8DB 2DGOA 2DNOA 2CQHA 2DHAA 4C4WA 1ZZNA 1VQ4S 4QPTA
chains in the Genus database with same CATH superfamily
5KFSA 3W2VB 3N5FA 4P74A 4PUOA 1OMSA 5LL6d 5E33A 5J1EA 3HHKA 1D0EA 3AOBA 1JXLA 2JFKA 3GE9A 2D3O1 2HBYB 1FX2A 1PAUB 3G8TA 2LLZA 3SIPB 5AE1A 4IH7A 4UOGA 2Q66A 2RS2A 1KQSR 1ICEB 2WVDA 3BREA 5A0YA 4QCLA 3RUBL 3P45B 3PM9A 4OFZA 3D4JA 2VDHA 2FHJD 2HK3A 1NKEA 1C0TA 3LH2S 1YJ9S 3RZAA 1IBKJ 2V8PA 2WOMB 1HWKA 5HP1A 2HHTA 2W4PA 4LQ9A 3UE2A 3DLKB 4XAKA 1R0AA 4UY8T 3BO3A 4GRSA 3KTQA 1SQFA 4K7QA 3IWLA 2A2CA 3PY8A 3G4SS 3BO4A 5H9EJ 5HN0A 1N4LA 2O66A 2WZ1A 1CJTB 3HVTB 4MFBB 1NKBA 5ETNA 1VGYA 1NJIT 2EK6A 4USMA 4QOTA 4DV0J 4O4RA 1U1MA 3GWCA 3M8YA 1XK8A 3BH7B 4JI1J 3LP2A 4QIVA 3KJQB 5KFUA 1IBCB 3C6TB 2ATLA 4J9SA 2CJAA 1LW2A 1R89A 5ETSA 1R7IA 2XYHB 3ZZOA 4CTAA 5D0HA 1M1KT 3EX7B 2XI2A 3K59A 1UFWA 1HQEB 2XULA 2DNRA 2OGUA 3PYEA 3R5GA 4DR5J 2UXDF 1CJVB 1OO0B 1ZETA 5C24A 2OPPB 3QPIA 4GKJF 1GXLA 1TUVA 1YJRA 2AZ3A 2LXIA 2M88A 3NG8A 4AT1B 5ADZA 2OPSB 4IOCQ 1Q79A 3T3FA 4OYWA 4CI0B 4F36A 4WFBQ 4H4OA 1SH3A 2RF2B 2V34A 2VHGA 3G9CA 2BA9A 1NH8A 2ADCA 1S9EB 3K8WA 1JJHA 3C16B 3OV7A 1F9FA 2RVJA 3DRXA 3SYZA 4WIQA 2C22A 1M0SA 1D9AA 2B9YA 3C15A 5F3TA 2BE7D 3EGVA 3LP1B 3GJRB 3Q86A 4C11B 3DLHA 2MZRA 1AA1B 1LXJA 2QYGA 3FMBA 5DQHA 3MMCB 1VYAA 1GXUA 3UQSA 2K1RA 4A8KA 1YJNS 1JMTA 4CLTA 5DGBA 3NMRA 3H2VE 2HFNA 3SSRA 5KFGA 2HHSA 1CG2A 4B9TA 3RR8A 1V6HA 1ZM3A 3GMGA 3T19A 2VA2A 3DHXA 1KOOA 4UOHA 2L08A 3UN5A 2WVBA 1URRA 3I5CA 4N8NA 3PDNA 3PW2A 2CJXB 4MYUA 2IJRA 1IKYB 4K4XA 3ZNUA 3KLFA 4URQU 3EVMA 2VZ9A 1FD8A 4X62J 3TAMB 4P2SA 5B09A 4K4TA 2UVRA 1SV5A 1HWJA 4DFPA 1HNZJ 3MMAB 3BF4A 3BKUA 4DQPA 1A6LA 4JI6J 3V4MA 1FJ7A 3D5MA 3T1YF 2A6OA 2MQPA 4HEA9 4WJBA 5E3RA 4DQIA 1NK6A 1NLKL 2IHR1 3I31A 1ZTWA 2WBMA 3NL0A 2K2PA 3M1VB 3ZXWA 1FRXA 2FZKB 4JI3J 5DG8A 4DR7J 4IFVB 2OJ3A 4NEYA 1RP5A 2GQ2A 4ZPAA 1QSYA 5I42A 1VQ9S 4NZ0A 3H5UA 2E66A 2Q79A 4UOFA 3SSSA 1LWFA 2HHVA 1N0UA 4EO8A 4F0KA 4OZ0A 1SUQB 2KFZA 3KLEB 2N82B 3UWTA 2UV8A 1NK4A 1U25A 4NXMF 3E8OA 3K5LA 4EI2A 2MZJA 4QWDA 2HIQA 3VVTA 1WEZA 1WHWA 2C3MA 2XY5A 2RHSB 4IG3A 2ZH2A 3QLHA 2IAJB 3DDKA 4KPCA 4Q2LA 1GTHA 4F4YA 3T5HA 4RW8B 2UXBJ 4ZPTR 1IKWA 2VG6A 3MWBA 3NNAA 2FHOB 5LSLA 3BV8A 3M6XA 4FVMA 4HHJA 5GMEA 4YDDB 2K7JA 2ZC4A 1VQPS 1HR0F 3HULA 2QL9B 2RH3A 5KFXA 4CM0A 3QJJA 4B9NA 1Y11A 3CDUA 4OV6A 2JRSA 2V8VA 3MM8B 4ID5B 3BB5A 3S1TA 5AE3A 1RWUA 2VG7A 3J7YI 1SJ1A 1YG0A 1XR7A 3CVKA 2IDLA 3VR1A 2A18A 4IO9Q 1UP1A 3OL8A 2OEKA 1MG7A 1SJFA 4CO3A 1HBMA 3M8QA 4LVOP 2GMLA 2VKRA 3V81A 4F4KA 4J9RA 2HHQA 5T14A 3CT9A 4I2QA 2V4JB 1LW0B 3HVWA 3MOJB 2MKSA 4G6VB 1FXLA 4FNHA 2W2PP 2NSCA 4ZVGA 1QD1A 1SB6A 2DGVA 5HANA 5I3UA 3JS9A 4Y65A 3IGNA 1QSSA 2DXDA 4P7TA 2YPYA 4ERDA 4RW8A 3QATA 1J5OA 4JI7J 2R7SA 1XTZA 5J1NA 5G4DA 3GV5B 2XY7A 3AAWB 1L3TA 1KFSA 1TAUA 1ZM2A 4X2BA 5A8RA 2I6WA 4FVCA 3HKWA 1KNZA 3SDEA 1S9FA 2LQ8A 1X4CA 5E7OB 2EI5A 4QZVB 2CDRB 3OTOF 4XO0A 3FFIB 1HQEA 2WVCA 2ZOFA 5B08A 2Z2LA 2ZEJA 3IP0A 1SIWB 1RYSA 2XS5A 3PKYA 4KGZB 4ZVTB 4DI6A 5LMNF 4DSEA 3HK2A 2OD4A 1SKUB 5KG1A 4DCOB 5KG3A 1SJ4P 4H4OB 3MHYA 2HGNA 2D9PA 1VBKA 2WW8A 2HWIA 4ED4A 3MR3A 4J9PA 3HHEA 4ZVHA 1QAJA 3MR7A 1U6BA 1WSRA 4G1QB 2DNQA 2YH0A 2CQBA 2XCPA 4Z7CA 4RWXA 3H2LA 4USUA 1U02A 5DZ6A 2XS2A 4I7FA 2RRBA 3GFXA 5FLXU 4KHMA 3NBPA 1RT3B 1HKAA 1VRUA 2GO9A 1URNA 2BQ3A 3C2PA 5K5MA 4CO2A 3BPSP 2HG4A 4C6AA 2RQMA 1VBZA 1REVA 3RBZA 1MMDA 1R8AA 3NAIA 3QSYB 4DL3A 1MU2A 3GJTB 3G82A 2CAJA 1U45A 1JIHA 2FVRA 1RT1A 1GX6A 1CULA 5I3QA 1RT7B 3UCUP 2SXLA 2VICA 4M5IA 3VAHA 3CCMS 1L5UA 3MMJA 1QSLA 1IVZA 4J7CA 1SUQA 3ZZRA 4DV0F 4K2JA 4YR3A 5K9FA 2QL5B 3G86A 4ED8A 9RUBA 1BLUA 3CB4A 2R42A 3EE3A 1R0CB 1VIOA 1EJ7L 3GV7B 3KUEA 2IC3B 4OZJA 4WKRA 1N32F 2HQGA 5HL7Q 2ZE2A 2IYGA 3KJFB 3DGPA 3DRPB 4HACB 2V50A 2XSFA 2BKNA 2UVWA 2QC3A 5D4PA 1V5IB 3NBPB 1CS4A 3J7ZT 1TAQA 2YKPA 4DR6J 1N88A 2CQ0A 3D3BJ 1VQ8S 1F3FA 2VFSA 3AB2B 4K2XA 2LQ9A 4JYAJ 2I5JB 2VG5A 2HURA 3FEXB 5F41A 1FRIA 3EZ5A 2GVDA 1A0OB 1FRHA 2C3OA 2W7AA 2VPYB 2YNGA 2NXEA 3KXDA 1WORA 1G4CA 5A6PA 1PYOB 4YB1P 4URGA 3IRXA 4DDFA 1XMBA 1XQIA 2EKNA 2I0XA 3PFOA 1IKXB 3KLIB 3M2RA 4OLOA 4DPOA 2OPSA 2AJ0A 1LW0A 2PO4A 1YRTA 5AXLA 2MKHA 1NCLA 1RAFB 1XN9A 4DLEA 3Q8YA 4ETXA 1TTHB 1KHWA 3QSIA 4L73A 1O8BA 2BE2B 2HRYA 3AD7C 5CHCB 5DJBA 3WIUA 2IBKA 3B82A 1P9YA 2PA8D 4NLXA 1J5OB 1YSJA 1KEKA 1H6KX 1NJWA 3J7A1 5B0DA 4LVNP 1ZM9A 1TZ0A 4PEOA 1RTZA 1IQTA 2K3IA 4FBUA 3Q8QB 2ZH6A 4EEYA 2MQOA 3EPGA 1YJVA 4FPRA 2NXNA 1NU4A 2YKOA 1RHUB 2BX6A 1I1GA 2M52A 2WW4A 3FBEA 3TEHB 4C98A 4F25A 4OHXA 2FY8A 4FYVB 5G0RB 4DX5A 3IA0A 1U1RA 1RHQB 4M5MA 3M9NB 5DDRC 1VMBA 2XZDB 4QWEA 1YHQS 2DR9A 2HVIA 2BANA 5D4NA 2CJQA 2DNYA 4E8UA 1XR5A 5KFPA 5DM7Q 1FWKA 2IVMA 2R8HA 3OJUA 3JSMA 3C6UB 1KTVA 2DB1A 2XM3A 4ZCLA 4C8KA 1UETA 3AXKA 2O01C 2OMLA 2GMJA 2AP6A 3F0NA 3JSRA 4RUBA 1RTHA 2B8QA 4WFAQ 1M5KC 4EBCA 2UZAA 2RQCA 3U7JA 1L3KA 1RAAB 1HBNA 5HQLA 4MAKA 1UMJA 4KR0B 1Q5YA 5F0WA 4PQUA 1WOSA 3CJKB 2W2OP 3R6LB 4LRAA 4BWMA 4WYWA 4N47A 5J2NA 3FKBA 5BJRA 4Q0BB 3OXLA 1VBYA 3MEGB 2HWTA 1NHKL 4GVBB 1HLWA 3EDQB 2X3DA 3LP0A 2EFNA 4NMXA 3GIKA 3H4BA 1NHUA 3CDBA 2OEMA 2ZH4A 3ZZZA 4H54A 2E1RA 3THPA 3T6BA 2DGUA 3IR6B 2YTCA 2XMTA 3MUMP 1U1LA 4KV8A 5K14A 3J81U 1PG5B 4DV2F 4X66F 3GYXB 5CYMB 4OYBA 2YKNA 3UR0A 2IA6A 2ACMA 3K89A 4ILLA 4OI1A 4DJBA 3HHLA 4OI4A 1RBOB 1D9DA 1LWEA 2GCFA 4A4JA 1X5SA 1EARA 4NL5A 1RU1A 1DBDA 4K59A 4LSLB 4FXVA 3UPFA 4RNOA 4CP5A 5HO4A 2R2SA 4ED3A 3TARA 1Z4UA 4MYTA 5HI7A 2AGOA 2R8KA 4GKKJ 1JKHB 2GGPB 3PJXA 4WZMA 4LFBJ 1OPIA 2RU3A 1H0HB 2A2DA 3ZFVA 3ENWA 2BZ2A 5F8NA 1C1CA 4LREA 3QT6A 3UO0A 1DRZA 4FKXA 2LEBA 2HHHJ 2G1DA 5E41A 1AW0A 1GMUA 1F9EB 3OFEA 2MLYA 4I1TA 4RKUC 3KLHB 5ETLA 2J7UA 3TR5A 2RNEA 3QGPA 3OL7A 1T7PA 5JJBA 3D54A 3FUYA 3W66A 4F26A 1WF1A 2COLA 3H90A 2F4VF 1Y10A 4ZPCA 4I67A 4EBEA 4LSNB 8ATCB 3JYTB 1IKYA 2UUTA 2L9DA 3MEDB 2LA4A 3KWMA 2DNKA 3K58A 2W1BA 1RISA 4DPYA 2DH8A 4K4YA 4KHPF 1RZMA 3R1HA 1HHTP 1QUPA 2ZBRA 4YFUA 1PC4A 4RW6B 4PG8A 2F9JA 5LOQA 2CPHA 2GHVC 3DOMB 4A8MP 3HO1A 1NBEB 5HAOA 3DLEA 4P52A 3LWLA 3PX4A 4BS2A 4NLWA 1U48A 3BH6B 3C46A 4KH0B 1OYDA 4MH8A 1RT6B 1V3RA 1QUVA 2FLNA 3HVAA 4HTIA 5KFIA 5DQGA 2ZH9A 4DV6F 3PKMA 2YNGB 2UP1A 1X4BA 2XO7A 1TK5A 3KLHA 2KYXA 3VQTA 4OZ3A 1UL3A 1RT4A 2NZCA 3A12A 1UA1A 4DR4F 5LJ3Y 1RAIB 2I8EA 1JLBA 3ETMA 5J2MB 1M90T 2V6AA 3IM9A 1TK8A 3POTB 3X3UA 3U1MA 5M2RA 2I9SA 3MECA 3CC7S 2P9CA 4BWJA 4KO0B 2ZNZA 2AGQA 4LFBF 3D0GE 2D3OR 3PYDA 1GXTA 3HT0A 1Q5VA 1PYSB 1NDPA 1KD1T 2CQCA 2ZKUA 1R8CA 3H5SA 3OR1A 2PA3A 4DV5J 4GC6A 4JI7F 3VQSA 3MURP 1F6TA 2V2KA 2MZSA 5E3CA 1REVB 4MIAA 1TL7B 1RXOB 2V68A 4DG1A 4J37A 2L9NA 2ROPA 2PMHA 1TKTB 3CC2S 3PX0A 2GJIA 1Y9OA 5C42A 2VA3A 2LEAA 4NA3A 5KFAA 3FQLA 3NS5A 1FRJA 2L9WA 4DX7A 2IIHA 4ZLJA 1RWXB 2C42A 3V6KA 5L1KA 3GJQB 1VLOA 1SJQA 3VGTA 3VTIA 4PG5A 2XCAA 1H7WA 2Z2ZA 1TP7A 2AMCB 5DG7A 2F65A 3F44A 3LQVA 5I3PA 3RBDA 4PUOB 5KG0A 1ZPVA 5B0CA 3RW6A 3MM9B 1N5YB 3IBFB 3TW0A 1X9MA 4NWBA 3CJKA 3T1HF 1RA6A 1JLQA 3J80U 4FF3A 3D28A 4M5DA 1BQMA 5T41A 2DTJA 4ZHRA 2MKJA 2Y1JA 4LF1A 2RSQA 1X5OA 1VHIA 3WHIA 3Q8PB 1UVMA 4RZRA 1KVIA 1IKVB 2ZZMA 2XTJP 5F9NA 3CCVS 3RGIA 2ZVIA 2F3JA 4DUZJ 5IT9U 3BR9A 3O3LA 5J2PB 3I4PA 5ETRA 3JTNA 3N28A 4Q7AA 2JH3A 2QLWA 3HFVA 3HZEA 2XWYA 3VHQA 3B54A 1BXNA 1J27A 3MCNA 1C0UA 4OX7A 1PIEA 2ZHBA 4MKYA 1TK0A 2VKZG 4P71A 3KLFB 1VRTB 3UD4P 3BN7A 1S76D 1NDLA 2KJVA 3MCSA 3G96A 1KS2A 2VFTA 4DR7F 4NLQA 2DNHA 4B3MJ 3JXOA 3NAHA 2BQRA 1W26A 4PXCA 2GVZB 3GILA 4IO1A 1YBAA 2CPFA 4R8UA 1IR1A 3DOMA 2W9CB 1VI7A 1SC6A 3BDPA 3D67A 1CEZA 2W9BB 2B9XA 2Y1RI 2KM8C 2H51B 2YY3A 1NK5A 2BACA 3T41A 4O23A 5CZVA 3H98A 2CVIA 4GMKA 2APOA 4ZVUB 2BOPA 4B3MF 4ECWA 4LFCJ 5HVGA 4DV5F 1I3OB 2FVSA 3MUTP 3H2UB 2ASJA 3PHTA 1ZPWX 3I0SB 4X4SA 1DTTB 5ETPA 2UUCJ 2KJWA 3KG0A 3R5CA 1WNEA 3PV8A 4OZLA 3PRBA 4UT4A 2BW2A 4OYXA 3TVKA 2O1PA 4LF4J 3FVYA 3HP6A 2ZDPA 2VQEJ 4ECYA 5MLCV 4C7QA 4DL2A 4FKYA 4DR4J 2UUBJ 2M8DB 4BHQA 2DNOA 1JLCA 2CNNB 3FDSA 3MFIA 2C2KB 2N4DA 3QYYA 1VK8A 3R5AA 4QPTA 1VQ4S 4PABA 1HNVB 3GSDA 1CQMA 4LUBA 3QT8A 1QTNB 2BJ8A 4FS2A 2JZ5A 3DDIA 4Q45A 1DFDA 2MGZB 2VIHA 2RUGA 2ZC3A 3I5AA 3DC2A 3EXYA 4PYAA 2Z2YB 4I6WA 4R0EA 4L6V3 3KUGA 4KV8B 2HHWA 3L7PA 1U26A 5J2QA 1H3DA 1RABB 2MLXA 3M2VB 2DGXA 5GMKa 4ECQA 1JJCB 2A1BA 3HSZA 1V9OA 4XTTA 2EWHA 4A46A 3QJLA 4NOHA 2CXEA 2IVFB 2K7KA 2Q1LA 4YB5A 2MQQA 3HXMA 3S8SA 3NOCA 2CRLA 5DG9A 2J0XA 2MHEA 1GX5A 4IKAA 4OI0A 2WK4A 2FJXA 1ZA1B 2B7CB 1HW9A 1PC5A 3KK2A 1IUJA 3A8IA 3IRWP 1HMVA 4K4WA 1P1LA 2CJ9A 5RUBA 4DL4A 1M5OC 3R7NB 3OHBA 1KLMB 1U09A 1U6ZA 3LA0A 4DS4A 4OZ5A 4RU2A 3D6HB 3KJVB 1U4BA 2R2UA 2JLGA 2CQIA 3DRSB 3A3PB 2NZ4A 2BW7A 4DMZA 4G3IA 2ZHOA 1YRUA 3AJ1A 3BBCA 3DYAB 2FC8A 2KXFA 5IQQA 5KT7A 1N34F 5HLFA 4C3KA 7FD1A 1NUEA 1YTYA 2B6AB 3T9NA 1B4SA 3ZZUA 3RR7A 3HSGA 4U96A 4LF8F 2WSEC 1IKWB 2VG6B 3PRVA 3CTRA 3IR5B 1RLDA 3MAHA 2ZH7A 2DPJA 1QDUB 2C2RA 1TL3A 1AZSA 3E2EA 1VOMA 3PG9A 4OLPA 5D15A 4JI0J 4YB7A 4F4AA 3I56S 2RRNA 1Q95G 2DIVA 1U1OA 1QY7A 2KVIA 3M30B 2WONB 5KFRA 4TLRA 2NREA 3BSAA 2CNLB 3QZ7A 4FDFA 2HWHA 1RT1B 3GFHA 2P6SA 1ZH5A 4F2SA 1RE1B 1FJGJ 5KOXA 2CVEA 4A47A 1S57A 3KHLA 1MN9A 1FKAF 1IWGA 3ZC4A 2AYMA 1LFWA 4MIWA 4LR8A 1XNQJ 4OV1A 3R9LA 3NCPA 2FYXA 1RADB 3NWRA 3HHLB 2N4CA 4OMFG 1B64A 1GAOA 4KYZA 2ZOMA 3H0PA 3KK3A 2BRLA 4B02A 2ZBQA 1S6UA 3DXSX 2J9CA 3B4MA 3M2UA 3H25A 1K8AT 5IWAJ 1VC5A 4B3SF 1U0HB 4Q2MA 3W9HA 1PSDA 4ZMMA 3RB6A 4IRKA 3PJ9A 1VQSA 1S6PB 2VASA 1KKHA 3ADAC 3ISND 2LKZA 3QFHA 1V3SA 2DT9A 4W4MA 3GPAA 5E3PA 3W1YC 2OTLS 2FLPA 3C3LA 2RKIB 3AD8C 2A3JA 3H5XA 2ROGA 1RAGB 2KL8A 4K8RA 3QBCA 2B5JA 3DI6A 4LR7A 3O5TB 4OI2A 2GIQA 4I69A 1JWWA 4CLKA 2C2EA 2IVYA 2F4VJ 2HAIA 1D8ZA 2D41A 2DNLA 3FBCA 4NLRA 4RJVA 3I0RA 4NLUA 3M6WA 3RB0A 2HGMA 2PSZA 5E3QA 1Q4RA 3H4DA 2AJ2A 2CADA 5J1PA 4YHHJ 1S79A 4CRJA 2UUBF 2WVFA 2P9GA 4G1QA 2W2MP 1QAIA 1T95A 4TNOA 2OP5A 5GADU 4RNMA 5KG4A 1N8RT 4C8OA 2CPYA 1WHXA 4DFKA 4J5OA 3CCQS 2P5VA 2DEIA 4N8OA 4YMEA 5FIIA 4YP3A 3OTOJ 1RTDA 2PE8A 1HNIB 3WC0A 4KAIA 4USKA 4DF4A 2LQ5A 1VRUB 2Y3YA 3W2WA 1N36J 1KVKA 4JOUA 5JXSA 2ILYA 4MMOA 5DLGA 1R8HA 4JYAF 4CLUA 3K5MA 2B4UA 2EEYA 2B0GA 3BKFA 3S01A 2QO3A 1D1UA 3W8GA 1GTEA 4ZVQB 3QRPA 4X84A 1KC8T 2MQLA 1CJVA 3QAUA 4DV2J 2KG0A 1N36F 2DR6A 2QMWA 2WHOA 3HZGA 3QGHA 6AT1B 4K0KF 1K1SA 2YNFB 1RU2A 2YVSA 3IAM9 3SQGA 2IM1A 3UI3A 4DN0A 1SI9A 1XMQJ 2XBPA 3KKFA 2QA4S 1JJ4A 4LR9A 2P6TA 1SJRA 4PG7A 1F2HA 1YVFA 1M5PC 4S0MA 4AQYF 3Q22A 5FLXY 3LOUA 1HBNB 4KB7A 4U7UD 4ZP7A 2WAQD 3DLGB 1T05B 2FZGB 2NCKL 2MEWA 3T1AA 3QAEA 3UN2A 2H4WB 2UV8G 4ZN3A 3MPVA 2W9BA 4EYHB 1YX2A 3B6BA 1HMVB 3FZ2A 4HH0A 5A8WA 2W8KA 2YX7A 3NXZA 1UPMB 4JV1A 3KOAA 1XMOJ 4HL9A 3NGDA 4X65F 5K8MA 1P9QC 1RAEB 2QJ3A 4F67A 1HBMB 3M8QB 3HX9A 1ZZFA 1YZ7A 2GVDB 3U1NA 4HI2A 3CJRA 4JI4J 3DLKA 4WU2A 1E6YA 3FEYB 3IRXB 1HARA 2IFXA 1T9TA 2AJFE 1HBUB 4TQSA 4Y0FA 1S9GB 4DV4J 3MM6B 4CO4A 3U1LA 1T9VA 3EICA 1TL4A 4DUTA 2VV5A 5KFHA 1LWEB 1R31A 4O0NA 2K8GA 1RBAA 1WEXA 2CA9A 4PKDB 2NUHA 4V19J 3G8SA 3I55S 1PBAA 1Q82T 3QJPA 3A8JA 4IG0A 1KDNA 4ATNA 4OYZA 5D3GB 4EK2A 5DZ7A 5LMNJ 5D0EA 4B17A 4O0IA 4EBDA 4CIOA 5DGAA 4ZCIA 1OSCA 3VF0B 5I4MA 3J7YU 3MR5A 4A8WA 2YWHA 1JQGA 2GO8A 3EGNA 3LAMA 2J0QD 3A4TA 4ANEA 4JI0F 5KT6A 2H3EB 4QYZJ 2V2ZA 1OJ4A 3OPKA 3DRYA 1VJQA 3W9JA 5CABA 3TX8A 1DAXA 3CCWA 4JV0A 1VC6A 4L75A 3TZZA 1FHTA 3MF5A 1SQEA 5KG6A 2V4QA 1NHVA 4KPYA 1VK3A 5T7LA 3PNIA 1O51A 3JSMB 3PYGA 2J9DA 3GZ7A 3NNHA 3Q2SC 1Q53A 2FVPA 1T9WA 4OI6A 2ERRA 1DLOA 3T9ZA 3PHEA 5KTQA 4DX6A 1DQ8A 2ZD1A 2W9AA 3JQJA 1WWHA 4P6QA 3C8YA 4H4KA 5CAAA 1UVIA 2BJ3A 2E9ZA 2CG8A 4KH1B 5L38A 1RSCA 5A76A 5IFMA 4WYLA 3M8SA 4HDGA 2HLUA 4ZDNA 4KSEB 1TV6B 5E0OA 3UW1A 5K20B 2DGWA 1KTQA 3KHRA 4JV5J 2JNJA 1HD1A 1CULB 3TUIC 4M5KA 5C25A 1VDHA 1FK9B 2HBQB 2MKYA 1H7XA 3D6FB 4UZBA 1RDRA 3HHNB 2X7IA 2V69A 3QWUA 3BJYA 2V4JA 2QX0A 4X64J 2UUAF 3Q23A 1RKIA 2YXLA 1I94F 8RUCA 1WELA 1I6JA 1T11A 5B7WA 4NA2A 4IQMA 2MKIA 1UVLA 1UEKA 3CDAA 3TA0A 4B9VA 2B6AA 2YWGA 3ILJA 1UKUA 2F1FA 3JSBA 5ETVA 5CYQB 4ZS6A 4ID8A 1GQEA 1X0PA 2DRDA 2FIUA 3DNCA 2G13A 4PWWA 2BJDA 1FFWB 5BXIA 5B0BA 2OLWA 3K17A 3M8ZA 3UDVA 3IM8A 4NLOA 2AKWB 1BQNA 1HI1A 2H48B 2W01A 4XK8C 2BR0A 4B9SA 1TL7A 1MWQA 2OMOA 4DG1B 3MAAB 3PO5A 1REGX 4KC5A 5BR8J 3N6NA 2YKQA 1TV6A 3L9ZA 3R27A 5GAGI 4DSLA 4LF5J 4JI3F 4M5JA 3TAQA 3VZHA 1SIZA 1LWXA 1Z2ZA 3M7VA 4G1IA 1RWOB 3KLEA 1HD0A 1NAQA 4DSJA 4TLQA 4ZIVA 1B0TA 1TL1A 3BBBA 3AQOA 5D4LA 2JSXA 4U7UK 3QIDA 1HNZF 1MMNA 2WSFC 4F0MA 1HW8A 4YUDA 3C14A 3DM2B 2FHMA 4ZLLA 3CCRS 1Q81T 1IN0A 1RCOB 3QGIA 1XC9A 3R2CJ 4WP3A 3UNYA 1EHWA 3UCZP 1S77D 2YKAA 4BDPA 2OPRB 2X3GA 1FWLA 2CQPA 3DKDA 4OX8A 3TZXA 2A6MA 3BGRA 4M5GA 3BEGB 4KRWA 4WP8A 2R7WA 4J90A 4LIRA 4DV1F 1F5CA 2VBWA 1FKOB 2KXHA 2J9EA 2MHNA 2JX2A 3FK4A 3IC1A 2ZOGA 4ID5A 4Y6IA 1CBKA 3Q8SB 3L4BC 4DPTA 3JTPA 3OFGA 1SH0A 2IM0A 3CCSS 2CWXA 2BKPA 1XBWA 2YQ3A 1Y5IB 3BZQA 1YJ7A 2C2MB 4K5RA 3DDNA 3OTDA 1OY9A 3RRKA 1TKZB 4A8YA 4DQRA 1PKUA 4F02A 1U1QA 3FBFA 4WU3A 4IUFA 5KAKA 1Z1ZA 1MLAA 4USWA 2AYEA 2PEBA 3VCDA 6FD1A 3I32A 4ZK7M 2KRBA 4ZVEA 4L72B 4EZ6A 1ROFA 1IM4A 1F5BA 1I51B 3WBZA 1S10A 1S1UB 1ZAVA 2HS0A 2JJ4D 1K9MT 1VFJA 1ZOTA 1HPZA 2H9ZA 3EXCX 3F56A 2J6TA 1JLGA 2OELA 3JAMY 4CLLA 5EN1A 3MOZA 3GTYX 2F4FA 3MMBB 3G87A 3MD3A 3TWZA 5K8NA 4M5LA 5AXKA 1MMLA 1IR2A 2F8HA 4ANDA 3RAMA 2AD9A 4UY85 1MNEA 3N0VA 3WZ0A 1I94J 1KFDA 1RYRA 2DCLA 4P2MA 1J5EJ 3I0SA 1FK9A 1WC6A 2PDAA 3BN4A 1XNQF 2LDYA 2ZWOA 3LGMA 2R8JA 1M1GA 2W7PA 1RAOA 1OY8A 2A0FB 3N79A 2CQ1A 4O3NA 1K0VA 3TJ9A 4B9MA 2ZNYA 1XR6A 2HFUA 4CYUB 5KT5A 3J7AN 1X4DA 3FGVA 3A8EA 3IMQJ 4B08A 5IQ6A 3PIOQ 3MDFA 2KFYA 4JV2A 1A9NB 1WKLA 5IV4A 2OI2A 2BMBA 3M9OB 2DVIA 3LO3A 2BOAA 1JLQB 4MK7A 2OHDA 3I5BA 1JLGB 1C1CB 5BYQA 2YWFA 5A8WB 3GU0A 2CQDA 2ZWPA 3RTVA 2NYIA 2Z58B 3B4DA 3MMBA 1BQXA 4QR0A 5KFBA 4DWIA 2XMMA 5GAGU 4LF9J 4FN5A 2RKIA 1OY6A 3VGSA 1M5VC 2W4DA 2FGOA 2QN6B 1NZ8A 3FCWA 5HMZA 2RRAA 2DPIA 2FTRA 2Q43A 2QT7A 2OPPA 1CC7A 4MKVA 3AY0A 4TXSA 4NX9A 5B0AA 4LSNA 1G2EA 4ECSA 2CWKA 2PFDA 1FKPA 1RT5A 2RS8A 4EYIB 3RRHA 3PO4A 2NXJA 2G2YA 3DLJA 2M0GB 2QV6A 2J76E 4IG3B 4U6PA 3EYZA 1NZAA 2DHGA 1XWLA 2PFFB 2H54B 5L1LA 4ZKAA 2LQJA 3G8QA 3C15B 1RI7A 2EXUA 4RO0A 1EETA 3BGFA 3FJ2A 4UQTA 1HNXJ 5C5JA 5IT0A 3O6QA 2V4RA 1Y7PA 1Y5LB 4R25A 2IJNA 5GVQA 2XC9A 3OJSA 3QRRA 4C48A 2HVDA 2HRUA 4DSFA 1O5JA 4U67Q 3BGUA 1JLEA 2JVOA 1CLFA 3AJ2A 2IJFA 2MKCA 2NR0A 1U2CA 1RTIA 2R7QA 3I9ZA 3Q8VA 3OBIA 4EMDA 4F3OA 1JK9B 1F1BB 3IS9A 2FB0A 5CCMA 3D6TB 1TFWA 1XMQF 3TUJC 4JI4F 4RW9A 1N6QB 4IRCA 2GX8A 4PCQA 4DHVA 1IWAA 2DHHA 2JEFA 2KT2A 4DOZA 2QA2A 4ETZA 4C0BA 4RU9A 2X1AA 3VAIA 1S6QB 1SBRA 1NK8A 1MROB 1YBTA 2BKOA 3T5KA 1RHRB 3CULA 4NCBA 3VWSA 3UDEA 3DLGA 4DCJB 2MJUA 4KIAA 5HMWA 1AZSB 1MW7A 4LF6F 4KBIA 4OJHA 1WEYA 4M5DB 4P2FA 2GQCA 3FCVA 2HIYA 3NGUA 2HVEA 3FFIA 4URSA 1U1KA 1OIAA 2FJAB 3TUPA 4JI8F 4BC7A 2W9CA 2AW0A 4Y2MA 2HNYB 4RR5A 4LF4F 2ROEA 1KQFB 1HNWJ 3OD2A 1WJ9A 3UCGA 2OH2A 4ED2A 4J9OA 2HFZA 3MR2A 2XZWA 4TU8A 1N33F 3GIIA 1NK7A 2GJFA 4RL1A 4WTOB 1VRTA 2U2FA 2MSSA 3UN3A 4RNNA 4TVAB 2HQCA 2XI3A 1IM6A 3H59A 3GLJA 4ZPWR 3U02A 2ZJRQ 1C1BB 5ETQA 1HNWF 3BQ1A 4DFMA 1FFGB 4F0HA 2EFQA 3DLEB 1HQ2A 1BQMB 2OAUA 4O3PA 5GAEI 2MQ8A 1CC8A 3HJVA 2IM3A 4B3RF 3M8WA 5HK4A 4E98A 1RT6A 2OIHA 4F3QA 2HVZA 2HFVA 4TQRA 3W5XA 4J9MA 1S1XB 3K5OA 3MEEA 2VFUA 5A8KA 1RT7A 3TRGA 5LJ5Y 4QBUA 2XWXA 1IXKA 5M2PA 5BR8F 2BE9B 4ZCKA 2JEJA 4M1KA 1KOHA 4N7TA 7FDRA 2VONA 4CO5A 4IFYA 3O2IA 3DYAA 1TL1B 1NKCA 1N5QA 2YKNB 1S4FA 1T03A 3DOLB 1W7WA 1R6VA 1N5SA 2IC3A 3HD1A 1I5OB 3THVA 2ZE2B 2J5AA 1H72C 3HSJA 4MK9A 2QSWA 5F3ZA 1Q8LA 4FPIA 2UXBF 1QAXA 1UPPA 3S7RA 4NLVA 4FYWB 4M8LA 5IWAF 2RDJA 1H98A 4QIWD 1HI0P 2HZVA 5F8JA 2ZD1B 2JC1A 2AHOB 4GC7A 2DRAA 2MKKA 1LNQA 4AYBD 3NKYA 1SVDA 2B4OA 4IFVA 3W62A 2XLKA 3OL6A 4RUHA 4IOAQ 4R0JA 4ZA1A 3K8VA 4DR3J 3RW7A 1U7LA 2DGTA 5AXMA 2R7OA 5C25B 4JI5F 1RTIB 1K44A 1WUUA 2CZVC 2JHEA 3ETOA 5C42B 1L3UA 4RUAA 3NRBA 2WCXA 5SUHA 4Q5VA 2BQUA 1RWKB 2GJ2A 2J6SA 2IPOB 1G1XA 5H9FJ 4DQSA 3AH6A 4QQBA 2M4MA 2DRBA 3CGIA 1T94A 3LANA 3FRZA 3I96A 4NCGB 5KT2A 1RKJA 3C19A 2MXYA 4OL8A 1TMMA 3P5BP 1EZZB 3BQ0A 2V8GA 4PAAA 2OTJS 4KFBA 3UVJB 5C7PA 3CCUS 5IZHA 3M1VA 5IC6B 3V2UC 5F8GA 3ICLA 1LK7A 2OFGX 4A8FA 3HPOA 2GA7A 2CZ4A 4ZJQA 2UU9J 3BGLA 3DFEA 3AT1B 1FJCA 3DLLQ 4PXEA 4IH6A 1Q8KA 4OHWA 4ZVSB 2FLLA 5C24B 1RJJA 2IA0A 1N0VC 3MPDA 4G65A 4ZOSA 5KFFA 1YLXA 4QPXA 4CZCA 1HBUA 2XYPB 4RW9B 3MR6A 1YITS 5FDLB 1UW9A 4I2QB 3ITHA 3QNWB 3A13A 4GO5X 2CJKA 1AFIA 1FDNA 1S9EA 3ZZTA 1S6QA 3JAMU 1P6TA 3MM7B 5HBMB 1NNDA 3NY0A 5I3UB 2L48A 3KK1B 3HJFA 1FE4A 4OJGA 1S72S 2EFVA 1WC1A 2GVZA 3BYRA 4IG0B 4Y34A 4YN3B 3ILOA 4NLYA 2BVZA 3N9UC 1FNOA 3ZZYA 5EX3A 3T5JA 4ELUA 1ZBTA 2DO4A 3A8KA 1OS5A 3K5NA 2RQ4A 2LEPA 1CS4B 3W65A 3TUZC 3NS6A 1TUGB 4HT7A 2PEHA 3OXGA 3W2WB 2W8LA 2LP4A 3HDSA 2OFHX 3IO1A 4TKTA 2HNZA 4YEAA 3US5A 1TR0A 3CCTA 3CEDA 4MK8A 4OYMA 1FERA 2I5JA 2VG5B 5H1SV 2MQMA 5KFJA 1QM9A 3WIVA 3D0HE 2Z4PA 3UDCA 2G0IA 1UTAA 3LTOA 6FDRA 3QZ8A 2HFSA 1QE1B 4KHPJ 4KKOB 2XLJA 3VAKA 4LF8J 5IXUA 2VB6A 5AJ3F 2R4FA 2VL1A 2K3KA 4KGMA 3NNCA 2AEJA 3QO9B 4L74A 4USJC 3J80Y 2Y1LB 1SKSA 2Y9HA 3TAMA 4N5SA 1N48A 2DH7A 2WB1D 3I6PA 5FJ4A 3IG1B 3DOLA 5HVFA 4CNYA 2HKEA 3LW5C 1YZ6A 3VV2B 4B3OA 2B56A 1C4CA 2V67A 1DURA 2VOOA 4QWAA 4CDIA 1HI8A 1NXIA 2RU9A 5KT3A 4ICLA 2FVCA 2HPUA 2KU7A 4LSZB 1RTJB 4ALZA 5DRKA 3VALA 2DH9A 2OPQB 3AOCA 1HNVA 3OLBA 1FFSB 4PR6A 3TQ1A 3OFFA 1S49A 1S59A 2C2OB 4YB6A 5KFLA 5I42B 2CDQA 4KGVB 4A8QA 5H9EK 2HHPA 5D0GA 1MN7A 1B99A 1X4EA 4MTPA 4RPFA 1D09B 4Q8EA 3D1HA 3NLCA 3O8WA 3H42A 3R2DJ 2C3PA 2NUUG 3SCJE 2C2ZB 3EZOA 1XNRJ 3DMJB 5JMNA 2UU9F 2HGLA 4OYPA 1KQGB 3I0RB 4FYDA 1WOPA 2E1MC 4FZVA 1OQ6A 2ZDOA 3A3OB 1RWNB 4TY8B 1AROP 3CE8A 1NK0A 4AL5A 3R8YA 3KK3B 2F8MA 5HJXA 2VJUA 4NLTA 1Y4ZB 3CD0A 3M8RA 4Z7YA 4OIXA 5J1EB 2E1CA 1S48A 2MY8A 1EKSA 4K4ZA 2R8GA 4EWTA 2VU5A 3F73A 3CMAS 2OUGA 2E7XA 3R7SB 2V5HG 4XPCA 3Q89A 4K4SA 2BUNA 2ZVSA 2BJEA 1R43A 1DTQB 4WBFA 1S12A 1C0TB 1RHJB 4TN2A 4YOEA 2D7SA 5IS2A 4QW8A 4U7CA 3TZYA 1EQMA 2XLIA 3WQPA 2BEFA 5IM0B 5L1IA 2RILA 2BJ7A 2C1EB 2HZAA 4ZVRB 3GYGA 1IKXA 3KLIA 2VJVA 1U1PA 1WG1A 2FGCA 4D3HA 2VQFJ 5C2GA 3V4IB 1T9UA 3KUHA 4QIFA 2ZM6J 5A6WA 4ZJLA 3R3TA 3NGSA 4KE5A 2M5YA 2MZTA 3HHLD 4HT5A 2WB4A 4LFAJ 4ES3A 1FRLA 3KLVA 3KK1A 1XJWB 1X4FA 2FVQA 2CPDA 2Q3PA 4F4WA 2C28A 3OR1B 2ZBIA 3BGRB 4DPXA 4F8RA 2KRRA 3CJ0A 2MDAA 4ED7A 1RGVA 3LP2B 2BJ9A 2BABA 4OYIA 4R5PB 3THTA 1TVRA 2HLTA 2P9EA 2IRXA 4YY3J 2MYFA 3GIRA 1KSPA 3CUNA 3JQKA 5EWFA 1AXQA 3ZTSA 3ET6A 3DOKA 3BS9A 3QIPA 1HYSB 2MGZA 4I56A 2VODA 1HHQA 2Y8WA 3T1YJ 3EGWB 1TUWA 4HR2A 1LQ9A 2MTLA 4B3RJ 1R8BA 1GMVA 1X7VA 3PRDA 1N6QA 1VIXA 5CD4H 3ISNC 3QO9A 2AEMA 4C8NA 4WE1B 4ZPBA 1N5YA 2C3YA 1IQZA 1WF2A 4DR2F 1EAYC 2J9DE 5JVHQ 3PTWA 3JQMA 4J9QA 1PAEX 5DLFA 1N34J 4HKQA 3S6EA 2LMIA 1YBUA 2KO1A 2L41A 4ED1A 4Q0BA 2DYAA 3LP0B 2E5HA 2EBEA 4J9KA 1FNMA 2PI5A 1PILA 2BANB 2FQQB 2BJ1A 2QFJA 3KJVA 3TI0A 4EZ9A 1KONA 2D74B 2V8HA 2MQNA 3AODA 1CQNA 2B4VA 1SKRA 1WKKA 4DSKA 4K4VA 1L3SA 2HHUA 2BV3A 3QGGA 3MECB 3KHGA 2D3UA 3MXHP 1EIYB 2BM1A 2FJDB 5CA5A 5L39A 2J0SD 1FESA 5KFOA 1IBLJ 4ILMA 4EUVA 4ECRA 1FDDA 1DARA 2AT1B 2MMYA 3MMCA 3DN9A 3H5YA 3E3XA 1LK5A 3M4XA 4FS1A 4JI2J 2EFPA 2N7YA 4LIWA 1RT2A 2LFVA 2DGQA 4PPDA 4XDCA 4JI2F 4P75A 4ZLPA 1UCNA 3GFYA 4PPZA 1PO6A 4QU7A 2B43A 3IN5A 5EWEA 1VQ5S 4MIBA 3W9IA 2IDEA 1SKWA 4CLYA 2KTQA 4ILRA 4WPAA 4ZVFA 4LF9F 1VLYA 2VC0A 1WHVA 3QFWA 2HQIA 1JNRB 1RHKB 2X1BA 2PMZD 1G3OA 5K14B 1UZDA 1NO8A 2YNFA 4PXDA 3SQGB 4CM2A 4DZ6A 4YR0A 3MUVP 4ECVA 5IM0A 5H9FK 4NI2B 2YQ0A 1M5SA 3BDEA 2FJVA 1UZHA 2AEFA 2CNKB 4Q44A 3AOAA 5EX0A 2VF3A 4NZ7A 3W60A 2HHHF 4NASA 4RBUA 2M2BA 2M70A 4YDXA 1P27B 1JX4A 2RE1A 1M5HA 3GR0A 3LGNA 3Q83A 3QLHB 4MT1A 2QFIA 5D6GA 2GGPA 1T05A 1EETB 1RUSA 2QGFB 3OTEA 3W63A 5F8HA 3R5DA 2V9WA 3CC4S 5THWA 4F04B 4K50A 1VCTA 1F9HA 3MEKA 5HQ8A 2VPXB 4Y2CA 5ETTA 4DL0C 3VAGA 1IBMJ 5L1JA 1KVJA 3K0JA 1UJ6A 3MM8A 2DNZA 3IWNC 1RK8A 4DR2J 3SFUA 4CLPA 3TNVA 2RUSA 2QLBB 4ECZA 4PYDA 2FZCB 4CWBA 4WF9Q 4G1PA 1UWBB 2AF6A 2ZH5A 3RG6A 1NPPA 3FRYA 4LT6A 5J2QB 3DCAA 4C8ZA 1KHVA 4RX6A 4XPEA 4USTA 1T0TV 3BQ2A 1PBUA 2V2QA 2D1CA 1FVSA 2QL7B 3IG1A 2QEXS 3EDRB 4NLDA 5CZXA 2HW3A 1AB8A 2HYIB 4H4MA 4RNHA 3CDEA 3V4IA 1FO1A 2HFOA 3W5YA 2G2OA 3HKZD 4KY3A 4DPWA 3KMSA 5J2NB 5AXNA 3MAAA 3MEGA 1FX4A 1LXNA 4GVBA 1QAYA 5L46A 2GNKA 2HNDB 2QZ8A 4WP9A 3HT3A 3CWJA 1VR6A 1S1TA 4CQ1A 2YH1A 5EHHA 3DRRB 1UVJA 3HD2A 1OWXA 1UA0A 1XEZA 2D9OA 3Q8UA 4CH7A 3J7Z5 3NEKA 2ACYA 2ZJQQ 4CH0S 4ZVOB 4ECUA 3POTA 1KWMA 3CCZA 4O4GB 3RBEA 3GIJA 1ZTTA 3PFEA 5FDLA 1BGXT 4WFZA 3KYLA 3OT9A 2ZBPA 1S0NA 3EPIA 5HQMA 3KJNB 2R7RA 1QVGR 2DNGA 4X65J 1JNZB 3WC2A 1FI4A 1WG5A 3O44A 4HHUA 4GVLA 5HJYA 5HBMA 5IT4A 4M5NA 1AT1B 3WDOA 3SV4A 3M6VA 3VGUA 4RBVA 1W2BR 1WI8A 3VZIA 4ES1A 2QLXA 1S1UA 3K2YA 3OTBA 2DXEA 5LXRA 3CO9A 3D9BA 1TKXB 1W25A 2OEJA 5E3AA 3ZZ0A 4OZ1A 5L9NA 2OSRA 3M30A 5LT5A 3PYFA 5KFWA 1WDTA 2JLFA 2FUG9 3SBMA 4C8LA 4HVZA 2C3UA 2R7UA 1CJUA 3PEHA 4Y2KA 4F50A 1K0TA 3IAS9 1WC3A 3FMWA 4PZVA 3CF5Q 4AL7A 4KJIA 4PXBA 2RIJA 3AQPA 3ULHA 1Q1KA 1UEVA 4EFAC 2IBOA 3SZ2A 3JB9k 2DK2A 4AFFA 2VUGA 3P8BB 1PGZA 2NQPA 1RA7A 3QT7A 3D6MB 5GAHI 3D0IE 3MEDA 1RWMB 1Y5NB 5KFKA 4P10A 2RF2A 1JLFA 4ED6A 3KG4A 1T02A 2CZ9A 4NZ6A 2XQCA 2W7OA 2FY1A 4BBYA 1RWWB 2YQ1A 1C4AA 3NP5A 1E6VA 2ZH3A 2VC1A 3HM9A 2CPJA 1GEHA 1SPBP 4OHZA 1CPZA 3ONQA 4I64A 2JDJA 2QMUB 4P2XA 2CG4A 3DGVA 2Y0BB 3MPWA 3KK2B 1O6XA 1JB0C 2KN4A 1VS3A 2OD6A 2G9OA 4ZP9A 4I2PB 2XO6A 1AUDA 3SCKE 4GO7X 3DI6B 4Z2XA 3KFWX 4YHHF 1X8DA 3R97A 4DUYF 4XDDA 5HATA 1Q78A 4DV6J 3H8YA 3NCQA 1C0UB 5AT1B 1GMWD 3VAMA 2LU1A 2VFVA 2V94A 5LXYA 1SC4B 1OSDA 3BM7A 3NCRA 4RW7B 5HMXA 2XSJB 2XGPA 3P5TL 1Q7YT 4QYZK 3RAQA 4FF1A 4ITSA 3GQCA 4X4VA 1YWXA 4I4BA 4L3NA 1G7CB 3OVAA 1BHNA 3DGPB 4HACA 4TU7A 2ZKTA 1JXEA 1FXRA 3G6YA 4KFBB 3UVJA 2DCUB 3UFCX 2LYVA 4U9RA 4USHA 5F8MA 4ELVA 4PQAA 2AZ1A 4KHRA 2G0CA 1UEUA 2HMIB 4DPUA 4C8MA 1F5AA 2RDDA 4NLSA 3OVSA 2J7KA 1JJ2R 1OPZA 3OTCA 2D69A 3SFGA 3UDLA 3PR5B 1S97A 1FNXH 5KFEA 1GH8A 2FD2A 3KG1A 3BBFA 1K73T 1DTTA 4PG4A 2HQDA 1X4HA 1Y00A 2MSTA 2BM0A 3PX6A 1UVNA 2GS8A 2LDIA 2CPEA 4ZCMA 5JUMA 4OX9J 3AA8A 1RWPB 2KKHA 5HSPA 3VAJA 5F8IA 3CXCR 1YJWS 4I68A 4GKKF 4E2FB 3FSIA 3FBBA 1FWPA 3IFEA 2QLFB 4Q8FA 1H38A 3PR4A 1MROA 1H2UX 1X60A 2O67A 3EMTA 2UUCF 3TVZA 2EFGA 4C2MA 2NPFA 4EGLA 4AL6A 4WWSA 4MKAA 4Y3CA 1B3TA 2JEGA 5CYJA 3R5BA 1VBXA 1HWUA 2W4CA 3ZO7A 1RT2B 2R3VA 4HLBA 2XMKA 3SCIE 4X66J 1TKXA 5IV3A 3LAKA 5EDWA 2YNIA 2WTFA 3P3DA 4DV3J 1BWVA 1J2VA 1IKVA 2HEKA 2QMXA 4USIA 2Z57B 4O3OA 1X0FA 1KRPA 4RLEA 1F2GA 3ET6B 2LXFA 2XNQA 2MB0B 1WF0A 3BSNA 4NE9C 1NSPA 4AD6A 4J9UE 4O3SA 4I6YA 3W3SA 1TQLA 2H1YA 1TU0B 4OX9F 2ASLA 3NWGA 2O3DA 1CVJA 3QT5A 3I87A 5HLFB 5A2QU 1D3WA 3RU0A 4DR3F 4UOCA 1V5VA 3CIZA 1FDAA 1HQUA 1RLCL 2X51A 3N01A 4WZQA 3HI9A 2JFDA 1X5PA 3OHAA 4AQYJ 4HYKA 1HR0J 2JC0A 2AJ4A 3H20A 1NB2A 3MCMA 4WFXA 5LMUJ 2R2TA 3KLGB 2GHPA 4LFAF 4O3QA 4NLGA 4UUWA 1FKOA 1VRQC 2M7SA 3P6YC 2E1AA 3KMQA 2GQQA 2IRYA 3G6XA 1NSAA 2AWZA 2FHJA 4OQJA 3SXLA 3DRSA 2YKMB 2XNRA 1WACA 1Q0NA 3D1OA 1XMOF 1WI6A 1FKPB 1FRKA 1RT5B 2EG2A 3CO0P 3ENQA 5KFNA 5KG2A 3RB3A 5M2UA 3MPYA 3UR3C 1O0PA 1R8PA 3K7RA 3EWGA 4NMLA 4MFBA 2AIRB 4KGKA 4FBTA 4CO1A 2J0WA 4DUYJ 1LV5A 2FC9A 1A7GE 3M2UB 1RCXB 3MM9A 3PCOB 3RYLA 4YS2A 2GIRA 3C66A 4I7FB 4ZIWA 2G4BA 4FYXB 3G2XA 4JP8A 3ZTOA 3H7HB 2R7TA 2XHWA 2D3ZA 1S6PA 3QRQA 3OR2B 1BUXA 4FYYB 3IR7B 1VQMS 2HNZB 2KH9A 1NH7A 4OHYA 1S1TB 1CJKB 3TJ8A 4DV1J 1B0VA 1S7IA 2RDIA 3W5ZA 4N76A 3FCHA 2ZZNA 3EVOA 3P4UB 4ZN1A 4B9LA 5EGYA 4P7VA 1RBLA 1NSQA 4I0WA 3KHHA 1OQ3A 1RT4B 4A8XA 2Y1IA 2XYGB 1JLBB 3MM6A 4NI2A 4PWUA 5J2MA 4N56A 2EK1A 4N77A 1TL5A 3W2VA 2PT0A 3R7BB 1F60B 2DIUA 2EPIA 4J91A 2R8IA 4C9DA 1YJUA 4DL7A 4ECTA 4FXDA 4R8UB 4PQUB 3HVRA 2VBXA 5EWGA 2PI4A 1UJ4A 4C4WA 3BPDA 4F2RA 1ZZNA 4LF6J 4CLZA 1S5ZA 4UW2A 1KLMA 2JL9A 3IBWA 2DY9A 3KNAA 1NJXA 3MCOA 1CJKA 1ZS6A 2F63A 1DY3A 1GNKA 2HNYA 2ALZA 1ZAXA 2CNOB 3BSCA 1WHYA 5ETMA 4A48A 1S0OA 1H73A 3BYPA 3SI8A 2JOQA 3MPUB 3ZNJ1 5DDQC 1LWCB 3Q0AA 1B7FA 1TMJA 3TQEA 3ZTPA 4O3RA 4IYQA 4OI3A 2FJWA 4W92B 4B3SJ 2DHSA 2HBRB 3H40A 2IMOA 4HH1A 5ETOA 2UXCF 1YGYA 5D0RA 4TU9A 4B9UA 2UUAJ 2XY6A 2P2CB 3HLUA 1JKHA 4X4QA 4Z37A 5A8RB 4DV7F 2L3MA 2IMWP 3MM5A 2J7WA 2PN6A 3C6TA 1BMQB 4QW9A 3IWXA 3PW0A 1DQAA 1FVQA 1YIJS 3VVUA 1HNXF 2CPIA 1F3VA 3GG1A 2HNDA 1JLEB 3CJQA 4ZPVR 2YNHB 2YWEA 2BXJA 3GSIA 5D4OA 3CD7A 3N6LA 4NRTA 4LF7F 3WX4A 1SCJB 1Y3KA 2YWKA 3GCXP 4KKOA 2RD5C 3SCLE 3PXGa 2ZJPQ 1U47A 2FJBB 3OSNA 4K4UA 1P8GA 3MD1A 3ENVA 2M3DA 4RBTA 4QWBA 3U27A 2XS7A 2DGSA 2E5IA 4V19X 3FSXA 2NXCA 2IAJA 1ZYQA 4IOBA 2PMWA 5K8PA 1NM2A 1HPZB 1U0SA 1PYTA 1RT3A 3AHPA 2E7VA 2F8EX 5D3GA 3TA2A 3RB4A 4ICLB 4R5PA 2B9WA 2OPQA 4UF4A 3J81Y 1WC0A 2W2QP 2DITA 3TVYA 4QIGA 2UVVA 3T6JA 2YKMA 4OZNA 2XGQA 1RQ0A 2QRRA 2YNHA 3OUYA 2E5JA 1SC3B 4L3KA 1WD6A 1F0XA 2E5GA 3O1LA 1R6YA 2EG1A 1ZA2B 2NYHA 3W61A 3SMZA 4BLGA 4CLSA 4FF2A 4K0KJ 3K5PA 2OKQA 4KO0A 2CYYA 3J81j 2LECA 1FEEA 1JLFB 3T5LA 1Q7LB 1BWEA 2LU2A 3I9V9 4QIEA 1SV5B 1ZM4A 4O44B 1YKWA 2CQ4A 2E7WA 4WTYA 1FRMA 2EW9A 2Z56B 2UXCJ 1C1BA 4X4PA 2KHDA 2DISA 2DNMA 4C0OC 3TANA 2DR8A 1SQGA 5K8OA 3L95X 1HBOB 3R5JB 5KFYA 2VH7A 2N3LA 3QWPA 1QTMA 4J9VA 3PW4A 2ADBA 2Q6CA 1C2PA 4YR2A 1EX8A 2K06A 5LMUF 1JLAB 2ZITA 1NRKA 1DTQA 2HQ3A 2FJEB 2O5DA 3RBXA 4DCPB 4AE5A 5GAHU 1MSWD 2JLEA 1VC0A 1LWFB 1GFWB 5D78A 3PVXA 1B7YB 1SH2A 4IRDA 4OHVA 1N5TA 1YK9A 4LRFA 4NLPA 1D9FA 4AXJA 1N52B 4F3MA 1SL0A 4N41A 1Z2LA 4Y00A 1H74A 1T9XA 2MY7A 4AUKA 3Q8RB 5IT9Y 1DLOB 2ATCB 2M8HA 3B8HA 1NJYA 4JI6F 3P96A 2VQEF 2CPXA 4WK3A 1U2RA 4O44A 3I4HX 4A8SA 3M9MB 4X62F 2HVHA 2HQFA 3PIPQ 3OSPA 3V6DA 1LW2B 5DO2A 3PZPA 3CJ2A 4ZHRB 1TFYA 1OYEA 4RW4A 5BYSA 1BD6A 4RUCA 4CTAB 4DV4F 4QYRA 2RB7A 3TAPA 1T3OA 2Y8YA 1PCAA 2NS1B 4IDKA 4NXNF 1EP4B 3EM1A 4Y2IA 1NEEA 1ITPA 2EKYA 3GJSB 2B5JB 4LFCF 1X9WA 1WTBA 5D77A 3G82B 3AB4B 3DU6A 4HHHA 3EJMA 2YWWA 3OQ2A 3DOKB 2QSFA 4LRCA 5BYRA 2G2ZA 1MWZA 2H5IB 3MGJA 3PW7A 3DU5A 3M2VA 3OLAA 4DBQA 3NGTA 1WSVA 4X4OA 4UTGA 3K57A 4ZJOA 3PACA 3QQCD 4LF2A 2DNNA 3DLBA 1NB7A 1RAJA 3LWMA 3C14B 2VFRA 1HIYA 2YX1A 3KNGA 1Y0HA 2E44A 3IBCB 4V1Ak 4AXIA 5AE2A 2HHXA 2XMJA 1XIQA 4ES2A 2OSQA 4MKBA 2KVQE 4DQQA 2J8SA 2AYBA 3MM5B 1RTJA 2GZOA 2MJNA 3D3CJ 3RJMB 3OW2R 5A0YB 3GONA 2K1RB 2LA6A 3HHLC 4RW4B 4UUXA 2UVUA 2HZCA 4CLWA 1PJ6A 4WIIA 1FA0A 1EP4A 2DBBA 2E29A 2MLZA 3CSKA 3GG0A 3QIPB 4DUZF 1NMEB 2WONA 1TKTA 1VHFA 2BRKA 3M32A 2KYZA 1H2TZ 3AXMA 3ENAA 1RB0A 4NA1A 4U8VA 5F0UA 5LM7E 3TJAA 1W2IA 3CJ5A 3GIMA 2RAQA 3L7OA 3UD5A 1VQOS 5IC4B 2V0NA 3M2RB 2ZFHA 4M5HA 5HMYA 3MFHA 4CNZA 1UAWA 3ITHB 4IQXA 3CCLS 2Z2MA 2W25A 1WTFA 3T1HJ 4OJ1A 3ILIA 4DR1F 4X4UA 2GFFA 1VQ7S 2QA1A 1E6VB 5KG5A 4HTJA 3BO2A 2HK2A 1B70B 1ULRA 4NYZA 2Y0SD 3P49B 4JV5F 2WSCC 2PIIA 1TL3B 4J9NA 5MAOA 1FJGF 2DKOB 1NPRA 3SDEB 3HFKA 1IR0A 2CQ3A 1DJ0A 2B51A 2LXUA 1LEOA 4P73A 1SJ3P 2KFNA 4OZ2A 1HBOA 1T9YA 3CNQP 2ZHAA 4IR9A 1FE0A 2BDPA 2G1HA 3PEJA 1S4EA 1UFLA 1HWLA 4DU7A 2KM8B 1X31C 3IXQA 2HS3A 4TY9A 3V5RA 2HS4A 7AT1B 2ZBCA 3R1LA 5HVHA 1UJ5A 1E6YB 2PC6A 3CCES 1IBKF 3EGZA 3LF0A 3NOGA 1LWCA 2VDIA 2GV1A 1UW4A 5EUHA 1NSKL 3L7UA 5FD1A 4C3MA 4ECXA 1XNRF 2GAHC 1VQLS 2H5JB 2EC2A 3CMQA 1RWVB 3HFZB 3TP2A 3LUYA 4DR6F 3JTOA 3M6UA 3C16A 4W98A 4F4ZA 3LGHA 2GAGC 2IRUA 1WC4A 4CYUA 1S0MA 4LRBA 4B3OB 4M95A 2QG9B 2PD1A 3SV3A 4PWDB 2DO0A 4JBCA 1U8SA 4WFNQ 2H5EA 5L8RC 3LPYA 5KFTA 3V6DB 3E01B 3AJDA 1DZ5A 5KT4A 1Q8IA 3KDNA 2E1PA 3D2WA 1AYEA 1LOUA 3FQKA 4WK1A 2XG8A 2LCWA 4LRDA 1Q86T 3BR8A 3Q24A 4ELTA 2ZUGA 5KFVA 2V2VA 3Q2TC 1APSA 5ITHA 1Y3JA 2IYIA 1U24A 2E9RX 4QU6A 5CYMA 4FF4A 2XB2D 5KOWA 4JUZA 5T7LB 4C0HA 4K5SA 5B0GA 2I2YA 2MZQA 4WFYA 2AQ4A 4GKJJ 4DFJA 3EZUA 1QLNA 4DR5F 3V6HA 2UXDJ 2VQFF 2AX1A 1ELOA 3G6ES 4DEZA 3DHWC 3NMAA 1HL6A 1Q16B 2KHCA 5LSOA 4PWDA 2HSEB 4I6AA 2WVEA 2UUWA 4FP9A 4WKYA 5JVGQ 4LMZA 2VD3A 4HDHA 1U2FA 1FT8A 3E01A 3OFHA 4NYPA 5F9LA 4CH1A 3CPWR 4ED0A 9ATCB 2R7XA 2IY5B 1L3VA 2ZH1A 1IJEB 2PGCA 4CT8A 4Q43A 1T8EA 4NEZA 1KR4A 1UWBA 1S99A 2RMLA 2GIFA 5B0FA 3WX8A 4CLFA 2B3TB 2FDNA 2H65B 2XHCA 5DDOC 1YQHA 5F8LA 1DQ9A 2B9EA 2BYCA 2GW8A 4BC9A 4CO0A 3JYTA 1SL1A 1YI2S 3MM7A 2G0JA 2YPZA 2DXFA 1GT8A 3E51A 5KFMA 3M8PB 1HQUB 2X1GA 1WOOA 3W7BA 2N7CA 1R3NA 1UVKA 2WRMA 3GFZA 4NXNJ 2AJQA 1VQKS 1AFJA 3OVBA 3HHDA 3A3NB 4M94A 4DN9A 3G71S 1X9SA 4CCHA 2HBZB 2XZTB 3ZTRA 4H4KC 2LVWA 2C2DA 2OO4A 2LQBA 5KFDA 1TVRB 1K47A 1WC5A 1U8WA 1JLAA 1RAHB 4UQGA 4NCAA 5G0RA 1TKDA 4QWCA 4UZCA 4JI8J 1RACB 3SQOP 4X4TA 3MZIA 5ETKA 3FNNA 1G6BA 4KQZA 1ZAWA 4WCEQ 2KDOA 4M63A 4PRFA 5D8HB 2I38A 4FXWA 1X4GA 3MAQA 3GP9A 2R7VA 8AT1B 4LF5F 3GB0A 2DEJA 4YQWA 4ER8A 5E5NA 2AJ1A 1UWAA 3FZBA 3ZZPA 2CPZA 3IGVA 4YY3F 4TYAA 5GAEU 4JI5J 2Q6BA 1JXVA 2WBRA 1HYSA 2RHQB 4C97A 4NCGA 4ZLNA 1FF2A 1S1WA 4ENOA 4XIUA 5AJ3J 3D66A 2XMAA 4LSLA 3SEOA 1KLNA 3CJ3A 4JB8B 2OPRA 1GK8A 2NLWA 2NXUA 2AX0A 3CDWA 2KZMA 3OR2A 1VQYA 5DM6Q 5A2QY 5L9XA 4DXLA 3X1LB 3MTJA 4B3TF 4IDKB 4I2PA 1V3ZA 2M9KA 3ISZA 2VPWB 2ILZA 5CQGA 3OXFA 1RHMB 1X4AA 2QTWA 1SXLA 2U1AA 2Z30B 1R0AB 2F9DA 3DMJA 4NPOA 4ED5A 4DZDA 3RRGA 3TO8A 2GMHA 4LBPA 5HROA 1IJFB 3HF5A 5IOLA 1QVFR 4X4NA 1KN6A 3TZWA 1SC1B 2DD8S 3N5BA 4IFYB 5CD4A 1X5TA 4P9SA 4RW7A 1CJTA 2R9LA 1VQNS 3MMAA 4ZPDA 1T03B 2MPUA 3D1QA 3ILLA 1FDBA 4ANCA 1AUSL 3CJ4A 1BC6A 4MJKA 1P1TA 4DU8A 5CH7B 1U49A 2BBEA 2Z8QA 1JLCB 3TOQA 1FJEB 4DX8H 1U0HA 2EBGA 2V9KA 2I1RA 1LFPA 4W90B 3TYTA 4LQ3A 1S1XA 5KFCA 1LKZA 4BCAA 2ZH8A 2W2NP 3CJ8A 2CJYB 3VAFA 3DRRA 4QR2A 4DV3F 4IR1A 4KTQA 3JSYA 1ACMB 1MU2B 1VISA 3FEZA 3A1YG 2DNPA 5C2CA 4U95A 1N5VA 2CIMA 1NPKA 1UFKA 2KI2A 3BKTA 1GMWA 4IH5A 3GCWP 3GR1A 3G6VA 1IBMF 1TELA 2N3OA 2F40A 2POKA 4U8YA 4KT0C 4EO6A 2XMUA 1S1VA 4LF7J 1HHSA 2JEIA 4RW6A 1FCAA 2KT5A 3DXBA 5CYQA 4OX6A 5KG7A 2J8AA 4X4RA 1N32J 1SL2A 1PJ7A 1YRXA 2AGPA 5DDPC 5GMDA 1KP6A 2F5GA 1HFEL 2CQ2A 3DRPA 3HSDA 3N4WA 4RWWA 1EB0A 2JVRA 1HWIA 4C11A 2ASDA 1RTDB 2GC8A 2ASYA 4LJMA 3UD3P 2CFXA 4Y2AA 4FNIA 2VG7B 3I82A 2B4PA 3MI7X 4DR1J 4QR1A 1N54B 4WXOA 4ZVPB 2V8DA 2XEXA 2VBYA 3FC9A 2YBVA 2FPHX 4L76A 1NDCA 1NDKA 3HMJG 3V81B 2B7BB 1S7HA 2DJWA 4ZP6A 2V63A 2NSBA 2R2RA 1BY9A 1XERA 2CUYA 2FLOA 5KFZA 4KGXB 4TY8A 3BGOP 2Z0GA 3F41A 4USVA 3M8PA 1WKJA 4F7VA 5DQIA 1KQKA 2KG1A 1IBLF 3L3CA 1WDDA 4DLGA 2BE2A 2GHWA 3KDOA 2RJZA 3EVWA 4H4MB 2A10A 1S1WB 2KB2A 5DS7A 4JI1F 2FHKA 2KXNB 2IM2A 1FD2A 1HA1A 1KBRA 3ELHA 2NPIA 4DF8A 2WOMA 5HP1B 1M1HA 4E0DA 3MEEB 3GYNA 3OL9A 2QIFA 3OUYB 3SSQA 3M32B 2QA4G 5GADI 3W64A 1B0PA 3PJWA 4J9LA 2QE5A 1R27B 2RT3A 5J2PA 3CJSA 4TYBA 1K1QA 3CMES 3VGVA 4O4GA 2XSJA 1S9GA 4D3GA 3MTKA 3HVTA 1U1NA 2AYGA 2VPZB 3C6UA 1PJ5A 4OYAA 1U6FA 2CJBA 2XMVA 1VJWA 1N33J 1RTHB 4F4XA 2W24A 4A8OA 1D8YA 1VQ6S 2DR5A 1DHMA 1EKRA 1R0BG 4LBIA 3FSYA 1BE4A 3AA9A 4ZP8A 4DL6A 3KLGA 4EU0A 3L09A 3CD6S 2AV5A 2HRTA 3AFGA 3B78A 1BQNB 2YX4A 3AD9C 4QJVA 5SZTA 3UNGC 1N56A 3GV8B 1WG4A 5KFQA 1YJTA 2J6UA 2HMIA 5LSRA 1YDLA 1FEHA 3TA1A 3D68A 2H4YB 4PG6A 5DETA 5CCLA 3M05A 1QE1A 2JWNA 2MZ1A 3LPEA 1CJUB 3N6MA 1H2VZ 3QMQA 4OYOA 3TX0A 3V6JA 3NGRA 4NYOA 2B8PA 1S6OA 3W8PA 1FTRA 5HROB 4C8YA 3CIMA 2ABYA 2KT3A 2F7VA 3CCJS 4DV7J 1CSJA 2ZZTA 2EVZA 1NJZA 2VBZA 1FXDA 1J5EF 2E9TA 3PW5A 3DM2A 1FTCA 3TEGA 2E5LJ 4WE1A 1S1VB 4NRUA 2X1FA 2DHXA 3LP1A 5E2QA 1T3NA 2QYCA 2C2NA 1HNIA 3CW2C 4B3TJ 2ZM6F 2CQGA 1Q8BA 3LALA 4HI1A 4C3LA 4CT9A 3RAXA 4WXWA 1S0VA 5U47A 2ZUAA 4NXMJ 2DR7A 2EC0A 5CXTA 2E5LF 2YNIB 3EUNA 4X64F 2ALYB 3CJTA 4DS5A 2QLJB 4OJ3A 4P72A 1MWYA 5B0EA 2KZZA 2CKWA 3HCXA 3D7SB 1NK9A 1EQ0A 2DY1A 2RQKA 5A8KB 2XMWA 2HAFA 4LBHA 3CD5A 4Y28C 3BSOA 2VOPA 2DGOA 2CQHA 3ZTQA 2DHAA 1QJHA 3IS9B 4DSIA 4RNFA 3NGKA 2AU0A 1TKZA 3R6GB 4ZITA 4DL5A 3NS7B 2P8IA 2EFOA
chains in the Genus database with same CATH topology
5KFSA 3W2VB 3N5FA 4PUOA 5LL6d 5E33A 5J1EA 3HHKA 1D0EA 1JXLA 2JFKA 3GE9A 3G8TA 2LLZA 5AE1A 4IH7A 2Q66A 2RS2A 1KQSR 5A0YA 3BREA 4QCLA 3PM9A 4OFZA 2FHJD 1NKEA 1C0TA 3LH2S 1YJ9S 3RZAA 2WOMB 1HWKA 5HP1A 2HHTA 2W4PA 4LQ9A 3UE2A 3DLKB 4XAKA 1R0AA 4UY8T 3BO3A 3KTQA 3IWLA 2A2CA 3PY8A 3G4SS 3BO4A 5HN0A 1N4LA 2O66A 3HVTB 4MFBB 1VGYA 1NJIT 2EK6A 4QOTA 4O4RA 1U1MA 3GWCA 1XK8A 3LP2A 4QIVA 5KFUA 2ATLA 3C6TB 4J9SA 2CJAA 1LW2A 1R89A 1R7IA 3ZZOA 4CTAA 1M1KT 3EX7B 2XI2A 3K59A 1UFWA 1HQEB 2XULA 2DNRA 2UXDF 1OO0B 1ZETA 5C24A 2OPPB 3QPIA 4GKJF 1GXLA 1TUVA 1YJRA 2LXIA 2M88A 3NG8A 5ADZA 4IOCQ 2OPSB 3T3FA 1Q79A 4LF8F 4WFBQ 4CI0B 4H4OA 1SH3A 2RF2B 3G9CA 2BA9A 1NH8A 2ADCA 1S9EB 3K8WA 1JJHA 3OV7A 1F9FA 2RVJA 3DRXA 3SYZA 2C22A 1M0SA 1D9AA 2B9YA 5F3TA 3LP1B 4C11B 3DLHA 2MZRA 1LXJA 3FMBA 5DQHA 3MMCB 1GXUA 3UQSA 2K1RA 4A8KA 1YJNS 1JMTA 5DGBA 3NMRA 3H2VE 2HFNA 3SSRA 5KFGA 2HHSA 1CG2A 4B9TA 3RR8A 1V6HA 1ZM3A 3GMGA 3T19A 2VA2A 3DHXA 1KOOA 2L08A 3I5CA 1URRA 4N8NA 3PDNA 3PW2A 4MYUA 1IKYB 4K4XA 3KLFA 4URQU 2VZ9A 1FD8A 4K4TA 3TAMB 4P2SA 5B09A 2UVRA 1SV5A 1HWJA 4DFPA 3MMAB 3BF4A 4DQPA 1A6LA 3V4MA 1FJ7A 3D5MA 3T1YF 2MQPA 4HEA9 4WJBA 5E3RA 4DQIA 1NK6A 2IHR1 3I31A 3NL0A 1ZTWA 2WBMA 2K2PA 3M1VB 1FRXA 5DG8A 4IFVB 2OJ3A 4ZPAA 1RP5A 2GQ2A 1QSYA 5I42A 1VQ9S 4NZ0A 3H5UA 2E66A 2Q79A 3SSSA 1LWFA 2HHVA 1N0UA 4EO8A 4OZ0A 1SUQB 2KFZA 3KLEB 2N82B 3UWTA 2UV8A 1NK4A 1U25A 4NXMF 3E8OA 3K5LA 4QWDA 2MZJA 2HIQA 1WEZA 1WHWA 2C3MA 2XY5A 4IG3A 2ZH2A 3QLHA 2IAJB 3DDKA 4Q2LA 4F4YA 1GTHA 3T5HA 4RW8B 4ZPTR 1IKWA 2VG6A 3MWBA 3NNAA 2FHOB 5LSLA 5LMUF 3M6XA 4FVMA 4HHJA 1HR0F 4YDDB 2K7JA 2ZC4A 1VQPS 5FJ4A 5KFXA 2RH3A 3QJJA 4B9NA 3CDUA 5AE3A 2JRSA 2V8VA 3MM8B 4ID5B 3BB5A 3S1TA 1RWUA 2VG7A 3J7YI 1SJ1A 1YG0A 1XR7A 3CVKA 3VR1A 4IO9Q 2A18A 1UP1A 3OL8A 1SJFA 4CO3A 1HBMA 3M8QA 4LVOP 2GMLA 2VKRA 3V81A 4F4KA 4J9RA 2HHQA 5T14A 3CT9A 4I2QA 2V4JB 1LW0B 3HVWA 3MOJB 2MKSA 4G6VB 1FXLA 4FNHA 2NSCA 4ZVGA 1SB6A 2DGVA 5I3UA 4Y65A 3IGNA 1QSSA 4P7TA 4ERDA 4RW8A 1J5OA 2R7SA 1XTZA 5J1NA 5G4DA 3GV5B 2XY7A 3AAWB 1L3TA 1KFSA 1TAUA 1ZM2A 4X2BA 5A8RA 4FVCA 3HKWA 1KNZA 3SDEA 1S9FA 1X4CA 5E7OB 2EI5A 4QZVB 3OTOF 4XO0A 3FFIB 1HQEA 2ZOFA 5B08A 1RYSA 2Z2LA 2XS5A 1SIWB 3PKYA 4DSEA 5LMNF 3HK2A 2OD4A 5KG1A 5KG3A 1SJ4P 4H4OB 3MHYA 2HGNA 2D9PA 2WW8A 2HWIA 3MR3A 4J9PA 1U6BA 3HHEA 4ZVHA 1QAJA 4G1QB 2DNQA 2YH0A 2CQBA 2XCPA 4RWXA 3H2LA 2XS2A 4I7FA 2RRBA 3GFXA 4KHMA 3NBPA 1RT3B 2GO9A 1VRUA 1URNA 2BQ3A 3C2PA 5K5MA 4CO2A 2HG4A 2RQMA 1VBZA 1REVA 1MMDA 1R8AA 3NAIA 4DL3A 1MU2A 1U45A 1JIHA 2FVRA 1RT1A 1GX6A 5I3QA 3UCUP 1RT7B 2SXLA 1L5UA 3VAHA 3CCMS 1QSLA 3MMJA 3ZZRA 1SUQA 4DV0F 4YR3A 5K9FA 3G86A 4ED8A 1BLUA 3CB4A 1VIOA 3GV7B 2IC3B 4OZJA 4WKRA 1N32F 5HL7Q 2ZE2A 2IYGA 3DGPA 3DRPB 2XSFA 2UVWA 5D4PA 3NBPB 3J7ZT 1TAQA 2YKPA 1N88A 2CQ0A 1VQ8S 2VFSA 3AB2B 4K2XA 2LQ9A 2I5JB 2VG5A 3FEXB 5F41A 1FRIA 3EZ5A 1FRHA 2C3OA 2W7AA 4QWBA 2VPYB 2YNGA 4YB1P 5A6PA 4URGA 3IRXA 4DDFA 1XMBA 2I0XA 3PFOA 1IKXB 3KLIB 3M2RA 4OLOA 4DPOA 2OPSA 2AJ0A 2PO4A 1LW0A 1YRTA 5AXLA 2MKHA 1XN9A 4DLEA 4ETXA 1KHWA 1RKJA 1O8BA 2BE2B 2HRYA 5CHCB 5DJBA 2IBKA 3B82A 1J5OB 2PA8D 4NLXA 1YSJA 1KEKA 1H6KX 1NJWA 3J7A1 5B0DA 4LVNP 1ZM9A 1TZ0A 1IQTA 2K3IA 4FBUA 3Q8QB 2ZH6A 4EEYA 2MQOA 3EPGA 1YJVA 4FPRA 1T8EA 1NU4A 2YKOA 2M52A 4C98A 1I1GA 2W9CB 4F25A 4OHXA 5G0RB 1U1RA 2CJKA 3IA0A 2DVIA 3CULA 3M9NB 5DDRC 1VMBA 4QWEA 1YHQS 2DR9A 2HVIA 2BANA 5D4NA 2CJQA 2DNYA 4E8UA 1XR5A 5KFPA 5DM7Q 2IVMA 2R8HA 3OJUA 3JSMA 3C6UB 1KTVA 2DB1A 4ZCLA 4C8KA 1UETA 3JSRA 2O01C 2OMLA 2GMJA 2AP6A 4WFAQ 4AQYF 1RTHA 1M5KC 4EBCA 2UZAA 2RQCA 3U7JA 1L3KA 1HBNA 4MAKA 1UMJA 4KR0B 5F0WA 4PQUA 3CJKB 4BWMA 5J2NA 4WYWA 4N47A 5BJRA 4Q0BB 3OXLA 1VBYA 3MEGB 2HWTA 1NKBA 3GIKA 3LP0A 2EFNA 3H4BA 1NHUA 3CDBA 2ZH4A 3ZZZA 4H54A 2E1RA 3THPA 3T6BA 2DGUA 3IR6B 2YTCA 2XMTA 3MUMP 1U1LA 4KV8A 5K14A 4DV2F 4X66F 3GYXB 5CYMB 3UR0A 2YKNA 2IA6A 4ILLA 4OI1A 4DJBA 3HHLA 4OI4A 1D9DA 1LWEA 2GCFA 4A4JA 1X5SA 2QA4S 4NL5A 4LSLB 1DBDA 4K59A 3UPFA 4FXVA 4RNOA 2R2SA 5HO4A 4ED3A 3TARA 2R8KA 1Z4UA 4MYTA 5HI7A 2AGOA 4WZMA 1JKHB 2GGPB 3PJXA 1OPIA 1H0HB 2A2DA 3ZFVA 3ENWA 2BZ2A 5F8NA 1C1CA 1DRZA 2LEBA 1AW0A 2G1DA 5E41A 3OFEA 4I1TA 4RKUC 3KLHB 2J7UA 3TR5A 2RNEA 3QGPA 3OL7A 1T7PA 5JJBA 3D54A 4F26A 1WF1A 2COLA 2F4VF 4ZPCA 4I67A 4EBEA 4LSNB 3JYTB 1IKYA 2UUTA 2L9DA 3MEDB 2LA4A 3KWMA 2DNKA 3K58A 4K4YA 1RISA 2DH8A 4KHPF 3R1HA 1HHTP 1QUPA 4YFUA 1PC4A 4RW6B 4PG8A 2F9JA 2CPHA 2GHVC 4A8MP 3HO1A 3DLEA 3LWLA 3PX4A 4BS2A 4NLWA 1U48A 3C46A 4MH8A 1RT6B 1V3RA 1QUVA 2FLNA 3HVAA 4HTIA 5KFIA 5DQGA 2ZH9A 4DV6F 3PKMA 2YNGB 2UP1A 1X4BA 2XO7A 1TK5A 3KLHA 2KYXA 3VQTA 1UL3A 1RT4A 1UA1A 4DR4F 5LJ3Y 2I8EA 1JLBA 5J2MB 1M90T 1TK8A 3POTB 3X3UA 3U1MA 5M2RA 2I9SA 3MECA