1VQ9V

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq9V00
2OTLV 1VQ6V 3CCEV 1VQKV 1YJ9V 3G6EV 1KC8W 3CC4V 1YITV 1QVGU 2QEXV 3CXCU 3CCRV 1YHQV 1K9MW 1VQOV 3I56V 1N8RW 1S72V 3CCVV 1YJWV 2D3OW 5DM6V 4WFAV 1Q82W 4WFBV 1VQPV 1M1KW 2OTJV 3CC7V 1K8AW 3CCQV 1Q81W 1R73A 1Q7YW 1VQ4V 3OW2U 1VQ9V 3CCMV 3CCLV 3G4SV 1NJIW 1QVFU 3CMAV 1VQNV 3CCJV 2QA4V 3G71V 4WF9V 1VQLV 1W2BU 1JJ2U 3CPWU 1KQSU 1YIJV 1VQ8V 3CD6V 1VQ7V 4WCEV 3I55V 3CMEV 1KD1W 1VQ5V 3CC2V 1YJNV 1YI2V 1Q86W 1VQMV 3CCUV 3CCSV 1M90W 1K73W
chains in the Genus database with same CATH superfamily
3D8CA 4TSFG 2Q0OC 1GH6A 4FLTA 1JPXA 4KUMA 4NB5A 5CA1B 1FFXA 4JV5O 2UXCB 4JI5B 1KYOF 1W0JG 2K1EA 4Q6GA 4FM1A 2ARHA 1OZ0A 5KMGB 4CS3A 2YEVA 5LGUA 2PYJA 4WBNA 3JAWB 4YJ2B 1KC8W 1PPJH 4YHHB 1N36O 3CC4V 4O2AB 3W7TA 1IX9A 2MK3A 5EC2C 4J9ZB 3AG2B 3SYCA 2XNDG 5LXTB 1SF9A 3ML0A 2DYSC 1AJPA 2HHHO 4E2LA 2P06A 3BEHA 3W7SA 3L73H 5H6RA 2ZE8A 3Q4HB 4UCSA 3RBZA 1Y76B 2HFEC 3RFRA 2CTPA 1LR1A 1WPBA 3ABTA 4X1KA 4JYYA 4I9QA 3K06A 3D36A 1S72V 1P84F 3B77A 3OT7A 3ZCCA 1HR0B 2QTOA 3QTCA 2UXDO 1HNWO 1AROP 3ABMB 3AG3C 4LR3A 4GUNA 5KLVH 1EN4A 4JI7B 1ZL8A 1Q8IA 4IYIA 4DV4B 5IYDO 1NQTA 5IJ0A 4IIJA 2PF4E 3QO8A 2YDEA 5KA5A 1F4NA 3CJHA 4MTXA 1JCHA 3M99B 5CA3A 4WF9V 4I0XA 1BGYH 2PYLA 5HFLA 2UXCO 1OHHG 2FTKA 4JI5O 1YF2A 3OR6C 1QVGU 1YHQV 4X20B 4MTFA 2KG7B 4I4TA 2Q5ZA 4FLUA 4YHHO 4DYLA 2EIJC 5JQGB 4DR4B 3WG7B 3X2QB 1THZA 4PA3A 1HNXB 3STLC 1BL8A 2P67A 3E83A 3QO7A 1K73W 3B8NA 1AP6A 4DV7B 2LO1A 3WB0A 3JCUZ 1H38A 3IC9A 1JVMA 3AG1C 5LYJA 4DUZB 2HJFC 2Q4PA 4J7JA 3TK1A 4HBNA 1WLEA 2Q0AA 1TUBB 3RYHA 3OUFA 3JAKB 1SZXA 1KMIZ 1OV9A 4X62B 2DMXA 1SQBH 1HR0O 3ZRXA 1GM9A 2OIGA 4FFKA 3THOA 4RWUA 4JI7O 1FS0G 3BPZA 3E2EA 3K08A 3BA8A 3MAQA 2LP7A 4DV4O 1NU1H 4BW9A 2EINB 2CH7A 1BSMA 1WB7A 4WFEA 1FFXB 1G6UA 2EIKB 4UVCA 2YIAA 2ZINA 1S5LZ 1SQGA 2JJ1G 5H2FZ 4UFZA 1M1KW 4B3TB 4NKGB 2KKWA 1GO3F 4K35A 5F2VO 1K5QA 4PI2A 1IZ3A 2VQFO 4FLVA 4JI6B 3OFNG 2GTSA 3P3PA 3ZHUA 4DR4O 4DR3B 2BTQB 3HR0A 3CXCU 1CXZB 1OCOB 1TA8A 1HNXO 3CB2A 4DR2B 1YTFB 1SRYA 1J5EB 2CDYA 4DV5O 4DV7O 1NJIW 3D3QA 1M56C 4GCZA 4I5SA 2QDOA 4MS2A 2IH1C 3OGIB 4ZI7A 2A79B 5LHIA 5KA6A 4UCTA 1NKDA 2OYQA 4DV0B 3LSUA 4JTAB 4X62O 4F6RA 4XDKA 5D5QA 1WA8B 2W6IG 3B2EE 5H6QA 3E8GA 4LFAB 3L74H 5KX5A 3CCQV 3K3WA 4FM2A 1ZX3A 4XBFA 1AI6A 1ZL8B 3E22B 1VQ8V 4AQYB 4B3MB 4W4LA 4G2KA 3FD9A 1ZTEA 2HVJC 1US6A 3E8FA 3S3WA 2Y4UA 4CBCA 1JFFA 2YIDA 4UXNA 3CJHB 3JD1A 2R9RB 3ETDA 3K5OA 2RNBA 4I0XB 1SQXH 3E89A 1VQ4V 4QPKA 1ZWIC 3KCYA 4UVAA 2UUAB 3TGUH 4B3TO 1LNQA 3JD3A 3AG2C 2Q8VA 4I4TB 5FL7G 3CRMA 1IVSA 1VQKV 1QU7A 1BHAA 5IT9N 2JVDA 1K4DC 4JI6O 1XHXA 2GHYA 4F6EA 2YXHA 3RVZA 4DR3O 3OR7C 4J80A 4TT3G 1PM9A 1MOFA 4JI3B 3ETEA 3H1KH 4DR2O 2DW4A 4YXWG 1J5EO 1ZAUA 4WFGA 5LP6A 3MDSA 5LYJB 2YIBD 3N2KA 1LUVA 4RUEA 1RM1B 4MTOA 2YC0A 3ABMC 5EBWC 2ZNJA 1YCIA 3ZIAG 3RYHB 3B8MA 1R3LC 2VQEB 2R72A 1WPXA 4DV0O 1N0NA 3OUSA 3DTUB 4H13B 2ODMA 3PJSK 1MA1A 2YIBA 1K4CC 3L9DA 3TJTA 1N4CA 4LFAO 1PKXA 1TAEA 3RYCB 1NH2B 5B3SB 2DQ0A 4O2BA 1BHBA 3BA9A 4AQYO 3TXQA 4JYCA 1VF5B 1H2KA 3KKYA 2XHBA 4DRXB 1JMKC 1BE3H 5L3DA 4NTXA 1XMQB 1XNRB 2W6JG 1Y66A 4UB6Z 1VIBA 2R70A 2UUAO 5IYZB 2CTWA 4AI8A 3OEHG 1NVPD 2QKAA 4FZ1A 3WG7C 5DM6V 4MTGA 2OCCB 3CP1A 3J81N 4QIWF 1L1FA 1B06A 4TV9A 1X59A 2N74A 2DYRC 4ZOLA 3JATA 2V1DA 2WAMA 3ASOB 4JI3O 1XQ8A 4O4HA 2FL4A 4CC5A 3VQVA 1VF6C 1JQ0A 1WP7A 3F7YC 1S0VA 1BT8A 4I9WA 5K1PA 4MW8A 1K7DA 4F6RB 5KAIZ 4BW5A 5JCOC 5KHIA 1F51A 2QKSA 3LDCA 2VS0A 1RSOA 3DSQA 3AK1A 5EZYB 3K0DA 3SJCC 1PL4A 2WLIA 4CH5A 3T4ZA 2EINC 4AHCA 4JYBA 3BVOA 1PD3A 2F95B 4CH3A 2EIKC 1GMGA 2EBOA 3IGAC 4NR1A 4UUJC 2IM9A 5B1OA 4DO2A 1D5NA 2Q7HA 4LH7A 5L3FA 2YUAA 4BIUA 2G38A 1H2NA 4JAVA 4TQFA 2H94A 5KHJA 1XMQO 1GK9A 2RJZA 1XNRO 2QE7G 5FPRA 1X4TA 1HW7A 2YSUB 1Y74A 2A7WA 3ZN0A 3UCSC 1OCOC 1ZLZA 2P5OA 1XL6A 2LGQA 4LF9O 2QGNA 4X1YA 1N33B 4K8XA 1IURA 3ETQA 4X64B 3U10A 3MHSC 1H2GA 3JARA 1Q82W 1OJHA 1TUEB 1URFA 1H2SB 3D36C 3CRAA 3K03A 1H2MA 3LNNA 5HFMA 3CHXA 3CSXA 3RVYA 1WJZA 3SPHA 3SYOA 2KSDA 5JJNB 4DW1A 5FLXN 2X6AA 2ILMA 2RQ6A 4ABMA 5EIBC 4J9YB 1KKCA 3JASA 4JI2B 2QM4A 1H2LA 4A5UB 3CMEV 5IJ9A 3WU2Z 5LMUB 1CPYA 2E5LB 2IH3C 3HKDB 4XDJA 3K04A 2M6YA 4O4LA 5IY5B 2DWEC 2Q68A 1QNMA 2C2AA 3FAVA 2DJVA 2H8PC 5L3EA 4QE7A 4GLXA 4KHPO 3APQA 3ZHTA 3R66A 5H9CA 3HKBA 2ZE7A 2XUMA 1SQPH 2W0FC 1N33O 1AI5A 4X64O 4ZOLB 1Q5OA 2X7RB 3JATB 1V55C 1YIJV 4PHZA 3U0ZA 3BABA 2Z5UA 2E74B 1UFIA 2ZIOA 1GAXA 5LHHA 5CBFA 2B9ZA 3CRRA 3G6EV 5LGNA 1M9NA 1XBLA 3W7WA 3OEEG 4MVSA 5EK0A 3UM7A 1XDCA 2Y0PA 3I5DA 3M8AA 5B3SC 4GKJB 3L71H 2EX3A 4WCEV 1QQCA 1P49A 3RWRD 2WLIB 1J95A 1FPOA 4JI2O 2CE4A 1YITV 1XHZA 2A3QA 3GB7C 1GM8A 4FK5C 2D3OW 5LHGA 3ZRWA 2AZ0A 1SC5B 2L35A 2OTJV 1S77D 2IJJA 3IFXA 5L3CA 1FXHA 3HKEB 5LMUO 2QKCA 3CEIA 2E5LO 1SERA 1AILA 4P9PA 2LW1A 1FAFA 1Q86W 1DF4A 4LF5B 1KP2A 3HPLC 4I50B 2UU9B 3H9VA 2OCCC 4MVZA 3CCEV 4I55B 1VMGA 5JVDB 5J2TA 1Y74B 4W4KA 4JI1B 2JGDA 2LW7A 4CH6A 1K8AW 4JASA 3F7VC 3OM3B 5IE9A 3UQ8A 3ASOC 1F7YA 4X1YB 1PNMA 2CTRA 1W59A 3PN1A 1QLNA 3SJBC 1YI2V 3C3SA 3T1CA 3E35A 4PA9A 1AJNA 5B1AB 4MW3A 3JAMN 1DF5A 2WA4A 4LC1A 4TUYA 4CS2A 2DQ3A 1VQPV 2N05A 5GTIZ 1SKVA 2ZCEA 1WB8A 1VQNV 3SYQA 2Q9LA 2Y4TA 3JALA 5BMVA 3SJAC 3WB1A 2R9IA 5B5EZ 2QWQB 4GKJO 3LSQA 4RO2A 4LNUB 3A0HZ 1YXBA 5B1BB 2JEXA 4EFBA 1I0HA 3VQXA 4O4IA 1PL0A 5C8YB 4U3JA 1VQ9V 2ZE5A 1ZSPA 1Y67A 1FJGB 1NTKH 4QE9A 3I55V 4PA4A 4PJ0Z 4YIPA 3RW0A 4CC6A 3OAAG 5KUKA 1N34B 4D7TA 4KFMA 2CTQA 4H44B 1W0KG 2UU9O 5BR8B 3DGEA 2WLKA 2IBZH 2ZDIC 4X1IA 1DLBA 2JRIA 1BZKA 2IJHA 4JI1O 1SZTA 5EYPA 4FZ0A 3J80N 3K0GA 1K5SA 1JX9A 4ZKIA 3FB5C 4LWSA 1GN3A 3LDEA 3H1IH 4I7ZB 4X88A 1D2DA 3BAAA 4RQEA 4UCUA 2QWPB 1HNZB 1MNGA 2YEVB 2F4VB 4EB6A 1W2BU 3CD6V 4WBNB 4B3SB 3WFVA 1SQQH 4JTCB 3SYAA 4ZHQA 4IHJA 3L70H 2GUZA 4UV9A 1E1RG 3FB7C 3OMIB 4JAUA 4DUZO 2EJRA 1U96A 1NT2B 4ZIBA 1NBMG 4X1KB 2BOCC 4PDLA 1M90W 3ZRWB 1XEQA 3E8BA 5IY5C 1FJGO 2L6LA 2F43G 1G4YB 5CA0A 1V54C 1P7GA 2LFRA 1FXKC 4DR6B 1COWG 2HLDG 4X9QA 5CB4A 1N34O 3J7AU 2OT5A 3P30A 1EZJA 3GWOA 4PA7A 4RQFA 4U7NA 2WLNA 4LP8A 5BY1A 2OCHA 1Q3EA 3RYIA 5BR8O 1IBLB 5J2TB 5IJ0B 3CCUV 2HVKC 2Y48A 1JJOA 4IIJB 5E1AC 2JGDB 5LA6A 1SA0A 1BQZA 1RFYA 4YJ3A 3SDLA 5KHGA 2LGWA 4IT5A 4DK0A 3T2MA 5J2UA 3CRCA 3OGCC 3B09A 1WP8A 3LSSA 1MSDA 2WLLA 2Z0AA 4HYOA 4WFHA 3G6BA 1M4UA 4FJCC 3UT5A 4X89A 1I94B 2B1IA 2Q73A 4NYKA 3C90A 4K8ZA 2R9AA 2F4VO 1EN5A 1FFTB 4BIZA 3JD0A 4B3SO 3A8TA 1NR1A 3DC6A 2Q6AA 1K34A 4GX5A 1A32A 5BMVB 2QWOB 5KHHA 1QR9A 3QO5A 4TQDA 4OXSA 4RAIA 1QHTA 2P6JA 1SETA 1M93A 5JJJB 2CAZC 1AR1B 4NVPA 2H3OA 4NXMB 1PNKA 1R6TA 1EFRG 1RP3B 1MMMA 4U3JB 3ZJZA 3APOA 3ZMUA 2BE3A 2UUCB 2A0LA 4DV1B 4DR6O 3OTFA 1JJ2U 4YIOA 3HKCA 1UJWB 1G8MA 5ITZA 2PZSA 2JS5A 4B7KA 2BSKA 4J41A 4B3MO 3H1JH 4Z1MG 4B08A 3BCCH 2PI5A 4ASUG 2WLHA 5EYPB 1QLEB 2CH7B 5B1AC 2WLJA 3DXRA 1KECA 1FXVA 1AJQA 4KXRA 2LFSA 4FVMA 1I94O 3AG4B 4JAAA 4DR7B 4FFBA 3X2QC 2UXBB 5B66Z 1HDJA 2GV9A 4J42A 2XOKG 2CUGA 4P2ZA 5B1BC 2GUZB 4LH6A 3JYCA 3O9OA 2IW5A 3G67A 1Q6HA 1FKAO 4MVRA 1Z5WA 4NXMO 2ZE6A 5LGTA 4ZI7B 5L3BA 4J11A 2VQEO 2PTMA 2Q7EA 5CA0B 4K3AA 2UUCO 4JI4B 3ETGA 4OPAA 4DV1O 3ABKB 4OX9B 3ZRVA 3AEIA 5CB4B 5KMGA 3VQWA 1OCRB 1S5JA 4BAYA 5KX5B 1AB3A 3SPCA 4WFBV 4O2AA 5AG2A 3IC7A 1B6QA 3P32A 2WA3A 3LUTB 4PV1B 4PDRA 1NS1A 1JFFB 2EIJB 1B04A 2Z3YA 4JZGA 2JEUA 1IBKB 1N32B 2BCCH 3SPIA 5J2UB 3Q4HA 1TVKA 2YXLA 1Y76A 1JA8A 1Y6XA 2RMKB 3SPJA 2ZR3A 3FFQA 1P4RA 3UT5B 2ZQMA 3OW2U 2ZM6B 3CCMV 2XT9A 4FLXA 2K9PA 3G80A 1Z5VA 4DR7O 1K33A 4DW0A 4IGGA 2UXXA 2WWWA 1VQ5V 2ITDC 2F1MA 2UXBO 2IU3A 1I5YA 3FYEB 2DWDC 3QNEA 4PDVA 4LF4B 4PD4F 1V9PA 2FYUH 1D5AA 2Y69B 2NNUA 4JPRA 3JD2A 1K3EA 2DN9A 4NTYA 5JWPA 4CS4A 5LP6B 1XILA 3B4SA 5FNVA 2VWKA 3N2KB 2EZPA 1U97A 2W0XA 4JV5B 5E79Z 1OCZB 1XNQB 2E75B 2QSAA 3F5WC 5DECA 4JI4O 1K97A 4OX9O 3HKCB 1R3JC 4X20A 2KG7A 3RT3C 4X65B 2ADPA 5ITZB 3MHHC 3CMAV 3FX7A 2ZR2A 4O2BB 4FLYA 1IDSA 3BRCA 5JQGA 2VRZA 4R6ZA 2HHHB 2M7WA 3ZEDA 2ATKC 2ZNIA 1VQOV 2FKXA 4AILC 4ICGA 4GX0A 1S5HC 1IBKO 1N32O 2QJ1A 1R3KC 2ZXWB 4DV3B 4JI0B 1E1QG 2RCVA 3SYPA 1TUBA 3ZHSA 1QBZA 3K58A 3JAKA 2A9HA 2ZM6O 5DEDA 1K9MW 1G1XB 3SPGA 3K5NA 4IL6Z 2E3CA 1EZVH 2DE0X 4R7CA 4LF4O 4G27B 4TV9B 3T4DA 3ZBHA 3CC7V 3T1YB 1S3JA 1Q90D 4N23A 1B3QA 5JCOA 3EXAA 1KUQA 1RM1C 1R1BA 1NVPB 4GKKB 3H01A 1VP7A 2N04A 1P7BA 4QPJA 4O4HB 3S3XA 2HR3A 1H8EG 1AI4A 1S76D 4PELA 1XUQA 4H37A 1ROPA 4OGQB 1XNQO 1Q7YW 3ZRSA 1Q43A 2P4KA 4EEQA 4TWKA 3L72H 2F23A 1MZEA 4HNAA 1YTFD 3U11A 3ZHQA 1RSOB 2P7TC 3ZX6A 4X65O 1R6NA 3FB8C 4HZ3A 1QLEC 2XTAA 1YJWV 1QR8A 3QG5A 2BTQA 2EULA 2ITCC 1DTOA 4QGPA 5KUMA 4O4JA 1KQSU 3K79A 3ABLB 3AG4C 3BFRA 4RUFA 4LFBB 1TVKB 2EZOA 3RYFA 5K1XA 1E79G 2ZD9A 4DV3O 3OD4A 4JI0O 3ZMZA 2QWRB 3N2GA 2QTSA 3CCVV 1VARA 2P22C 5EIBD 4NXNB 1YDXA 2VWJA 5IYBO 3HB3B 5BZBA 1WA8A 3SJQC 1SQFA 4JYAB 1H8HG 1CP9A 1XI1A 4MVMA 4R50A 3CC2V 3TETA 3T1YO 1YJNV 3M7MX 1VEWA 3JARB 1NI8A 2V4DA 3FYIB 5DN6G 3E22A 3ASNB 2OIEA 1EBOA 4GKKO 3C3TA 5JJEB 2LJ2A 5FNVB 4FM0A 4H0LB 2X0LA 3ABKC 4NTWA 1VQLV 1OCRC 2QWNB 4DXWA 2JK5C 3UKMA 1Y4MA 4JF3A 5KAFZ 2AHYA 1VQ6V 1M57B 2EIMB 5JH7A 2NR5A 3CCRV 3SR2C 4DK1A 2HG5C 5KHKA 1WN7A 2X6BA 3JASB 2VQFB 5CBHA 2B5UA 3W7UA 2ZIMA 3A0RA 1BQ0A 5L3GA 4D7SA 2O57A 5GTHZ 1VQ7V 5IJ9B 4UB8Z 3UO3A 4P9OA 4PDMA 1GN6A 2JIZG 1VF7A 3T1HB 1SS3A 1PP9H 4DV5B 2OWOA 1MG1A 1YJ9V 2XAJA 1RPOA 4O4LB 4LFBO 2DYRB 2UXNA 4Z2WA 5CBGA 4LF5O 4E4EA 3FAVB 1NH2D 2FB5A 3D3IA 1UPGA 3CX5F 3K9SA 3ZHVA 4GZRB 3K5MA 4TV8A 4NXNO 2Y69C 3HKBB 3WB2A 4JYAO 5EBMC 1BCCH 5LP6C 3H1HH 3RYCA 1QCEA 1Z2GA 3O65A 3ZN1A 2RN9A 4MVOA 2XAQA 4U3FH 5GONA 2EILB 5BXZA 2XAHA 2ZKOA 2AGAA 4KL1A 2F93B 1OCZC 1HP8A 1YVWA 1KD1W 1MABG 2NLJC 3DC5A 4DRXA 2BTOA 2XAGA 4DV2B 3E86A 4QNHB 2CGNA 2GTAA 3BY6A 3KG2A 4LCUC 1NR7A 3OMNB 4L8JA 5EC1C 2HEPA 3TCUA 5IYZA 4HNAB 2KQXA 3EVKA 4G28B 4BR6A 2JJ2G 2YI9A 3IAYA 1WAZA 3VQYA 4TOIA 2ETNA 2P90A 2GSMB 1XREA 3CCSV 4BWAA 1F4MA 2ZXWC 4F4LA 3F5TA 2HP8A 4O4JB 3T1HO 2XASA 3W7XA 5LOVA 4OPHA 3RGBA 3RYFB 5LMNB 4HAMA 3L75H 5IDJA 3N2GB 3TXSA 2AHZA 1KU9A 2RDCA 2IU0A 3LDDA 2QEXV 5B1NA 3FKSG 2JGUA 4X66B 3H1LH 3KCXA 5EZYA 4JI8B 1GRJA 2JS3A 4GYCB 1R6KA 3G71V 2Y0IA 4FLZA 4U7OA 1OCCB 3NR7A 3B40A 3ZHRA 4TUYB 1HNZO 5IWAB 2NN4A 1FYJA 3VOUA 3CWBH 1ZUQA 1F23A 1XL4A 2QR4A 3JALB 1KB9F 4DV2O 1FD9A 2IJKA 1R73A 2AZ2A 1WNSA 3CS5A 5FPOA 3A2FA 4DV6B 2GDSA 5JH7B 5IYCO 1DK1A 2F66C 3R65A 5A9GA 1NTMH 4O4IB 1IBMB 2AW9A 1KBHA 2ZDIA 3SGIA 4R8CA 3ABLC 3IJ4A 4B7EA 4JZ2A 2PGGA 1MZFA 1NZ6A 1GKFA 4LF6B 2YICA 4J7ZA 1AI7A 4DR5B 4Z1VA 3ZMSA 2UUBB 1QVFU 2QM8A 1IXMA 5D5PA 2IJIA 2LQTA 2MW2B 3K5LA 2X6CA 1GM7A 5LMNO 1V55B 4WFFA 2AXTZ 4X1IB 4FIPC 4L87A 1IBLO 4UV8A 1EM1A 3ZMVA 3CRQA 3KZIZ 4TV8B 2ADQB 1RPRA 3ABUA 5LBQA 3N27A 3ASNC 3MD0A 1L0LH 4LBEC 3ZS8C 4X66O 3VBBA 4LFCB 4H33A 1I08A 2DYSB 2WPDG 4LWSB 4JI8O 3AK3A 4JGSA 5GONB 4X8AA 1YEWA 1T5EA 1NTZH 5IWAO 4EB6B 4LF7B 1ORQC 4PI0A 1KP3A 3AG7A 3HKDA 1M57C 2EIMC 3RN4A 4ZHQB 4K0KB 1FXKA 4IHJB 3AG3B 1R3IC 3OTOB 4DV6O 3E8HA 4CH4A 3EFFK 3LNMB 4FLWA 1N8RW 4Q20A 4J10A 1HWYA 1YSCA 3K9AA 2YXYA 1PV0A 4LF9B 1IBMO 1K92A 4N21A 3OE7G 5CA1A 4UCRA 4IYHA 3ZMTA 1XMOB 1TGOA 3GVMA 4MVQA 3JSNA 2YI8A 2DOSA 4EFEA 1VQMV 5LOVB 4ZBMA 4LF6O 4DR5O 1L8DA 4UCVA 3K59A 2UUBO 4WFAV 4B3RB 3JAWA 4YJ2A 4DR1B 2D2CB 1BS3A 4DUYB 3RYIB 4D6TH 4LF8B 2QA4V 5LXTA 2CGOA 1AR4A 3CE2A 4C7UA 5LL6Y 3CXHF 5LA6B 3K57A 1SA0B 4GT1A 1KKDA 2EILC 4YJ3B 2XAFA 2A06H 5CMUA 2B1GA 4LFCO 3BHPA 3QVNA 2Q69A 1PNLA 4J7KA 2KB1A 2WLLB 1CEZA 2PY5A 3STZC 5A2QN 2Q7GA 3AG1B 1GTOA 4KP4A 4LF7O 3HKEA 3QF7A 2ZT9B 4MVUA 4YY3B 1L0NH 2YS8A 3CYOA 1AVMA 3GWKC 3UO2A 4I50A 1I7FA 4PA6A 4FPPA 4I55A 4BIOA 4K0KO 2EJ7A 5JVDA 3OTOO 5EBLC 1I5XA 1Q81W 4KHPB 1O9GA 3G4SV 1GN4A 2QM7A 3ICXA 4MT8A 3AK2A 1YZBA 1Q6IA 4UCOA 5H5NA 1XMOO 1JR9A 4QJFB 2E76B 2WLMA 4EKWA 2V7QG 4GX1A 1BMFG 1M5IA 3CCJV 1N36B 1MSWD 3CPWU 1GN2A 3NXSA 4DR1O 4B3RO 1EN6A 2BSKB 1AP5A 2PUSA 2HKOA 2Q67A 4DUYO 5CN0A 1Q6UA 3JCZA 4LF8O 2JDIG 5TISZ 3OMAB 1OCCC 2GBOA 2CK3G 1AR5A 1IXBA 4LNUA 2P4VA 1LUWA 3DXRB 2FMLA 5J9PC 5C8YA 3P3NA 4P30A 4XDLA 4CZZA 3EHBB 1ENVA 3A0BZ 5C93A 1DGSA 2OTLV 2HJDA 2WSSG 4FFBB 2PI4A 2UXDB 1M56B 1HNWB 5GW7A 1VF6A 3JSLA 4MSWC 3I56V 1N0JA 3JD4A 1SESA 4UVBA 4YY3O 2BOBC 3FB6C 1JOYA 1SQVH 4FMTA 3CCLV 1V54B 1FXKB 4GX2A 4JTDB 1O9HA 1XOUA
chains in the Genus database with same CATH topology
1FFTB 1MG1A 4TSFG 2QKSA 1YJ9V 4BIZA 3LDCA 2XAJA 3JD0A 1JPXA 1RPOA 2DYRB 1NR1A 3K0DA 4KUMA 2UXNA 2WLIA 2Q6AA 5CBGA 1K34A 4GX5A 3T4ZA 2EINC 4JYBA 1NH2D 1PD3A 3D3IA 1QR9A 3QO5A 2EIKC 4OXSA 4RAIA 1GMGA 2EBOA 3IGAC 1W0JG 2K1EA 2P6JA 4UUJC 2Y69C 1OZ0A 1SETA 5B1OA 2YEVA 5LGUA 4DO2A 5L3FA 4BIUA 1AR1B 1KC8W 1PNKA 3ZJZA 1EFRG 3CC4V 5EBMC 4JAVA 3W7TA 3ZMUA 2H94A 2MK3A 5EC2C 1QCEA 4J9ZB 1GK9A 2QE7G 3AG2B 3ZN1A 3SYCA 2XNDG 4MVOA 2XAQA 2EILB 3ML0A 2XAHA 2DYSC 1AJPA 2A0LA 1OCZC 2YSUB 4E2LA 3ZN0A 1JJ2U 3BEHA 3W7SA 1KD1W 1OCOC 5H6RA 1MABG 2NLJC 3RBZA 1XL6A 1UJWB 1G8MA 2HFEC 2XAGA 3E86A 4QNHB 3ABTA 3BY6A 3KG2A 4LCUC 1NR7A 3OMNB 3MHSC 1H2GA 5EC1C 3K06A 3D36A 1S72V 3TCUA 1Q82W 4Z1MG 1TUEB 3B77A 3ZCCA 2PI5A 2QTOA 4G28B 2JJ2G 4ASUG 2WLHA 1AROP 3ABMB 1QLEB 3AG3C 3K03A 5B1AC 2WLJA 5HFMA 3RVYA 2P90A 1KECA 3SPHA 2GSMB 3SYOA 3CCSV 1FXVA 1AJQA 2LFSA 5IYDO 1F4MA 2X6AA 1NQTA 2ZXWC 3AG4B 4F4LA 2XASA 3QO8A 3W7XA 5KA5A 3X2QC 1F4NA 4J9YB 4MTXA 2XOKG 1JCHA 3M99B 5CA3A 4WF9V 4HAMA 3CMEV 4P2ZA 5IDJA 5HFLA 5B1BC 1OHHG 2AHZA 2FTKA 3JYCA 3OR6C 2IU0A 3LDDA 2IW5A 1QVGU 2QEXV 1YHQV 1CPYA 5B1NA 4MTFA 2IH3C 3FKSG 4MVRA 4XDJA 3K04A 5IY5B 2DWEC 5LGTA 2EIJC 5L3BA 1R6KA 2Q68A 3G71V 2C2AA 3WG7B 4U7OA 1OCCB 3X2QB 2H8PC 1THZA 5L3EA 4QE7A 4PA3A 3STLC 1BL8A 2P67A 3E83A 3QO7A 3ETGA 1K73W 3B8NA 3ABKB 3ZRVA 3AEIA 1OCRB 1H38A 5H9CA 3VOUA 4BAYA 1JVMA 3AG1C 1F23A 2HJFC 3SPCA 3TK1A 4WFBV 1XL4A 2W0FC 1WLEA 2IJKA 1AI5A 1R73A 3IC7A 1B6QA 3OUFA 3P32A 2X7RB 3LUTB 1V55C 1YIJV 5IYCO 4PDRA 3ZRXA 1GM9A 2Z5UA 2EIJB 2Z3YA 3R65A 5LHHA 2JEUA 5CBFA 3SPIA 3G6EV 5LGNA 1M9NA 2ZDIA 3W7WA 1FS0G 3OEEG 4R8CA 3SPJA 4MVSA 3ABLC 3E2EA 2ZR3A 3K08A 1P4RA 5EK0A 3UM7A 2LP7A 2ZQMA 3OW2U 3CCMV 5B3SC 1GKFA 1K33A 2UXXA 2WWWA 4WCEV 1AI7A 2ITDC 1VQ5V 2EINB 2IU3A 3ZMSA 4WFEA 1I5YA 3FYEB 2DWDC 3QNEA 4PDVA 1QVFU 2QM8A 1IXMA 2IJIA 2EIKB 2X6CA 1J95A 2WLIB 4UVCA 1GM7A 1V55B 1YITV 4WFFA 3GB7C 2Y69B 1GM8A 4FK5C 2NNUA 5LHGA 2D3OW 4FIPC 4JPRA 3ZRWA 4L87A 2JJ1G 3JD2A 1M1KW 4UV8A 1K3EA 3ZMVA 2OTJV 1S77D 1RPRA 2IJJA 3ABUA 3IFXA 5LBQA 5L3CA 1FXHA 1GO3F 3ASNC 1SERA 3MD0A 4LBEC 2EZPA 1K5QA 4P9PA 3VBBA 1Q86W 3OFNG 4H33A 1DF4A 2DYSB 2WPDG 1KP2A 3HPLC 4JGSA 1OCZB 2OCCC 4MVZA 3CCEV 4X8AA 3CXCU 1OCOB 3F5WC 1YTFB 1SRYA 1K97A 1ORQC 1K8AW 4JASA 1R3JC 3F7VC 3OM3B 1KP3A 1M57C 3ASOC 1NJIW 2EIMC 3MHHC 3CMAV 2ZR2A 1M56C 1PNMA 4GCZA 4I5SA 4MS2A 2IH1C 1QLNA 1YI2V 2A79B 5LHIA 3T1CA 3E35A 5KA6A 1FXKA 4PA9A 4R6ZA 1AJNA 1R3IC 1NKDA 3AG3B 5B1AB 4MW3A 2M7WA 3E8HA 1DF5A 2ATKC 4JTAB 4LC1A 3EFFK 3LNMB 4XDKA 1VQOV 2W6IG 1N8RW 4Q20A 5H6QA 1HWYA 2DQ3A 1YSCA 1VQPV 3K9AA 4GX0A 1S5HC 3E8GA 1R3KC 3CCQV 3K3WA 1K92A 4XBFA 1AI6A 4N21A 2ZXWB 3OE7G 1VQNV 3SYQA 3ZMTA 1E1QG 4MVQA 1VQ8V 3SYPA 1QBZA 4G2KA 2R9IA 2A9HA 1VQMV 1K9MW 2HVJC 3SPGA 4ZBMA 3E8FA 3LSQA 4RO2A 4CBCA 4UXNA 3JD1A 5B1BB 2R9RB 2JEXA 4WFAV 3ETDA 4R7CA 4G27B 3T4DA 1PL0A 3CC7V 1S3JA 4N23A 3E89A 1VQ4V 1VQ9V 4QPKA 1ZWIC 4UVAA 2QA4V 1RM1C 1NVPB 4QE9A 3I55V 4PA4A 3RW0A 1LNQA 3H01A 1P7BA 3JD3A 3AG2C 3OAAG 4QPJA 5FL7G 4GT1A 2HR3A 5KUKA 1KKDA 1VQKV 2EILC 2XAFA 4KFMA 1H8EG 1BHAA 1AI4A 1S76D 5CMUA 2B1GA 1K4DC 1W0KG 4PELA 2Q69A 4H37A 1PNLA 2GHYA 1ROPA 2KB1A 2WLLB 1CEZA 3DGEA 3STZC 3RVZA 2WLKA 1Q7YW 2ZDIC 3OR7C 4TT3G 1DLBA 1MOFA 3ZRSA 3ETEA 4TWKA 2IJHA 3AG1B 2DW4A 1GTOA 4YXWG 1YTFD 4WFGA 1SZTA 4KP4A 2P7TC 4MVUA 1R6NA 3FB8C 4RUEA 3K0GA 1K5SA 1RM1B 1JX9A 4ZKIA 4MTOA 3CYOA 4HZ3A 3FB5C 3ABMC 5EBWC 1QLEC 3ZIAG 3LDEA 1YJWV 4PA6A 3B8MA 1R3LC 1QR8A 4FPPA 4X88A 4RQEA 1WPXA 2ITCC 1I5XA 5EBLC 1Q81W 3OUSA 3DTUB 1DTOA 2YEVB 3G4SV 5KUMA 3PJSK 1W2BU 3CD6V 1KQSU 3K79A 2QM7A 1K4CC 3ABLB 3AG4C 4MT8A 4RUFA 3WFVA 2EZOA 1PKXA 4JTCB 1E79G 2ZD9A 1NH2B 5B3SB 2DQ0A 3ZMZA 1BHBA 3SYAA 4QJFB 4JYCA 3CCVV 4UV9A 5IYBO 3HB3B 2WLMA 4EKWA 5BZBA 2V7QG 1E1RG 4GX1A 3SJQC 1BMFG 1H8HG 3CCJV 3FB7C 3OMIB 1CP9A 3CPWU 4JAUA 1MSWD 2EJRA 3NXSA 4MVMA 4R50A 5L3DA 3CC2V 3TETA 1YJNV 1NBMG 2HKOA 2Q67A 2BOCC 5CN0A 2W6JG 1Y66A 4PDLA 3FYIB 3ZRWB 1M90W 5DN6G 3ASNB 3JCZA 3E8BA 5IY5C 1EBOA 2F43G 2JDIG 3OEHG 1G4YB 1V54C 1NVPD 2LFRA 1FXKC 3WG7C 3OMAB 1COWG 1OCCC 2HLDG 4MTGA 5DM6V 2CK3G 2OCCB 2OT5A 3CP1A 3P30A 4QIWF 1L1FA 1EZJA 2X0LA 3GWOA 3ABKC 5J9PC 4PA7A 4RQFA 4U7NA 2WLNA 1VQLV 4LP8A 1OCRC 4P30A 4XDLA 4DXWA 2JK5C 3UKMA 4CZZA 1Y4MA 2DYRC 3EHBB 4JF3A 1ENVA 5C93A 3CCUV 2HVKC 2AHYA 2Y48A 2OTLV 1VQ6V 2V1DA 1M57B 2WAMA 2WSSG 3ASOB 5E1AC 2EIMB 2PI4A 1M56B 5GW7A 3CCRV 4MSWC 3I56V 3JD4A 1SESA 2HG5C 4UVBA 2X6BA 2BOBC 3T2MA 3FB6C 5CBHA 2B5UA 1JQ0A 3W7UA 1JOYA 3OGCC 4FMTA 1V54B 3CCLV 3A0RA 3F7YC 1FXKB 3LSSA 2WLLA 4HYOA 4WFHA 1S0VA 4I9WA 5L3GA 4GX2A 4FJCC 1VQ7V 4X89A 4MW8A 1K7DA 4P9OA 2B1IA 4BW5A 4JTDB 4PDMA 2JIZG 1F51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL V;  1VQ6 V;  3CCE V;  1VQK V;  1YJ9 V;  3G6E V;  1KC8 W;  3CC4 V;  1YIT V;  1QVG U;  2QEX V;  3CXC U;  3CCR V;  1YHQ V;  1K9M W;  1VQO V;  3I56 V;  1N8R W;  1S72 V;  3CCV V;  1YJW V;  2D3O W;  5DM6 V;  4WFA V;  1Q82 W;  4WFB V;  1VQP V;  1M1K W;  2OTJ V;  3CC7 V;  1K8A W;  3CCQ V;  1Q81 W;  1R73 A;  1Q7Y W;  1VQ4 V;  3OW2 U;  1VQ9 V;  3CCM V;  3CCL V;  3G4S V;  1NJI W;  1QVF U;  3CMA V;  1VQN V;  3CCJ V;  2QA4 V;  3G71 V;  4WF9 V;  1VQL V;  1W2B U;  1JJ2 U;  3CPW U;  1KQS U;  1YIJ V;  1VQ8 V;  3CD6 V;  1VQ7 V;  4WCE V;  3I55 V;  3CME V;  1KD1 W;  1VQ5 V;  3CC2 V;  1YJN V;  1YI2 V;  1Q86 W;  1VQM V;  3CCU V;  3CCS V;  1M90 W;  1K73 W; 
#chains in the Genus database with same CATH topology
 3D8C A;  4TSF G;  2Q0O C;  1GH6 A;  4FLT A;  1JPX A;  4KUM A;  4NB5 A;  5CA1 B;  1FFX A;  4JV5 O;  2UXC B;  4JI5 B;  1KYO F;  1W0J G;  2K1E A;  4Q6G A;  4FM1 A;  2ARH A;  1OZ0 A;  5KMG B;  4CS3 A;  2YEV A;  5LGU A;  2PYJ A;  4WBN A;  3JAW B;  4YJ2 B;  1KC8 W;  1PPJ H;  4YHH B;  1N36 O;  3CC4 V;  4O2A B;  3W7T A;  1IX9 A;  2MK3 A;  5EC2 C;  4J9Z B;  3AG2 B;  3SYC A;  2XND G;  5LXT B;  1SF9 A;  3ML0 A;  2DYS C;  1AJP A;  2HHH O;  4E2L A;  2P06 A;  3BEH A;  3W7S A;  3L73 H;  5H6R A;  2ZE8 A;  3Q4H B;  4UCS A;  3RBZ A;  1Y76 B;  2HFE C;  3RFR A;  2CTP A;  1LR1 A;  1WPB A;  3ABT A;  4X1K A;  4JYY A;  4I9Q A;  3K06 A;  3D36 A;  1S72 V;  1P84 F;  3B77 A;  3OT7 A;  3ZCC A;  1HR0 B;  2QTO A;  3QTC A;  2UXD O;  1HNW O;  1ARO P;  3ABM B;  3AG3 C;  4LR3 A;  4GUN A;  5KLV H;  1EN4 A;  4JI7 B;  1ZL8 A;  1Q8I A;  4IYI A;  4DV4 B;  5IYD O;  1NQT A;  5IJ0 A;  4IIJ A;  2PF4 E;  3QO8 A;  2YDE A;  5KA5 A;  1F4N A;  3CJH A;  4MTX A;  1JCH A;  3M99 B;  5CA3 A;  4WF9 V;  4I0X A;  1BGY H;  2PYL A;  5HFL A;  2UXC O;  1OHH G;  2FTK A;  4JI5 O;  1YF2 A;  3OR6 C;  1QVG U;  1YHQ V;  4X20 B;  4MTF A;  2KG7 B;  4I4T A;  2Q5Z A;  4FLU A;  4YHH O;  4DYL A;  2EIJ C;  5JQG B;  4DR4 B;  3WG7 B;  3X2Q B;  1THZ A;  4PA3 A;  1HNX B;  3STL C;  1BL8 A;  2P67 A;  3E83 A;  3QO7 A;  1K73 W;  3B8N A;  1AP6 A;  4DV7 B;  2LO1 A;  3WB0 A;  3JCU Z;  1H38 A;  3IC9 A;  1JVM A;  3AG1 C;  5LYJ A;  4DUZ B;  2HJF C;  2Q4P A;  4J7J A;  3TK1 A;  4HBN A;  1WLE A;  2Q0A A;  1TUB B;  3RYH A;  3OUF A;  3JAK B;  1SZX A;  1KMI Z;  1OV9 A;  4X62 B;  2DMX A;  1SQB H;  1HR0 O;  3ZRX A;  1GM9 A;  2OIG A;  4FFK A;  3THO A;  4RWU A;  4JI7 O;  1FS0 G;  3BPZ A;  3E2E A;  3K08 A;  3BA8 A;  3MAQ A;  2LP7 A;  4DV4 O;  1NU1 H;  4BW9 A;  2EIN B;  2CH7 A;  1BSM A;  1WB7 A;  4WFE A;  1FFX B;  1G6U A;  2EIK B;  4UVC A;  2YIA A;  2ZIN A;  1S5L Z;  1SQG A;  2JJ1 G;  5H2F Z;  4UFZ A;  1M1K W;  4B3T B;  4NKG B;  2KKW A;  1GO3 F;  4K35 A;  5F2V O;  1K5Q A;  4PI2 A;  1IZ3 A;  2VQF O;  4FLV A;  4JI6 B;  3OFN G;  2GTS A;  3P3P A;  3ZHU A;  4DR4 O;  4DR3 B;  2BTQ B;  3HR0 A;  3CXC U;  1CXZ B;  1OCO B;  1TA8 A;  1HNX O;  3CB2 A;  4DR2 B;  1YTF B;  1SRY A;  1J5E B;  2CDY A;  4DV5 O;  4DV7 O;  1NJI W;  3D3Q A;  1M56 C;  4GCZ A;  4I5S A;  2QDO A;  4MS2 A;  2IH1 C;  3OGI B;  4ZI7 A;  2A79 B;  5LHI A;  5KA6 A;  4UCT A;  1NKD A;  2OYQ A;  4DV0 B;  3LSU A;  4JTA B;  4X62 O;  4F6R A;  4XDK A;  5D5Q A;  1WA8 B;  2W6I G;  3B2E E;  5H6Q A;  3E8G A;  4LFA B;  3L74 H;  5KX5 A;  3CCQ V;  3K3W A;  4FM2 A;  1ZX3 A;  4XBF A;  1AI6 A;  1ZL8 B;  3E22 B;  1VQ8 V;  4AQY B;  4B3M B;  4W4L A;  4G2K A;  3FD9 A;  1ZTE A;  2HVJ C;  1US6 A;  3E8F A;  3S3W A;  2Y4U A;  4CBC A;  1JFF A;  2YID A;  4UXN A;  3CJH B;  3JD1 A;  2R9R B;  3ETD A;  3K5O A;  2RNB A;  4I0X B;  1SQX H;  3E89 A;  1VQ4 V;  4QPK A;  1ZWI C;  3KCY A;  4UVA A;  2UUA B;  3TGU H;  4B3T O;  1LNQ A;  3JD3 A;  3AG2 C;  2Q8V A;  4I4T B;  5FL7 G;  3CRM A;  1IVS A;  1VQK V;  1QU7 A;  1BHA A;  5IT9 N;  2JVD A;  1K4D C;  4JI6 O;  1XHX A;  2GHY A;  4F6E A;  2YXH A;  3RVZ A;  4DR3 O;  3OR7 C;  4J80 A;  4TT3 G;  1PM9 A;  1MOF A;  4JI3 B;  3ETE A;  3H1K H;  4DR2 O;  2DW4 A;  4YXW G;  1J5E O;  1ZAU A;  4WFG A;  5LP6 A;  3MDS A;  5LYJ B;  2YIB D;  3N2K A;  1LUV A;  4RUE A;  1RM1 B;  4MTO A;  2YC0 A;  3ABM C;  5EBW C;  2ZNJ A;  1YCI A;  3ZIA G;  3RYH B;  3B8M A;  1R3L C;  2VQE B;  2R72 A;  1WPX A;  4DV0 O;  1N0N A;  3OUS A;  3DTU B;  4H13 B;  2ODM A;  3PJS K;  1MA1 A;  2YIB A;  1K4C C;  3L9D A;  3TJT A;  1N4C A;  4LFA O;  1PKX A;  1TAE A;  3RYC B;  1NH2 B;  5B3S B;  2DQ0 A;  4O2B A;  1BHB A;  3BA9 A;  4AQY O;  3TXQ A;  4JYC A;  1VF5 B;  1H2K A;  3KKY A;  2XHB A;  4DRX B;  1JMK C;  1BE3 H;  5L3D A;  4NTX A;  1XMQ B;  1XNR B;  2W6J G;  1Y66 A;  4UB6 Z;  1VIB A;  2R70 A;  2UUA O;  5IYZ B;  2CTW A;  4AI8 A;  3OEH G;  1NVP D;  2QKA A;  4FZ1 A;  3WG7 C;  5DM6 V;  4MTG A;  2OCC B;  3CP1 A;  3J81 N;  4QIW F;  1L1F A;  1B06 A;  4TV9 A;  1X59 A;  2N74 A;  2DYR C;  4ZOL A;  3JAT A;  2V1D A;  2WAM A;  3ASO B;  4JI3 O;  1XQ8 A;  4O4H A;  2FL4 A;  4CC5 A;  3VQV A;  1VF6 C;  1JQ0 A;  1WP7 A;  3F7Y C;  1S0V A;  1BT8 A;  4I9W A;  5K1P A;  4MW8 A;  1K7D A;  4F6R B;  5KAI Z;  4BW5 A;  5JCO C;  5KHI A;  1F51 A;  2QKS A;  3LDC A;  2VS0 A;  1RSO A;  3DSQ A;  3AK1 A;  5EZY B;  3K0D A;  3SJC C;  1PL4 A;  2WLI A;  4CH5 A;  3T4Z A;  2EIN C;  4AHC A;  4JYB A;  3BVO A;  1PD3 A;  2F95 B;  4CH3 A;  2EIK C;  1GMG A;  2EBO A;  3IGA C;  4NR1 A;  4UUJ C;  2IM9 A;  5B1O A;  4DO2 A;  1D5N A;  2Q7H A;  4LH7 A;  5L3F A;  2YUA A;  4BIU A;  2G38 A;  1H2N A;  4JAV A;  4TQF A;  2H94 A;  5KHJ A;  1XMQ O;  1GK9 A;  2RJZ A;  1XNR O;  2QE7 G;  5FPR A;  1X4T A;  1HW7 A;  2YSU B;  1Y74 A;  2A7W A;  3ZN0 A;  3UCS C;  1OCO C;  1ZLZ A;  2P5O A;  1XL6 A;  2LGQ A;  4LF9 O;  2QGN A;  4X1Y A;  1N33 B;  4K8X A;  1IUR A;  3ETQ A;  4X64 B;  3U10 A;  3MHS C;  1H2G A;  3JAR A;  1Q82 W;  1OJH A;  1TUE B;  1URF A;  1H2S B;  3D36 C;  3CRA A;  3K03 A;  1H2M A;  3LNN A;  5HFM A;  3CHX A;  3CSX A;  3RVY A;  1WJZ A;  3SPH A;  3SYO A;  2KSD A;  5JJN B;  4DW1 A;  5FLX N;  2X6A A;  2ILM A;  2RQ6 A;  4ABM A;  5EIB C;  4J9Y B;  1KKC A;  3JAS A;  4JI2 B;  2QM4 A;  1H2L A;  4A5U B;  3CME V;  5IJ9 A;  3WU2 Z;  5LMU B;  1CPY A;  2E5L B;  2IH3 C;  3HKD B;  4XDJ A;  3K04 A;  2M6Y A;  4O4L A;  5IY5 B;  2DWE C;  2Q68 A;  1QNM A;  2C2A A;  3FAV A;  2DJV A;  2H8P C;  5L3E A;  4QE7 A;  4GLX A;  4KHP O;  3APQ A;  3ZHT A;  3R66 A;  5H9C A;  3HKB A;  2ZE7 A;  2XUM A;  1SQP H;  2W0F C;  1N33 O;  1AI5 A;  4X64 O;  4ZOL B;  1Q5O A;  2X7R B;  3JAT B;  1V55 C;  1YIJ V;  4PHZ A;  3U0Z A;  3BAB A;  2Z5U A;  2E74 B;  1UFI A;  2ZIO A;  1GAX A;  5LHH A;  5CBF A;  2B9Z A;  3CRR A;  3G6E V;  5LGN A;  1M9N A;  1XBL A;  3W7W A;  3OEE G;  4MVS A;  5EK0 A;  3UM7 A;  1XDC A;  2Y0P A;  3I5D A;  3M8A A;  5B3S C;  4GKJ B;  3L71 H;  2EX3 A;  4WCE V;  1QQC A;  1P49 A;  3RWR D;  2WLI B;  1J95 A;  1FPO A;  4JI2 O;  2CE4 A;  1YIT V;  1XHZ A;  2A3Q A;  3GB7 C;  1GM8 A;  4FK5 C;  2D3O W;  5LHG A;  3ZRW A;  2AZ0 A;  1SC5 B;  2L35 A;  2OTJ V;  1S77 D;  2IJJ A;  3IFX A;  5L3C A;  1FXH A;  3HKE B;  5LMU O;  2QKC A;  3CEI A;  2E5L O;  1SER A;  1AIL A;  4P9P A;  2LW1 A;  1FAF A;  1Q86 W;  1DF4 A;  4LF5 B;  1KP2 A;  3HPL C;  4I50 B;  2UU9 B;  3H9V A;  2OCC C;  4MVZ A;  3CCE V;  4I55 B;  1VMG A;  5JVD B;  5J2T A;  1Y74 B;  4W4K A;  4JI1 B;  2JGD A;  2LW7 A;  4CH6 A;  1K8A W;  4JAS A;  3F7V C;  3OM3 B;  5IE9 A;  3UQ8 A;  3ASO C;  1F7Y A;  4X1Y B;  1PNM A;  2CTR A;  1W59 A;  3PN1 A;  1QLN A;  3SJB C;  1YI2 V;  3C3S A;  3T1C A;  3E35 A;  4PA9 A;  1AJN A;  5B1A B;  4MW3 A;  3JAM N;  1DF5 A;  2WA4 A;  4LC1 A;  4TUY A;  4CS2 A;  2DQ3 A;  1VQP V;  2N05 A;  5GTI Z;  1SKV A;  2ZCE A;  1WB8 A;  1VQN V;  3SYQ A;  2Q9L A;  2Y4T A;  3JAL A;  5BMV A;  3SJA C;  3WB1 A;  2R9I A;  5B5E Z;  2QWQ B;  4GKJ O;  3LSQ A;  4RO2 A;  4LNU B;  3A0H Z;  1YXB A;  5B1B B;  2JEX A;  4EFB A;  1I0H A;  3VQX A;  4O4I A;  1PL0 A;  5C8Y B;  4U3J A;  1VQ9 V;  2ZE5 A;  1ZSP A;  1Y67 A;  1FJG B;  1NTK H;  4QE9 A;  3I55 V;  4PA4 A;  4PJ0 Z;  4YIP A;  3RW0 A;  4CC6 A;  3OAA G;  5KUK A;  1N34 B;  4D7T A;  4KFM A;  2CTQ A;  4H44 B;  1W0K G;  2UU9 O;  5BR8 B;  3DGE A;  2WLK A;  2IBZ H;  2ZDI C;  4X1I A;  1DLB A;  2JRI A;  1BZK A;  2IJH A;  4JI1 O;  1SZT A;  5EYP A;  4FZ0 A;  3J80 N;  3K0G A;  1K5S A;  1JX9 A;  4ZKI A;  3FB5 C;  4LWS A;  1GN3 A;  3LDE A;  3H1I H;  4I7Z B;  4X88 A;  1D2D A;  3BAA A;  4RQE A;  4UCU A;  2QWP B;  1HNZ B;  1MNG A;  2YEV B;  2F4V B;  4EB6 A;  1W2B U;  3CD6 V;  4WBN B;  4B3S B;  3WFV A;  1SQQ H;  4JTC B;  3SYA A;  4ZHQ A;  4IHJ A;  3L70 H;  2GUZ A;  4UV9 A;  1E1R G;  3FB7 C;  3OMI B;  4JAU A;  4DUZ O;  2EJR A;  1U96 A;  1NT2 B;  4ZIB A;  1NBM G;  4X1K B;  2BOC C;  4PDL A;  1M90 W;  3ZRW B;  1XEQ A;  3E8B A;  5IY5 C;  1FJG O;  2L6L A;  2F43 G;  1G4Y B;  5CA0 A;  1V54 C;  1P7G A;  2LFR A;  1FXK C;  4DR6 B;  1COW G;  2HLD G;  4X9Q A;  5CB4 A;  1N34 O;  3J7A U;  2OT5 A;  3P30 A;  1EZJ A;  3GWO A;  4PA7 A;  4RQF A;  4U7N A;  2WLN A;  4LP8 A;  5BY1 A;  2OCH A;  1Q3E A;  3RYI A;  5BR8 O;  1IBL B;  5J2T B;  5IJ0 B;  3CCU V;  2HVK C;  2Y48 A;  1JJO A;  4IIJ B;  5E1A C;  2JGD B;  5LA6 A;  1SA0 A;  1BQZ A;  1RFY A;  4YJ3 A;  3SDL A;  5KHG A;  2LGW A;  4IT5 A;  4DK0 A;  3T2M A;  5J2U A;  3CRC A;  3OGC C;  3B09 A;  1WP8 A;  3LSS A;  1MSD A;  2WLL A;  2Z0A A;  4HYO A;  4WFH A;  3G6B A;  1M4U A;  4FJC C;  3UT5 A;  4X89 A;  1I94 B;  2B1I A;  2Q73 A;  4NYK A;  3C90 A;  4K8Z A;  2R9A A;  2F4V O;  1EN5 A;  1FFT B;  4BIZ A;  3JD0 A;  4B3S O;  3A8T A;  1NR1 A;  3DC6 A;  2Q6A A;  1K34 A;  4GX5 A;  1A32 A;  5BMV B;  2QWO B;  5KHH A;  1QR9 A;  3QO5 A;  4TQD A;  4OXS A;  4RAI A;  1QHT A;  2P6J A;  1SET A;  1M93 A;  5JJJ B;  2CAZ C;  1AR1 B;  4NVP A;  2H3O A;  4NXM B;  1PNK A;  1R6T A;  1EFR G;  1RP3 B;  1MMM A;  4U3J B;  3ZJZ A;  3APO A;  3ZMU A;  2BE3 A;  2UUC B;  2A0L A;  4DV1 B;  4DR6 O;  3OTF A;  1JJ2 U;  4YIO A;  3HKC A;  1UJW B;  1G8M A;  5ITZ A;  2PZS A;  2JS5 A;  4B7K A;  2BSK A;  4J41 A;  4B3M O;  3H1J H;  4Z1M G;  4B08 A;  3BCC H;  2PI5 A;  4ASU G;  2WLH A;  5EYP B;  1QLE B;  2CH7 B;  5B1A C;  2WLJ A;  3DXR A;  1KEC A;  1FXV A;  1AJQ A;  4KXR A;  2LFS A;  4FVM A;  1I94 O;  3AG4 B;  4JAA A;  4DR7 B;  4FFB A;  3X2Q C;  2UXB B;  5B66 Z;  1HDJ A;  2GV9 A;  4J42 A;  2XOK G;  2CUG A;  4P2Z A;  5B1B C;  2GUZ B;  4LH6 A;  3JYC A;  3O9O A;  2IW5 A;  3G67 A;  1Q6H A;  1FKA O;  4MVR A;  1Z5W A;  4NXM O;  2ZE6 A;  5LGT A;  4ZI7 B;  5L3B A;  4J11 A;  2VQE O;  2PTM A;  2Q7E A;  5CA0 B;  4K3A A;  2UUC O;  4JI4 B;  3ETG A;  4OPA A;  4DV1 O;  3ABK B;  4OX9 B;  3ZRV A;  3AEI A;  5CB4 B;  5KMG A;  3VQW A;  1OCR B;  1S5J A;  4BAY A;  5KX5 B;  1AB3 A;  3SPC A;  4WFB V;  4O2A A;  5AG2 A;  3IC7 A;  1B6Q A;  3P32 A;  2WA3 A;  3LUT B;  4PV1 B;  4PDR A;  1NS1 A;  1JFF B;  2EIJ B;  1B04 A;  2Z3Y A;  4JZG A;  2JEU A;  1IBK B;  1N32 B;  2BCC H;  3SPI A;  5J2U B;  3Q4H A;  1TVK A;  2YXL A;  1Y76 A;  1JA8 A;  1Y6X A;  2RMK B;  3SPJ A;  2ZR3 A;  3FFQ A;  1P4R A;  3UT5 B;  2ZQM A;  3OW2 U;  2ZM6 B;  3CCM V;  2XT9 A;  4FLX A;  2K9P A;  3G80 A;  1Z5V A;  4DR7 O;  1K33 A;  4DW0 A;  4IGG A;  2UXX A;  2WWW A;  1VQ5 V;  2ITD C;  2F1M A;  2UXB O;  2IU3 A;  1I5Y A;  3FYE B;  2DWD C;  3QNE A;  4PDV A;  4LF4 B;  4PD4 F;  1V9P A;  2FYU H;  1D5A A;  2Y69 B;  2NNU A;  4JPR A;  3JD2 A;  1K3E A;  2DN9 A;  4NTY A;  5JWP A;  4CS4 A;  5LP6 B;  1XIL A;  3B4S A;  5FNV A;  2VWK A;  3N2K B;  2EZP A;  1U97 A;  2W0X A;  4JV5 B;  5E79 Z;  1OCZ B;  1XNQ B;  2E75 B;  2QSA A;  3F5W C;  5DEC A;  4JI4 O;  1K97 A;  4OX9 O;  3HKC B;  1R3J C;  4X20 A;  2KG7 A;  3RT3 C;  4X65 B;  2ADP A;  5ITZ B;  3MHH C;  3CMA V;  3FX7 A;  2ZR2 A;  4O2B B;  4FLY A;  1IDS A;  3BRC A;  5JQG A;  2VRZ A;  4R6Z A;  2HHH B;  2M7W A;  3ZED A;  2ATK C;  2ZNI A;  1VQO V;  2FKX A;  4AIL C;  4ICG A;  4GX0 A;  1S5H C;  1IBK O;  1N32 O;  2QJ1 A;  1R3K C;  2ZXW B;  4DV3 B;  4JI0 B;  1E1Q G;  2RCV A;  3SYP A;  1TUB A;  3ZHS A;  1QBZ A;  3K58 A;  3JAK A;  2A9H A;  2ZM6 O;  5DED A;  1K9M W;  1G1X B;  3SPG A;  3K5N A;  4IL6 Z;  2E3C A;  1EZV H;  2DE0 X;  4R7C A;  4LF4 O;  4G27 B;  4TV9 B;  3T4D A;  3ZBH A;  3CC7 V;  3T1Y B;  1S3J A;  1Q90 D;  4N23 A;  1B3Q A;  5JCO A;  3EXA A;  1KUQ A;  1RM1 C;  1R1B A;  1NVP B;  4GKK B;  3H01 A;  1VP7 A;  2N04 A;  1P7B A;  4QPJ A;  4O4H B;  3S3X A;  2HR3 A;  1H8E G;  1AI4 A;  1S76 D;  4PEL A;  1XUQ A;  4H37 A;  1ROP A;  4OGQ B;  1XNQ O;  1Q7Y W;  3ZRS A;  1Q43 A;  2P4K A;  4EEQ A;  4TWK A;  3L72 H;  2F23 A;  1MZE A;  4HNA A;  1YTF D;  3U11 A;  3ZHQ A;  1RSO B;  2P7T C;  3ZX6 A;  4X65 O;  1R6N A;  3FB8 C;  4HZ3 A;  1QLE C;  2XTA A;  1YJW V;  1QR8 A;  3QG5 A;  2BTQ A;  2EUL A;  2ITC C;  1DTO A;  4QGP A;  5KUM A;  4O4J A;  1KQS U;  3K79 A;  3ABL B;  3AG4 C;  3BFR A;  4RUF A;  4LFB B;  1TVK B;  2EZO A;  3RYF A;  5K1X A;  1E79 G;  2ZD9 A;  4DV3 O;  3OD4 A;  4JI0 O;  3ZMZ A;  2QWR B;  3N2G A;  2QTS A;  3CCV V;  1VAR A;  2P22 C;  5EIB D;  4NXN B;  1YDX A;  2VWJ A;  5IYB O;  3HB3 B;  5BZB A;  1WA8 A;  3SJQ C;  1SQF A;  4JYA B;  1H8H G;  1CP9 A;  1XI1 A;  4MVM A;  4R50 A;  3CC2 V;  3TET A;  3T1Y O;  1YJN V;  3M7M X;  1VEW A;  3JAR B;  1NI8 A;  2V4D A;  3FYI B;  5DN6 G;  3E22 A;  3ASN B;  2OIE A;  1EBO A;  4GKK O;  3C3T A;  5JJE B;  2LJ2 A;  5FNV B;  4FM0 A;  4H0L B;  2X0L A;  3ABK C;  4NTW A;  1VQL V;  1OCR C;  2QWN B;  4DXW A;  2JK5 C;  3UKM A;  1Y4M A;  4JF3 A;  5KAF Z;  2AHY A;  1VQ6 V;  1M57 B;  2EIM B;  5JH7 A;  2NR5 A;  3CCR V;  3SR2 C;  4DK1 A;  2HG5 C;  5KHK A;  1WN7 A;  2X6B A;  3JAS B;  2VQF B;  5CBH A;  2B5U A;  3W7U A;  2ZIM A;  3A0R A;  1BQ0 A;  5L3G A;  4D7S A;  2O57 A;  5GTH Z;  1VQ7 V;  5IJ9 B;  4UB8 Z;  3UO3 A;  4P9O A;  4PDM A;  1GN6 A;  2JIZ G;  1VF7 A;  3T1H B;  1SS3 A;  1PP9 H;  4DV5 B;  2OWO A;  1MG1 A;  1YJ9 V;  2XAJ A;  1RPO A;  4O4L B;  4LFB O;  2DYR B;  2UXN A;  4Z2W A;  5CBG A;  4LF5 O;  4E4E A;  3FAV B;  1NH2 D;  2FB5 A;  3D3I A;  1UPG A;  3CX5 F;  3K9S A;  3ZHV A;  4GZR B;  3K5M A;  4TV8 A;  4NXN O;  2Y69 C;  3HKB B;  3WB2 A;  4JYA O;  5EBM C;  1BCC H;  5LP6 C;  3H1H H;  3RYC A;  1QCE A;  1Z2G A;  3O65 A;  3ZN1 A;  2RN9 A;  4MVO A;  2XAQ A;  4U3F H;  5GON A;  2EIL B;  5BXZ A;  2XAH A;  2ZKO A;  2AGA A;  4KL1 A;  2F93 B;  1OCZ C;  1HP8 A;  1YVW A;  1KD1 W;  1MAB G;  2NLJ C;  3DC5 A;  4DRX A;  2BTO A;  2XAG A;  4DV2 B;  3E86 A;  4QNH B;  2CGN A;  2GTA A;  3BY6 A;  3KG2 A;  4LCU C;  1NR7 A;  3OMN B;  4L8J A;  5EC1 C;  2HEP A;  3TCU A;  5IYZ A;  4HNA B;  2KQX A;  3EVK A;  4G28 B;  4BR6 A;  2JJ2 G;  2YI9 A;  3IAY A;  1WAZ A;  3VQY A;  4TOI A;  2ETN A;  2P90 A;  2GSM B;  1XRE A;  3CCS V;  4BWA A;  1F4M A;  2ZXW C;  4F4L A;  3F5T A;  2HP8 A;  4O4J B;  3T1H O;  2XAS A;  3W7X A;  5LOV A;  4OPH A;  3RGB A;  3RYF B;  5LMN B;  4HAM A;  3L75 H;  5IDJ A;  3N2G B;  3TXS A;  2AHZ A;  1KU9 A;  2RDC A;  2IU0 A;  3LDD A;  2QEX V;  5B1N A;  3FKS G;  2JGU A;  4X66 B;  3H1L H;  3KCX A;  5EZY A;  4JI8 B;  1GRJ A;  2JS3 A;  4GYC B;  1R6K A;  3G71 V;  2Y0I A;  4FLZ A;  4U7O A;  1OCC B;  3NR7 A;  3B40 A;  3ZHR A;  4TUY B;  1HNZ O;  5IWA B;  2NN4 A;  1FYJ A;  3VOU A;  3CWB H;  1ZUQ A;  1F23 A;  1XL4 A;  2QR4 A;  3JAL B;  1KB9 F;  4DV2 O;  1FD9 A;  2IJK A;  1R73 A;  2AZ2 A;  1WNS A;  3CS5 A;  5FPO A;  3A2F A;  4DV6 B;  2GDS A;  5JH7 B;  5IYC O;  1DK1 A;  2F66 C;  3R65 A;  5A9G A;  1NTM H;  4O4I B;  1IBM B;  2AW9 A;  1KBH A;  2ZDI A;  3SGI A;  4R8C A;  3ABL C;  3IJ4 A;  4B7E A;  4JZ2 A;  2PGG A;  1MZF A;  1NZ6 A;  1GKF A;  4LF6 B;  2YIC A;  4J7Z A;  1AI7 A;  4DR5 B;  4Z1V A;  3ZMS A;  2UUB B;  1QVF U;  2QM8 A;  1IXM A;  5D5P A;  2IJI A;  2LQT A;  2MW2 B;  3K5L A;  2X6C A;  1GM7 A;  5LMN O;  1V55 B;  4WFF A;  2AXT Z;  4X1I B;  4FIP C;  4L87 A;  1IBL O;  4UV8 A;  1EM1 A;  3ZMV A;  3CRQ A;  3KZI Z;  4TV8 B;  2ADQ B;  1RPR A;  3ABU A;  5LBQ A;  3N27 A;  3ASN C;  3MD0 A;  1L0L H;  4LBE C;  3ZS8 C;  4X66 O;  3VBB A;  4LFC B;  4H33 A;  1I08 A;  2DYS B;  2WPD G;  4LWS B;  4JI8 O;  3AK3 A;  4JGS A;  5GON B;  4X8A A;  1YEW A;  1T5E A;  1NTZ H;  5IWA O;  4EB6 B;  4LF7 B;  1ORQ C;  4PI0 A;  1KP3 A;  3AG7 A;  3HKD A;  1M57 C;  2EIM C;  3RN4 A;  4ZHQ B;  4K0K B;  1FXK A;  4IHJ B;  3AG3 B;  1R3I C;  3OTO B;  4DV6 O;  3E8H A;  4CH4 A;  3EFF K;  3LNM B;  4FLW A;  1N8R W;  4Q20 A;  4J10 A;  1HWY A;  1YSC A;  3K9A A;  2YXY A;  1PV0 A;  4LF9 B;  1IBM O;  1K92 A;  4N21 A;  3OE7 G;  5CA1 A;  4UCR A;  4IYH A;  3ZMT A;  1XMO B;  1TGO A;  3GVM A;  4MVQ A;  3JSN A;  2YI8 A;  2DOS A;  4EFE A;  1VQM V;  5LOV B;  4ZBM A;  4LF6 O;  4DR5 O;  1L8D A;  4UCV A;  3K59 A;  2UUB O;  4WFA V;  4B3R B;  3JAW A;  4YJ2 A;  4DR1 B;  2D2C B;  1BS3 A;  4DUY B;  3RYI B;  4D6T H;  4LF8 B;  2QA4 V;  5LXT A;  2CGO A;  1AR4 A;  3CE2 A;  4C7U A;  5LL6 Y;  3CXH F;  5LA6 B;  3K57 A;  1SA0 B;  4GT1 A;  1KKD A;  2EIL C;  4YJ3 B;  2XAF A;  2A06 H;  5CMU A;  2B1G A;  4LFC O;  3BHP A;  3QVN A;  2Q69 A;  1PNL A;  4J7K A;  2KB1 A;  2WLL B;  1CEZ A;  2PY5 A;  3STZ C;  5A2Q N;  2Q7G A;  3AG1 B;  1GTO A;  4KP4 A;  4LF7 O;  3HKE A;  3QF7 A;  2ZT9 B;  4MVU A;  4YY3 B;  1L0N H;  2YS8 A;  3CYO A;  1AVM A;  3GWK C;  3UO2 A;  4I50 A;  1I7F A;  4PA6 A;  4FPP A;  4I55 A;  4BIO A;  4K0K O;  2EJ7 A;  5JVD A;  3OTO O;  5EBL C;  1I5X A;  1Q81 W;  4KHP B;  1O9G A;  3G4S V;  1GN4 A;  2QM7 A;  3ICX A;  4MT8 A;  3AK2 A;  1YZB A;  1Q6I A;  4UCO A;  5H5N A;  1XMO O;  1JR9 A;  4QJF B;  2E76 B;  2WLM A;  4EKW A;  2V7Q G;  4GX1 A;  1BMF G;  1M5I A;  3CCJ V;  1N36 B;  1MSW D;  3CPW U;  1GN2 A;  3NXS A;  4DR1 O;  4B3R O;  1EN6 A;  2BSK B;  1AP5 A;  2PUS A;  2HKO A;  2Q67 A;  4DUY O;  5CN0 A;  1Q6U A;  3JCZ A;  4LF8 O;  2JDI G;  5TIS Z;  3OMA B;  1OCC C;  2GBO A;  2CK3 G;  1AR5 A;  1IXB A;  4LNU A;  2P4V A;  1LUW A;  3DXR B;  2FML A;  5J9P C;  5C8Y A;  3P3N A;  4P30 A;  4XDL A;  4CZZ A;  3EHB B;  1ENV A;  3A0B Z;  5C93 A;  1DGS A;  2OTL V;  2HJD A;  2WSS G;  4FFB B;  2PI4 A;  2UXD B;  1M56 B;  1HNW B;  5GW7 A;  1VF6 A;  3JSL A;  4MSW C;  3I56 V;  1N0J A;  3JD4 A;  1SES A;  4UVB A;  4YY3 O;  2BOB C;  3FB6 C;  1JOY A;  1SQV H;  4FMT A;  3CCL V;  1V54 B;  1FXK B;  4GX2 A;  4JTD B;  1O9H A;  1XOU A; 
#chains in the Genus database with same CATH homology
 1FFT B;  1MG1 A;  4TSF G;  2QKS A;  1YJ9 V;  4BIZ A;  3LDC A;  2XAJ A;  3JD0 A;  1JPX A;  1RPO A;  2DYR B;  1NR1 A;  3K0D A;  4KUM A;  2UXN A;  2WLI A;  2Q6A A;  5CBG A;  1K34 A;  4GX5 A;  3T4Z A;  2EIN C;  4JYB A;  1NH2 D;  1PD3 A;  3D3I A;  1QR9 A;  3QO5 A;  2EIK C;  4OXS A;  4RAI A;  1GMG A;  2EBO A;  3IGA C;  1W0J G;  2K1E A;  2P6J A;  4UUJ C;  2Y69 C;  1OZ0 A;  1SET A;  5B1O A;  2YEV A;  5LGU A;  4DO2 A;  5L3F A;  4BIU A;  1AR1 B;  1KC8 W;  1PNK A;  3ZJZ A;  1EFR G;  3CC4 V;  5EBM C;  4JAV A;  3W7T A;  3ZMU A;  2H94 A;  2MK3 A;  5EC2 C;  1QCE A;  4J9Z B;  1GK9 A;  2QE7 G;  3AG2 B;  3ZN1 A;  3SYC A;  2XND G;  4MVO A;  2XAQ A;  2EIL B;  3ML0 A;  2XAH A;  2DYS C;  1AJP A;  2A0L A;  1OCZ C;  2YSU B;  4E2L A;  3ZN0 A;  1JJ2 U;  3BEH A;  3W7S A;  1KD1 W;  1OCO C;  5H6R A;  1MAB G;  2NLJ C;  3RBZ A;  1XL6 A;  1UJW B;  1G8M A;  2HFE C;  2XAG A;  3E86 A;  4QNH B;  3ABT A;  3BY6 A;  3KG2 A;  4LCU C;  1NR7 A;  3OMN B;  3MHS C;  1H2G A;  5EC1 C;  3K06 A;  3D36 A;  1S72 V;  3TCU A;  1Q82 W;  4Z1M G;  1TUE B;  3B77 A;  3ZCC A;  2PI5 A;  2QTO A;  4G28 B;  2JJ2 G;  4ASU G;  2WLH A;  1ARO P;  3ABM B;  1QLE B;  3AG3 C;  3K03 A;  5B1A C;  2WLJ A;  5HFM A;  3RVY A;  2P90 A;  1KEC A;  3SPH A;  2GSM B;  3SYO A;  3CCS V;  1FXV A;  1AJQ A;  2LFS A;  5IYD O;  1F4M A;  2X6A A;  1NQT A;  2ZXW C;  3AG4 B;  4F4L A;  2XAS A;  3QO8 A;  3W7X A;  5KA5 A;  3X2Q C;  1F4N A;  4J9Y B;  4MTX A;  2XOK G;  1JCH A;  3M99 B;  5CA3 A;  4WF9 V;  4HAM A;  3CME V;  4P2Z A;  5IDJ A;  5HFL A;  5B1B C;  1OHH G;  2AHZ A;  2FTK A;  3JYC A;  3OR6 C;  2IU0 A;  3LDD A;  2IW5 A;  1QVG U;  2QEX V;  1YHQ V;  1CPY A;  5B1N A;  4MTF A;  2IH3 C;  3FKS G;  4MVR A;  4XDJ A;  3K04 A;  5IY5 B;  2DWE C;  5LGT A;  2EIJ C;  5L3B A;  1R6K A;  2Q68 A;  3G71 V;  2C2A A;  3WG7 B;  4U7O A;  1OCC B;  3X2Q B;  2H8P C;  1THZ A;  5L3E A;  4QE7 A;  4PA3 A;  3STL C;  1BL8 A;  2P67 A;  3E83 A;  3QO7 A;  3ETG A;  1K73 W;  3B8N A;  3ABK B;  3ZRV A;  3AEI A;  1OCR B;  1H38 A;  5H9C A;  3VOU A;  4BAY A;  1JVM A;  3AG1 C;  1F23 A;  2HJF C;  3SPC A;  3TK1 A;  4WFB V;  1XL4 A;  2W0F C;  1WLE A;  2IJK A;  1AI5 A;  1R73 A;  3IC7 A;  1B6Q A;  3OUF A;  3P32 A;  2X7R B;  3LUT B;  1V55 C;  1YIJ V;  5IYC O;  4PDR A;  3ZRX A;  1GM9 A;  2Z5U A;  2EIJ B;  2Z3Y A;  3R65 A;  5LHH A;  2JEU A;  5CBF A;  3SPI A;  3G6E V;  5LGN A;  1M9N A;  2ZDI A;  3W7W A;  1FS0 G;  3OEE G;  4R8C A;  3SPJ A;  4MVS A;  3ABL C;  3E2E A;  2ZR3 A;  3K08 A;  1P4R A;  5EK0 A;  3UM7 A;  2LP7 A;  2ZQM A;  3OW2 U;  3CCM V;  5B3S C;  1GKF A;  1K33 A;  2UXX A;  2WWW A;  4WCE V;  1AI7 A;  2ITD C;  1VQ5 V;  2EIN B;  2IU3 A;  3ZMS A;  4WFE A;  1I5Y A;  3FYE B;  2DWD C;  3QNE A;  4PDV A;  1QVF U;  2QM8 A;  1IXM A;  2IJI A;  2EIK B;  2X6C A;  1J95 A;  2WLI B;  4UVC A;  1GM7 A;  1V55 B;  1YIT V;  4WFF A;  3GB7 C;  2Y69 B;  1GM8 A;  4FK5 C;  2NNU A;  5LHG A;  2D3O W;  4FIP C;  4JPR A;  3ZRW A;  4L87 A;  2JJ1 G;  3JD2 A;  1M1K W;  4UV8 A;  1K3E A;  3ZMV A;  2OTJ V;  1S77 D;  1RPR A;  2IJJ A;  3ABU A;  3IFX A;  5LBQ A;  5L3C A;  1FXH A;  1GO3 F;  3ASN C;  1SER A;  3MD0 A;  4LBE C;  2EZP A;  1K5Q A;  4P9P A;  3VBB A;  1Q86 W;  3OFN G;  4H33 A;  1DF4 A;  2DYS B;  2WPD G;  1KP2 A;  3HPL C;  4JGS A;  1OCZ B;  2OCC C;  4MVZ A;  3CCE V;  4X8A A;  3CXC U;  1OCO B;  3F5W C;  1YTF B;  1SRY A;  1K97 A;  1ORQ C;  1K8A W;  4JAS A;  1R3J C;  3F7V C;  3OM3 B;  1KP3 A;  1M57 C;  3ASO C;  1NJI W;  2EIM C;  3MHH C;  3CMA V;  2ZR2 A;  1M56 C;  1PNM A;  4GCZ A;  4I5S A;  4MS2 A;  2IH1 C;  1QLN A;  1YI2 V;  2A79 B;  5LHI A;  3T1C A;  3E35 A;  5KA6 A;  1FXK A;  4PA9 A;  4R6Z A;  1AJN A;  1R3I C;  1NKD A;  3AG3 B;  5B1A B;  4MW3 A;  2M7W A;  3E8H A;  1DF5 A;  2ATK C;  4JTA B;  4LC1 A;  3EFF K;  3LNM B;  4XDK A;  1VQO V;  2W6I G;  1N8R W;  4Q20 A;  5H6Q A;  1HWY A;  2DQ3 A;  1YSC A;  1VQP V;  3K9A A;  4GX0 A;  1S5H C;  3E8G A;  1R3K C;  3CCQ V;  3K3W A;  1K92 A;  4XBF A;  1AI6 A;  4N21 A;  2ZXW B;  3OE7 G;  1VQN V;  3SYQ A;  3ZMT A;  1E1Q G;  4MVQ A;  1VQ8 V;  3SYP A;  1QBZ A;  4G2K A;  2R9I A;  2A9H A;  1VQM V;  1K9M W;  2HVJ C;  3SPG A;  4ZBM A;  3E8F A;  3LSQ A;  4RO2 A;  4CBC A;  4UXN A;  3JD1 A;  5B1B B;  2R9R B;  2JEX A;  4WFA V;  3ETD A;  4R7C A;  4G27 B;  3T4D A;  1PL0 A;  3CC7 V;  1S3J A;  4N23 A;  3E89 A;  1VQ4 V;  1VQ9 V;  4QPK A;  1ZWI C;  4UVA A;  2QA4 V;  1RM1 C;  1NVP B;  4QE9 A;  3I55 V;  4PA4 A;  3RW0 A;  1LNQ A;  3H01 A;  1P7B A;  3JD3 A;  3AG2 C;  3OAA G;  4QPJ A;  5FL7 G;  4GT1 A;  2HR3 A;  5KUK A;  1KKD A;  1VQK V;  2EIL C;  2XAF A;  4KFM A;  1H8E G;  1BHA A;  1AI4 A;  1S76 D;  5CMU A;  2B1G A;  1K4D C;  1W0K G;  4PEL A;  2Q69 A;  4H37 A;  1PNL A;  2GHY A;  1ROP A;  2KB1 A;  2WLL B;  1CEZ A;  3DGE A;  3STZ C;  3RVZ A;  2WLK A;  1Q7Y W;  2ZDI C;  3OR7 C;  4TT3 G;  1DLB A;  1MOF A;  3ZRS A;  3ETE A;  4TWK A;  2IJH A;  3AG1 B;  2DW4 A;  1GTO A;  4YXW G;  1YTF D;  4WFG A;  1SZT A;  4KP4 A;  2P7T C;  4MVU A;  1R6N A;  3FB8 C;  4RUE A;  3K0G A;  1K5S A;  1RM1 B;  1JX9 A;  4ZKI A;  4MTO A;  3CYO A;  4HZ3 A;  3FB5 C;  3ABM C;  5EBW C;  1QLE C;  3ZIA G;  3LDE A;  1YJW V;  4PA6 A;  3B8M A;  1R3L C;  1QR8 A;  4FPP A;  4X88 A;  4RQE A;  1WPX A;  2ITC C;  1I5X A;  5EBL C;  1Q81 W;  3OUS A;  3DTU B;  1DTO A;  2YEV B;  3G4S V;  5KUM A;  3PJS K;  1W2B U;  3CD6 V;  1KQS U;  3K79 A;  2QM7 A;  1K4C C;  3ABL B;  3AG4 C;  4MT8 A;  4RUF A;  3WFV A;  2EZO A;  1PKX A;  4JTC B;  1E79 G;  2ZD9 A;  1NH2 B;  5B3S B;  2DQ0 A;  3ZMZ A;  1BHB A;  3SYA A;  4QJF B;  4JYC A;  3CCV V;  4UV9 A;  5IYB O;  3HB3 B;  2WLM A;  4EKW A;  5BZB A;  2V7Q G;  1E1R G;  4GX1 A;  3SJQ C;  1BMF G;  1H8H G;  3CCJ V;  3FB7 C;  3OMI B;  1CP9 A;  3CPW U;  4JAU A;  1MSW D;  2EJR A;  3NXS A;  4MVM A;  4R50 A;  5L3D A;  3CC2 V;  3TET A;  1YJN V;  1NBM G;  2HKO A;  2Q67 A;  2BOC C;  5CN0 A;  2W6J G;  1Y66 A;  4PDL A;  3FYI B;  3ZRW B;  1M90 W;  5DN6 G;  3ASN B;  3JCZ A;  3E8B A;  5IY5 C;  1EBO A;  2F43 G;  2JDI G;  3OEH G;  1G4Y B;  1V54 C;  1NVP D;  2LFR A;  1FXK C;  3WG7 C;  3OMA B;  1COW G;  1OCC C;  2HLD G;  4MTG A;  5DM6 V;  2CK3 G;  2OCC B;  2OT5 A;  3CP1 A;  3P30 A;  4QIW F;  1L1F A;  1EZJ A;  2X0L A;  3GWO A;  3ABK C;  5J9P C;  4PA7 A;  4RQF A;  4U7N A;  2WLN A;  1VQL V;  4LP8 A;  1OCR C;  4P30 A;  4XDL A;  4DXW A;  2JK5 C;  3UKM A;  4CZZ A;  1Y4M A;  2DYR C;  3EHB B;  4JF3 A;  1ENV A;  5C93 A;  3CCU V;  2HVK C;  2AHY A;  2Y48 A;  2OTL V;  1VQ6 V;  2V1D A;  1M57 B;  2WAM A;  2WSS G;  3ASO B;  5E1A C;  2EIM B;  2PI4 A;  1M56 B;  5GW7 A;  3CCR V;  4MSW C;  3I56 V;  3JD4 A;  1SES A;  2HG5 C;  4UVB A;  2X6B A;  2BOB C;  3T2M A;  3FB6 C;  5CBH A;  2B5U A;  1JQ0 A;  3W7U A;  1JOY A;  3OGC C;  4FMT A;  1V54 B;  3CCL V;  3A0R A;  3F7Y C;  1FXK B;  3LSS A;  2WLL A;  4HYO A;  4WFH A;  1S0V A;  4I9W A;  5L3G A;  4GX2 A;  4FJC C;  1VQ7 V;  4X89 A;  4MW8 A;  1K7D A;  4P9O A;  2B1I A;  4BW5 A;  4JTD B;  4PDM A;  2JIZ G;  1F51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...