1VQ9V

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq9V00
3CCUV 1QVFU 3CMEV 1W2BU 1YI2V 1M1KW 1KD1W 1VQ8V 3CCSV 4WCEV 3CCMV 1VQOV 3CCEV 1M90W 1VQ6V 3I56V 3CCRV 1VQMV 4WFAV 3CCLV 1VQ4V 3CXCU 4WF9V 3CPWU 1VQLV 1NJIW 1KC8W 1YITV 1YHQV 1VQ5V 3CC2V 1S72V 3CC4V 1VQNV 2OTJV 3G6EV 2D3OW 3G71V 2QA4V 1JJ2U 3G4SV 1R73A 1KQSU 3CMAV 1K73W 1YJ9V 2OTLV 3OW2U 4WFBV 1YJNV 1VQPV 1YJWV 3CCVV 1Q7YW 1Q81W 1Q86W 1N8RW 3CCJV 5DM6V 1QVGU 1VQ9V 1VQKV 1K8AW 1Q82W 1K9MW 3CD6V 3CCQV 1YIJV 2QEXV 3CC7V 3I55V 1VQ7V
chains in the Genus database with same CATH superfamily
4H37A 5HFMA 3A0BZ 4ZOLB 5CBGA 1R3LC 3JYCA 3RYIA 1KU9A 1G4YB 4DV6O 4ABMA 3IAYA 3UKMA 5EZYA 1GRJA 1Q5OA 1KP2A 3FYEB 1JQ0A 1HW7A 4UUJC 2KG7A 3D36A 3P3PA 4LF9O 1K92A 3VQXA 3ZX6A 4ZOLA 4N21A 2XASA 1DF5A 4LF8B 3OMNB 5GONB 3OD4A 4UCOA 1DF4A 1FFTB 1FXKC 4A5UB 2E75B 4AI8A 2UUAO 1R1BA 5D5QA 1KD1W 2XTAA 1OJHA 3ZMTA 2R9IA 2F95B 2Y69C 3M8AA 4PJ0Z 4OX9O 1B3QA 1KKDA 1G8MA 1SERA 5IYCO 2VS0A 2EIJB 3IJ4A 2WLIB 4OX9B 2OTJV 4DR2B 4QPJA 1XREA 5CBHA 4I55A 3N2KA 4NXNO 1NS1A 5BR8O 3CWBH 1M93A 4HNAA 1FFXB 5D5PA 4ZIBA 3H01A 2JIZG 4TSFG 3T4ZA 4PI0A 4YJ3B 3ABKC 4K0KO 4EB6A 3CPWU 2JRIA 3O65A 2QGNA 1YVWA 4NXMB 2WWWA 3OTOO 3T4DA 2KKWA 1PKXA 1XUQA 2LW1A 3RGBA 4LF7B 1QVGU 4G28B 5JJNB 4XDKA 1NH2D 1VQ9V 1AI6A 4LF7O 5IJ0B 3TETA 2HHHO 3GWOA 5B1AB 2YIAA 2A7WA 4B3MO 1IDSA 1H38A 3OGIB 5EC2C 4B3MB 1PL4A 1V55B 3MDSA 2HFEC 1P84F 3ZEDA 1Q6IA 3RYIB 4FZ1A 5KX5B 4FK5C 1SA0A 2RQ6A 2LFSA 4I50A 2P7TC 2RN9A 1V9PA 2UU9O 2E74B 4FM2A 5EYPB 2WLIA 4MTXA 2UU9B 5EIBC 1FPOA 4WFGA 3RVYA 2Y48A 1QHTA 2ZKOA 5BXZA 1P4RA 1XEQA 1OV9A 2GTAA 1K3EA 3CCSV 2CH7A 2EIKC 3JAWB 4TUYB 4EEQA 5LL6Y 1A32A 4ZHQB 4AHCA 1EBOA 2HVKC 3ICXA 5J2TA 1N0NA 4MVQA 4DR5O 2KG7B 4XDJA 1BZKA 3K5OA 4EKWA 5EZYB 1SQPH 4CH3A 1IBMB 1MSDA 3EHBB 2UUCB 1E1QG 1QLEC 1IBKO 2OT5A 1AROP 1YEWA 3S3WA 4K0KB 4RWUA 4X64O 4J11A 1F7YA 2YEVB 1M56C 3OEEG 5KAIZ 5KHGA 3CCMV 2OWOA 4LF5O 4I5SA 2C2AA 1SETA 1H2KA 3QF7A 3SYCA 1Q3EA 4KL1A 3CC2V 5FL7G 1YXBA 5GONA 4DR6B 4X9QA 2WLNA 3RW0A 4DRXA 3Q4HB 2H3OA 2E3CA 4X20A 2JJ2G 4NKGB 1SZTA 3K06A 4E2LA 1MNGA 3EFFK 2B1IA 3ETQA 3HPLC 2GTSA 2UXBO 3CRQA 3OUSA 3ZS8C 1MA1A 3ZRVA 2X7RB 1H8EG 2Y0PA 3E22B 4EFEA 1SF9A 2EILB 3E35A 5H5NA 2WLLB 3CSXA 4TQDA 5B1BB 1ZX3A 4B3TO 4J42A 5F2VO 4NXNB 2F4VO 2BCCH 1AJPA 1WJZA 4J9YB 5LHIA 1COWG 4PA6A 4UCSA 1Y74B 2ZIMA 3FB5C 4JZ2A 2IM9A 1FFXA 4HNAB 3M99B 1NKDA 4PD4F 2YXYA 3VQVA 4K8ZA 2WPDG 2Y0IA 3OTOB 3WG7B 4BWAA 4MVZA 5JWPA 4X20B 3VOUA 1K73W 4R50A 5JH7A 5GW7A 2DYRB 1R6NA 1AP6A 2ITDC 3E2EA 1KECA 4KHPB 2GUZA 2AXTZ 5FNVB 1P7BA 4W4LA 4OGQB 3B8MA 2WAMA 3P30A 3CCUV 3SPHA 2UUCO 1JFFB 4CH5A 5C8YA 2EX3A 4X1KA 2YEVA 4MS2A 1TVKB 3VBBA 2NN4A 3CRCA 3DXRA 4GKJO 2LGQA 4I4TB 4UCTA 4X1YB 3FD9A 2WA3A 3OMIB 4B7EA 5LOVB 1VQ7V 3JAKB 4DW0A 3UCSC 5AG2A 2W6JG 5CMUA 4JF3A 5J2TB 1V54B 2QWPB 1M9NA 5B1NA 1D5AA 5EK0A 3G67A 3KCXA 5TISZ 1AJQA 2QWRB 3AG4B 5LOVA 2A9HA 3PN1A 4D7TA 1ENVA 1KP3A 3N2KB 2DE0X 4PI2A 4JI2O 1SS3A 3J7AU 1BQZA 3ZMZA 4LF9B 4L87A 3AG4C 5KA5A 2Q7EA 2GV9A 3WG7C 1L0NH 5L3BA 1NQTA 3B8NA 1S0VA 4DR5B 3S3XA 4ASUG 3LDDA 2ETNA 2M7WA 2Q67A 1EN4A 4BIUA 4K8XA 1Q86W 4BIOA 2Q0OC 4O4JA 2DQ0A 4DK0A 3ZHQA 1B04A 1SA0B 4DV0B 1KYOF 4JYYA 1Y74A 2P6JA 5FLXN 1AILA 1FS0G 4LC1A 4F6RB 5KMGB 3RVZA 3HKCA 1M57B 1IBKB 1Q43A 4MTGA 3K3WA 2QDOA 4O4HA 4ZI7A 1ZLZA 3AEIA 2ZE5A 1X4TA 4I4TA 4X8AA 1CEZA 2ZIOA 3ABMB 3NR7A 4FMTA 4LF5B 1AVMA 3K03A 5L3DA 4U7OA 3KKYA 3LUTB 1S5HC 5CN0A 3K57A 1Z5WA 3B2EE 3ZRWB 4JAUA 4UFZA 1VEWA 4I9QA 1FKAO 3CC4V 1NZ6A 4P30A 3QTCA 3ZHVA 3ABLC 2LJ2A 3M7MX 2QR4A 3R66A 2HHHB 3ASOB 2BOBC 1GTOA 3HB3B 1Y66A 4DV1O 3HKEB 2EZOA 2Z5UA 1B6QA 4MVRA 4IGGA 3SYAA 1Y67A 2CDYA 1OCRB 3CCRV 4GKJB 1PL0A 4XBFA 3UO3A 1RPRA 1M5IA 3JARA 1R3IC 4ICGA 4DR1O 4GYCB 2H94A 3ZCCA 1YJNV 1W0JG 2EJ7A 1QLEB 3LDEA 3OE7G 3DSQA 1HNWO 1FAFA 5C93A 2PI4A 4NYKA 2Q6AA 1LNQA 5H6QA 2CGOA 1I08A 1RFYA 3FB6C 1TUBA 3LSUA 3TGUH 1ZL8B 4BW5A 1IBLB 3BA8A 1HWYA 2Q73A 4FLWA 2W6IG 3SYPA 3X2QC 5EIBD 3CEIA 3DC5A 3QO5A 4CH4A 2BSKB 5JVDB 2X6CA 3UT5A 2LFRA 5CA1A 3BPZA 4GZRB 3CCVV 4JI7O 3JAWA 2BOCC 5LXTB 2Z3YA 1ZAUA 4JGSA 4UV8A 3BA9A 1PPJH 4QE7A 3WB2A 2X0LA 1NBMG 3WFVA 4CC6A 2Y69B 2KSDA 4X65O 5DECA 5KHHA 1JFFA 3RYHB 1GN3A 5C8YB 2CH7B 2Q9LA 2QWNB 3BY6A 4YJ2A 1JR9A 4U7NA 2YUAA 4Z1MG 2ATKC 3OR6C 1UJWB 4JZGA 4DR6O 3JD0A 5LMUO 2DMXA 2PUSA 2HJFC 3JALA 5CA1B 1EN5A 5BZBA 2KQXA 3P32A 4DO2A 4JI1O 5CBFA 5B1OA 4MVOA 4JI6B 3TCUA 1FXVA 1YIJV 1Y4MA 1Q6UA 4RAIA 2XOKG 1M57C 1YTFB 3CCEV 2QWOB 3FYIB 5K1PA 3SJCC 3E89A 1GO3F 3WB0A 3FKSG 5IJ9B 2HKOA 3BHPA 2RCVA 3DXRB 4OPAA 3JSLA 4QIWF 3ABLB 1UPGA 4RUFA 3L71H 4JTDB 5LMNO 2YIDA 1XDCA 1M56B 2V7QG 1K34A 1ROPA 2XT9A 3W7UA 2F4VB 2OCHA 3I5DA 5K1XA 2ZR2A 3I56V 4CH6A 3R65A 3CYOA 2OCCC 3A8TA 2NLJC 4W4KA 4JI4B 2ZD9A 1OCCC 1K33A 3Q4HA 2HG5C 1Q6HA 3ZHRA 1XL6A 4PELA 4ZKIA 5B3SC 5H6RA 2MK3A 1VF6C 2VQEB 3STZC 4LF4O 1JX9A 1PP9H 1OCOC 5EBMC 1IZ3A 4J80A 2Q7GA 1K4DC 5KLVH 1N4CA 1J95A 1Q8IA 4IIJB 4DV1B 3L9DA 2ILMA 1IVSA 4K35A 3W7WA 5IY5B 2PGGA 5IJ9A 1OCZC 4GKKO 3KZIZ 2WLLA 4TQFA 2A3QA 2DW4A 3ETGA 1BSMA 4UB8Z 3UT5B 5BMVB 3TK1A 1H2MA 1H2SB 2DQ3A 3CXCU 4TV9A 1YHQV 1VQ5V 4MSWC 4HBNA 1HNZO 3SPGA 4PA7A 4WFBV 4GX0A 3JALB 4PDLA 3BVOA 3CD6V 4LF8O 5ITZB 5JJEB 1K4CC 2YS8A 3GWKC 3ZMVA 2IBZH 1M90W 3N2GB 1Z2GA 2DN9A 3T1HB 4JI1B 1AI4A 3O9OA 1TUBB 3E8GA 5LA6A 5J2UB 4WBNA 2P22C 1KBHA 1JPXA 3UQ8A 1K97A 4KFMA 2WLKA 4YIPA 3B4SA 2ZM6B 2BTQB 2DWDC 1I5XA 2UXDO 1N33B 4Q6GA 2JEXA 3FB7C 1HNXO 2ADPA 3EVKA 1NH2B 2FTKA 3OUFA 5BR8B 4JTAB 1B06A 3D36C 1VF5B 2ZDIC 1PD3A 4X1IA 5CB4B 2DYRC 2CTQA 1VF6A 5DEDA 3THOA 2CAZC 2R72A 5L3FA 5E79Z 1DK1A 1VP7A 4TV8B 3ETDA 4MVMA 1K5SA 3OAAG 3OTFA 5EC1C 4DYLA 3U10A 1HR0B 1S5JA 4B3SO 3ZMUA 4J41A 1YI2V 2AHZA 2XAFA 4K3AA 5B5EZ 4B3SB 4UB6Z 1YCIA 4H0LB 1ZL8A 1GM9A 1S72V 1VQNV 3F7VC 2IH1C 1TAEA 1MZFA 4I7ZB 4X88A 2CTWA 1AI7A 4O4IA 4PDMA 4NVPA 1QBZA 4DV3B 3CMEV 3RYFB 3MHHC 4P9OA 2WLJA 3ZIAG 3RFRA 1MG1A 3JASA 3JASB 4JYCA 4B3TB 3EXAA 4MW8A 1IURA 1WP8A 2QM7A 3ASNC 2E5LB 1CPYA 3AG2B 2XAQA 3ZJZA 5CA3A 4X1IB 4LFAO 2IW5A 4PA4A 4DV2B 3LSQA 1QLNA 2ADQB 2XHBA 3F5WC 2HJDA 1MZEA 4DV4B 4WFEA 4IYIA 3WB1A 5FPOA 1BS3A 2OIEA 2P90A 4UCRA 3LNMB 1X59A 3E83A 3T2MA 3NXSA 5JCOC 1PM9A 2AZ0A 3KG2A 4CBCA 2P4KA 3X2QB 2D3OW 4C7UA 2XAGA 4X62B 2QTOA 4JI8B 1FXHA 1QNMA 1XNRO 4X66B 4LF4B 4F6RA 1WP7A 4YXWG 4GX2A 2D2CB 1GAXA 1PNKA 1L1FA 5IWAB 3ZN1A 1JA8A 1S5LZ 2YC0A 4KP4A 1FYJA 2HP8A 2VQFO 1K5QA 3BEHA 1FXKA 1XILA 2EINC 4RQFA 2YXHA 1GN2A 2PTMA 2VQFB 4DV6B 1S3JA 3CX5F 1F4NA 1Q81W 2ZXWC 2ZE6A 1TGOA 4G27B 2PY5A 1MOFA 2DJVA 3CP1A 1MABG 4MT8A 2G38A 4UCUA 1S77D 2Q4PA 3E8HA 3RWRD 3TXQA 5LXTA 1OCOB 2FMLA 4DR7O 2Q8VA 4J9ZB 3G4SV 2UUAB 2UXBB 4U3JA 1BL8A 4OPHA 3P3NA 4J10A 3IC7A 1IX9A 2CUGA 1F23A 4R7CA 2KB1A 1NTMH 5JQGA 4MVSA 4DV7O 3SYQA 5IYZB 1VQ4V 4B3RB 2W0FC 2PF4E 2O57A 4JV5B 4X1KB 4Z1VA 4N23A 3SJBC 4ZHQA 1BCCH 1IBMO 1RSOB 4QE9A 1NVPD 4LFAB 3AG7A 2EIMB 2FYUH 1TUEB 3F7YC 2XAHA 3U11A 4YHHB 1J5EO 1LUVA 2V4DA 4JYAB 1XBLA 4L8JA 1VQMV 4X64B 5IT9N 1NJIW 4J7ZA 2XNDG 1V54C 2YICA 3SPIA 4GCZA 1EZVH 2OTLV 3ZBHA 2W0XA 2JS5A 4NXMO 4DRXB 2Y4TA 1WNSA 3CHXA 4NTXA 4FFBA 4O2BA 1M1KW 3K9AA 1VQ6V 3CS5A 2PZSA 3H1KH 4X62O 2HLDG 1RM1B 3FX7A 3AK3A 3JAMN 4DUZB 5LP6A 5LHGA 3CE2A 3RYFA 2HR3A 2R70A 4NTWA 4DUZO 1WB8A 3K5LA 4DR1B 1GM8A 2HEPA 3C3SA 2QKAA 1WPXA 1RSOA 1N34O 4H13B 1KC8W 1P49A 4UV9A 5BY1A 1SQQH 3OFNG 1R3JC 4PDRA 2DYSB 4FIPC 1IXBA 3AG3B 2UXNA 3E8FA 4DR3B 1VMGA 1IBLO 3A0HZ 1KB9F 1N36B 4JAVA 1HDJA 2WLMA 1ZSPA 2ZE7A 4IHJA 2QJ1A 3B77A 4DV4O 4WF9V 2RJZA 4D7SA 3AK1A 2IJHA 2E76B 4LP8A 2P67A 4WBNB 4JTCB 3RYHA 3T1HO 3STLC 1EN6A 5H2FZ 2YDEA 1SZXA 4JI7B 4WCEV 4QPKA 3W7TA 4CC5A 5DN6G 3E86A 4DR4O 2P06A 3KCYA 3JD4A 5FPRA 5LA6B 1Z5VA 4JI8O 1ZWIC 4JI5B 4LR3A 2M6YA 3LDCA 2F66C 4FM0A 5JJJB 4TWKA 1HNXB 2AZ2A 3T1CA 4JI5O 4MTFA 4TT3G 4H33A 4JYAO 1O9HA 2QE7G 3I55V 2YIBA 3JAKA 2JK5C 1US6A 2OYQA 1R6KA 3C3TA 3ZHTA 2YSUB 1SC5B 1XOUA 4DUYO 3ETEA 4F4LA 3OR7C 2A06H 1P7GA 4O4IB 4U3JB 5J9PC 4FZ0A 1Y76B 4Z2WA 4AQYB 1SQGA 4TUYA 1XQ8A 3IC9A 4AILC 4LH7A 2ZNJA 4IL6Z 4KXRA 2B5UA 3D3QA 1EM1A 1SQFA 3K08A 3W7SA 4NR1A 1N0JA 4LBEC 5LP6B 1WPBA 3FB8C 3K04A 2EINB 1NT2B 4JYBA 3CRAA 1N34B 2LQTA 2ZINA 4LF6B 3ZRXA 4B3RO 2YI9A 4LH6A 5KHJA 1AB3A 5HFLA 4FLVA 3JSNA 5KMGA 2V1DA 4JPRA 4JV5O 1RM1C 1H2GA 2UUBB 1N32B 3K5NA 2FL4A 1ORQC 2YXLA 2N05A 1GK9A 1URFA 5JCOA 3H9VA 3H1IH 2BTQA 5IDJA 1N36O 3W7XA 3ZRWA 3CCJV 3K5MA 2N04A 4LFCB 3H1LH 2QEXV 2QSAA 3AG1B 4YIOA 2GSMB 5J2UA 4FPPA 1QVFU 3CRRA 5LBQA 3ABTA 1YITV 3UM7A 3MAQA 5H9CA 4IT5A 1YSCA 3ASOC 2IU0A 5KUKA 1SQVH 1E79G 2JGDA 4LWSA 4DXWA 4NB5A 3J80N 5LGUA 2JDIG 5KAFZ 3SR2C 4ZBMA 3QG5A 3PJSK 1W2BU 2RMKB 4GKKB 3HR0A 1SKVA 4JI0B 2EIJC 1QR8A 2IJKA 4JASA 4HZ3A 3BRCA 4R6ZA 3AG3C 1MSWD 1GH6A 5IWAO 1G1XB 1PNMA 3BFRA 4LNUA 2CTRA 1SQBH 1VQKV 2IH3C 1HNZB 4O4JB 3GB7C 3L74H 2ZXWB 3FAVB 3FAVA 5A2QN 4BIZA 1JMKC 5LHHA 2ZCEA 4JI3B 5KA6A 3ZMSA 5LMUB 1R3KC 3RN4A 2EBOA 1NTKH 4IHJB 5LGTA 2WSSG 4KUMA 4QNHB 2BSKA 5KHIA 3K0DA 1AR1B 4DR7B 2ZM6O 3CC7V 1W59A 1WA8A 5IYBO 4JI6O 1N33O 2UXDB 2P4VA 1T5EA 5LYJA 1JOYA 5JVDA 4TV9B 1QU7A 2ODMA 1HP8A 1YJ9V 5L3CA 1O9GA 1V55C 1PNLA 3SJQC 4DV7B 4O4LA 1KUQA 1DLBA 2AW9A 2H8PC 4DR2O 4PA9A 1NR1A 3K79A 3A2FA 4IIJA 5E1AC 1BHBA 3JD1A 1XHZA 4YJ3A 5B66Z 3HKDB 1R73A 2BE3A 1Q90D 2OCCB 4YHHO 2DYSC 5EYPA 1UFIA 1CP9A 3HKBA 3AG2C 1K8AW 2QM4A 3ASNB 2OIGA 4I55B 3C90A 4I50B 4X89A 2ZE8A 4J7KA 1AJNA 2IJJA 2K1EA 2RNBA 1FJGB 4UVBA 1NI8A 1I94O 3VQWA 4AQYO 1WAZA 2XUMA 3UO2A 1DGSA 3G80A 2NNUA 3HKEA 1G6UA 5EBLC 2L35A 2F23A 1XL4A 3CB2A 3CJHB 5IJ0A 1NR7A 4RO2A 3SGIA 5BMVA 2DWEC 2E5LO 4GT1A 4I0XB 4OXSA 1BE3H 1WLEA 2F93B 3QVNA 1D5NA 1ZUQA 2EULA 3G71V 2JVDA 4RQEA 1YJWV 3DGEA 1F51A 3RYCA 5IE9A 2HVJC 1AI5A 3ZHUA 3MHSC 5KUMA 5LGNA 4BW9A 4QJFB 5CA0A 5IYZA 2R9AA 4TV8A 2JGUA 3APOA 3IGAC 2YI8A 4LFCO 5CB4A 4MW3A 1Q7YW 4UXNA 1LR1A 2ZR3A 1H2LA 1SRYA 4CS4A 1XMQO 3N27A 2AHYA 4DK1A 5EBWC 4P2ZA 3DTUB 5A9GA 1LUWA 1BGYH 1VF7A 1H8HG 4NTYA 1KQSU 1KMIZ 2P5OA 3FFQA 2LP7A 4B08A 3GVMA 4PDVA 1RPOA 1XHXA 1Q82W 1XMOO 4JI0O 3LSSA 2NR5A 3K59A 3DC6A 1XMOB 2MW2B 1WB7A 2Q5ZA 3APQA 4WFAV 3T1YB 3JD2A 3OGCC 4F6EA 1GMGA 1IXMA 3MD0A 1VQPV 4EFBA 3RYCB 5B1BC 4RUEA 4G2KA 1YDXA 1E1RG 1JJOA 5GTHZ 1PV0A 1U96A 1EFRG 1SQXH 1BQ0A 4I9WA 2B1GA 3A0RA 3SYOA 3QO8A 1YF2A 1I0HA 5JH7B 2EJRA 3OW2U 4UVAA 3LNNA 2LGWA 1SESA 3JATB 1GN4A 2Z0AA 3HKCB 5KX5A 2FB5A 4GUNA 3QNEA 2FKXA 4R8CA 2B9ZA 1J5EB 3G6EV 4FFBB 2ARHA 1JJ2U 4LF6O 1BMFG 4DV2O 2JJ1G 5B3SB 4CS3A 2VRZA 1W0KG 3ABUA 1U97A 2UUBO 1N32O 2QKCA 3U0ZA 5L3GA 3QO7A 4FM1A 2PI5A 3B09A 2VWJA 2EIMC 3E22A 3TJTA 3CRMA 2VWKA 3J81N 1XMQB 2CGNA 3CMAV 4O4LB 1THZA 2YIBD 1OZ0A 4FVMA 2UXXA 4D6TH 5JQGB 5DM6V 1I5YA 1KKCA 2K9PA 1Y76A 1XNRB 1XNQO 1VQOV 3G6BA 1Y6XA 1XNQB 3OEHG 4J7JA 2A79B 1WA8B 3TXSA 4HAMA 1OCCB 2GDSA 2CK3G 2RDCA 4X65B 3H1HH 2UXCB 2X6BA 4UCVA 3ABKB 4GX1A 3K58A 1MMMA 2UXCO 4XDLA 1DTOA 4DR3O 5KHKA 1AR4A 1R6TA 5FNVA 1JCHA 1HNWB 4IYHA 1FXKB 4GLXA 3RT3C 3IFXA 2JEUA 3SPCA 1CXZB 2GBOA 3B40A 2JS3A 3SDLA 3K9SA 1QQCA 2PYLA 5ITZA 3L72H 3D8CA 2Q69A 2N74A 4JI3O 2Q0AA 1BT8A 1S76D 4E4EA 4JI2B 3ZRSA 4QGPA 2QWQB 1BHAA 2IJIA 2F1MA 4HYOA 4DR4B 3CXHF 4BR6A 4FLTA 4FLUA 2X6AA 3JD3A 5L3EA 4DV5O 2JGDB 4LWSB 1XI1A 2Q68A 4UVCA 4TOIA 1QR9A 1WN7A 4DV5B 4BAYA 4FLXA 1ZTEA 1TVKA 1L8DA 2XAJA 5LP6C 3ZHSA 3JCUZ 1OHHG 4DW1A 2CTPA 3SJAC 4DUYB 1I7FA 3CJHA 1K7DA 4DV0O 1YTFD 1N8RW 4B7KA 4FFKA 4YJ2B 3BAAA 3SPJA 1VIBA 2GUZB 2AGAA 1K9MW 1JVMA 2ZQMA 3T1YO 4JI4O 3E8BA 5GTIZ 1NVPB 1HR0O 4FLYA 3RBZA 1AP5A 3JCZA 1NTZH 4Q20A 3VQYA 3JARB 3OT7A 4O2AA 5IYDO 4CS2A 2WA4A 1NU1H 3JATA 5CA0B 4DV3O 3HKBB 1AR5A 3CCQV 1L0LH 2QKSA 1FJGO 2EIKB 2BTOA 4O2AB 2CE4A 1EZJA 4PHZA 4FLZA 3OM3B 1GKFA 1RP3B 1I94B 4YY3B 1FD9A 2Q7HA 3ML0A 2GHYA 4JAAA 4MTOA 2DOSA 4GX5A 4X1YA 4YY3O 4PV1B 4WFFA 4U3FH 3AG1C 2ITCC 3L75H 3WU2Z 4I0XA 4PA3A 2R9RB 4EB6B 3ABMC 3K0GA 4MVUA 3AK2A 2ZT9B 5IY5C 3H1JH 1VQ8V 1D2DA 1M4UA 5B1AC 2QM8A 2QTSA 4LFBB 4O4HB 4ZI7B 5LYJB 1VQLV 2F43G 2ZNIA 5LMNB 4CZZA 3ZN0A 3L70H 1GM7A 1VARA 4LFBO 4LCUC 2L6LA 2LW7A 2ZDIA 4FJCC 2IU3A 4H44B 2A0LA 4O2BB 1GN6A 1H2NA 2EZPA 4WFHA 4KHPO 1OCRC 3BCCH 3CCLV 4P9PA 1TA8A 3D3IA 4X66O 2LO1A 3BABA 2QA4V 3HKDA 3OMAB 1QCEA 1OCZB 3N2GA 2VQEO 3F5TA 4LNUB 1F4MA 1YZBA 2WLHA 2PYJA 2EILC 2Y4UA 3L73H
chains in the Genus database with same CATH topology
4X89A 3LUTB 4H37A 3ZN1A 1S5HC 5HFMA 4KP4A 1AJNA 5CN0A 1K5QA 2IJJA 3BEHA 2K1EA 3ZRWB 1FXKA 4JAUA 2EINC 4UVBA 4RQFA 3CC4V 5CBGA 1R3LC 4P30A 3ABLC 3JYCA 1S3JA 1F4NA 1G4YB 1Q81W 2ZXWC 4G27B 1MOFA 3ASOB 2BOBC 1GTOA 3CP1A 1Y66A 3HB3B 3UKMA 2NNUA 1MABG 4MT8A 5EBLC 1S77D 2EZOA 2Z5UA 1B6QA 1KP2A 3E8HA 3FYEB 1JQ0A 4MVRA 3SYAA 1XL4A 4UUJC 1NR7A 4RO2A 1OCRB 2DWEC 3D36A 3CCRV 1OCOB 1K92A 1PL0A 4XBFA 1RPRA 4GT1A 4OXSA 1WLEA 4N21A 1R3IC 3G71V 2XASA 4J9ZB 3G4SV 1DF5A 4RQEA 2H94A 3ZCCA 1YJNV 1W0JG 3DGEA 1YJWV 3OMNB 1QLEB 3LDEA 1F51A 3OE7G 1BL8A 2HVJC 1AI5A 1DF4A 5C93A 1FFTB 2PI4A 1FXKC 2Q6AA 1LNQA 3IC7A 3MHSC 5H6QA 5KUMA 5LGNA 1KD1W 1F23A 2R9IA 4R7CA 2Y69C 3ZMTA 2KB1A 4QJFB 1KKDA 1G8MA 4MVSA 3SYQA 1SERA 3FB6C 1VQ4V 5IYCO 2W0FC 2EIJB 2WLIB 2OTJV 3IGAC 4QPJA 5CBHA 4BW5A 1Q7YW 4MW3A 4N23A 4UXNA 4QE9A 1HWYA 2ZR3A 1NVPD 1SRYA 2W6IG 2EIMB 3H01A 3SYPA 1TUEB 3F7YC 2JIZG 2XAHA 3X2QC 2AHYA 4TSFG 3T4ZA 3QO5A 5EBWC 3ABKC 4P2ZA 3DTUB 1VQMV 3CPWU 1NJIW 2XNDG 1V54C 3SPIA 1H8HG 2X6CA 4GCZA 2LFRA 2WWWA 1KQSU 3T4DA 2OTLV 1PKXA 3CCVV 2LP7A 2BOCC 4PDVA 2Z3YA 1RPOA 1QVGU 4G28B 1Q82W 4JGSA 4XDKA 1NH2D 4UV8A 1VQ9V 1AI6A 4QE7A 3LSSA 1M1KW 3TETA 3K9AA 2X0LA 3GWOA 5B1AB 1NBMG 3WFVA 1VQ6V 2Y69B 4WFAV 3JD2A 3OGCC 2HLDG 1RM1B 3BY6A 1GMGA 1H38A 5LHGA 1IXMA 5EC2C 3MD0A 2HR3A 1VQPV 1V55B 4U7NA 2HFEC 5B1BC 4Z1MG 4RUEA 4G2KA 1GM8A 1E1RG 4FK5C 2ATKC 2LFSA 3OR6C 1EFRG 2P7TC 1WPXA 1UJWB 4I9WA 3JD0A 2B1GA 1KC8W 2HJFC 2WLIA 4MTXA 4UV9A 3A0RA 3SYOA 3QO8A 5BZBA 3P32A 4DO2A 4WFGA 3RVYA 2Y48A 3OFNG 5CBFA 2EJRA 3OW2U 1R3JC 4PDRA 5B1OA 4UVAA 2DYSB 4MVOA 4FIPC 3TCUA 1FXVA 3AG3B 1P4RA 1SESA 2UXNA 1YIJV 1Y4MA 3E8FA 4RAIA 2XOKG 1M57C 1YTFB 4JAVA 1K3EA 3CCSV 2WLMA 2EIKC 3CCEV 3FYIB 3E89A 3B77A 1GO3F 4WF9V 3FKSG 3QNEA 2HKOA 1EBOA 4R8CA 2HVKC 4QIWF 3ABLB 3G6EV 1JJ2U 2IJHA 4RUFA 4MVQA 1BMFG 4JTDB 2JJ1G 4LP8A 2P67A 5B3SB 1M56B 4XDJA 4JTCB 1W0KG 3ABUA 3STLC 2V7QG 1K34A 1ROPA 4EKWA 3W7UA 4WCEV 5L3GA 3QO7A 4QPKA 2ZR2A 3I56V 3W7TA 2PI5A 3R65A 3CYOA 3E86A 5DN6G 2EIMC 2OCCC 2NLJC 3JD4A 2ZD9A 3EHBB 1ZWIC 3LDCA 1OCCC 4TWKA 1E1QG 3CMAV 1K33A 1QLEC 1THZA 3T1CA 2OT5A 2HG5C 1AROP 1OZ0A 2UXXA 4MTFA 4TT3G 5DM6V 4H33A 1I5YA 1XL6A 4PELA 4ZKIA 2QE7G 5B3SC 5H6RA 2MK3A 3I55V 2JK5C 3STZC 2YEVB 1M56C 1JX9A 3OEEG 1OCOC 1R6KA 3CCMV 1VQOV 4I5SA 2C2AA 2YSUB 5EBMC 3ETEA 1SETA 1K4DC 4F4LA 3OR7C 3SYCA 1J95A 3OEHG 3CC2V 2A79B 5FL7G 5J9PC 4HAMA 3W7WA 5IY5B 2WLNA 3RW0A 1OCZC 1OCCB 2CK3G 2WLLA 2DW4A 3ETGA 2B5UA 2X6BA 2JJ2G 1SZTA 3ABKB 3K06A 4GX1A 3TK1A 4E2LA 2DQ3A 3EFFK 1DTOA 4XDLA 2B1IA 3CXCU 3K08A 3W7SA 3HPLC 1YHQV 1VQ5V 4LBEC 4MSWC 1JCHA 3SPGA 1FXKB 3FB8C 3K04A 2EINB 3OUSA 4PA7A 4WFBV 3ZRVA 2X7RB 1H8EG 3IFXA 4GX0A 2JEUA 3SPCA 4PDLA 4JYBA 3CD6V 3ZRXA 2EILB 3E35A 1K4CC 5B1BB 2Q69A 2WLLB 3ZMVA 5HFLA 1M90W 1S76D 2V1DA 4JPRA 1RM1C 1AI4A 1H2GA 3E8GA 1JPXA 1AJPA 1ORQC 3ZRSA 1K97A 4KFMA 2WLKA 1GK9A 1BHAA 2IJIA 4HYOA 4J9YB 5LHIA 1COWG 5IDJA 4PA6A 3W7XA 3FB5C 2DWDC 2X6AA 3JD3A 3ZRWA 3CCJV 1I5XA 5L3EA 3M99B 1NKDA 2JEXA 3FB7C 2QEXV 3AG1B 2GSMB 1NH2B 2FTKA 3OUFA 4FPPA 4JTAB 2Q68A 4UVCA 1QVFU 1QR9A 2ZDIC 1PD3A 5LBQA 2WPDG 4BAYA 2DYRC 3WG7B 3ABTA 2XAJA 1YITV 3UM7A 5H9CA 1OHHG 4MVZA 5L3FA 1YSCA 3ASOC 2IU0A 5KUKA 3VOUA 1E79G 3ETDA 4MVMA 1K5SA 1K73W 1K7DA 3OAAG 1YTFD 4R50A 1N8RW 5EC1C 4DXWA 5GW7A 2DYRB 1R6NA 2ITDC 3E2EA 1KECA 5LGUA 3SPJA 2JDIG 1K9MW 1JVMA 1P7BA 2ZQMA 4ZBMA 3B8MA 3ZMUA 2WAMA 3E8BA 3P30A 3CCUV 3PJSK 1YI2V 1W2BU 3SPHA 1NVPB 2AHZA 2XAFA 3RBZA 2EIJC 3JCZA 1QR8A 2IJKA 4JASA 4Q20A 4HZ3A 1GM9A 2YEVA 1S72V 1VQNV 3F7VC 5IYDO 2IH1C 4MS2A 3VBBA 4R6ZA 3AG3C 1MSWD 1PNMA 4X88A 1AI7A 1VQKV 2IH3C 3OMIB 3CCQV 4PDMA 2QKSA 3GB7C 1VQ7V 2EIKB 1QBZA 1EZJA 3OM3B 1GKFA 2ZXWB 3CMEV 3ML0A 3MHHC 4P9OA 2GHYA 2W6JG 2WLJA 4BIZA 5CMUA 5LHHA 4JF3A 4MTOA 1V54B 3ZIAG 1MG1A 1M9NA 4GX5A 5B1NA 5EK0A 1AJQA 4WFFA 3AG4B 3ZMSA 5KA6A 1R3KC 2A9HA 2EBOA 1ENVA 1KP3A 4JYCA 5LGTA 4MW8A 3AG1C 2ITCC 2WSSG 4PA3A 2R9RB 4KUMA 3ZMZA 4QNHB 2QM7A 3ASNC 1CPYA 3K0DA 3ABMC 3AG2B 3AG4C 3K0GA 4L87A 4MVUA 5KA5A 1AR1B 3CC7V 3WG7C 2XAQA 5IYBO 5IY5C 3ZJZA 5CA3A 1VQ8V 5L3BA 5B1AC 2QM8A 2IW5A 1NQTA 4PA4A 3B8NA 1S0VA 1VQLV 2F43G 1JOYA 4CZZA 3LSQA 3ZN0A 1QLNA 3LDDA 4ASUG 2M7WA 3F5WC 2Q67A 1GM7A 4BIUA 4WFEA 4LCUC 1YJ9V 5L3CA 1V55C 2ZDIA 1Q86W 1PNLA 3SJQC 4FJCC 2P90A 2DQ0A 2IU3A 3LNMB 2A0LA 1DLBA 2H8PC 3E83A 2EZPA 2P6JA 4PA9A 4WFHA 1FS0G 4LC1A 3T2MA 1NR1A 1OCRC 3NXSA 3RVZA 3CCLV 3K79A 1M57B 4P9PA 3KG2A 5E1AC 4CBCA 1BHBA 3JD1A 3D3IA 4MTGA 3X2QB 3K3WA 2D3OW 3AEIA 2QA4V 2XAGA 1R73A 3OMAB 2QTOA 1QCEA 1OCZB 4X8AA 1FXHA 2OCCB 2DYSC 1CP9A 1F4MA 1CEZA 2WLHA 4YXWG 3ABMB 3AG2C 4GX2A 4FMTA 1K8AW 3K03A 3ASNB 5L3DA 1PNKA 2EILC 4U7OA 1L1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU V;  1QVF U;  3CME V;  1W2B U;  1YI2 V;  1M1K W;  1KD1 W;  1VQ8 V;  3CCS V;  4WCE V;  3CCM V;  1VQO V;  3CCE V;  1M90 W;  1VQ6 V;  3I56 V;  3CCR V;  1VQM V;  4WFA V;  3CCL V;  1VQ4 V;  3CXC U;  4WF9 V;  3CPW U;  1VQL V;  1NJI W;  1KC8 W;  1YIT V;  1YHQ V;  1VQ5 V;  3CC2 V;  1S72 V;  3CC4 V;  1VQN V;  2OTJ V;  3G6E V;  2D3O W;  3G71 V;  2QA4 V;  1JJ2 U;  3G4S V;  1R73 A;  1KQS U;  3CMA V;  1K73 W;  1YJ9 V;  2OTL V;  3OW2 U;  4WFB V;  1YJN V;  1VQP V;  1YJW V;  3CCV V;  1Q7Y W;  1Q81 W;  1Q86 W;  1N8R W;  3CCJ V;  5DM6 V;  1QVG U;  1VQ9 V;  1VQK V;  1K8A W;  1Q82 W;  1K9M W;  3CD6 V;  3CCQ V;  1YIJ V;  2QEX V;  3CC7 V;  3I55 V;  1VQ7 V; 
#chains in the Genus database with same CATH topology
 4H37 A;  5HFM A;  3A0B Z;  4ZOL B;  5CBG A;  1R3L C;  3JYC A;  3RYI A;  1KU9 A;  1G4Y B;  4DV6 O;  4ABM A;  3IAY A;  3UKM A;  5EZY A;  1GRJ A;  1Q5O A;  1KP2 A;  3FYE B;  1JQ0 A;  1HW7 A;  4UUJ C;  2KG7 A;  3D36 A;  3P3P A;  4LF9 O;  1K92 A;  3VQX A;  3ZX6 A;  4ZOL A;  4N21 A;  2XAS A;  1DF5 A;  4LF8 B;  3OMN B;  5GON B;  3OD4 A;  4UCO A;  1DF4 A;  1FFT B;  1FXK C;  4A5U B;  2E75 B;  4AI8 A;  2UUA O;  1R1B A;  5D5Q A;  1KD1 W;  2XTA A;  1OJH A;  3ZMT A;  2R9I A;  2F95 B;  2Y69 C;  3M8A A;  4PJ0 Z;  4OX9 O;  1B3Q A;  1KKD A;  1G8M A;  1SER A;  5IYC O;  2VS0 A;  2EIJ B;  3IJ4 A;  2WLI B;  4OX9 B;  2OTJ V;  4DR2 B;  4QPJ A;  1XRE A;  5CBH A;  4I55 A;  3N2K A;  4NXN O;  1NS1 A;  5BR8 O;  3CWB H;  1M93 A;  4HNA A;  1FFX B;  5D5P A;  4ZIB A;  3H01 A;  2JIZ G;  4TSF G;  3T4Z A;  4PI0 A;  4YJ3 B;  3ABK C;  4K0K O;  4EB6 A;  3CPW U;  2JRI A;  3O65 A;  2QGN A;  1YVW A;  4NXM B;  2WWW A;  3OTO O;  3T4D A;  2KKW A;  1PKX A;  1XUQ A;  2LW1 A;  3RGB A;  4LF7 B;  1QVG U;  4G28 B;  5JJN B;  4XDK A;  1NH2 D;  1VQ9 V;  1AI6 A;  4LF7 O;  5IJ0 B;  3TET A;  2HHH O;  3GWO A;  5B1A B;  2YIA A;  2A7W A;  4B3M O;  1IDS A;  1H38 A;  3OGI B;  5EC2 C;  4B3M B;  1PL4 A;  1V55 B;  3MDS A;  2HFE C;  1P84 F;  3ZED A;  1Q6I A;  3RYI B;  4FZ1 A;  5KX5 B;  4FK5 C;  1SA0 A;  2RQ6 A;  2LFS A;  4I50 A;  2P7T C;  2RN9 A;  1V9P A;  2UU9 O;  2E74 B;  4FM2 A;  5EYP B;  2WLI A;  4MTX A;  2UU9 B;  5EIB C;  1FPO A;  4WFG A;  3RVY A;  2Y48 A;  1QHT A;  2ZKO A;  5BXZ A;  1P4R A;  1XEQ A;  1OV9 A;  2GTA A;  1K3E A;  3CCS V;  2CH7 A;  2EIK C;  3JAW B;  4TUY B;  4EEQ A;  5LL6 Y;  1A32 A;  4ZHQ B;  4AHC A;  1EBO A;  2HVK C;  3ICX A;  5J2T A;  1N0N A;  4MVQ A;  4DR5 O;  2KG7 B;  4XDJ A;  1BZK A;  3K5O A;  4EKW A;  5EZY B;  1SQP H;  4CH3 A;  1IBM B;  1MSD A;  3EHB B;  2UUC B;  1E1Q G;  1QLE C;  1IBK O;  2OT5 A;  1ARO P;  1YEW A;  3S3W A;  4K0K B;  4RWU A;  4X64 O;  4J11 A;  1F7Y A;  2YEV B;  1M56 C;  3OEE G;  5KAI Z;  5KHG A;  3CCM V;  2OWO A;  4LF5 O;  4I5S A;  2C2A A;  1SET A;  1H2K A;  3QF7 A;  3SYC A;  1Q3E A;  4KL1 A;  3CC2 V;  5FL7 G;  1YXB A;  5GON A;  4DR6 B;  4X9Q A;  2WLN A;  3RW0 A;  4DRX A;  3Q4H B;  2H3O A;  2E3C A;  4X20 A;  2JJ2 G;  4NKG B;  1SZT A;  3K06 A;  4E2L A;  1MNG A;  3EFF K;  2B1I A;  3ETQ A;  3HPL C;  2GTS A;  2UXB O;  3CRQ A;  3OUS A;  3ZS8 C;  1MA1 A;  3ZRV A;  2X7R B;  1H8E G;  2Y0P A;  3E22 B;  4EFE A;  1SF9 A;  2EIL B;  3E35 A;  5H5N A;  2WLL B;  3CSX A;  4TQD A;  5B1B B;  1ZX3 A;  4B3T O;  4J42 A;  5F2V O;  4NXN B;  2F4V O;  2BCC H;  1AJP A;  1WJZ A;  4J9Y B;  5LHI A;  1COW G;  4PA6 A;  4UCS A;  1Y74 B;  2ZIM A;  3FB5 C;  4JZ2 A;  2IM9 A;  1FFX A;  4HNA B;  3M99 B;  1NKD A;  4PD4 F;  2YXY A;  3VQV A;  4K8Z A;  2WPD G;  2Y0I A;  3OTO B;  3WG7 B;  4BWA A;  4MVZ A;  5JWP A;  4X20 B;  3VOU A;  1K73 W;  4R50 A;  5JH7 A;  5GW7 A;  2DYR B;  1R6N A;  1AP6 A;  2ITD C;  3E2E A;  1KEC A;  4KHP B;  2GUZ A;  2AXT Z;  5FNV B;  1P7B A;  4W4L A;  4OGQ B;  3B8M A;  2WAM A;  3P30 A;  3CCU V;  3SPH A;  2UUC O;  1JFF B;  4CH5 A;  5C8Y A;  2EX3 A;  4X1K A;  2YEV A;  4MS2 A;  1TVK B;  3VBB A;  2NN4 A;  3CRC A;  3DXR A;  4GKJ O;  2LGQ A;  4I4T B;  4UCT A;  4X1Y B;  3FD9 A;  2WA3 A;  3OMI B;  4B7E A;  5LOV B;  1VQ7 V;  3JAK B;  4DW0 A;  3UCS C;  5AG2 A;  2W6J G;  5CMU A;  4JF3 A;  5J2T B;  1V54 B;  2QWP B;  1M9N A;  5B1N A;  1D5A A;  5EK0 A;  3G67 A;  3KCX A;  5TIS Z;  1AJQ A;  2QWR B;  3AG4 B;  5LOV A;  2A9H A;  3PN1 A;  4D7T A;  1ENV A;  1KP3 A;  3N2K B;  2DE0 X;  4PI2 A;  4JI2 O;  1SS3 A;  3J7A U;  1BQZ A;  3ZMZ A;  4LF9 B;  4L87 A;  3AG4 C;  5KA5 A;  2Q7E A;  2GV9 A;  3WG7 C;  1L0N H;  5L3B A;  1NQT A;  3B8N A;  1S0V A;  4DR5 B;  3S3X A;  4ASU G;  3LDD A;  2ETN A;  2M7W A;  2Q67 A;  1EN4 A;  4BIU A;  4K8X A;  1Q86 W;  4BIO A;  2Q0O C;  4O4J A;  2DQ0 A;  4DK0 A;  3ZHQ A;  1B04 A;  1SA0 B;  4DV0 B;  1KYO F;  4JYY A;  1Y74 A;  2P6J A;  5FLX N;  1AIL A;  1FS0 G;  4LC1 A;  4F6R B;  5KMG B;  3RVZ A;  3HKC A;  1M57 B;  1IBK B;  1Q43 A;  4MTG A;  3K3W A;  2QDO A;  4O4H A;  4ZI7 A;  1ZLZ A;  3AEI A;  2ZE5 A;  1X4T A;  4I4T A;  4X8A A;  1CEZ A;  2ZIO A;  3ABM B;  3NR7 A;  4FMT A;  4LF5 B;  1AVM A;  3K03 A;  5L3D A;  4U7O A;  3KKY A;  3LUT B;  1S5H C;  5CN0 A;  3K57 A;  1Z5W A;  3B2E E;  3ZRW B;  4JAU A;  4UFZ A;  1VEW A;  4I9Q A;  1FKA O;  3CC4 V;  1NZ6 A;  4P30 A;  3QTC A;  3ZHV A;  3ABL C;  2LJ2 A;  3M7M X;  2QR4 A;  3R66 A;  2HHH B;  3ASO B;  2BOB C;  1GTO A;  3HB3 B;  1Y66 A;  4DV1 O;  3HKE B;  2EZO A;  2Z5U A;  1B6Q A;  4MVR A;  4IGG A;  3SYA A;  1Y67 A;  2CDY A;  1OCR B;  3CCR V;  4GKJ B;  1PL0 A;  4XBF A;  3UO3 A;  1RPR A;  1M5I A;  3JAR A;  1R3I C;  4ICG A;  4DR1 O;  4GYC B;  2H94 A;  3ZCC A;  1YJN V;  1W0J G;  2EJ7 A;  1QLE B;  3LDE A;  3OE7 G;  3DSQ A;  1HNW O;  1FAF A;  5C93 A;  2PI4 A;  4NYK A;  2Q6A A;  1LNQ A;  5H6Q A;  2CGO A;  1I08 A;  1RFY A;  3FB6 C;  1TUB A;  3LSU A;  3TGU H;  1ZL8 B;  4BW5 A;  1IBL B;  3BA8 A;  1HWY A;  2Q73 A;  4FLW A;  2W6I G;  3SYP A;  3X2Q C;  5EIB D;  3CEI A;  3DC5 A;  3QO5 A;  4CH4 A;  2BSK B;  5JVD B;  2X6C A;  3UT5 A;  2LFR A;  5CA1 A;  3BPZ A;  4GZR B;  3CCV V;  4JI7 O;  3JAW A;  2BOC C;  5LXT B;  2Z3Y A;  1ZAU A;  4JGS A;  4UV8 A;  3BA9 A;  1PPJ H;  4QE7 A;  3WB2 A;  2X0L A;  1NBM G;  3WFV A;  4CC6 A;  2Y69 B;  2KSD A;  4X65 O;  5DEC A;  5KHH A;  1JFF A;  3RYH B;  1GN3 A;  5C8Y B;  2CH7 B;  2Q9L A;  2QWN B;  3BY6 A;  4YJ2 A;  1JR9 A;  4U7N A;  2YUA A;  4Z1M G;  2ATK C;  3OR6 C;  1UJW B;  4JZG A;  4DR6 O;  3JD0 A;  5LMU O;  2DMX A;  2PUS A;  2HJF C;  3JAL A;  5CA1 B;  1EN5 A;  5BZB A;  2KQX A;  3P32 A;  4DO2 A;  4JI1 O;  5CBF A;  5B1O A;  4MVO A;  4JI6 B;  3TCU A;  1FXV A;  1YIJ V;  1Y4M A;  1Q6U A;  4RAI A;  2XOK G;  1M57 C;  1YTF B;  3CCE V;  2QWO B;  3FYI B;  5K1P A;  3SJC C;  3E89 A;  1GO3 F;  3WB0 A;  3FKS G;  5IJ9 B;  2HKO A;  3BHP A;  2RCV A;  3DXR B;  4OPA A;  3JSL A;  4QIW F;  3ABL B;  1UPG A;  4RUF A;  3L71 H;  4JTD B;  5LMN O;  2YID A;  1XDC A;  1M56 B;  2V7Q G;  1K34 A;  1ROP A;  2XT9 A;  3W7U A;  2F4V B;  2OCH A;  3I5D A;  5K1X A;  2ZR2 A;  3I56 V;  4CH6 A;  3R65 A;  3CYO A;  2OCC C;  3A8T A;  2NLJ C;  4W4K A;  4JI4 B;  2ZD9 A;  1OCC C;  1K33 A;  3Q4H A;  2HG5 C;  1Q6H A;  3ZHR A;  1XL6 A;  4PEL A;  4ZKI A;  5B3S C;  5H6R A;  2MK3 A;  1VF6 C;  2VQE B;  3STZ C;  4LF4 O;  1JX9 A;  1PP9 H;  1OCO C;  5EBM C;  1IZ3 A;  4J80 A;  2Q7G A;  1K4D C;  5KLV H;  1N4C A;  1J95 A;  1Q8I A;  4IIJ B;  4DV1 B;  3L9D A;  2ILM A;  1IVS A;  4K35 A;  3W7W A;  5IY5 B;  2PGG A;  5IJ9 A;  1OCZ C;  4GKK O;  3KZI Z;  2WLL A;  4TQF A;  2A3Q A;  2DW4 A;  3ETG A;  1BSM A;  4UB8 Z;  3UT5 B;  5BMV B;  3TK1 A;  1H2M A;  1H2S B;  2DQ3 A;  3CXC U;  4TV9 A;  1YHQ V;  1VQ5 V;  4MSW C;  4HBN A;  1HNZ O;  3SPG A;  4PA7 A;  4WFB V;  4GX0 A;  3JAL B;  4PDL A;  3BVO A;  3CD6 V;  4LF8 O;  5ITZ B;  5JJE B;  1K4C C;  2YS8 A;  3GWK C;  3ZMV A;  2IBZ H;  1M90 W;  3N2G B;  1Z2G A;  2DN9 A;  3T1H B;  4JI1 B;  1AI4 A;  3O9O A;  1TUB B;  3E8G A;  5LA6 A;  5J2U B;  4WBN A;  2P22 C;  1KBH A;  1JPX A;  3UQ8 A;  1K97 A;  4KFM A;  2WLK A;  4YIP A;  3B4S A;  2ZM6 B;  2BTQ B;  2DWD C;  1I5X A;  2UXD O;  1N33 B;  4Q6G A;  2JEX A;  3FB7 C;  1HNX O;  2ADP A;  3EVK A;  1NH2 B;  2FTK A;  3OUF A;  5BR8 B;  4JTA B;  1B06 A;  3D36 C;  1VF5 B;  2ZDI C;  1PD3 A;  4X1I A;  5CB4 B;  2DYR C;  2CTQ A;  1VF6 A;  5DED A;  3THO A;  2CAZ C;  2R72 A;  5L3F A;  5E79 Z;  1DK1 A;  1VP7 A;  4TV8 B;  3ETD A;  4MVM A;  1K5S A;  3OAA G;  3OTF A;  5EC1 C;  4DYL A;  3U10 A;  1HR0 B;  1S5J A;  4B3S O;  3ZMU A;  4J41 A;  1YI2 V;  2AHZ A;  2XAF A;  4K3A A;  5B5E Z;  4B3S B;  4UB6 Z;  1YCI A;  4H0L B;  1ZL8 A;  1GM9 A;  1S72 V;  1VQN V;  3F7V C;  2IH1 C;  1TAE A;  1MZF A;  4I7Z B;  4X88 A;  2CTW A;  1AI7 A;  4O4I A;  4PDM A;  4NVP A;  1QBZ A;  4DV3 B;  3CME V;  3RYF B;  3MHH C;  4P9O A;  2WLJ A;  3ZIA G;  3RFR A;  1MG1 A;  3JAS A;  3JAS B;  4JYC A;  4B3T B;  3EXA A;  4MW8 A;  1IUR A;  1WP8 A;  2QM7 A;  3ASN C;  2E5L B;  1CPY A;  3AG2 B;  2XAQ A;  3ZJZ A;  5CA3 A;  4X1I B;  4LFA O;  2IW5 A;  4PA4 A;  4DV2 B;  3LSQ A;  1QLN A;  2ADQ B;  2XHB A;  3F5W C;  2HJD A;  1MZE A;  4DV4 B;  4WFE A;  4IYI A;  3WB1 A;  5FPO A;  1BS3 A;  2OIE A;  2P90 A;  4UCR A;  3LNM B;  1X59 A;  3E83 A;  3T2M A;  3NXS A;  5JCO C;  1PM9 A;  2AZ0 A;  3KG2 A;  4CBC A;  2P4K A;  3X2Q B;  2D3O W;  4C7U A;  2XAG A;  4X62 B;  2QTO A;  4JI8 B;  1FXH A;  1QNM A;  1XNR O;  4X66 B;  4LF4 B;  4F6R A;  1WP7 A;  4YXW G;  4GX2 A;  2D2C B;  1GAX A;  1PNK A;  1L1F A;  5IWA B;  3ZN1 A;  1JA8 A;  1S5L Z;  2YC0 A;  4KP4 A;  1FYJ A;  2HP8 A;  2VQF O;  1K5Q A;  3BEH A;  1FXK A;  1XIL A;  2EIN C;  4RQF A;  2YXH A;  1GN2 A;  2PTM A;  2VQF B;  4DV6 B;  1S3J A;  3CX5 F;  1F4N A;  1Q81 W;  2ZXW C;  2ZE6 A;  1TGO A;  4G27 B;  2PY5 A;  1MOF A;  2DJV A;  3CP1 A;  1MAB G;  4MT8 A;  2G38 A;  4UCU A;  1S77 D;  2Q4P A;  3E8H A;  3RWR D;  3TXQ A;  5LXT A;  1OCO B;  2FML A;  4DR7 O;  2Q8V A;  4J9Z B;  3G4S V;  2UUA B;  2UXB B;  4U3J A;  1BL8 A;  4OPH A;  3P3N A;  4J10 A;  3IC7 A;  1IX9 A;  2CUG A;  1F23 A;  4R7C A;  2KB1 A;  1NTM H;  5JQG A;  4MVS A;  4DV7 O;  3SYQ A;  5IYZ B;  1VQ4 V;  4B3R B;  2W0F C;  2PF4 E;  2O57 A;  4JV5 B;  4X1K B;  4Z1V A;  4N23 A;  3SJB C;  4ZHQ A;  1BCC H;  1IBM O;  1RSO B;  4QE9 A;  1NVP D;  4LFA B;  3AG7 A;  2EIM B;  2FYU H;  1TUE B;  3F7Y C;  2XAH A;  3U11 A;  4YHH B;  1J5E O;  1LUV A;  2V4D A;  4JYA B;  1XBL A;  4L8J A;  1VQM V;  4X64 B;  5IT9 N;  1NJI W;  4J7Z A;  2XND G;  1V54 C;  2YIC A;  3SPI A;  4GCZ A;  1EZV H;  2OTL V;  3ZBH A;  2W0X A;  2JS5 A;  4NXM O;  4DRX B;  2Y4T A;  1WNS A;  3CHX A;  4NTX A;  4FFB A;  4O2B A;  1M1K W;  3K9A A;  1VQ6 V;  3CS5 A;  2PZS A;  3H1K H;  4X62 O;  2HLD G;  1RM1 B;  3FX7 A;  3AK3 A;  3JAM N;  4DUZ B;  5LP6 A;  5LHG A;  3CE2 A;  3RYF A;  2HR3 A;  2R70 A;  4NTW A;  4DUZ O;  1WB8 A;  3K5L A;  4DR1 B;  1GM8 A;  2HEP A;  3C3S A;  2QKA A;  1WPX A;  1RSO A;  1N34 O;  4H13 B;  1KC8 W;  1P49 A;  4UV9 A;  5BY1 A;  1SQQ H;  3OFN G;  1R3J C;  4PDR A;  2DYS B;  4FIP C;  1IXB A;  3AG3 B;  2UXN A;  3E8F A;  4DR3 B;  1VMG A;  1IBL O;  3A0H Z;  1KB9 F;  1N36 B;  4JAV A;  1HDJ A;  2WLM A;  1ZSP A;  2ZE7 A;  4IHJ A;  2QJ1 A;  3B77 A;  4DV4 O;  4WF9 V;  2RJZ A;  4D7S A;  3AK1 A;  2IJH A;  2E76 B;  4LP8 A;  2P67 A;  4WBN B;  4JTC B;  3RYH A;  3T1H O;  3STL C;  1EN6 A;  5H2F Z;  2YDE A;  1SZX A;  4JI7 B;  4WCE V;  4QPK A;  3W7T A;  4CC5 A;  5DN6 G;  3E86 A;  4DR4 O;  2P06 A;  3KCY A;  3JD4 A;  5FPR A;  5LA6 B;  1Z5V A;  4JI8 O;  1ZWI C;  4JI5 B;  4LR3 A;  2M6Y A;  3LDC A;  2F66 C;  4FM0 A;  5JJJ B;  4TWK A;  1HNX B;  2AZ2 A;  3T1C A;  4JI5 O;  4MTF A;  4TT3 G;  4H33 A;  4JYA O;  1O9H A;  2QE7 G;  3I55 V;  2YIB A;  3JAK A;  2JK5 C;  1US6 A;  2OYQ A;  1R6K A;  3C3T A;  3ZHT A;  2YSU B;  1SC5 B;  1XOU A;  4DUY O;  3ETE A;  4F4L A;  3OR7 C;  2A06 H;  1P7G A;  4O4I B;  4U3J B;  5J9P C;  4FZ0 A;  1Y76 B;  4Z2W A;  4AQY B;  1SQG A;  4TUY A;  1XQ8 A;  3IC9 A;  4AIL C;  4LH7 A;  2ZNJ A;  4IL6 Z;  4KXR A;  2B5U A;  3D3Q A;  1EM1 A;  1SQF A;  3K08 A;  3W7S A;  4NR1 A;  1N0J A;  4LBE C;  5LP6 B;  1WPB A;  3FB8 C;  3K04 A;  2EIN B;  1NT2 B;  4JYB A;  3CRA A;  1N34 B;  2LQT A;  2ZIN A;  4LF6 B;  3ZRX A;  4B3R O;  2YI9 A;  4LH6 A;  5KHJ A;  1AB3 A;  5HFL A;  4FLV A;  3JSN A;  5KMG A;  2V1D A;  4JPR A;  4JV5 O;  1RM1 C;  1H2G A;  2UUB B;  1N32 B;  3K5N A;  2FL4 A;  1ORQ C;  2YXL A;  2N05 A;  1GK9 A;  1URF A;  5JCO A;  3H9V A;  3H1I H;  2BTQ A;  5IDJ A;  1N36 O;  3W7X A;  3ZRW A;  3CCJ V;  3K5M A;  2N04 A;  4LFC B;  3H1L H;  2QEX V;  2QSA A;  3AG1 B;  4YIO A;  2GSM B;  5J2U A;  4FPP A;  1QVF U;  3CRR A;  5LBQ A;  3ABT A;  1YIT V;  3UM7 A;  3MAQ A;  5H9C A;  4IT5 A;  1YSC A;  3ASO C;  2IU0 A;  5KUK A;  1SQV H;  1E79 G;  2JGD A;  4LWS A;  4DXW A;  4NB5 A;  3J80 N;  5LGU A;  2JDI G;  5KAF Z;  3SR2 C;  4ZBM A;  3QG5 A;  3PJS K;  1W2B U;  2RMK B;  4GKK B;  3HR0 A;  1SKV A;  4JI0 B;  2EIJ C;  1QR8 A;  2IJK A;  4JAS A;  4HZ3 A;  3BRC A;  4R6Z A;  3AG3 C;  1MSW D;  1GH6 A;  5IWA O;  1G1X B;  1PNM A;  3BFR A;  4LNU A;  2CTR A;  1SQB H;  1VQK V;  2IH3 C;  1HNZ B;  4O4J B;  3GB7 C;  3L74 H;  2ZXW B;  3FAV B;  3FAV A;  5A2Q N;  4BIZ A;  1JMK C;  5LHH A;  2ZCE A;  4JI3 B;  5KA6 A;  3ZMS A;  5LMU B;  1R3K C;  3RN4 A;  2EBO A;  1NTK H;  4IHJ B;  5LGT A;  2WSS G;  4KUM A;  4QNH B;  2BSK A;  5KHI A;  3K0D A;  1AR1 B;  4DR7 B;  2ZM6 O;  3CC7 V;  1W59 A;  1WA8 A;  5IYB O;  4JI6 O;  1N33 O;  2UXD B;  2P4V A;  1T5E A;  5LYJ A;  1JOY A;  5JVD A;  4TV9 B;  1QU7 A;  2ODM A;  1HP8 A;  1YJ9 V;  5L3C A;  1O9G A;  1V55 C;  1PNL A;  3SJQ C;  4DV7 B;  4O4L A;  1KUQ A;  1DLB A;  2AW9 A;  2H8P C;  4DR2 O;  4PA9 A;  1NR1 A;  3K79 A;  3A2F A;  4IIJ A;  5E1A C;  1BHB A;  3JD1 A;  1XHZ A;  4YJ3 A;  5B66 Z;  3HKD B;  1R73 A;  2BE3 A;  1Q90 D;  2OCC B;  4YHH O;  2DYS C;  5EYP A;  1UFI A;  1CP9 A;  3HKB A;  3AG2 C;  1K8A W;  2QM4 A;  3ASN B;  2OIG A;  4I55 B;  3C90 A;  4I50 B;  4X89 A;  2ZE8 A;  4J7K A;  1AJN A;  2IJJ A;  2K1E A;  2RNB A;  1FJG B;  4UVB A;  1NI8 A;  1I94 O;  3VQW A;  4AQY O;  1WAZ A;  2XUM A;  3UO2 A;  1DGS A;  3G80 A;  2NNU A;  3HKE A;  1G6U A;  5EBL C;  2L35 A;  2F23 A;  1XL4 A;  3CB2 A;  3CJH B;  5IJ0 A;  1NR7 A;  4RO2 A;  3SGI A;  5BMV A;  2DWE C;  2E5L O;  4GT1 A;  4I0X B;  4OXS A;  1BE3 H;  1WLE A;  2F93 B;  3QVN A;  1D5N A;  1ZUQ A;  2EUL A;  3G71 V;  2JVD A;  4RQE A;  1YJW V;  3DGE A;  1F51 A;  3RYC A;  5IE9 A;  2HVJ C;  1AI5 A;  3ZHU A;  3MHS C;  5KUM A;  5LGN A;  4BW9 A;  4QJF B;  5CA0 A;  5IYZ A;  2R9A A;  4TV8 A;  2JGU A;  3APO A;  3IGA C;  2YI8 A;  4LFC O;  5CB4 A;  4MW3 A;  1Q7Y W;  4UXN A;  1LR1 A;  2ZR3 A;  1H2L A;  1SRY A;  4CS4 A;  1XMQ O;  3N27 A;  2AHY A;  4DK1 A;  5EBW C;  4P2Z A;  3DTU B;  5A9G A;  1LUW A;  1BGY H;  1VF7 A;  1H8H G;  4NTY A;  1KQS U;  1KMI Z;  2P5O A;  3FFQ A;  2LP7 A;  4B08 A;  3GVM A;  4PDV A;  1RPO A;  1XHX A;  1Q82 W;  1XMO O;  4JI0 O;  3LSS A;  2NR5 A;  3K59 A;  3DC6 A;  1XMO B;  2MW2 B;  1WB7 A;  2Q5Z A;  3APQ A;  4WFA V;  3T1Y B;  3JD2 A;  3OGC C;  4F6E A;  1GMG A;  1IXM A;  3MD0 A;  1VQP V;  4EFB A;  3RYC B;  5B1B C;  4RUE A;  4G2K A;  1YDX A;  1E1R G;  1JJO A;  5GTH Z;  1PV0 A;  1U96 A;  1EFR G;  1SQX H;  1BQ0 A;  4I9W A;  2B1G A;  3A0R A;  3SYO A;  3QO8 A;  1YF2 A;  1I0H A;  5JH7 B;  2EJR A;  3OW2 U;  4UVA A;  3LNN A;  2LGW A;  1SES A;  3JAT B;  1GN4 A;  2Z0A A;  3HKC B;  5KX5 A;  2FB5 A;  4GUN A;  3QNE A;  2FKX A;  4R8C A;  2B9Z A;  1J5E B;  3G6E V;  4FFB B;  2ARH A;  1JJ2 U;  4LF6 O;  1BMF G;  4DV2 O;  2JJ1 G;  5B3S B;  4CS3 A;  2VRZ A;  1W0K G;  3ABU A;  1U97 A;  2UUB O;  1N32 O;  2QKC A;  3U0Z A;  5L3G A;  3QO7 A;  4FM1 A;  2PI5 A;  3B09 A;  2VWJ A;  2EIM C;  3E22 A;  3TJT A;  3CRM A;  2VWK A;  3J81 N;  1XMQ B;  2CGN A;  3CMA V;  4O4L B;  1THZ A;  2YIB D;  1OZ0 A;  4FVM A;  2UXX A;  4D6T H;  5JQG B;  5DM6 V;  1I5Y A;  1KKC A;  2K9P A;  1Y76 A;  1XNR B;  1XNQ O;  1VQO V;  3G6B A;  1Y6X A;  1XNQ B;  3OEH G;  4J7J A;  2A79 B;  1WA8 B;  3TXS A;  4HAM A;  1OCC B;  2GDS A;  2CK3 G;  2RDC A;  4X65 B;  3H1H H;  2UXC B;  2X6B A;  4UCV A;  3ABK B;  4GX1 A;  3K58 A;  1MMM A;  2UXC O;  4XDL A;  1DTO A;  4DR3 O;  5KHK A;  1AR4 A;  1R6T A;  5FNV A;  1JCH A;  1HNW B;  4IYH A;  1FXK B;  4GLX A;  3RT3 C;  3IFX A;  2JEU A;  3SPC A;  1CXZ B;  2GBO A;  3B40 A;  2JS3 A;  3SDL A;  3K9S A;  1QQC A;  2PYL A;  5ITZ A;  3L72 H;  3D8C A;  2Q69 A;  2N74 A;  4JI3 O;  2Q0A A;  1BT8 A;  1S76 D;  4E4E A;  4JI2 B;  3ZRS A;  4QGP A;  2QWQ B;  1BHA A;  2IJI A;  2F1M A;  4HYO A;  4DR4 B;  3CXH F;  4BR6 A;  4FLT A;  4FLU A;  2X6A A;  3JD3 A;  5L3E A;  4DV5 O;  2JGD B;  4LWS B;  1XI1 A;  2Q68 A;  4UVC A;  4TOI A;  1QR9 A;  1WN7 A;  4DV5 B;  4BAY A;  4FLX A;  1ZTE A;  1TVK A;  1L8D A;  2XAJ A;  5LP6 C;  3ZHS A;  3JCU Z;  1OHH G;  4DW1 A;  2CTP A;  3SJA C;  4DUY B;  1I7F A;  3CJH A;  1K7D A;  4DV0 O;  1YTF D;  1N8R W;  4B7K A;  4FFK A;  4YJ2 B;  3BAA A;  3SPJ A;  1VIB A;  2GUZ B;  2AGA A;  1K9M W;  1JVM A;  2ZQM A;  3T1Y O;  4JI4 O;  3E8B A;  5GTI Z;  1NVP B;  1HR0 O;  4FLY A;  3RBZ A;  1AP5 A;  3JCZ A;  1NTZ H;  4Q20 A;  3VQY A;  3JAR B;  3OT7 A;  4O2A A;  5IYD O;  4CS2 A;  2WA4 A;  1NU1 H;  3JAT A;  5CA0 B;  4DV3 O;  3HKB B;  1AR5 A;  3CCQ V;  1L0L H;  2QKS A;  1FJG O;  2EIK B;  2BTO A;  4O2A B;  2CE4 A;  1EZJ A;  4PHZ A;  4FLZ A;  3OM3 B;  1GKF A;  1RP3 B;  1I94 B;  4YY3 B;  1FD9 A;  2Q7H A;  3ML0 A;  2GHY A;  4JAA A;  4MTO A;  2DOS A;  4GX5 A;  4X1Y A;  4YY3 O;  4PV1 B;  4WFF A;  4U3F H;  3AG1 C;  2ITC C;  3L75 H;  3WU2 Z;  4I0X A;  4PA3 A;  2R9R B;  4EB6 B;  3ABM C;  3K0G A;  4MVU A;  3AK2 A;  2ZT9 B;  5IY5 C;  3H1J H;  1VQ8 V;  1D2D A;  1M4U A;  5B1A C;  2QM8 A;  2QTS A;  4LFB B;  4O4H B;  4ZI7 B;  5LYJ B;  1VQL V;  2F43 G;  2ZNI A;  5LMN B;  4CZZ A;  3ZN0 A;  3L70 H;  1GM7 A;  1VAR A;  4LFB O;  4LCU C;  2L6L A;  2LW7 A;  2ZDI A;  4FJC C;  2IU3 A;  4H44 B;  2A0L A;  4O2B B;  1GN6 A;  1H2N A;  2EZP A;  4WFH A;  4KHP O;  1OCR C;  3BCC H;  3CCL V;  4P9P A;  1TA8 A;  3D3I A;  4X66 O;  2LO1 A;  3BAB A;  2QA4 V;  3HKD A;  3OMA B;  1QCE A;  1OCZ B;  3N2G A;  2VQE O;  3F5T A;  4LNU B;  1F4M A;  1YZB A;  2WLH A;  2PYJ A;  2EIL C;  2Y4U A;  3L73 H; 
#chains in the Genus database with same CATH homology
 4X89 A;  3LUT B;  4H37 A;  3ZN1 A;  1S5H C;  5HFM A;  4KP4 A;  1AJN A;  5CN0 A;  1K5Q A;  2IJJ A;  3BEH A;  2K1E A;  3ZRW B;  1FXK A;  4JAU A;  2EIN C;  4UVB A;  4RQF A;  3CC4 V;  5CBG A;  1R3L C;  4P30 A;  3ABL C;  3JYC A;  1S3J A;  1F4N A;  1G4Y B;  1Q81 W;  2ZXW C;  4G27 B;  1MOF A;  3ASO B;  2BOB C;  1GTO A;  3CP1 A;  1Y66 A;  3HB3 B;  3UKM A;  2NNU A;  1MAB G;  4MT8 A;  5EBL C;  1S77 D;  2EZO A;  2Z5U A;  1B6Q A;  1KP2 A;  3E8H A;  3FYE B;  1JQ0 A;  4MVR A;  3SYA A;  1XL4 A;  4UUJ C;  1NR7 A;  4RO2 A;  1OCR B;  2DWE C;  3D36 A;  3CCR V;  1OCO B;  1K92 A;  1PL0 A;  4XBF A;  1RPR A;  4GT1 A;  4OXS A;  1WLE A;  4N21 A;  1R3I C;  3G71 V;  2XAS A;  4J9Z B;  3G4S V;  1DF5 A;  4RQE A;  2H94 A;  3ZCC A;  1YJN V;  1W0J G;  3DGE A;  1YJW V;  3OMN B;  1QLE B;  3LDE A;  1F51 A;  3OE7 G;  1BL8 A;  2HVJ C;  1AI5 A;  1DF4 A;  5C93 A;  1FFT B;  2PI4 A;  1FXK C;  2Q6A A;  1LNQ A;  3IC7 A;  3MHS C;  5H6Q A;  5KUM A;  5LGN A;  1KD1 W;  1F23 A;  2R9I A;  4R7C A;  2Y69 C;  3ZMT A;  2KB1 A;  4QJF B;  1KKD A;  1G8M A;  4MVS A;  3SYQ A;  1SER A;  3FB6 C;  1VQ4 V;  5IYC O;  2W0F C;  2EIJ B;  2WLI B;  2OTJ V;  3IGA C;  4QPJ A;  5CBH A;  4BW5 A;  1Q7Y W;  4MW3 A;  4N23 A;  4UXN A;  4QE9 A;  1HWY A;  2ZR3 A;  1NVP D;  1SRY A;  2W6I G;  2EIM B;  3H01 A;  3SYP A;  1TUE B;  3F7Y C;  2JIZ G;  2XAH A;  3X2Q C;  2AHY A;  4TSF G;  3T4Z A;  3QO5 A;  5EBW C;  3ABK C;  4P2Z A;  3DTU B;  1VQM V;  3CPW U;  1NJI W;  2XND G;  1V54 C;  3SPI A;  1H8H G;  2X6C A;  4GCZ A;  2LFR A;  2WWW A;  1KQS U;  3T4D A;  2OTL V;  1PKX A;  3CCV V;  2LP7 A;  2BOC C;  4PDV A;  2Z3Y A;  1RPO A;  1QVG U;  4G28 B;  1Q82 W;  4JGS A;  4XDK A;  1NH2 D;  4UV8 A;  1VQ9 V;  1AI6 A;  4QE7 A;  3LSS A;  1M1K W;  3TET A;  3K9A A;  2X0L A;  3GWO A;  5B1A B;  1NBM G;  3WFV A;  1VQ6 V;  2Y69 B;  4WFA V;  3JD2 A;  3OGC C;  2HLD G;  1RM1 B;  3BY6 A;  1GMG A;  1H38 A;  5LHG A;  1IXM A;  5EC2 C;  3MD0 A;  2HR3 A;  1VQP V;  1V55 B;  4U7N A;  2HFE C;  5B1B C;  4Z1M G;  4RUE A;  4G2K A;  1GM8 A;  1E1R G;  4FK5 C;  2ATK C;  2LFS A;  3OR6 C;  1EFR G;  2P7T C;  1WPX A;  1UJW B;  4I9W A;  3JD0 A;  2B1G A;  1KC8 W;  2HJF C;  2WLI A;  4MTX A;  4UV9 A;  3A0R A;  3SYO A;  3QO8 A;  5BZB A;  3P32 A;  4DO2 A;  4WFG A;  3RVY A;  2Y48 A;  3OFN G;  5CBF A;  2EJR A;  3OW2 U;  1R3J C;  4PDR A;  5B1O A;  4UVA A;  2DYS B;  4MVO A;  4FIP C;  3TCU A;  1FXV A;  3AG3 B;  1P4R A;  1SES A;  2UXN A;  1YIJ V;  1Y4M A;  3E8F A;  4RAI A;  2XOK G;  1M57 C;  1YTF B;  4JAV A;  1K3E A;  3CCS V;  2WLM A;  2EIK C;  3CCE V;  3FYI B;  3E89 A;  3B77 A;  1GO3 F;  4WF9 V;  3FKS G;  3QNE A;  2HKO A;  1EBO A;  4R8C A;  2HVK C;  4QIW F;  3ABL B;  3G6E V;  1JJ2 U;  2IJH A;  4RUF A;  4MVQ A;  1BMF G;  4JTD B;  2JJ1 G;  4LP8 A;  2P67 A;  5B3S B;  1M56 B;  4XDJ A;  4JTC B;  1W0K G;  3ABU A;  3STL C;  2V7Q G;  1K34 A;  1ROP A;  4EKW A;  3W7U A;  4WCE V;  5L3G A;  3QO7 A;  4QPK A;  2ZR2 A;  3I56 V;  3W7T A;  2PI5 A;  3R65 A;  3CYO A;  3E86 A;  5DN6 G;  2EIM C;  2OCC C;  2NLJ C;  3JD4 A;  2ZD9 A;  3EHB B;  1ZWI C;  3LDC A;  1OCC C;  4TWK A;  1E1Q G;  3CMA V;  1K33 A;  1QLE C;  1THZ A;  3T1C A;  2OT5 A;  2HG5 C;  1ARO P;  1OZ0 A;  2UXX A;  4MTF A;  4TT3 G;  5DM6 V;  4H33 A;  1I5Y A;  1XL6 A;  4PEL A;  4ZKI A;  2QE7 G;  5B3S C;  5H6R A;  2MK3 A;  3I55 V;  2JK5 C;  3STZ C;  2YEV B;  1M56 C;  1JX9 A;  3OEE G;  1OCO C;  1R6K A;  3CCM V;  1VQO V;  4I5S A;  2C2A A;  2YSU B;  5EBM C;  3ETE A;  1SET A;  1K4D C;  4F4L A;  3OR7 C;  3SYC A;  1J95 A;  3OEH G;  3CC2 V;  2A79 B;  5FL7 G;  5J9P C;  4HAM A;  3W7W A;  5IY5 B;  2WLN A;  3RW0 A;  1OCZ C;  1OCC B;  2CK3 G;  2WLL A;  2DW4 A;  3ETG A;  2B5U A;  2X6B A;  2JJ2 G;  1SZT A;  3ABK B;  3K06 A;  4GX1 A;  3TK1 A;  4E2L A;  2DQ3 A;  3EFF K;  1DTO A;  4XDL A;  2B1I A;  3CXC U;  3K08 A;  3W7S A;  3HPL C;  1YHQ V;  1VQ5 V;  4LBE C;  4MSW C;  1JCH A;  3SPG A;  1FXK B;  3FB8 C;  3K04 A;  2EIN B;  3OUS A;  4PA7 A;  4WFB V;  3ZRV A;  2X7R B;  1H8E G;  3IFX A;  4GX0 A;  2JEU A;  3SPC A;  4PDL A;  4JYB A;  3CD6 V;  3ZRX A;  2EIL B;  3E35 A;  1K4C C;  5B1B B;  2Q69 A;  2WLL B;  3ZMV A;  5HFL A;  1M90 W;  1S76 D;  2V1D A;  4JPR A;  1RM1 C;  1AI4 A;  1H2G A;  3E8G A;  1JPX A;  1AJP A;  1ORQ C;  3ZRS A;  1K97 A;  4KFM A;  2WLK A;  1GK9 A;  1BHA A;  2IJI A;  4HYO A;  4J9Y B;  5LHI A;  1COW G;  5IDJ A;  4PA6 A;  3W7X A;  3FB5 C;  2DWD C;  2X6A A;  3JD3 A;  3ZRW A;  3CCJ V;  1I5X A;  5L3E A;  3M99 B;  1NKD A;  2JEX A;  3FB7 C;  2QEX V;  3AG1 B;  2GSM B;  1NH2 B;  2FTK A;  3OUF A;  4FPP A;  4JTA B;  2Q68 A;  4UVC A;  1QVF U;  1QR9 A;  2ZDI C;  1PD3 A;  5LBQ A;  2WPD G;  4BAY A;  2DYR C;  3WG7 B;  3ABT A;  2XAJ A;  1YIT V;  3UM7 A;  5H9C A;  1OHH G;  4MVZ A;  5L3F A;  1YSC A;  3ASO C;  2IU0 A;  5KUK A;  3VOU A;  1E79 G;  3ETD A;  4MVM A;  1K5S A;  1K73 W;  1K7D A;  3OAA G;  1YTF D;  4R50 A;  1N8R W;  5EC1 C;  4DXW A;  5GW7 A;  2DYR B;  1R6N A;  2ITD C;  3E2E A;  1KEC A;  5LGU A;  3SPJ A;  2JDI G;  1K9M W;  1JVM A;  1P7B A;  2ZQM A;  4ZBM A;  3B8M A;  3ZMU A;  2WAM A;  3E8B A;  3P30 A;  3CCU V;  3PJS K;  1YI2 V;  1W2B U;  3SPH A;  1NVP B;  2AHZ A;  2XAF A;  3RBZ A;  2EIJ C;  3JCZ A;  1QR8 A;  2IJK A;  4JAS A;  4Q20 A;  4HZ3 A;  1GM9 A;  2YEV A;  1S72 V;  1VQN V;  3F7V C;  5IYD O;  2IH1 C;  4MS2 A;  3VBB A;  4R6Z A;  3AG3 C;  1MSW D;  1PNM A;  4X88 A;  1AI7 A;  1VQK V;  2IH3 C;  3OMI B;  3CCQ V;  4PDM A;  2QKS A;  3GB7 C;  1VQ7 V;  2EIK B;  1QBZ A;  1EZJ A;  3OM3 B;  1GKF A;  2ZXW B;  3CME V;  3ML0 A;  3MHH C;  4P9O A;  2GHY A;  2W6J G;  2WLJ A;  4BIZ A;  5CMU A;  5LHH A;  4JF3 A;  4MTO A;  1V54 B;  3ZIA G;  1MG1 A;  1M9N A;  4GX5 A;  5B1N A;  5EK0 A;  1AJQ A;  4WFF A;  3AG4 B;  3ZMS A;  5KA6 A;  1R3K C;  2A9H A;  2EBO A;  1ENV A;  1KP3 A;  4JYC A;  5LGT A;  4MW8 A;  3AG1 C;  2ITC C;  2WSS G;  4PA3 A;  2R9R B;  4KUM A;  3ZMZ A;  4QNH B;  2QM7 A;  3ASN C;  1CPY A;  3K0D A;  3ABM C;  3AG2 B;  3AG4 C;  3K0G A;  4L87 A;  4MVU A;  5KA5 A;  1AR1 B;  3CC7 V;  3WG7 C;  2XAQ A;  5IYB O;  5IY5 C;  3ZJZ A;  5CA3 A;  1VQ8 V;  5L3B A;  5B1A C;  2QM8 A;  2IW5 A;  1NQT A;  4PA4 A;  3B8N A;  1S0V A;  1VQL V;  2F43 G;  1JOY A;  4CZZ A;  3LSQ A;  3ZN0 A;  1QLN A;  3LDD A;  4ASU G;  2M7W A;  3F5W C;  2Q67 A;  1GM7 A;  4BIU A;  4WFE A;  4LCU C;  1YJ9 V;  5L3C A;  1V55 C;  2ZDI A;  1Q86 W;  1PNL A;  3SJQ C;  4FJC C;  2P90 A;  2DQ0 A;  2IU3 A;  3LNM B;  2A0L A;  1DLB A;  2H8P C;  3E83 A;  2EZP A;  2P6J A;  4PA9 A;  4WFH A;  1FS0 G;  4LC1 A;  3T2M A;  1NR1 A;  1OCR C;  3NXS A;  3RVZ A;  3CCL V;  3K79 A;  1M57 B;  4P9P A;  3KG2 A;  5E1A C;  4CBC A;  1BHB A;  3JD1 A;  3D3I A;  4MTG A;  3X2Q B;  3K3W A;  2D3O W;  3AEI A;  2QA4 V;  2XAG A;  1R73 A;  3OMA B;  2QTO A;  1QCE A;  1OCZ B;  4X8A A;  1FXH A;  2OCC B;  2DYS C;  1CP9 A;  1F4M A;  1CEZ A;  2WLH A;  4YXW G;  3ABM B;  3AG2 C;  4GX2 A;  4FMT A;  1K8A W;  3K03 A;  3ASN B;  5L3D A;  1PNK A;  2EIL C;  4U7O A;  1L1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...