1VQ9V

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq9V00
1QVFU 5DM6V 3CCUV 1W2BU 1KC8W 3CD6V 3CCVV 3CCRV 2QEXV 1R73A 1VQ8V 2OTJV 1M1KW 1Q81W 1YJNV 1K73W 3CCEV 3CMAV 1QVGU 2QA4V 3I55V 2D3OW 1KQSU 4WFAV 1YITV 3CC4V 1YHQV 1VQ6V 1YJ9V 2OTLV 1JJ2U 3CCMV 1KD1W 1VQ9V 1N8RW 1M90W 1VQ7V 1VQ5V 1VQ4V 1YJWV 1YIJV 1NJIW 3CC2V 3CCJV 3CCSV 1Q86W 1VQPV 3CPWU 3G71V 1VQMV 3CCQV 1VQKV 1K8AW 1VQNV 4WCEV 3CCLV 1VQLV 1Q82W 3G6EV 3CMEV 3I56V 1S72V 1VQOV 4WFBV 1YI2V 1Q7YW 3G4SV 1K9MW 3CC7V 4WF9V 3CXCU 3OW2U
chains in the Genus database with same CATH superfamily
3BA8A 5B1NA 4JI6O 2XT9A 4JI7O 1KKDA 3SDLA 1G6UA 4JYYA 2WLKA 4HBNA 1Q86W 4ZBMA 4YY3B 4AI8A 3WB2A 2PGGA 4X9QA 3T1HB 5LP6B 3ZJZA 2N04A 3JATB 1NVPD 2QEXV 4RUEA 1FXKC 4PDVA 2NN4A 4UV8A 4NTXA 1RFYA 4FFBB 4O4JA 3QF7A 5LHHA 2HKOA 1FXHA 5KHKA 4TV8A 2GTAA 3ZRWB 5LP6C 4PD4F 1Q43A 1T5EA 3L70H 4X1IA 4B3MO 3ABTA 1KBHA 1WPXA 4TUYA 2H94A 4H37A 3SR2C 3P32A 3OEHG 2NLJC 5B66Z 1K4CC 3GB7C 5L3FA 2Y4TA 1ORQC 4JI6B 2RDCA 3K04A 5CBGA 5J2TB 1LNQA 3LDCA 4LNUA 5JH7B 3C3SA 3R65A 3ZHTA 4PV1B 4CBCA 1K9MW 3ZHVA 4JYCA 3SYAA 1K34A 3HKEA 4BW5A 4IT5A 2VRZA 1TA8A 3SPGA 3A0HZ 2QTOA 2DWDC 3E83A 4JI3B 1MSDA 5B1OA 4LF5O 3FB6C 4MTXA 3CP1A 4BIZA 1YF2A 1VQMV 4GZRB 2HR3A 4U7NA 1Y67A 2GDSA 3RYCA 3ZCCA 1RP3B 3KKYA 2BTQA 2Q7EA 4LP8A 4MTGA 1F23A 4F6RB 4DV4O 5JQGA 2JVDA 4H0LB 2QWPB 3T2MA 2DW4A 4B3MB 3AG1B 4B08A 2CH7A 2F23A 2P22C 2PZSA 4CH5A 1EFRG 5H6RA 3HKBA 1H2NA 3JD3A 4P9PA 2AXTZ 4LF9O 1VQLV 1FPOA 3G67A 4FLZA 3OUSA 5KHHA 2AZ0A 1Z5VA 3CXCU 3UT5B 2CE4A 1AVMA 2B1IA 1BMFG 4MVMA 1KMIZ 1DLBA 3K3WA 3AG1C 3ZHUA 1YJNV 2VQEO 2ETNA 1K97A 4B7KA 4RUFA 3CSXA 2ZNJA 1WB8A 3K5LA 1P49A 5B1AB 5IYZA 4OXSA 2EIJB 4BIOA 1VARA 1KB9F 2DN9A 4LF5B 1BHBA 2R9RB 4GYCB 2BTOA 4CH3A 1YDXA 5JCOC 3RYHB 4K8ZA 1J95A 1F7YA 4NB5A 2R70A 3ZRXA 2YEVA 1GMGA 5B1AC 3SYQA 3E89A 3H01A 4TV9A 2EIJC 4UCVA 3CEIA 1FXVA 4CH4A 1XL4A 3TCUA 4AQYO 2F1MA 4GT1A 3E22B 2LFSA 3TJTA 4I50B 2JJ2G 4HNAB 4ZHQB 4LF9B 3APOA 2WLLA 1PNMA 2G38A 3JASB 1GN2A 2FTKA 4RO2A 1L0LH 2ZCEA 1VQ9V 2ZR3A 3MDSA 4DK0A 5FLXN 1S5JA 1DTOA 3FX7A 4TWKA 1BSMA 4RWUA 1HNXB 5IWAB 3S3WA 2EBOA 1Y6XA 4X64O 3L9DA 3ASNC 4DV7O 4LC1A 5LMNO 4K0KO 5L3BA 1RPOA 1R6NA 5J2UB 1I5YA 2Q7GA 2YC0A 5EZYA 3LSUA 3DC6A 2ARHA 2A3QA 4O2AA 1NI8A 4JI2B 4GX0A 1WN7A 1FD9A 4DR1B 3VQYA 2RNBA 3IJ4A 4JTAB 2OYQA 1H2KA 5CMUA 2M7WA 3HKDB 1WJZA 1AR1B 3VQWA 4AQYB 2ZD9A 1FFXA 4FLYA 1S5LZ 4WFAV 1N33O 4PI2A 4MTFA 4RAIA 1OV9A 3OGCC 3QNEA 4FM1A 2JGUA 1KU9A 3SYPA 2ZE6A 4UXNA 1PPJH 5FPOA 5BR8O 4X64B 1DF5A 4ZOLA 1PD3A 4DV7B 1AP6A 4Q20A 1AR5A 1JJ2U 3RBZA 4K0KB 1UPGA 2Q4PA 3ZBHA 1SS3A 1HR0B 3IAYA 3CRMA 3P30A 1JOYA 3AK2A 4UCOA 1I5XA 4FLUA 3OTOO 2ZIOA 1UJWB 2FKXA 2Z5UA 4O4IA 4QE9A 3LSQA 4YJ2B 2JJ1G 3APQA 1I94O 5C93A 1N0JA 5EYPB 1SC5B 2LW7A 3ZRVA 4HZ3A 2CTRA 2YS8A 1N33B 1M9NA 2IJJA 1ZAUA 2QSAA 2FYUH 4IHJB 5EIBD 2LJ2A 3GWOA 5KAIZ 1SESA 2UUBO 5KAFZ 1XILA 1ZWIC 5BR8B 1IX9A 3ML0A 2OCCC 4MVUA 5BZBA 2ZE7A 2B9ZA 1BT8A 1MABG 2JEUA 1H2LA 3ZS8C 2WLMA 4PA3A 1A32A 3ASOB 4GKJB 1GN3A 4C7UA 3CD6V 3OTOB 3ETEA 1JX9A 2P67A 4J11A 2ILMA 3AG3B 5EC2C 4OPAA 2YXHA 2WAMA 4KL1A 4PA9A 1W0JG 3K9SA 1BGYH 1MSWD 3ASOC 4WCEV 4J80A 1H2SB 3D36A 4B3RO 2R9IA 5IJ9A 2DYRC 1EM1A 1R73A 1Y76A 1EN6A 4JZ2A 3AG3C 1SA0B 3MHSC 1N32B 1EN5A 3J80N 3AG4B 1R1BA 3E2EA 3SJCC 1ROPA 3SJQC 1OCZB 2UUBB 1Q5OA 4FK5C 5CA0A 3ICXA 4MVZA 4X62O 4ZI7B 1COWG 1GAXA 1I0HA 4P30A 3ZHSA 3VBBA 3CRAA 2WLJA 1L8DA 1WAZA 1SF9A 1QLEB 4FM0A 1R3IC 1P4RA 1OCZC 1EN4A 1O9GA 4NVPA 1VQPV 1RPRA 4DRXA 1K7DA 2JGDB 1HNWO 3OAAG 3TXSA 2IW5A 4B3RB 3AG7A 1OZ0A 3CMAV 1LUVA 1MZFA 4BIUA 4KHPO 1UFIA 5LGUA 2EJRA 4IYHA 3K5MA 1QHTA 1XEQA 1WNSA 2YIBA 1Y66A 4EFEA 3SJAC 5LBQA 3LNMB 2CGOA 1XMOO 5L3CA 3CC7V 2OWOA 4KUMA 1FJGO 2BSKA 1BS3A 4DV0O 5KX5B 4J7JA 3ETGA 4X62B 3W7TA 3JD0A 5BMVB 2VS0A 3AK3A 4FZ0A 4F4LA 3A8TA 4DV6B 2QTSA 2QM7A 5GW7A 3L74H 3WB0A 2QE7G 2EIKB 3C90A 1JFFA 3H1IH 3HKCB 1Q7YW 1AILA 1VMGA 2B5UA 4PDMA 2UUCO 3CWBH 4PA6A 1IBKO 4GX2A 1NVPB 1MZEA 3L75H 3ZX6A 3B40A 3MD0A 1HNWB 3OTFA 4IIJA 5C8YA 4LF7B 1U96A 2KG7B 2EIKC 5A2QN 2AHYA 4PDRA 4DV5B 1EZJA 4KHPB 1ZTEA 1VQKV 4MVOA 1XHXA 5K1XA 3OMAB 3CRQA 4U3JB 3EXAA 2Q0AA 1NT2B 1HNZO 3RYIA 5IYDO 2QA4V 1JCHA 4DV0B 2PI5A 1BQ0A 1KYOF 5IDJA 4I55A 3OR7C 1M4UA 1GM8A 2W6JG 3T1HO 1JA8A 2V1DA 2WLIB 3FAVA 4G2KA 4NR1A 1NBMG 5FPRA 5KMGA 5LOVA 1PNLA 4IYIA 2DE0X 4XDLA 1OCCB 4H33A 1F4MA 1Z5WA 3RWRD 2EZOA 3CE2A 2OTLV 5LXTB 4JAVA 3JAWB 5LYJB 1BQZA 1Q6IA 2VWKA 4DUZO 2YIBD 3NXSA 1M56B 4YJ3A 1DK1A 4UVCA 3K0GA 2UXBO 4H13B 3ETDA 1WP7A 1YTFD 2R72A 1K4DC 1OCCC 2OTJV 3DSQA 2YIAA 5FNVA 1VQ6V 4WFHA 1M56C 2MW2B 3E8BA 1HNZB 3JSLA 4FMTA 1NR1A 1XQ8A 2CUGA 1YEWA 3C3TA 1YI2V 4JYAB 1K5QA 4O4JB 3M8AA 4UVAA 4JI3O 2ODMA 4TV8B 1PKXA 1KD1W 3OT7A 3KZIZ 4AILC 5J9PC 3H1JH 1FXKA 1PNKA 3FKSG 3THOA 1ZLZA 1K33A 4FM2A 3NR7A 4DUZB 4X1IB 4TOIA 3CYOA 3G6EV 3Q4HA 3GVMA 3VOUA 4TUYB 4PHZA 5EBWC 2UXBB 3BFRA 2GUZA 2AHZA 5IE9A 2CDYA 1VF7A 5LP6A 4WFEA 4GLXA 2QR4A 1E1QG 4QGPA 4LNUB 1G1XB 2EILB 1M57B 2IJIA 3ZEDA 1YJWV 2Q0OC 2QWOB 3O9OA 4B7EA 2AZ2A 4I9QA 3CCQV 1OCRB 1Y74B 3HKEB 4KXRA 3LUTB 3ZRWA 4FLVA 4JI5O 4N23A 4LBEC 4P2ZA 2EILC 1M57C 3H1HH 4ZKIA 3H1KH 3TK1A 1OCRC 4J42A 2UXCO 3CC2V 3JYCA 3RYCB 1NR7A 2BTQB 1Q6HA 3CCLV 4HAMA 4DYLA 4NXMB 5JQGB 4YIPA 2IU0A 5KUMA 5CA3A 3A2FA 2CH7B 2Y69B 4QIWF 3ZRSA 1P84F 2E3CA 2P5OA 3HKBB 3IC9A 3ZMZA 4ASUG 4DR7O 4JI0B 2A9HA 3CX5F 2WSSG 2ZDIA 4CH6A 3CJHA 4R8CA 1NQTA 1QU7A 3DXRA 2ITCC 1US6A 2YI8A 1QVGU 4JI5B 1HNXO 1JVMA 5IWAO 5IYZB 4LH7A 1KUQA 1VQ4V 1IBMO 1IZ3A 1KKCA 2EIMB 3QTCA 4O4LA 2WLHA 2CAZC 2DOSA 2P4KA 4O2BA 5A9GA 2UXCB 1VF6A 4R7CA 4DK1A 4A5UB 2YEVB 4YHHO 4EEQA 3CCEV 4TV9B 5DECA 4PI0A 4JI2O 2ZXWB 2EIMC 2CK3G 4DR1O 3SPCA 1D5AA 1XBLA 5JCOA 4UUJC 2Q69A 1MNGA 3KG2A 2YI9A 3D3QA 2WLLB 4PA7A 5HFLA 2F4VB 1S76D 4DV1B 4DR7B 3K08A 2VWJA 2ZXWC 5JVDA 2Q73A 4MSWC 2EINB 5ITZA 2NNUA 1Q90D 4I9WA 2JIZG 3RYHA 3T1YB 1W0KG 4X65O 1H8HG 1BCCH 3F5WC 3BA9A 5E1AC 1QQCA 2GHYA 3IGAC 1J5EO 1IBMB 1S72V 2IM9A 5F2VO 3FD9A 5GONA 1AJQA 3P3NA 1XREA 2B1GA 4CC6A 4WF9V 2EINC 4J7ZA 1B3QA 2R9AA 4Z1VA 2DYSB 5EZYB 3UKMA 2F93B 1HR0O 2D3OW 5CB4A 1GM7A 3WG7B 4YHHB 3F5TA 4XBFA 5B5EZ 4D6TH 3STZC 4I5SA 1H38A 2EX3A 3M7MX 5B3SB 2DYSC 1FFXB 3LSSA 1VEWA 1ZX3A 3STLC 1KC8W 3MHHC 3WG7C 2ZKOA 3EHBB 2ATKC 1IBLO 1LR1A 2PYLA 4DR3O 3WFVA 3K5NA 2JDIG 2CTPA 3KCXA 4DUYO 4EFBA 2F43G 4FLTA 4G28B 4UVBA 2FB5A 2Y4UA 5B3SC 3PN1A 1RSOA 4X65B 4FJCC 4XDJA 3BABA 2LO1A 3JD1A 4ZOLB 4L87A 4MS2A 4LWSA 5EK0A 1S5HC 1O9HA 1J5EB 5LGTA 1VQ8V 1I7FA 4NKGB 4X89A 1D5NA 1VIBA 1VP7A 1SQQH 1N4CA 3JALA 1PL4A 4CC5A 2E75B 2DQ0A 1OCOB 4AHCA 4GKJO 2A7WA 4O4IB 3W7WA 1AJPA 4I4TB 3B09A 1HP8A 4MVRA 3U10A 2Q5ZA 2ITDC 3D8CA 4DW1A 1OCOC 1N8RW 3N2GA 4B3TO 4BWAA 1YIJV 3QVNA 1IBLB 1LUWA 2NR5A 3BHPA 3B77A 5IYBO 4UFZA 4DR3B 4DR5B 4DUYB 1N32O 2ZE8A 4NYKA 5JWPA 1U97A 3D3IA 3T4ZA 2HFEC 1B6QA 3JAKA 2UXNA 3RYFA 1SERA 3BPZA 2LFRA 5EYPA 1TUBA 5EBMC 3CS5A 4W4LA 3CRCA 1R6TA 2JRIA 1IXMA 4R50A 4LFAB 4LH6A 1URFA 2A06H 3ABKB 3SYCA 4D7TA 4CZZA 2DMXA 1YZBA 4UB8Z 2L35A 5IJ9B 1SRYA 4B3TB 3ABKC 2OT5A 3ZHQA 4UCSA 1NTZH 1TVKA 1Y76B 1FYJA 2OIEA 2WPDG 4J10A 2P6JA 4OPHA 1N0NA 1R3LC 3H1LH 5H5NA 1XHZA 1MA1A 3U11A 3CCMV 2ZINA 3OUFA 3JARA 5CA0B 4JI4O 3EVKA 1THZA 4U7OA 5CBHA 4NXNB 3TETA 3AK1A 4X1KA 3ABMB 2XAQA 2RJZA 4JZGA 3OGIB 1W2BU 1CPYA 2HEPA 4GKKO 4DV6O 1AP5A 1DGSA 5E79Z 3T1CA 3AG4C 3N2KA 4DRXB 2LP7A 1XNRO 2HLDG 4JPRA 3ABMC 3ZMSA 4JASA 2P06A 4ICGA 3LDEA 1G4YB 2IBZH 3FB5C 3FFQA 4DW0A 2BE3A 1QLEC 4LF7O 2YIDA 4IGGA 4MW8A 2Q8VA 4DV5O 1YHQV 2C2AA 5K1PA 1SQVH 2P4VA 1SZTA 3UQ8A 2X0LA 1K8AW 2UUAO 2BSKB 4E4EA 4JI4B 4HYOA 5LHGA 4DR2O 4I0XA 5B1BB 5LA6A 3CCUV 2QWRB 4CS2A 4E2LA 2XOKG 2KSDA 1JFFB 4G27B 3L71H 4GKKB 4UV9A 4UCRA 3CCSV 4MT8A 1GTOA 5CA1A 1Q82W 5B1BC 2HVJC 1XNRB 4B3SO 2M6YA 2ZIMA 1ZSPA 3K79A 1Q6UA 4WBNA 5C8YB 1XNQO 4F6EA 5JJJB 4Z1MG 2GBOA 1P7GA 2GSMB 4OX9B 4LF4B 1YSCA 1X4TA 1VF5B 1AI5A 4GX5A 5KHJA 1SZXA 3ETQA 2LGQA 3RYIB 1X59A 3A0BZ 1KP3A 5DM6V 4TT3G 3RVYA 4DV3B 2UUAB 2W0XA 4N21A 2LGWA 4H44B 1Q81W 3G6BA 4DR2B 4I55B 5IJ0A 4IL6Z 4PA4A 4JYAO 3FAVB 2JS3A 4JI1O 5KMGB 5LOVB 3CXHF 2QDOA 3G4SV 2HP8A 1K92A 4LCUC 4B3SB 2Y0IA 4NTYA 2GV9A 4YJ3B 3RN4A 1B06A 2WA4A 1ZL8A 5EBLC 1XNQB 1WA8A 4I7ZB 1WB7A 5LGNA 1ENVA 2EULA 3BCCH 2QKAA 1NZ6A 1N34O 3ABLB 4O4HA 4CS4A 1QR9A 2F95B 1EZVH 4JAUA 2X6AA 2UU9O 1BZKA 2IJHA 4KP4A 3TXQA 4EB6A 4DR6O 4DXWA 2GTSA 1CXZB 1GKFA 1WPBA 2O57A 1M90W 2ADPA 5AG2A 1NJIW 3WB1A 3ABLC 4X20A 2JK5C 2CGNA 2E5LO 5BXZA 1PP9H 4LF8O 3E8HA 2XAJA 2CTWA 4X1YA 1Z2GA 1QNMA 1BE3H 2QJ1A 1GM9A 4JI1B 4GUNA 3S3XA 4LF6B 4YXWG 1IURA 1M1KW 1FXKB 2Q7HA 2RCVA 1F4NA 1SKVA 3K58A 2YSUB 4JGSA 3B8MA 3Q4HB 2Q6AA 1R3KC 2YXYA 2P7TC 4NXMO 1JQ0A 2GUZB 3CMEV 1SQXH 4BAYA 1N34B 1HDJA 1P7BA 2BOBC 2QWQB 5L3DA 4FFKA 2A0LA 3MAQA 2QWNB 1HW7A 3K59A 5LMUO 1Q8IA 3E8FA 3JATA 3VQXA 1IXBA 4PDLA 3ZMUA 3FYIB 4JI0O 2UU9B 4FFBA 1XUQA 4DR6B 3CCJV 2DQ3A 1AROP 2P90A 4JI8B 5H9CA 5GTHZ 4K35A 2K1EA 2E5LB 4LF8B 1DF4A 3KCYA 3OE7G 4QPKA 3CCVV 2PI4A 5LL6Y 3E8GA 1CP9A 4Z2WA 3EFFK 1GO3F 2QM4A 3O65A 1K3EA 2LW1A 1WP8A 2YXLA 3OD4A 1BHAA 3LNNA 4JI7B 2DWEC 3ZN1A 1N36O 3VQVA 4QPJA 5J2TA 4WFBV 1IDSA 1Y74A 5JH7A 4P9OA 1NH2D 2H8PC 3RT3C 3OM3B 1NTKH 2BOCC 3JD2A 4BR6A 2IJKA 4CS3A 3T4DA 3K5OA 1E79G 2KQXA 4W4KA 4QE7A 3UM7A 2F4VO 2Y0PA 5LMUB 1H8EG 2PY5A 4DV1O 3CJHB 3DXRB 2KKWA 2HJFC 1AR4A 5L3EA 1S0VA 2Y69C 2HHHO 3T1YO 4TSFG 3ZMVA 2YDEA 1XOUA 4O4LB 5JJNB 4F6RA 2K9PA 2XNDG 2ZDIC 4O2BB 2EJ7A 5DN6G 2UXXA 4UCTA 4LFCO 1OJHA 3OMNB 2XAGA 3ZMTA 4FPPA 1NTMH 1SQPH 2IU3A 4X8AA 1SQFA 4X66O 4BW9A 3GWKC 1N36B 3CB2A 1QBZA 4MW3A 1SQBH 1MOFA 3BY6A 4OGQB 3UT5A 3W7UA 5KUKA 1PM9A 1VF6C 5IY5B 3U0ZA 4MVSA 1M5IA 2F66C 4GCZA 4JF3A 5JVDB 2Q9LA 5ITZB 1ZUQA 1HWYA 1K5SA 1GN4A 4FLXA 1SETA 1NU1H 4J9YB 3QO7A 1KQSU 3SPHA 2HHHB 5IY5C 4DV4B 3ZIAG 1VQ7V 1H2MA 3TGUH 2XUMA 5GONB 1JR9A 5CBFA 4ZIBA 2L6LA 2RN9A 5JJEB 4LFCB 4UCUA 5CB4B 3ASNB 3E22A 4JAAA 4I50A 4X66B 1TUEB 4HNAA 4ZHQA 4O2AB 1IVSA 5H2FZ 4JV5O 3JASA 5IYCO 3FB7C 2X6CA 5KA5A 3FYEB 2VQEB 3BEHA 1AI4A 2V7QG 3CPWU 3H9VA 5EIBC 1VQOV 4UB6Z 2W6IG 3X2QB 3RGBA 4JTCB 3I5DA 1AI7A 3PJSK 2CTQA 3I55V 1GRJA 1YJ9V 5J2UA 1RSOB 1PV0A 4DR5O 2OCHA 2XASA 1AJNA 3OMIB 3L73H 3OR6C 3X2QC 4LWSB 3DGEA 1PL0A 1B04A 3R66A 3SPJA 3W7SA 2RQ6A 2RMKB 1YVWA 3SJBC 3HKDA 3JALB 1YXBA 2Q67A 1GK9A 4XDKA 4ABMA 1XL6A 2PTMA 4WFFA 2IH1C 4FVMA 4LFAO 4JV5B 5GTIZ 1VQNV 3F7VC 3BAAA 3B2EE 4DO2A 5D5PA 1MMMA 2BCCH 3N27A 1QVFU 4RQEA 1XI1A 1AI6A 2HJDA 3N2GB 2PYJA 1FAFA 2KB1A 5LMNB 3CC4V 1QLNA 2IH3C 3DC5A 4KFMA 2X7RB 3DTUB 1V54B 5LHIA 5KLVH 3QO8A 3ZN0A 2QGNA 3A0RA 2XAFA 3UCSC 4TQFA 3L72H 4MVQA 4I4TA 4LFBO 2WWWA 3K03A 3JAKB 1YCIA 3RYFB 1V54C 1SQGA 4DR4O 4NXNO 1TUBB 2JS5A 4YJ2A 4DV2O 2WLNA 2EZPA 2OCCB 2D2CB 3HR0A 4K8XA 3AG2B 1H2GA 4R6ZA 2FL4A 3JD4A 4IHJA 5HFMA 1YITV 2ZM6O 3IFXA 2ZQMA 4LR3A 3K06A 1WLEA 1TVKB 3AG2C 1L1FA 3B8NA 1Q3EA 2E74B 3I56V 3LDDA 5EC1C 5FL7G 4FZ1A 1BL8A 1KP2A 4MTOA 3OEEG 3F7YC 3W7XA 3CCRV 2H3OA 2DYRB 4FLWA 3JARB 1K73W 5H6QA 2AGAA 1V9PA 4LFBB 3D36C 4YIOA 2VQFO 2X6BA 1I94B 4X1KB 2WA3A 4DR4B 4QNHB 4DV2B 2Y48A 2A79B 4TQDA 3G80A 3K0DA 3SYOA 3N2KB 1G8MA 3UO2A 1JMKC 1OHHG 2ZNIA 1SA0A 3ZHRA 2ZM6B 3BVOA 5KA6A 1NKDA 4NTWA 3AEIA 3OFNG 4U3FH 3QG5A 4ZI7A 3E35A 4EKWA 4LF4O 4OX9O 5L3GA 3P3PA 1L0NH 3CRRA 3FB8C 3UO3A 4QJFB 4RQFA 2OIGA 1CEZA 1VQ5V 1GN6A 2DJVA 2JEXA 4Q6GA 4I0XB 5LA6B 3SPIA 4DV3O 2VQFB 5CN0A 3HPLC 2XHBA 1F51A 3IC7A 4D7SA 2N05A 1YTFB 3JAMN 3M99B 2XTAA 5BY1A 2AW9A 1TGOA 2JGDA 4X88A 1NS1A 2YUAA 4JTDB 5CA1B 3RVZA 2ZE5A 2UXDO 1JPXA 1S77D 4WBNB 2V4DA 2HVKC 2ADQB 2MK3A 1XDCA 1FKAO 4IIJB 5KHIA 4J7KA 4J41A 5KX5A 2Z0AA 5DEDA 3RFRA 2Q68A 3CHXA 1R3JC 4PJ0Z 1GH6A 5BMVA 2XAHA 1JJOA 3JCZA 4JYBA 4FIPC 1R6KA 5IT9N 1KECA 4K3AA 5IJ0B 1FS0G 3HKCA 2PF4E 3JCUZ 4PELA 3RW0A 1W59A 2QM8A 2HG5C 1Y4MA 3SGIA 3B4SA 5D5QA 1XMQO 1EBOA 2N74A 1I08A 1S3JA 2KG7A 4J9ZB 4LF6O 1E1RG 1TAEA 2ZR2A 3OW2U 2UXDB 1QR8A 4L8JA 1ZL8B 3WU2Z 1M93A 1XMOB 1WA8B 4U3JA 1FJGB 2PUSA 3J81N 1V55B 4YY3O 2QKSA 5KHGA 1RM1B 4O4HB 2YICA 2W0FC 2E76B 3JSNA 2FMLA 2LQTA 3BRCA 2ZT9B 4EB6B 5FNVB 2WLIA 4GX1A 1NH2B 3HB3B 3J7AU 1V55C 2QKCA 2UUCB 1IBKB 1RM1C 4X20B 4JI8O 3K9AA 2Z3YA 1FFTB 5TISZ 1AB3A 4X1YB 5LXTA 3JAWA 3E86A 3G71V 4WFGA 5LYJA 1QCEA 3K57A 3ABUA 1D2DA 1XMQB 3QO5A 1MG1A
chains in the Genus database with same CATH topology
4MVRA 3OAAG 1QBZA 2IW5A 4MW3A 5B1NA 1MOFA 3BY6A 2ITDC 1OZ0A 3CMAV 3W7UA 5KUKA 4BIUA 1KKDA 1OCOC 1N8RW 5LGUA 1YIJV 2EJRA 5IY5B 2WLKA 5IYBO 3B77A 1Q86W 4ZBMA 4MVSA 1Y66A 4GCZA 4JF3A 5LBQA 3LNMB 5L3CA 3CC7V 3ZJZA 4KUMA 1HWYA 1K5SA 1NVPD 2QEXV 4RUEA 1FXKC 4PDVA 1SETA 3ETGA 4UV8A 4J9YB 3W7TA 3QO7A 1KQSU 3JD0A 3SPHA 3D3IA 3T4ZA 5IY5C 2HFEC 5LHHA 2HKOA 1B6QA 1FXHA 3ZIAG 1VQ7V 2UXNA 1SERA 4F4LA 2LFRA 2QM7A 5GW7A 2QE7G 2EIKB 5EBMC 3ZRWB 5CBFA 1Q7YW 1IXMA 4R50A 2B5UA 4PDMA 3ABKB 4PA6A 3SYCA 3ASNB 4GX2A 3ABTA 1NVPB 1WPXA 2H94A 3MD0A 4H37A 1TUEB 3P32A 3OEHG 2NLJC 4CZZA 1K4CC 5IYCO 3GB7C 2EIKC 3FB7C 2X6CA 5L3FA 2AHYA 1ORQC 3FYEB 4PDRA 5KA5A 3K04A 5CBGA 1EZJA 1LNQA 3LDCA 3BEHA 1AI4A 2V7QG 3CPWU 1VQKV 1SRYA 3ABKC 4MVOA 2OT5A 1VQOV 3R65A 1K9MW 2W6IG 4CBCA 3OMAB 4JYCA 3X2QB 2WPDG 4JTCB 3SYAA 1K34A 4BW5A 2P6JA 1AI7A 3PJSK 1R3LC 3SPGA 5IYDO 3I55V 2QA4V 1JCHA 1YJ9V 2PI5A 3CCMV 2QTOA 3OUFA 2DWDC 3E83A 5IDJA 5B1OA 3OR7C 1THZA 2XASA 3FB6C 1AJNA 1GM8A 4MTXA 2W6JG 3CP1A 4U7OA 5CBHA 3TETA 4BIZA 3OMIB 1VQMV 3OR6C 3X2QC 2HR3A 2V1DA 3DGEA 2WLIB 4U7NA 1PL0A 3ABMB 3SPJA 2XAQA 3W7SA 3ZCCA 4G2KA 1NBMG 1PNLA 1W2BU 4LP8A 4MTGA 1F23A 1CPYA 4XDLA 1OCCB 4H33A 1F4MA 2Q67A 3T2MA 2DW4A 2EZOA 1GK9A 4XDKA 2OTLV 1XL6A 3AG1B 4JAVA 4WFFA 3T1CA 3AG4C 2LP7A 3NXSA 1M56B 1EFRG 2IH1C 4UVCA 5H6RA 3JD3A 3K0GA 4P9PA 2HLDG 4JPRA 3ABMC 3ZMSA 1VQNV 3F7VC 1VQLV 4JASA 4DO2A 3ETDA 3LDEA 1G4YB 3OUSA 3FB5C 1YTFD 3CXCU 1K4DC 1OCCC 1QVFU 4MVMA 2B1IA 1BMFG 3K3WA 1DLBA 4RQEA 1QLEC 1AI6A 2OTJV 3AG1C 1YJNV 4MW8A 1VQ6V 2KB1A 4WFHA 3CC4V 1QLNA 1M56C 1YHQV 2IH3C 2C2AA 3E8BA 1K97A 4KFMA 4RUFA 2X7RB 3DTUB 1V54B 5LHIA 3QO8A 3ZN0A 1SZTA 4FMTA 1NR1A 3A0RA 5B1AB 2X0LA 1K8AW 4OXSA 2EIJB 2XAFA 4HYOA 1YI2V 5LHGA 1K5QA 5B1BB 1BHBA 2R9RB 4MVQA 3CCUV 4UVAA 2WWWA 3K03A 4E2LA 1J95A 1V54C 2XOKG 1PKXA 3ZRXA 2YEVA 1KD1W 1GMGA 5B1AC 3SYQA 3E89A 4G27B 3H01A 5J9PC 2EIJC 1FXKA 1PNKA 3FKSG 2WLNA 1FXVA 1K33A 4UV9A 1XL4A 2EZPA 2OCCB 3TCUA 4MT8A 3CCSV 1GTOA 1Q82W 5B1BC 2HVJC 3CYOA 3G6EV 3AG2B 4GT1A 2LFSA 3VOUA 5EBWC 2JJ2G 2AHZA 1H2GA 4R6ZA 3K79A 2WLLA 1PNMA 4WFEA 2FTKA 3JD4A 4RO2A 4Z1MG 5HFMA 1YITV 3IFXA 1E1QG 1VQ9V 2ZR3A 2ZQMA 2EILB 1M57B 2IJIA 1DTOA 2GSMB 3K06A 4TWKA 1YSCA 1YJWV 1WLEA 3AG2C 1AI5A 1L1FA 4GX5A 3B8NA 1OCRB 3CCQV 2EBOA 3I56V 3LDDA 5EC1C 5FL7G 3LUTB 3ASNC 3ZRWA 4LC1A 1BL8A 1KP2A 4MTOA 3OEEG 4N23A 1KP3A 5DM6V 3F7YC 1RPOA 4TT3G 3RVYA 1R6NA 4LBEC 5L3BA 3W7XA 3CCRV 2DYRB 4N21A 1Q81W 4P2ZA 1K73W 1I5YA 1M57C 2EILC 5H6QA 4ZKIA 3TK1A 2X6BA 1OCRC 4GX0A 3CC2V 3JYCA 4PA4A 1NR7A 4QNHB 4JTAB 3CCLV 4HAMA 5CMUA 2M7WA 2Y48A 2A79B 3G4SV 1AR1B 3K0DA 1K92A 3SYOA 2IU0A 5KUMA 4LCUC 5CA3A 2ZD9A 2Y69B 4QIWF 3ZRSA 1G8MA 4WFAV 5EBLC 4MTFA 4RAIA 1OHHG 3ZMZA 5LGNA 3OGCC 1ENVA 3QNEA 4ASUG 3SYPA 3ABLB 2A9HA 2WSSG 4UXNA 2ZDIA 1QR9A 4R8CA 1NQTA 5KA6A 1NKDA 4JAUA 2X6AA 2ITCC 1DF5A 3AEIA 3OFNG 1PD3A 3E35A 2IJHA 4Q20A 4KP4A 4EKWA 5L3GA 1QVGU 4DXWA 3FB8C 1JJ2U 3RBZA 4QJFB 1GKFA 1JVMA 4RQFA 1M90W 1CEZA 1VQ5V 1VQ4V 2JEXA 2EIMB 3P30A 1NJIW 1JOYA 3ABLC 2WLHA 2JK5C 3SPIA 3E8HA 2XAJA 1I5XA 5CN0A 1UJWB 3HPLC 4R7CA 1F51A 3IC7A 2Z5UA 1GM9A 1YTFB 3M99B 4QE9A 3LSQA 2YEVB 4YXWG 1M1KW 4X88A 3CCEV 2JJ1G 1FXKB 2ZXWB 5C93A 2EIMC 1F4NA 4JTDB 2CK3G 2YSUB 4JGSA 3ZRVA 4HZ3A 3RVZA 3SPCA 3B8MA 4UUJC 2Q6AA 2Q69A 1R3KC 2P7TC 1M9NA 1JQ0A 2IJJA 3KG2A 1JPXA 3CMEV 1S77D 2WLLB 2HVKC 4PA7A 5HFLA 4BAYA 1S76D 2MK3A 3K08A 1P7BA 2ZXWC 2BOBC 3GWOA 4MSWC 5L3DA 2EINB 2A0LA 2NNUA 4I9WA 2JIZG 1SESA 1W0KG 3E8FA 2Q68A 1ZWIC 1H8HG 4PDLA 1R3JC 3ML0A 2OCCC 3FYIB 3ZMUA 4MVUA 5BZBA 3F5WC 3CCJV 2DQ3A 1AROP 1MABG 2JEUA 2P90A 2XAHA 5E1AC 5H9CA 2GHYA 3JCZA 4JYBA 3IGAC 2WLMA 4FIPC 1S72V 4PA3A 1AJQA 1R6KA 2B1GA 1KECA 4WF9V 3ASOB 2EINC 2K1EA 3CD6V 1DF4A 2DYSB 3OE7G 4QPKA 3CCVV 1FS0G 3UKMA 2PI4A 3ETEA 1JX9A 2P67A 4PELA 3RW0A 2D3OW 3E8GA 1CP9A 2QM8A 1GM7A 3AG3B 2HG5C 1GO3F 3EFFK 5EC2C 3WG7B 1Y4MA 2WAMA 1K3EA 1BHAA 1EBOA 2DWEC 4XBFA 3ZN1A 4PA9A 1W0JG 4I5SA 3STZC 1MSWD 1S3JA 3ASOC 4WCEV 1H38A 4QPJA 3D36A 4J9ZB 4WFBV 1E1RG 2DYSC 2R9IA 5B3SB 3LSSA 2ZR2A 3OW2U 2DYRC 1QR8A 4P9OA 3STLC 1KC8W 1NH2D 3MHHC 1R73A 2H8PC 3OM3B 3AG3C 2BOCC 3WG7C 3EHBB 2ATKC 3MHSC 3JD2A 2IJKA 1V55B 3WFVA 3T4DA 2QKSA 2JDIG 1E79G 1RM1B 3AG4B 2F43G 4QE7A 3UM7A 4G28B 3E2EA 1ROPA 4UVBA 3SJQC 1H8EG 1OCZB 5B3SC 2W0FC 4FK5C 4FJCC 4MVZA 4XDJA 2HJFC 5L3EA 3JD1A 1S0VA 1COWG 2Y69C 4L87A 4MS2A 4P30A 5EK0A 2WLIA 4GX1A 1S5HC 1NH2B 3VBBA 4TSFG 2WLJA 3HB3B 1V55C 5LGTA 1VQ8V 4X89A 3ZMVA 1QLEB 1RM1C 1R3IC 1P4RA 1OCZC 2XNDG 3K9AA 2ZDIC 2Z3YA 1FFTB 5DN6G 2DQ0A 2UXXA 1OCOB 1VQPV 3E86A 3G71V 4WFGA 3OMNB 1RPRA 1QCEA 2XAGA 3ZMTA 3ABUA 4FPPA 2IU3A 4X8AA 3W7WA 1AJPA 3QO5A 1K7DA 1MG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF U;  5DM6 V;  3CCU V;  1W2B U;  1KC8 W;  3CD6 V;  3CCV V;  3CCR V;  2QEX V;  1R73 A;  1VQ8 V;  2OTJ V;  1M1K W;  1Q81 W;  1YJN V;  1K73 W;  3CCE V;  3CMA V;  1QVG U;  2QA4 V;  3I55 V;  2D3O W;  1KQS U;  4WFA V;  1YIT V;  3CC4 V;  1YHQ V;  1VQ6 V;  1YJ9 V;  2OTL V;  1JJ2 U;  3CCM V;  1KD1 W;  1VQ9 V;  1N8R W;  1M90 W;  1VQ7 V;  1VQ5 V;  1VQ4 V;  1YJW V;  1YIJ V;  1NJI W;  3CC2 V;  3CCJ V;  3CCS V;  1Q86 W;  1VQP V;  3CPW U;  3G71 V;  1VQM V;  3CCQ V;  1VQK V;  1K8A W;  1VQN V;  4WCE V;  3CCL V;  1VQL V;  1Q82 W;  3G6E V;  3CME V;  3I56 V;  1S72 V;  1VQO V;  4WFB V;  1YI2 V;  1Q7Y W;  3G4S V;  1K9M W;  3CC7 V;  4WF9 V;  3CXC U;  3OW2 U; 
#chains in the Genus database with same CATH topology
 3BA8 A;  5B1N A;  4JI6 O;  2XT9 A;  4JI7 O;  1KKD A;  3SDL A;  1G6U A;  4JYY A;  2WLK A;  4HBN A;  1Q86 W;  4ZBM A;  4YY3 B;  4AI8 A;  3WB2 A;  2PGG A;  4X9Q A;  3T1H B;  5LP6 B;  3ZJZ A;  2N04 A;  3JAT B;  1NVP D;  2QEX V;  4RUE A;  1FXK C;  4PDV A;  2NN4 A;  4UV8 A;  4NTX A;  1RFY A;  4FFB B;  4O4J A;  3QF7 A;  5LHH A;  2HKO A;  1FXH A;  5KHK A;  4TV8 A;  2GTA A;  3ZRW B;  5LP6 C;  4PD4 F;  1Q43 A;  1T5E A;  3L70 H;  4X1I A;  4B3M O;  3ABT A;  1KBH A;  1WPX A;  4TUY A;  2H94 A;  4H37 A;  3SR2 C;  3P32 A;  3OEH G;  2NLJ C;  5B66 Z;  1K4C C;  3GB7 C;  5L3F A;  2Y4T A;  1ORQ C;  4JI6 B;  2RDC A;  3K04 A;  5CBG A;  5J2T B;  1LNQ A;  3LDC A;  4LNU A;  5JH7 B;  3C3S A;  3R65 A;  3ZHT A;  4PV1 B;  4CBC A;  1K9M W;  3ZHV A;  4JYC A;  3SYA A;  1K34 A;  3HKE A;  4BW5 A;  4IT5 A;  2VRZ A;  1TA8 A;  3SPG A;  3A0H Z;  2QTO A;  2DWD C;  3E83 A;  4JI3 B;  1MSD A;  5B1O A;  4LF5 O;  3FB6 C;  4MTX A;  3CP1 A;  4BIZ A;  1YF2 A;  1VQM V;  4GZR B;  2HR3 A;  4U7N A;  1Y67 A;  2GDS A;  3RYC A;  3ZCC A;  1RP3 B;  3KKY A;  2BTQ A;  2Q7E A;  4LP8 A;  4MTG A;  1F23 A;  4F6R B;  4DV4 O;  5JQG A;  2JVD A;  4H0L B;  2QWP B;  3T2M A;  2DW4 A;  4B3M B;  3AG1 B;  4B08 A;  2CH7 A;  2F23 A;  2P22 C;  2PZS A;  4CH5 A;  1EFR G;  5H6R A;  3HKB A;  1H2N A;  3JD3 A;  4P9P A;  2AXT Z;  4LF9 O;  1VQL V;  1FPO A;  3G67 A;  4FLZ A;  3OUS A;  5KHH A;  2AZ0 A;  1Z5V A;  3CXC U;  3UT5 B;  2CE4 A;  1AVM A;  2B1I A;  1BMF G;  4MVM A;  1KMI Z;  1DLB A;  3K3W A;  3AG1 C;  3ZHU A;  1YJN V;  2VQE O;  2ETN A;  1K97 A;  4B7K A;  4RUF A;  3CSX A;  2ZNJ A;  1WB8 A;  3K5L A;  1P49 A;  5B1A B;  5IYZ A;  4OXS A;  2EIJ B;  4BIO A;  1VAR A;  1KB9 F;  2DN9 A;  4LF5 B;  1BHB A;  2R9R B;  4GYC B;  2BTO A;  4CH3 A;  1YDX A;  5JCO C;  3RYH B;  4K8Z A;  1J95 A;  1F7Y A;  4NB5 A;  2R70 A;  3ZRX A;  2YEV A;  1GMG A;  5B1A C;  3SYQ A;  3E89 A;  3H01 A;  4TV9 A;  2EIJ C;  4UCV A;  3CEI A;  1FXV A;  4CH4 A;  1XL4 A;  3TCU A;  4AQY O;  2F1M A;  4GT1 A;  3E22 B;  2LFS A;  3TJT A;  4I50 B;  2JJ2 G;  4HNA B;  4ZHQ B;  4LF9 B;  3APO A;  2WLL A;  1PNM A;  2G38 A;  3JAS B;  1GN2 A;  2FTK A;  4RO2 A;  1L0L H;  2ZCE A;  1VQ9 V;  2ZR3 A;  3MDS A;  4DK0 A;  5FLX N;  1S5J A;  1DTO A;  3FX7 A;  4TWK A;  1BSM A;  4RWU A;  1HNX B;  5IWA B;  3S3W A;  2EBO A;  1Y6X A;  4X64 O;  3L9D A;  3ASN C;  4DV7 O;  4LC1 A;  5LMN O;  4K0K O;  5L3B A;  1RPO A;  1R6N A;  5J2U B;  1I5Y A;  2Q7G A;  2YC0 A;  5EZY A;  3LSU A;  3DC6 A;  2ARH A;  2A3Q A;  4O2A A;  1NI8 A;  4JI2 B;  4GX0 A;  1WN7 A;  1FD9 A;  4DR1 B;  3VQY A;  2RNB A;  3IJ4 A;  4JTA B;  2OYQ A;  1H2K A;  5CMU A;  2M7W A;  3HKD B;  1WJZ A;  1AR1 B;  3VQW A;  4AQY B;  2ZD9 A;  1FFX A;  4FLY A;  1S5L Z;  4WFA V;  1N33 O;  4PI2 A;  4MTF A;  4RAI A;  1OV9 A;  3OGC C;  3QNE A;  4FM1 A;  2JGU A;  1KU9 A;  3SYP A;  2ZE6 A;  4UXN A;  1PPJ H;  5FPO A;  5BR8 O;  4X64 B;  1DF5 A;  4ZOL A;  1PD3 A;  4DV7 B;  1AP6 A;  4Q20 A;  1AR5 A;  1JJ2 U;  3RBZ A;  4K0K B;  1UPG A;  2Q4P A;  3ZBH A;  1SS3 A;  1HR0 B;  3IAY A;  3CRM A;  3P30 A;  1JOY A;  3AK2 A;  4UCO A;  1I5X A;  4FLU A;  3OTO O;  2ZIO A;  1UJW B;  2FKX A;  2Z5U A;  4O4I A;  4QE9 A;  3LSQ A;  4YJ2 B;  2JJ1 G;  3APQ A;  1I94 O;  5C93 A;  1N0J A;  5EYP B;  1SC5 B;  2LW7 A;  3ZRV A;  4HZ3 A;  2CTR A;  2YS8 A;  1N33 B;  1M9N A;  2IJJ A;  1ZAU A;  2QSA A;  2FYU H;  4IHJ B;  5EIB D;  2LJ2 A;  3GWO A;  5KAI Z;  1SES A;  2UUB O;  5KAF Z;  1XIL A;  1ZWI C;  5BR8 B;  1IX9 A;  3ML0 A;  2OCC C;  4MVU A;  5BZB A;  2ZE7 A;  2B9Z A;  1BT8 A;  1MAB G;  2JEU A;  1H2L A;  3ZS8 C;  2WLM A;  4PA3 A;  1A32 A;  3ASO B;  4GKJ B;  1GN3 A;  4C7U A;  3CD6 V;  3OTO B;  3ETE A;  1JX9 A;  2P67 A;  4J11 A;  2ILM A;  3AG3 B;  5EC2 C;  4OPA A;  2YXH A;  2WAM A;  4KL1 A;  4PA9 A;  1W0J G;  3K9S A;  1BGY H;  1MSW D;  3ASO C;  4WCE V;  4J80 A;  1H2S B;  3D36 A;  4B3R O;  2R9I A;  5IJ9 A;  2DYR C;  1EM1 A;  1R73 A;  1Y76 A;  1EN6 A;  4JZ2 A;  3AG3 C;  1SA0 B;  3MHS C;  1N32 B;  1EN5 A;  3J80 N;  3AG4 B;  1R1B A;  3E2E A;  3SJC C;  1ROP A;  3SJQ C;  1OCZ B;  2UUB B;  1Q5O A;  4FK5 C;  5CA0 A;  3ICX A;  4MVZ A;  4X62 O;  4ZI7 B;  1COW G;  1GAX A;  1I0H A;  4P30 A;  3ZHS A;  3VBB A;  3CRA A;  2WLJ A;  1L8D A;  1WAZ A;  1SF9 A;  1QLE B;  4FM0 A;  1R3I C;  1P4R A;  1OCZ C;  1EN4 A;  1O9G A;  4NVP A;  1VQP V;  1RPR A;  4DRX A;  1K7D A;  2JGD B;  1HNW O;  3OAA G;  3TXS A;  2IW5 A;  4B3R B;  3AG7 A;  1OZ0 A;  3CMA V;  1LUV A;  1MZF A;  4BIU A;  4KHP O;  1UFI A;  5LGU A;  2EJR A;  4IYH A;  3K5M A;  1QHT A;  1XEQ A;  1WNS A;  2YIB A;  1Y66 A;  4EFE A;  3SJA C;  5LBQ A;  3LNM B;  2CGO A;  1XMO O;  5L3C A;  3CC7 V;  2OWO A;  4KUM A;  1FJG O;  2BSK A;  1BS3 A;  4DV0 O;  5KX5 B;  4J7J A;  3ETG A;  4X62 B;  3W7T A;  3JD0 A;  5BMV B;  2VS0 A;  3AK3 A;  4FZ0 A;  4F4L A;  3A8T A;  4DV6 B;  2QTS A;  2QM7 A;  5GW7 A;  3L74 H;  3WB0 A;  2QE7 G;  2EIK B;  3C90 A;  1JFF A;  3H1I H;  3HKC B;  1Q7Y W;  1AIL A;  1VMG A;  2B5U A;  4PDM A;  2UUC O;  3CWB H;  4PA6 A;  1IBK O;  4GX2 A;  1NVP B;  1MZE A;  3L75 H;  3ZX6 A;  3B40 A;  3MD0 A;  1HNW B;  3OTF A;  4IIJ A;  5C8Y A;  4LF7 B;  1U96 A;  2KG7 B;  2EIK C;  5A2Q N;  2AHY A;  4PDR A;  4DV5 B;  1EZJ A;  4KHP B;  1ZTE A;  1VQK V;  4MVO A;  1XHX A;  5K1X A;  3OMA B;  3CRQ A;  4U3J B;  3EXA A;  2Q0A A;  1NT2 B;  1HNZ O;  3RYI A;  5IYD O;  2QA4 V;  1JCH A;  4DV0 B;  2PI5 A;  1BQ0 A;  1KYO F;  5IDJ A;  4I55 A;  3OR7 C;  1M4U A;  1GM8 A;  2W6J G;  3T1H O;  1JA8 A;  2V1D A;  2WLI B;  3FAV A;  4G2K A;  4NR1 A;  1NBM G;  5FPR A;  5KMG A;  5LOV A;  1PNL A;  4IYI A;  2DE0 X;  4XDL A;  1OCC B;  4H33 A;  1F4M A;  1Z5W A;  3RWR D;  2EZO A;  3CE2 A;  2OTL V;  5LXT B;  4JAV A;  3JAW B;  5LYJ B;  1BQZ A;  1Q6I A;  2VWK A;  4DUZ O;  2YIB D;  3NXS A;  1M56 B;  4YJ3 A;  1DK1 A;  4UVC A;  3K0G A;  2UXB O;  4H13 B;  3ETD A;  1WP7 A;  1YTF D;  2R72 A;  1K4D C;  1OCC C;  2OTJ V;  3DSQ A;  2YIA A;  5FNV A;  1VQ6 V;  4WFH A;  1M56 C;  2MW2 B;  3E8B A;  1HNZ B;  3JSL A;  4FMT A;  1NR1 A;  1XQ8 A;  2CUG A;  1YEW A;  3C3T A;  1YI2 V;  4JYA B;  1K5Q A;  4O4J B;  3M8A A;  4UVA A;  4JI3 O;  2ODM A;  4TV8 B;  1PKX A;  1KD1 W;  3OT7 A;  3KZI Z;  4AIL C;  5J9P C;  3H1J H;  1FXK A;  1PNK A;  3FKS G;  3THO A;  1ZLZ A;  1K33 A;  4FM2 A;  3NR7 A;  4DUZ B;  4X1I B;  4TOI A;  3CYO A;  3G6E V;  3Q4H A;  3GVM A;  3VOU A;  4TUY B;  4PHZ A;  5EBW C;  2UXB B;  3BFR A;  2GUZ A;  2AHZ A;  5IE9 A;  2CDY A;  1VF7 A;  5LP6 A;  4WFE A;  4GLX A;  2QR4 A;  1E1Q G;  4QGP A;  4LNU B;  1G1X B;  2EIL B;  1M57 B;  2IJI A;  3ZED A;  1YJW V;  2Q0O C;  2QWO B;  3O9O A;  4B7E A;  2AZ2 A;  4I9Q A;  3CCQ V;  1OCR B;  1Y74 B;  3HKE B;  4KXR A;  3LUT B;  3ZRW A;  4FLV A;  4JI5 O;  4N23 A;  4LBE C;  4P2Z A;  2EIL C;  1M57 C;  3H1H H;  4ZKI A;  3H1K H;  3TK1 A;  1OCR C;  4J42 A;  2UXC O;  3CC2 V;  3JYC A;  3RYC B;  1NR7 A;  2BTQ B;  1Q6H A;  3CCL V;  4HAM A;  4DYL A;  4NXM B;  5JQG B;  4YIP A;  2IU0 A;  5KUM A;  5CA3 A;  3A2F A;  2CH7 B;  2Y69 B;  4QIW F;  3ZRS A;  1P84 F;  2E3C A;  2P5O A;  3HKB B;  3IC9 A;  3ZMZ A;  4ASU G;  4DR7 O;  4JI0 B;  2A9H A;  3CX5 F;  2WSS G;  2ZDI A;  4CH6 A;  3CJH A;  4R8C A;  1NQT A;  1QU7 A;  3DXR A;  2ITC C;  1US6 A;  2YI8 A;  1QVG U;  4JI5 B;  1HNX O;  1JVM A;  5IWA O;  5IYZ B;  4LH7 A;  1KUQ A;  1VQ4 V;  1IBM O;  1IZ3 A;  1KKC A;  2EIM B;  3QTC A;  4O4L A;  2WLH A;  2CAZ C;  2DOS A;  2P4K A;  4O2B A;  5A9G A;  2UXC B;  1VF6 A;  4R7C A;  4DK1 A;  4A5U B;  2YEV B;  4YHH O;  4EEQ A;  3CCE V;  4TV9 B;  5DEC A;  4PI0 A;  4JI2 O;  2ZXW B;  2EIM C;  2CK3 G;  4DR1 O;  3SPC A;  1D5A A;  1XBL A;  5JCO A;  4UUJ C;  2Q69 A;  1MNG A;  3KG2 A;  2YI9 A;  3D3Q A;  2WLL B;  4PA7 A;  5HFL A;  2F4V B;  1S76 D;  4DV1 B;  4DR7 B;  3K08 A;  2VWJ A;  2ZXW C;  5JVD A;  2Q73 A;  4MSW C;  2EIN B;  5ITZ A;  2NNU A;  1Q90 D;  4I9W A;  2JIZ G;  3RYH A;  3T1Y B;  1W0K G;  4X65 O;  1H8H G;  1BCC H;  3F5W C;  3BA9 A;  5E1A C;  1QQC A;  2GHY A;  3IGA C;  1J5E O;  1IBM B;  1S72 V;  2IM9 A;  5F2V O;  3FD9 A;  5GON A;  1AJQ A;  3P3N A;  1XRE A;  2B1G A;  4CC6 A;  4WF9 V;  2EIN C;  4J7Z A;  1B3Q A;  2R9A A;  4Z1V A;  2DYS B;  5EZY B;  3UKM A;  2F93 B;  1HR0 O;  2D3O W;  5CB4 A;  1GM7 A;  3WG7 B;  4YHH B;  3F5T A;  4XBF A;  5B5E Z;  4D6T H;  3STZ C;  4I5S A;  1H38 A;  2EX3 A;  3M7M X;  5B3S B;  2DYS C;  1FFX B;  3LSS A;  1VEW A;  1ZX3 A;  3STL C;  1KC8 W;  3MHH C;  3WG7 C;  2ZKO A;  3EHB B;  2ATK C;  1IBL O;  1LR1 A;  2PYL A;  4DR3 O;  3WFV A;  3K5N A;  2JDI G;  2CTP A;  3KCX A;  4DUY O;  4EFB A;  2F43 G;  4FLT A;  4G28 B;  4UVB A;  2FB5 A;  2Y4U A;  5B3S C;  3PN1 A;  1RSO A;  4X65 B;  4FJC C;  4XDJ A;  3BAB A;  2LO1 A;  3JD1 A;  4ZOL B;  4L87 A;  4MS2 A;  4LWS A;  5EK0 A;  1S5H C;  1O9H A;  1J5E B;  5LGT A;  1VQ8 V;  1I7F A;  4NKG B;  4X89 A;  1D5N A;  1VIB A;  1VP7 A;  1SQQ H;  1N4C A;  3JAL A;  1PL4 A;  4CC5 A;  2E75 B;  2DQ0 A;  1OCO B;  4AHC A;  4GKJ O;  2A7W A;  4O4I B;  3W7W A;  1AJP A;  4I4T B;  3B09 A;  1HP8 A;  4MVR A;  3U10 A;  2Q5Z A;  2ITD C;  3D8C A;  4DW1 A;  1OCO C;  1N8R W;  3N2G A;  4B3T O;  4BWA A;  1YIJ V;  3QVN A;  1IBL B;  1LUW A;  2NR5 A;  3BHP A;  3B77 A;  5IYB O;  4UFZ A;  4DR3 B;  4DR5 B;  4DUY B;  1N32 O;  2ZE8 A;  4NYK A;  5JWP A;  1U97 A;  3D3I A;  3T4Z A;  2HFE C;  1B6Q A;  3JAK A;  2UXN A;  3RYF A;  1SER A;  3BPZ A;  2LFR A;  5EYP A;  1TUB A;  5EBM C;  3CS5 A;  4W4L A;  3CRC A;  1R6T A;  2JRI A;  1IXM A;  4R50 A;  4LFA B;  4LH6 A;  1URF A;  2A06 H;  3ABK B;  3SYC A;  4D7T A;  4CZZ A;  2DMX A;  1YZB A;  4UB8 Z;  2L35 A;  5IJ9 B;  1SRY A;  4B3T B;  3ABK C;  2OT5 A;  3ZHQ A;  4UCS A;  1NTZ H;  1TVK A;  1Y76 B;  1FYJ A;  2OIE A;  2WPD G;  4J10 A;  2P6J A;  4OPH A;  1N0N A;  1R3L C;  3H1L H;  5H5N A;  1XHZ A;  1MA1 A;  3U11 A;  3CCM V;  2ZIN A;  3OUF A;  3JAR A;  5CA0 B;  4JI4 O;  3EVK A;  1THZ A;  4U7O A;  5CBH A;  4NXN B;  3TET A;  3AK1 A;  4X1K A;  3ABM B;  2XAQ A;  2RJZ A;  4JZG A;  3OGI B;  1W2B U;  1CPY A;  2HEP A;  4GKK O;  4DV6 O;  1AP5 A;  1DGS A;  5E79 Z;  3T1C A;  3AG4 C;  3N2K A;  4DRX B;  2LP7 A;  1XNR O;  2HLD G;  4JPR A;  3ABM C;  3ZMS A;  4JAS A;  2P06 A;  4ICG A;  3LDE A;  1G4Y B;  2IBZ H;  3FB5 C;  3FFQ A;  4DW0 A;  2BE3 A;  1QLE C;  4LF7 O;  2YID A;  4IGG A;  4MW8 A;  2Q8V A;  4DV5 O;  1YHQ V;  2C2A A;  5K1P A;  1SQV H;  2P4V A;  1SZT A;  3UQ8 A;  2X0L A;  1K8A W;  2UUA O;  2BSK B;  4E4E A;  4JI4 B;  4HYO A;  5LHG A;  4DR2 O;  4I0X A;  5B1B B;  5LA6 A;  3CCU V;  2QWR B;  4CS2 A;  4E2L A;  2XOK G;  2KSD A;  1JFF B;  4G27 B;  3L71 H;  4GKK B;  4UV9 A;  4UCR A;  3CCS V;  4MT8 A;  1GTO A;  5CA1 A;  1Q82 W;  5B1B C;  2HVJ C;  1XNR B;  4B3S O;  2M6Y A;  2ZIM A;  1ZSP A;  3K79 A;  1Q6U A;  4WBN A;  5C8Y B;  1XNQ O;  4F6E A;  5JJJ B;  4Z1M G;  2GBO A;  1P7G A;  2GSM B;  4OX9 B;  4LF4 B;  1YSC A;  1X4T A;  1VF5 B;  1AI5 A;  4GX5 A;  5KHJ A;  1SZX A;  3ETQ A;  2LGQ A;  3RYI B;  1X59 A;  3A0B Z;  1KP3 A;  5DM6 V;  4TT3 G;  3RVY A;  4DV3 B;  2UUA B;  2W0X A;  4N21 A;  2LGW A;  4H44 B;  1Q81 W;  3G6B A;  4DR2 B;  4I55 B;  5IJ0 A;  4IL6 Z;  4PA4 A;  4JYA O;  3FAV B;  2JS3 A;  4JI1 O;  5KMG B;  5LOV B;  3CXH F;  2QDO A;  3G4S V;  2HP8 A;  1K92 A;  4LCU C;  4B3S B;  2Y0I A;  4NTY A;  2GV9 A;  4YJ3 B;  3RN4 A;  1B06 A;  2WA4 A;  1ZL8 A;  5EBL C;  1XNQ B;  1WA8 A;  4I7Z B;  1WB7 A;  5LGN A;  1ENV A;  2EUL A;  3BCC H;  2QKA A;  1NZ6 A;  1N34 O;  3ABL B;  4O4H A;  4CS4 A;  1QR9 A;  2F95 B;  1EZV H;  4JAU A;  2X6A A;  2UU9 O;  1BZK A;  2IJH A;  4KP4 A;  3TXQ A;  4EB6 A;  4DR6 O;  4DXW A;  2GTS A;  1CXZ B;  1GKF A;  1WPB A;  2O57 A;  1M90 W;  2ADP A;  5AG2 A;  1NJI W;  3WB1 A;  3ABL C;  4X20 A;  2JK5 C;  2CGN A;  2E5L O;  5BXZ A;  1PP9 H;  4LF8 O;  3E8H A;  2XAJ A;  2CTW A;  4X1Y A;  1Z2G A;  1QNM A;  1BE3 H;  2QJ1 A;  1GM9 A;  4JI1 B;  4GUN A;  3S3X A;  4LF6 B;  4YXW G;  1IUR A;  1M1K W;  1FXK B;  2Q7H A;  2RCV A;  1F4N A;  1SKV A;  3K58 A;  2YSU B;  4JGS A;  3B8M A;  3Q4H B;  2Q6A A;  1R3K C;  2YXY A;  2P7T C;  4NXM O;  1JQ0 A;  2GUZ B;  3CME V;  1SQX H;  4BAY A;  1N34 B;  1HDJ A;  1P7B A;  2BOB C;  2QWQ B;  5L3D A;  4FFK A;  2A0L A;  3MAQ A;  2QWN B;  1HW7 A;  3K59 A;  5LMU O;  1Q8I A;  3E8F A;  3JAT A;  3VQX A;  1IXB A;  4PDL A;  3ZMU A;  3FYI B;  4JI0 O;  2UU9 B;  4FFB A;  1XUQ A;  4DR6 B;  3CCJ V;  2DQ3 A;  1ARO P;  2P90 A;  4JI8 B;  5H9C A;  5GTH Z;  4K35 A;  2K1E A;  2E5L B;  4LF8 B;  1DF4 A;  3KCY A;  3OE7 G;  4QPK A;  3CCV V;  2PI4 A;  5LL6 Y;  3E8G A;  1CP9 A;  4Z2W A;  3EFF K;  1GO3 F;  2QM4 A;  3O65 A;  1K3E A;  2LW1 A;  1WP8 A;  2YXL A;  3OD4 A;  1BHA A;  3LNN A;  4JI7 B;  2DWE C;  3ZN1 A;  1N36 O;  3VQV A;  4QPJ A;  5J2T A;  4WFB V;  1IDS A;  1Y74 A;  5JH7 A;  4P9O A;  1NH2 D;  2H8P C;  3RT3 C;  3OM3 B;  1NTK H;  2BOC C;  3JD2 A;  4BR6 A;  2IJK A;  4CS3 A;  3T4D A;  3K5O A;  1E79 G;  2KQX A;  4W4K A;  4QE7 A;  3UM7 A;  2F4V O;  2Y0P A;  5LMU B;  1H8E G;  2PY5 A;  4DV1 O;  3CJH B;  3DXR B;  2KKW A;  2HJF C;  1AR4 A;  5L3E A;  1S0V A;  2Y69 C;  2HHH O;  3T1Y O;  4TSF G;  3ZMV A;  2YDE A;  1XOU A;  4O4L B;  5JJN B;  4F6R A;  2K9P A;  2XND G;  2ZDI C;  4O2B B;  2EJ7 A;  5DN6 G;  2UXX A;  4UCT A;  4LFC O;  1OJH A;  3OMN B;  2XAG A;  3ZMT A;  4FPP A;  1NTM H;  1SQP H;  2IU3 A;  4X8A A;  1SQF A;  4X66 O;  4BW9 A;  3GWK C;  1N36 B;  3CB2 A;  1QBZ A;  4MW3 A;  1SQB H;  1MOF A;  3BY6 A;  4OGQ B;  3UT5 A;  3W7U A;  5KUK A;  1PM9 A;  1VF6 C;  5IY5 B;  3U0Z A;  4MVS A;  1M5I A;  2F66 C;  4GCZ A;  4JF3 A;  5JVD B;  2Q9L A;  5ITZ B;  1ZUQ A;  1HWY A;  1K5S A;  1GN4 A;  4FLX A;  1SET A;  1NU1 H;  4J9Y B;  3QO7 A;  1KQS U;  3SPH A;  2HHH B;  5IY5 C;  4DV4 B;  3ZIA G;  1VQ7 V;  1H2M A;  3TGU H;  2XUM A;  5GON B;  1JR9 A;  5CBF A;  4ZIB A;  2L6L A;  2RN9 A;  5JJE B;  4LFC B;  4UCU A;  5CB4 B;  3ASN B;  3E22 A;  4JAA A;  4I50 A;  4X66 B;  1TUE B;  4HNA A;  4ZHQ A;  4O2A B;  1IVS A;  5H2F Z;  4JV5 O;  3JAS A;  5IYC O;  3FB7 C;  2X6C A;  5KA5 A;  3FYE B;  2VQE B;  3BEH A;  1AI4 A;  2V7Q G;  3CPW U;  3H9V A;  5EIB C;  1VQO V;  4UB6 Z;  2W6I G;  3X2Q B;  3RGB A;  4JTC B;  3I5D A;  1AI7 A;  3PJS K;  2CTQ A;  3I55 V;  1GRJ A;  1YJ9 V;  5J2U A;  1RSO B;  1PV0 A;  4DR5 O;  2OCH A;  2XAS A;  1AJN A;  3OMI B;  3L73 H;  3OR6 C;  3X2Q C;  4LWS B;  3DGE A;  1PL0 A;  1B04 A;  3R66 A;  3SPJ A;  3W7S A;  2RQ6 A;  2RMK B;  1YVW A;  3SJB C;  3HKD A;  3JAL B;  1YXB A;  2Q67 A;  1GK9 A;  4XDK A;  4ABM A;  1XL6 A;  2PTM A;  4WFF A;  2IH1 C;  4FVM A;  4LFA O;  4JV5 B;  5GTI Z;  1VQN V;  3F7V C;  3BAA A;  3B2E E;  4DO2 A;  5D5P A;  1MMM A;  2BCC H;  3N27 A;  1QVF U;  4RQE A;  1XI1 A;  1AI6 A;  2HJD A;  3N2G B;  2PYJ A;  1FAF A;  2KB1 A;  5LMN B;  3CC4 V;  1QLN A;  2IH3 C;  3DC5 A;  4KFM A;  2X7R B;  3DTU B;  1V54 B;  5LHI A;  5KLV H;  3QO8 A;  3ZN0 A;  2QGN A;  3A0R A;  2XAF A;  3UCS C;  4TQF A;  3L72 H;  4MVQ A;  4I4T A;  4LFB O;  2WWW A;  3K03 A;  3JAK B;  1YCI A;  3RYF B;  1V54 C;  1SQG A;  4DR4 O;  4NXN O;  1TUB B;  2JS5 A;  4YJ2 A;  4DV2 O;  2WLN A;  2EZP A;  2OCC B;  2D2C B;  3HR0 A;  4K8X A;  3AG2 B;  1H2G A;  4R6Z A;  2FL4 A;  3JD4 A;  4IHJ A;  5HFM A;  1YIT V;  2ZM6 O;  3IFX A;  2ZQM A;  4LR3 A;  3K06 A;  1WLE A;  1TVK B;  3AG2 C;  1L1F A;  3B8N A;  1Q3E A;  2E74 B;  3I56 V;  3LDD A;  5EC1 C;  5FL7 G;  4FZ1 A;  1BL8 A;  1KP2 A;  4MTO A;  3OEE G;  3F7Y C;  3W7X A;  3CCR V;  2H3O A;  2DYR B;  4FLW A;  3JAR B;  1K73 W;  5H6Q A;  2AGA A;  1V9P A;  4LFB B;  3D36 C;  4YIO A;  2VQF O;  2X6B A;  1I94 B;  4X1K B;  2WA3 A;  4DR4 B;  4QNH B;  4DV2 B;  2Y48 A;  2A79 B;  4TQD A;  3G80 A;  3K0D A;  3SYO A;  3N2K B;  1G8M A;  3UO2 A;  1JMK C;  1OHH G;  2ZNI A;  1SA0 A;  3ZHR A;  2ZM6 B;  3BVO A;  5KA6 A;  1NKD A;  4NTW A;  3AEI A;  3OFN G;  4U3F H;  3QG5 A;  4ZI7 A;  3E35 A;  4EKW A;  4LF4 O;  4OX9 O;  5L3G A;  3P3P A;  1L0N H;  3CRR A;  3FB8 C;  3UO3 A;  4QJF B;  4RQF A;  2OIG A;  1CEZ A;  1VQ5 V;  1GN6 A;  2DJV A;  2JEX A;  4Q6G A;  4I0X B;  5LA6 B;  3SPI A;  4DV3 O;  2VQF B;  5CN0 A;  3HPL C;  2XHB A;  1F51 A;  3IC7 A;  4D7S A;  2N05 A;  1YTF B;  3JAM N;  3M99 B;  2XTA A;  5BY1 A;  2AW9 A;  1TGO A;  2JGD A;  4X88 A;  1NS1 A;  2YUA A;  4JTD B;  5CA1 B;  3RVZ A;  2ZE5 A;  2UXD O;  1JPX A;  1S77 D;  4WBN B;  2V4D A;  2HVK C;  2ADQ B;  2MK3 A;  1XDC A;  1FKA O;  4IIJ B;  5KHI A;  4J7K A;  4J41 A;  5KX5 A;  2Z0A A;  5DED A;  3RFR A;  2Q68 A;  3CHX A;  1R3J C;  4PJ0 Z;  1GH6 A;  5BMV A;  2XAH A;  1JJO A;  3JCZ A;  4JYB A;  4FIP C;  1R6K A;  5IT9 N;  1KEC A;  4K3A A;  5IJ0 B;  1FS0 G;  3HKC A;  2PF4 E;  3JCU Z;  4PEL A;  3RW0 A;  1W59 A;  2QM8 A;  2HG5 C;  1Y4M A;  3SGI A;  3B4S A;  5D5Q A;  1XMQ O;  1EBO A;  2N74 A;  1I08 A;  1S3J A;  2KG7 A;  4J9Z B;  4LF6 O;  1E1R G;  1TAE A;  2ZR2 A;  3OW2 U;  2UXD B;  1QR8 A;  4L8J A;  1ZL8 B;  3WU2 Z;  1M93 A;  1XMO B;  1WA8 B;  4U3J A;  1FJG B;  2PUS A;  3J81 N;  1V55 B;  4YY3 O;  2QKS A;  5KHG A;  1RM1 B;  4O4H B;  2YIC A;  2W0F C;  2E76 B;  3JSN A;  2FML A;  2LQT A;  3BRC A;  2ZT9 B;  4EB6 B;  5FNV B;  2WLI A;  4GX1 A;  1NH2 B;  3HB3 B;  3J7A U;  1V55 C;  2QKC A;  2UUC B;  1IBK B;  1RM1 C;  4X20 B;  4JI8 O;  3K9A A;  2Z3Y A;  1FFT B;  5TIS Z;  1AB3 A;  4X1Y B;  5LXT A;  3JAW A;  3E86 A;  3G71 V;  4WFG A;  5LYJ A;  1QCE A;  3K57 A;  3ABU A;  1D2D A;  1XMQ B;  3QO5 A;  1MG1 A; 
#chains in the Genus database with same CATH homology
 4MVR A;  3OAA G;  1QBZ A;  2IW5 A;  4MW3 A;  5B1N A;  1MOF A;  3BY6 A;  2ITD C;  1OZ0 A;  3CMA V;  3W7U A;  5KUK A;  4BIU A;  1KKD A;  1OCO C;  1N8R W;  5LGU A;  1YIJ V;  2EJR A;  5IY5 B;  2WLK A;  5IYB O;  3B77 A;  1Q86 W;  4ZBM A;  4MVS A;  1Y66 A;  4GCZ A;  4JF3 A;  5LBQ A;  3LNM B;  5L3C A;  3CC7 V;  3ZJZ A;  4KUM A;  1HWY A;  1K5S A;  1NVP D;  2QEX V;  4RUE A;  1FXK C;  4PDV A;  1SET A;  3ETG A;  4UV8 A;  4J9Y B;  3W7T A;  3QO7 A;  1KQS U;  3JD0 A;  3SPH A;  3D3I A;  3T4Z A;  5IY5 C;  2HFE C;  5LHH A;  2HKO A;  1B6Q A;  1FXH A;  3ZIA G;  1VQ7 V;  2UXN A;  1SER A;  4F4L A;  2LFR A;  2QM7 A;  5GW7 A;  2QE7 G;  2EIK B;  5EBM C;  3ZRW B;  5CBF A;  1Q7Y W;  1IXM A;  4R50 A;  2B5U A;  4PDM A;  3ABK B;  4PA6 A;  3SYC A;  3ASN B;  4GX2 A;  3ABT A;  1NVP B;  1WPX A;  2H94 A;  3MD0 A;  4H37 A;  1TUE B;  3P32 A;  3OEH G;  2NLJ C;  4CZZ A;  1K4C C;  5IYC O;  3GB7 C;  2EIK C;  3FB7 C;  2X6C A;  5L3F A;  2AHY A;  1ORQ C;  3FYE B;  4PDR A;  5KA5 A;  3K04 A;  5CBG A;  1EZJ A;  1LNQ A;  3LDC A;  3BEH A;  1AI4 A;  2V7Q G;  3CPW U;  1VQK V;  1SRY A;  3ABK C;  4MVO A;  2OT5 A;  1VQO V;  3R65 A;  1K9M W;  2W6I G;  4CBC A;  3OMA B;  4JYC A;  3X2Q B;  2WPD G;  4JTC B;  3SYA A;  1K34 A;  4BW5 A;  2P6J A;  1AI7 A;  3PJS K;  1R3L C;  3SPG A;  5IYD O;  3I55 V;  2QA4 V;  1JCH A;  1YJ9 V;  2PI5 A;  3CCM V;  2QTO A;  3OUF A;  2DWD C;  3E83 A;  5IDJ A;  5B1O A;  3OR7 C;  1THZ A;  2XAS A;  3FB6 C;  1AJN A;  1GM8 A;  4MTX A;  2W6J G;  3CP1 A;  4U7O A;  5CBH A;  3TET A;  4BIZ A;  3OMI B;  1VQM V;  3OR6 C;  3X2Q C;  2HR3 A;  2V1D A;  3DGE A;  2WLI B;  4U7N A;  1PL0 A;  3ABM B;  3SPJ A;  2XAQ A;  3W7S A;  3ZCC A;  4G2K A;  1NBM G;  1PNL A;  1W2B U;  4LP8 A;  4MTG A;  1F23 A;  1CPY A;  4XDL A;  1OCC B;  4H33 A;  1F4M A;  2Q67 A;  3T2M A;  2DW4 A;  2EZO A;  1GK9 A;  4XDK A;  2OTL V;  1XL6 A;  3AG1 B;  4JAV A;  4WFF A;  3T1C A;  3AG4 C;  2LP7 A;  3NXS A;  1M56 B;  1EFR G;  2IH1 C;  4UVC A;  5H6R A;  3JD3 A;  3K0G A;  4P9P A;  2HLD G;  4JPR A;  3ABM C;  3ZMS A;  1VQN V;  3F7V C;  1VQL V;  4JAS A;  4DO2 A;  3ETD A;  3LDE A;  1G4Y B;  3OUS A;  3FB5 C;  1YTF D;  3CXC U;  1K4D C;  1OCC C;  1QVF U;  4MVM A;  2B1I A;  1BMF G;  3K3W A;  1DLB A;  4RQE A;  1QLE C;  1AI6 A;  2OTJ V;  3AG1 C;  1YJN V;  4MW8 A;  1VQ6 V;  2KB1 A;  4WFH A;  3CC4 V;  1QLN A;  1M56 C;  1YHQ V;  2IH3 C;  2C2A A;  3E8B A;  1K97 A;  4KFM A;  4RUF A;  2X7R B;  3DTU B;  1V54 B;  5LHI A;  3QO8 A;  3ZN0 A;  1SZT A;  4FMT A;  1NR1 A;  3A0R A;  5B1A B;  2X0L A;  1K8A W;  4OXS A;  2EIJ B;  2XAF A;  4HYO A;  1YI2 V;  5LHG A;  1K5Q A;  5B1B B;  1BHB A;  2R9R B;  4MVQ A;  3CCU V;  4UVA A;  2WWW A;  3K03 A;  4E2L A;  1J95 A;  1V54 C;  2XOK G;  1PKX A;  3ZRX A;  2YEV A;  1KD1 W;  1GMG A;  5B1A C;  3SYQ A;  3E89 A;  4G27 B;  3H01 A;  5J9P C;  2EIJ C;  1FXK A;  1PNK A;  3FKS G;  2WLN A;  1FXV A;  1K33 A;  4UV9 A;  1XL4 A;  2EZP A;  2OCC B;  3TCU A;  4MT8 A;  3CCS V;  1GTO A;  1Q82 W;  5B1B C;  2HVJ C;  3CYO A;  3G6E V;  3AG2 B;  4GT1 A;  2LFS A;  3VOU A;  5EBW C;  2JJ2 G;  2AHZ A;  1H2G A;  4R6Z A;  3K79 A;  2WLL A;  1PNM A;  4WFE A;  2FTK A;  3JD4 A;  4RO2 A;  4Z1M G;  5HFM A;  1YIT V;  3IFX A;  1E1Q G;  1VQ9 V;  2ZR3 A;  2ZQM A;  2EIL B;  1M57 B;  2IJI A;  1DTO A;  2GSM B;  3K06 A;  4TWK A;  1YSC A;  1YJW V;  1WLE A;  3AG2 C;  1AI5 A;  1L1F A;  4GX5 A;  3B8N A;  1OCR B;  3CCQ V;  2EBO A;  3I56 V;  3LDD A;  5EC1 C;  5FL7 G;  3LUT B;  3ASN C;  3ZRW A;  4LC1 A;  1BL8 A;  1KP2 A;  4MTO A;  3OEE G;  4N23 A;  1KP3 A;  5DM6 V;  3F7Y C;  1RPO A;  4TT3 G;  3RVY A;  1R6N A;  4LBE C;  5L3B A;  3W7X A;  3CCR V;  2DYR B;  4N21 A;  1Q81 W;  4P2Z A;  1K73 W;  1I5Y A;  1M57 C;  2EIL C;  5H6Q A;  4ZKI A;  3TK1 A;  2X6B A;  1OCR C;  4GX0 A;  3CC2 V;  3JYC A;  4PA4 A;  1NR7 A;  4QNH B;  4JTA B;  3CCL V;  4HAM A;  5CMU A;  2M7W A;  2Y48 A;  2A79 B;  3G4S V;  1AR1 B;  3K0D A;  1K92 A;  3SYO A;  2IU0 A;  5KUM A;  4LCU C;  5CA3 A;  2ZD9 A;  2Y69 B;  4QIW F;  3ZRS A;  1G8M A;  4WFA V;  5EBL C;  4MTF A;  4RAI A;  1OHH G;  3ZMZ A;  5LGN A;  3OGC C;  1ENV A;  3QNE A;  4ASU G;  3SYP A;  3ABL B;  2A9H A;  2WSS G;  4UXN A;  2ZDI A;  1QR9 A;  4R8C A;  1NQT A;  5KA6 A;  1NKD A;  4JAU A;  2X6A A;  2ITC C;  1DF5 A;  3AEI A;  3OFN G;  1PD3 A;  3E35 A;  2IJH A;  4Q20 A;  4KP4 A;  4EKW A;  5L3G A;  1QVG U;  4DXW A;  3FB8 C;  1JJ2 U;  3RBZ A;  4QJF B;  1GKF A;  1JVM A;  4RQF A;  1M90 W;  1CEZ A;  1VQ5 V;  1VQ4 V;  2JEX A;  2EIM B;  3P30 A;  1NJI W;  1JOY A;  3ABL C;  2WLH A;  2JK5 C;  3SPI A;  3E8H A;  2XAJ A;  1I5X A;  5CN0 A;  1UJW B;  3HPL C;  4R7C A;  1F51 A;  3IC7 A;  2Z5U A;  1GM9 A;  1YTF B;  3M99 B;  4QE9 A;  3LSQ A;  2YEV B;  4YXW G;  1M1K W;  4X88 A;  3CCE V;  2JJ1 G;  1FXK B;  2ZXW B;  5C93 A;  2EIM C;  1F4N A;  4JTD B;  2CK3 G;  2YSU B;  4JGS A;  3ZRV A;  4HZ3 A;  3RVZ A;  3SPC A;  3B8M A;  4UUJ C;  2Q6A A;  2Q69 A;  1R3K C;  2P7T C;  1M9N A;  1JQ0 A;  2IJJ A;  3KG2 A;  1JPX A;  3CME V;  1S77 D;  2WLL B;  2HVK C;  4PA7 A;  5HFL A;  4BAY A;  1S76 D;  2MK3 A;  3K08 A;  1P7B A;  2ZXW C;  2BOB C;  3GWO A;  4MSW C;  5L3D A;  2EIN B;  2A0L A;  2NNU A;  4I9W A;  2JIZ G;  1SES A;  1W0K G;  3E8F A;  2Q68 A;  1ZWI C;  1H8H G;  4PDL A;  1R3J C;  3ML0 A;  2OCC C;  3FYI B;  3ZMU A;  4MVU A;  5BZB A;  3F5W C;  3CCJ V;  2DQ3 A;  1ARO P;  1MAB G;  2JEU A;  2P90 A;  2XAH A;  5E1A C;  5H9C A;  2GHY A;  3JCZ A;  4JYB A;  3IGA C;  2WLM A;  4FIP C;  1S72 V;  4PA3 A;  1AJQ A;  1R6K A;  2B1G A;  1KEC A;  4WF9 V;  3ASO B;  2EIN C;  2K1E A;  3CD6 V;  1DF4 A;  2DYS B;  3OE7 G;  4QPK A;  3CCV V;  1FS0 G;  3UKM A;  2PI4 A;  3ETE A;  1JX9 A;  2P67 A;  4PEL A;  3RW0 A;  2D3O W;  3E8G A;  1CP9 A;  2QM8 A;  1GM7 A;  3AG3 B;  2HG5 C;  1GO3 F;  3EFF K;  5EC2 C;  3WG7 B;  1Y4M A;  2WAM A;  1K3E A;  1BHA A;  1EBO A;  2DWE C;  4XBF A;  3ZN1 A;  4PA9 A;  1W0J G;  4I5S A;  3STZ C;  1MSW D;  1S3J A;  3ASO C;  4WCE V;  1H38 A;  4QPJ A;  3D36 A;  4J9Z B;  4WFB V;  1E1R G;  2DYS C;  2R9I A;  5B3S B;  3LSS A;  2ZR2 A;  3OW2 U;  2DYR C;  1QR8 A;  4P9O A;  3STL C;  1KC8 W;  1NH2 D;  3MHH C;  1R73 A;  2H8P C;  3OM3 B;  3AG3 C;  2BOC C;  3WG7 C;  3EHB B;  2ATK C;  3MHS C;  3JD2 A;  2IJK A;  1V55 B;  3WFV A;  3T4D A;  2QKS A;  2JDI G;  1E79 G;  1RM1 B;  3AG4 B;  2F43 G;  4QE7 A;  3UM7 A;  4G28 B;  3E2E A;  1ROP A;  4UVB A;  3SJQ C;  1H8E G;  1OCZ B;  5B3S C;  2W0F C;  4FK5 C;  4FJC C;  4MVZ A;  4XDJ A;  2HJF C;  5L3E A;  3JD1 A;  1S0V A;  1COW G;  2Y69 C;  4L87 A;  4MS2 A;  4P30 A;  5EK0 A;  2WLI A;  4GX1 A;  1S5H C;  1NH2 B;  3VBB A;  4TSF G;  2WLJ A;  3HB3 B;  1V55 C;  5LGT A;  1VQ8 V;  4X89 A;  3ZMV A;  1QLE B;  1RM1 C;  1R3I C;  1P4R A;  1OCZ C;  2XND G;  3K9A A;  2ZDI C;  2Z3Y A;  1FFT B;  5DN6 G;  2DQ0 A;  2UXX A;  1OCO B;  1VQP V;  3E86 A;  3G71 V;  4WFG A;  3OMN B;  1RPR A;  1QCE A;  2XAG A;  3ZMT A;  3ABU A;  4FPP A;  2IU3 A;  4X8A A;  3W7W A;  1AJP A;  3QO5 A;  1K7D A;  1MG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...