1VQ9V

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq9V00
1R73A 3G4SV 3G71V 1YIJV 3CCLV 1KC8W 3I55V 4WCEV 5DM6V 1S72V 1VQNV 1Q7YW 1VQ7V 2OTLV 3CCJV 3CCVV 1VQKV 1VQMV 1YITV 4WFBV 1Q82W 2OTJV 2D3OW 1N8RW 1VQ6V 1VQ9V 1KD1W 3CCUV 2QA4V 3G6EV 3I56V 4WF9V 1YJ9V 3CPWU 4WFAV 3CC4V 3CXCU 1Q81W 1NJIW 1QVGU 3CC7V 1YJNV 3CCRV 1M90W 3CC2V 1VQ8V 1VQLV 1VQ4V 3OW2U 1VQOV 1K8AW 1YI2V 1YJWV 3CMAV 3CCQV 3CCEV 3CD6V 1QVFU 1VQ5V 3CCSV 1Q86W 1M1KW 2QEXV 1W2BU 1VQPV 1K9MW 1K73W 1JJ2U 1KQSU 3CMEV 1YHQV 3CCMV
chains in the Genus database with same CATH superfamily
5JCOA 3SPCA 1RPRA 4YJ2A 5KHGA 3JSNA 1VQMV 1X59A 3AG2B 1BMFG 1AI4A 4QIWF 5D5QA 3HKEA 3JAMN 2P22C 3E22B 3E89A 1H8EG 1QU7A 5B5EZ 5DECA 4ZKIA 3UM7A 1MOFA 4UUJC 3ABLC 3H1HH 2ZXWB 4GX0A 1N33B 4JZGA 4JI8B 3ZHSA 4JI5B 4I4TA 4I0XB 1D5AA 4FFBB 3JASA 1M56B 1SKVA 4BW9A 4CS2A 1Q7YW 4AI8A 3T2MA 2X0LA 2CTQA 3T1CA 5IWAO 5C8YA 1TVKB 4LF9O 5B1OA 3HKBB 1YCIA 4JI4O 4JI1B 3H1JH 4KXRA 5H6QA 1WPBA 2QTOA 2LFSA 3E8FA 4FZ1A 2HR3A 1FXHA 1HNZB 3CCLV 4B3MB 1XNQB 3E8GA 3FD9A 2D3OW 4BIOA 5B3SC 4UCRA 4F6RB 2VQFO 3LUTB 4LWSB 1DK1A 1OCZB 3E8BA 4DV7B 5LP6B 3JD2A 3C3SA 1EN4A 2XHBA 4UB6Z 4FLUA 3JATB 1V55B 2OYQA 4NXMB 2VRZA 4AQYB 4X65O 4DK1A 4QPJA 1KKDA 2UXDB 1XMOB 3ABUA 5LBQA 3M99B 4FPPA 1NU1H 4EFBA 1XREA 1N36B 4CC6A 3CSXA 1FXVA 2BSKB 2DYSC 1PL0A 1ZL8B 2Q6AA 4GT1A 2WWWA 2M6YA 2E5LB 2DYRC 3HPLC 2KB1A 3OM3B 1Q6UA 2HFEC 1W59A 2ZKOA 4UCUA 4BIUA 1YJNV 1CEZA 1VQ8V 4HNAA 1S0VA 1HNXO 5IE9A 1NZ6A 5CBGA 1VF6A 1WB7A 1PV0A 2EX3A 2Q67A 2FYUH 3HKDA 3TCUA 1TUBB 2EIJB 4FM0A 3QNEA 1OCRC 2Q4PA 1SQPH 1Q6IA 3UT5A 3VOUA 2JJ1G 1YTFB 1NT2B 1EFRG 3OR6C 4U7OA 2UXBB 3ZHUA 4P30A 3APQA 2WLMA 2G38A 3CX5F 5HFLA 1M5IA 4XDLA 3ETDA 1IBLO 5J2UB 2EILB 3ML0A 5CB4B 2HVKC 4EFEA 4NXNB 3ZMZA 1IBMB 1A32A 1QBZA 3FYIB 1JX9A 4DUZO 3AK1A 5B1AB 1VQ4V 5LA6A 4X8AA 1EN5A 2H94A 1S5HC 3IJ4A 3ZRWA 3Q4HB 1Y66A 1XMQB 5C93A 3I56V 4RQFA 1H2NA 2IJKA 1SQGA 1FXKC 1UJWB 3A0RA 4K3AA 4JAAA 1LNQA 1P49A 3K04A 2R72A 3CRMA 2CDYA 1GN6A 2VS0A 3A2FA 1MSWD 1M4UA 2IJHA 1Z2GA 4D7SA 2WLLA 2B5UA 1GM8A 2XAFA 1OCOB 4I9QA 3RYIB 1B04A 4NTWA 4O4IB 4PA7A 4U3FH 1FXKA 3SJBC 1YI2V 5AG2A 3LSUA 3ABKB 1SS3A 2EINB 2HVJC 3QTCA 4A5UB 5B1NA 1XI1A 4X1KB 3STZC 1ZLZA 1K5SA 1XEQA 1K7DA 1XL6A 5FNVB 4IHJB 4R6ZA 1D2DA 2RMKB 2Y48A 4DRXA 4JV5O 3ZMVA 4FLZA 2CE4A 5L3FA 2HKOA 3OFNG 4NVPA 4B3TO 4DR3O 5KHIA 1SA0A 1GO3F 2WSSG 4W4KA 2YXYA 2Z5UA 3K9AA 4RQEA 5LYJB 3TXSA 1K3EA 3ASNC 4KHPO 3ZRXA 2OT5A 2WLIB 3K08A 1M57C 2IJIA 3SYPA 5LGTA 1IBKO 3K9SA 5CA1A 1Z5WA 4O4JA 1G8MA 2LW7A 5JJJB 2YC0A 1HR0B 4ZOLA 4LF8O 1NI8A 2JGUA 2ZT9B 2EIMC 3JALA 5BZBA 4DV1B 2A9HA 2P6JA 2XAGA 2YEVA 1I0HA 2ZM6O 3T1HB 3H9VA 5EC1C 3ZIAG 1VP7A 4JI6B 4TV8A 4LF4B 3HB3B 2UUCO 4X1YA 2CTWA 1WNSA 4H0LB 1YITV 3CP1A 1JMKC 3BRCA 4UXNA 4DR4B 3AG4C 1BGYH 1WN7A 2LO1A 3L75H 1FFXB 5HFMA 1N0NA 2QM4A 1V54C 3S3XA 4MTFA 1E1RG 4DR2B 3AG7A 1XDCA 3IAYA 5KAIZ 3RN4A 4FJCC 1F51A 4YJ2B 3C90A 1Y74A 2JGDA 2QGNA 2Q69A 4LFAO 1J5EB 4XBFA 3R65A 3AG1C 4JYCA 3C3TA 1AB3A 3OTOB 1BHAA 3HKEB 4XDJA 2XAQA 1I08A 1SF9A 4O2BA 3AEIA 4UVAA 3EHBB 4DV0O 2X6AA 1R6TA 5J9PC 3E83A 3JAKA 4BAYA 2ADQB 4BWAA 2H8PC 4IGGA 4PJ0Z 3RBZA 4U7NA 1DGSA 3ZMTA 3JAWA 3SJAC 4J7KA 4BR6A 4PA6A 4TOIA 4I4TB 5BR8O 1VQNV 3JASB 5KUMA 1NS1A 3UQ8A 3FB5C 2YIBD 3M7MX 4U3JA 4UB8Z 3G6EV 4OX9O 4JI7B 5C8YB 4YHHO 4RUFA 3ABLB 4I55A 2P7TC 2RN9A 3VQVA 2Q8VA 1U96A 3KCXA 2ATKC 1DTOA 1AJNA 2DJVA 3HKCA 4YIPA 2Q7EA 1ZUQA 2JDIG 3QO8A 1H2MA 4B08A 1I5YA 1PD3A 4KUMA 1ORQC 2QDOA 1US6A 1H38A 1AVMA 2P4KA 2E3CA 3CD6V 4QGPA 3SYOA 1JJOA 3EXAA 3E2EA 1JJ2U 2QR4A 2V7QG 1XNRO 3DXRA 2R9AA 1SQFA 3MDSA 4LFBB 2QA4V 3CPWU 5B3SB 2YIAA 3W7UA 3BCCH 3RGBA 1U97A 4FLXA 4DR6B 4DV2B 4O4HA 1DF5A 1BCCH 5DM6V 3CCVV 4EB6A 2E75B 3B4SA 5KX5A 3MAQA 1NH2D 4DR7O 4DV5O 1EZJA 3AK3A 4TSFG 1HNWO 1VIBA 3JCUZ 1PL4A 4DW1A 4MT8A 4HNAB 2F93B 2DQ3A 2DW4A 3HKDB 3I5DA 3FYEB 5LGNA 3CRQA 2DYSB 4P9OA 3VQXA 1DF4A 3VBBA 2DYRB 5CBHA 3UT5B 2FB5A 1AI7A 3BFRA 4L8JA 2P06A 1EN6A 4C7UA 2QKCA 1Q3EA 2KKWA 4HYOA 3L72H 4X62B 4GLXA 3G71V 3ASOC 1MG1A 2BTQA 1N32B 4QE7A 4FM2A 3N27A 1BT8A 5LHHA 4IIJA 2F4VB 3ZN0A 3QO7A 4JI5O 2IU0A 2DWDC 1OCRB 1K4CC 1GKFA 1NTMH 2DWEC 2RNBA 3D3IA 5LA6B 1XUQA 1QR8A 4NTXA 4DV4B 3OEEG 2IJJA 3QO5A 1HP8A 3ZRWB 4YJ3A 3X2QC 2Q0AA 4MVSA 3GWOA 2LJ2A 5LMNB 1SERA 2ZNJA 1S76D 2V4DA 4GX1A 3U11A 1H8HG 1HNZO 2UXCB 4B3MO 4LP8A 1XNQO 4GKKO 2F95B 3J81N 5FPRA 5K1PA 3H1IH 2ZE7A 3A0HZ 3WB2A 4UCSA 2WLLB 2QM8A 2PYJA 3W7SA 1HWYA 3STLC 4TV9A 2K1EA 4X64B 4LFCO 3B40A 4NXMO 1FXKB 4AQYO 3DC5A 1VF5B 1XHZA 4TUYA 4TQDA 4TQFA 5EYPA 4OPHA 1YVWA 4JASA 4LF5B 3MHHC 1NKDA 2A0LA 4IT5A 1N34B 1XMOO 2WLJA 1GM9A 1RSOB 1N36O 1SQXH 2YICA 4RO2A 5EIBD 2W6IG 1P7GA 1K8AW 3M8AA 4DRXB 1LUVA 4JTDB 4J9YB 5EBMC 2AHZA 3CB2A 2L6LA 2EJRA 3CCJV 1AR1B 1SA0B 1M9NA 3LNNA 1NR7A 2VWKA 2YS8A 3RWRD 1SQQH 4JI4B 5FPOA 1TGOA 5CMUA 1Y6XA 4QJFB 4AILC 1YXBA 1K73W 1JPXA 5CA1B 3CMEV 1YHQV 3K59A 4H44B 2DN9A 3LDCA 4X9QA 3ZHQA 4OPAA 4O4JB 3JD1A 2P5OA 1GN2A 4PI2A 1MABG 4ZOLB 3CRRA 4J9ZB 1JCHA 4XDKA 2UXBO 3KKYA 3JALB 1G4YB 1NQTA 1XBLA 3ASNB 2RDCA 2WA3A 2YEVB 1W0JG 4MW8A 1M57B 1YJWV 3BHPA 5GONA 5IT9N 4TV8B 2DQ0A 2ITCC 3ETGA 4X1YB 3P30A 2WLKA 3FB7C 4NXNO 4HAMA 4JYAB 2Y4UA 1IBMO 1S5JA 3SPJA 5KHHA 3IFXA 4ZIBA 2EIMB 4LBEC 4LF7B 1J95A 3LDDA 3P32A 1FKAO 1Y76A 3ZCCA 3CCMV 1XMQO 3T1YB 4MSWC 2NNUA 4Q20A 1W0KG 2V1DA 3O65A 4X88A 5CN0A 4X66O 2OTJV 1ZTEA 2CK3G 1Y74B 2JGDB 2R70A 4DUYB 4MVUA 1I5XA 3ZHRA 1WPXA 4R8CA 4IL6Z 3AG4B 4P9PA 2PTMA 2QEXV 1V9PA 4JI0B 4MTXA 3ZRVA 4O2BB 3W7WA 5GTIZ 3BA9A 2PF4E 4B3RB 1V54B 3WU2Z 3NXSA 3QG5A 1E1QG 4LC1A 4GKJO 4LH7A 4B3SB 5L3GA 2YI8A 1VARA 1M56C 2GV9A 3BEHA 3JAKB 2KSDA 1BE3H 3JAWB 1CP9A 1IZ3A 1K33A 4QNHB 2LGQA 2VQEB 1WAZA 3QVNA 5LXTA 2ZCEA 1IBLB 2GDSA 3ZHVA 4U3JB 2A7WA 1L0NH 4J10A 4WFAV 3CC4V 2CAZC 3K0GA 1H2SB 4I55B 4X1IA 2Q5ZA 3AK2A 3N2GA 1RPOA 2YIDA 4DUZB 1H2KA 3K57A 2PI5A 2OCHA 4DV6B 3PJSK 2CH7A 2UUBB 3HKCB 3SR2C 2Y69C 5KMGA 3VQWA 1WLEA 1IXBA 4NYKA 5GW7A 4JI2O 1VEWA 1X4TA 1RSOA 3OTFA 2AHYA 1EZVH 3DGEA 2DE0X 3WB0A 3DSQA 3THOA 3CMAV 4MVRA 4ZHQA 3DC6A 4O2AA 2EIKC 1HR0O 5E79Z 4QE9A 1GN3A 1JR9A 2A06H 3W7TA 4YXWG 2NR5A 3DXRB 4DV1O 1JA8A 3JARA 2H3OA 3OAAG 1PM9A 1HW7A 3WFVA 3T1HO 2UU9B 3G6BA 5EC2C 4DV3B 3ZHTA 4JI6O 1OJHA 4FIPC 4LH6A 4LF4O 1FJGB 2F66C 4BIZA 3CE2A 4DR1B 4O4HB 3B8NA 2N05A 4DR4O 2YUAA 4GUNA 4MW3A 4EB6B 4G28B 1I94O 5KX5B 1WB8A 2A79B 3F7YC 1R6NA 1SC5B 5DN6G 1JFFA 1AILA 4JI3O 1XOUA 4GX5A 2HG5C 4DR2O 5EBLC 1L0LH 1KP2A 2GBOA 5H9CA 2W0FC 2ZD9A 4JGSA 1B3QA 4I9WA 2B1GA 2R9RB 1YZBA 1R3IC 4X20A 3LDEA 4LNUA 1F23A 3K5OA 4H13B 3OTOO 1QLEB 3B77A 1YDXA 5JVDA 3BAAA 3SDLA 1OCCC 1L8DA 4L87A 3OD4A 4J41A 1IBKB 1FYJA 3K5MA 4CH3A 1S72V 1R3KC 1IURA 5CA0A 1VQKV 3AG3C 1NTZH 2BTQB 2Q7HA 1N0JA 4IIJB 4FMTA 3BA8A 5H6RA 2ARHA 4GZRB 3BY6A 4AHCA 2OCCC 1YTFD 2E74B 2ZM6B 4ASUG 5IJ0A 2ETNA 4O4LA 3F5TA 3OUSA 4PDLA 2UUCB 2MW2B 3L9DA 3ZJZA 4YJ3B 2QKSA 3ASOB 2HJDA 4PDRA 3S3WA 2UUAB 2HJFC 1SQVH 2Q9LA 2BE3A 1Q81W 2WAMA 1M90W 2YIBA 3T4ZA 4FFKA 3FAVA 3LSQA 4ABMA 3ABMC 3OE7G 2RCVA 3P3NA 4B7EA 1SQBH 5LL6Y 4KFMA 2K9PA 2AW9A 1Q5OA 4K35A 1B06A 2EINC 2EBOA 4ZI7A 4TV9B 3X2QB 1I7FA 4JAVA 4YIOA 1Y67A 3BVOA 1R6KA 4LF6B 3CRCA 2HHHB 1GTOA 1R73A 2W6JG 1N4CA 1QQCA 4LFBO 2ILMA 1B6QA 3D36C 4TUYB 1BS3A 4H37A 5EYPB 3KG2A 1VQ9V 2AXTZ 1BQ0A 2QKAA 4D6TH 5FL7G 4R7CA 4DR6O 4DR5B 4PA4A 4DV2O 2EZPA 2LQTA 2XASA 3EVKA 2BCCH 4CZZA 3O9OA 3MD0A 1KKCA 3OR7C 2XUMA 1N8RW 1AP6A 3D36A 1EM1A 3ABTA 5EBWC 2P67A 4I5SA 2PY5A 2BOBC 1D5NA 4CBCA 1JOYA 4K0KB 5EZYA 2OIGA 3CHXA 1ZWIC 4CS3A 2Q68A 4G27B 1KC8W 2ODMA 4TWKA 2JIZG 4PA3A 2OWOA 2QM7A 1COWG 4FM1A 3OMNB 1NR1A 4EKWA 5IYZA 5BXZA 3CC2V 3GWKC 2ZIOA 4WFFA 3OW2U 4KP4A 2Z3YA 2LGWA 3ZX6A 3FB8C 2KG7A 2FKXA 3ETQA 3CS5A 3K58A 1MZEA 1N32O 1ZSPA 2NN4A 1XNRB 1RP3B 2ZR3A 2Y4TA 5GONB 2AGAA 2F4VO 4B7KA 4FLVA 1ZAUA 2YSUB 4DO2A 5KLVH 4ZBMA 1PNKA 1QVGU 3ZMUA 5J2TA 3D8CA 4K8ZA 3CCEV 1VQ5V 1F7YA 4DV4O 2P4VA 5DEDA 1R3JC 3ICXA 1Y76B 1N33O 2XTAA 5GTHZ 5TISZ 1OV9A 1NVPD 3PN1A 3ZMSA 5LMNO 4BW5A 5LOVA 5LMUB 1JVMA 2WPDG 4JI8O 4WFHA 1BL8A 1KP3A 2CUGA 3ZN1A 1FPOA 3SJQC 4YY3B 5EK0A 4ICGA 1UFIA 2UXCO 4W4LA 3R66A 3L73H 1PNMA 1IVSA 4H33A 1KBHA 1AI5A 1KYOF 4UVBA 2F23A 3I55V 1HDJA 1MMMA 1AR5A 2PI4A 4JI1O 3CCUV 3K06A 1TA8A 3J7AU 1AJPA 4J7JA 4X64O 3A0BZ 1MZFA 5ITZA 4WFEA 1KB9F 2B1IA 4MVOA 3CCSV 2GUZA 1T5EA 2D2CB 5EIBC 5K1XA 2JS3A 4LF5O 3SJCC 1N34O 1IX9A 2Z0AA 5E1AC 5B66Z 4CH4A 3TK1A 5B1BC 2CTRA 5LXTB 2HP8A 1RM1C 3ETEA 4DV7O 1QNMA 2F1MA 4X1IB 1PKXA 3RYFA 1XL4A 4DXWA 3N2GB 3RYCA 3APOA 1PPJH 2HLDG 1GN4A 1XHXA 2CH7B 2JS5A 2AZ0A 2IM9A 4I50A 3D3QA 5KMGB 1AJQA 2UXDO 5JQGA 1R1BA 4WF9V 5LHIA 2ITDC 5KHKA 2IH3C 4UVCA 4PV1B 3RYHA 4JTCB 1VQPV 2E5LO 4ZHQB 3UO3A 4O2AB 3UO2A 4GKKB 1SESA 1LUWA 1Q82W 3CEIA 4JF3A 1SRYA 3WG7C 5BMVA 2ZIMA 2M7WA 4G2KA 2Y69B 5IWAB 2ZE5A 4WBNA 3JARB 4LF9B 3GVMA 3JCZA 4DYLA 4PHZA 1F4MA 1Q8IA 3CCQV 4LFCB 1QVFU 4X89A 2B9ZA 3TETA 3CXHF 4MTGA 5KUKA 1P84F 4WCEV 5IY5C 4JYAO 1K34A 2EIKB 2RJZA 1Z5VA 2IBZH 3P3PA 4Z1VA 1BSMA 2X7RB 1UPGA 1O9HA 1L1FA 4LF7O 1VF6C 2ZQMA 5IYDO 3CCRV 5IYCO 2VQFB 3NR7A 4J11A 5A2QN 1JFFB 3T1YO 2YDEA 2BTOA 2E76B 4JZ2A 5IJ9A 4PI0A 2EZOA 3G4SV 1VQ7V 2OTLV 3E35A 2JEXA 1ROPA 5CA3A 4X65B 4DUYO 5JH7A 2QWQB 1XILA 1P7BA 4X20B 1KECA 4LNUB 4F6EA 2GHYA 1QCEA 3SPIA 3CXCU 1GM7A 4JTAB 4R50A 5JVDB 4FZ0A 4LR3A 4JI0O 1KUQA 1GRJA 2PZSA 5JWPA 1AP5A 3AG2C 3T4DA 4B3RO 1AR4A 4MVQA 3W7XA 4B3SO 1URFA 5CA0B 4TT3G 3SYCA 1WA8A 4RAIA 3CJHA 3N2KA 2ADPA 1TAEA 4FVMA 3ZRSA 2P90A 1TUEB 4FK5C 1NJIW 5A9GA 1KU9A 1OZ0A 3G67A 2JEUA 1NBMG 4K8XA 2ZXWC 3G80A 1HNXB 2VQEO 1QHTA 5L3DA 4J42A 1OCCB 4PELA 5BY1A 4UCOA 1YF2A 2QWPB 5IJ0B 2PYLA 5JJNB 4O4LB 3B8MA 3OMIB 1S3JA 1FS0G 2XT9A 1SZXA 2VWJA 1QR9A 3AG3B 4JYBA 3H1LH 1NTKH 3CC7V 3E22A 5F2VO 3K5NA 4DV6O 3LSSA 2UUBO 2EJ7A 3AG1B 3FAVB 3RVYA 4CH5A 2QWNB 2OCCB 1YIJV 2JJ2G 2CGOA 3H01A 3RW0A 1P4RA 2QTSA 4PDVA 4MS2A 4DW0A 4X66B 3KCYA 5L3EA 2KQXA 5CBFA 4I0XA 3CYOA 4FFBA 1MNGA 4ZI7B 5IDJA 1K5QA 2YI9A 2PUSA 1LR1A 3ZS8C 2JVDA 2RQ6A 4GCZA 3ABMB 3OUFA 1FFTB 1TVKA 3HKBA 2ZDIC 3ZEDA 1KD1W 1IDSA 1G1XB 4Z1MG 2UU9O 1OCZC 3K3WA 4GKJB 4RUEA 4DV3O 2F43G 5LP6C 5IYBO 1V55C 1FJGO 4PD4F 4CH6A 4DR1O 1SZTA 1Q86W 4PA9A 4GX2A 3JSLA 1S77D 3OMAB 4N21A 2O57A 1CPYA 4F6RA 4OXSA 4PDMA 3ZBHA 2GTAA 2QJ1A 2ZDIA 3K79A 4LWSA 1AI6A 5D5PA 1O9GA 3CRAA 1Q90D 4NTYA 5LP6A 2N04A 3JATA 3RT3C 2X6BA 3L71H 1NH2B 1K4DC 5EZYB 3H1KH 1XQ8A 1YSCA 3K03A 3JYCA 1PNLA 2ZINA 3JD3A 4MVMA 1E79G 4JI2B 1WP8A 3RVZA 3FX7A 2QE7G 5IYZB 5H2FZ 2BSKA 2XAJA 4NKGB 1ZL8A 4J7ZA 1W2BU 2EIJC 4JV5B 2ZE6A 2KG7B 3EFFK 1Q6HA 4B3TB 4UV9A 4DR3B 1J5EO 3MHSC 1ZX3A 4CC5A 1MA1A 2HEPA 1F4NA 2CTPA 4I7ZB 1THZA 5FLXN 1YJ9V 3K5LA 4KHPB 1NVPB 5J2TB 1MSDA 2XAHA 1M1KW 1PP9H 3IGAC 3B09A 2A3QA 1TUBA 2EILC 2ZE8A 1RFYA 2NLJC 1S5LZ 2Y0IA 2X6CA 2UUAO 2Q7GA 4N23A 4EEQA 4IYHA 5B1AC 4LF8B 5LOVB 2L35A 1I94B 3SGIA 2Q0OC 4IYIA 4FLTA 3FFQA 4DK0A 4J80A 4Q6GA 3TJTA 3BABA 1DLBA 4JI3B 1AROP 1WP7A 2YXLA 1KQSU 3HR0A 4CS4A 2DMXA 5LHGA 5J2UA 4KL1A 1IXMA 4JI7O 2QWOB 1ENVA 3RFRA 5CB4A 5L3BA 1VMGA 2PGGA 2UXXA 2Y0PA 2FL4A 1BQZA 4UCVA 4D7TA 4LF6O 4UV8A 3CWBH 5ITZB 2JK5C 2YXHA 2HHHO 1OHHG 2FTKA 3QF7A 5KAFZ 4WFGA 3Q4HA 2GUZB 3BPZA 4HZ3A 3L70H 3L74H 4GYCB 1OCOC 4QPKA 3JD0A 2C2AA 2IU3A 1YEWA 1CXZB 4JPRA 1GMGA 4DR5O 4JAUA 3ABKC 2ZR2A 2LFRA 4LFAB 3KZIZ 3SYAA 3IC7A 3A8TA 5KA5A 5KA6A 2DOSA 2QWRB 3RYFB 3RYCB 2LP7A 1K92A 1JQ0A 2N74A 3FB6C 2UXNA 2GSMB 4I50B 3OGCC 3RYIA 2LW1A 4O4IA 2GTSA 5JQGB 4UCTA 4DV0B 2ZNIA 3IC9A 4K0KO 5B1BB 3OEHG 3F7VC 3SPGA 2MK3A 1BHBA 3DTUB 1RM1B 1M93A 3RYHB 4FLWA 4X1KA 2XNDG 1GAXA 4E4EA 3UCSC 5BR8B 3JD4A 1VF7A 5BMVB 2WA4A 5FNVA 1SETA 1GK9A 4IHJA 4MVZA 4OX9B 4WBNB 3J80N 4YHHB 1H2GA 4MTOA 1G6UA 2Q73A 1VQLV 1VQOV 3SPHA 1FAFA 3OGIB 3VQYA 4NB5A 3K0DA 4WFBV 5LYJA 1Q43A 3U0ZA 3WB1A 4RWUA 4HBNA 1VQ6V 2OIEA 3E8HA 2WLIA 3WG7B 2JRIA 2R9IA 2CGNA 2IW5A 1GH6A 4X62O 1BZKA 3E86A 1H2LA 3GB7C 4F4LA 4NR1A 2XOKG 1QLEC 5H5NA 4E2LA 5IJ9B 3TXQA 5LGUA 5LMUO 2WLHA 2BOCC 5JJEB 1QLNA 3SYQA 4FLYA 5JH7B 5IY5B 2AZ2A 3FKSG 4YY3O 1KMIZ 3TGUH 2QSAA 4Z2WA 1EBOA 5JCOC 2FMLA 1K9MW 3B2EE 3UKMA 3LNMB 5KHJA 4LCUC 1WJZA 4UFZA 1R3LC 5L3CA 2W0XA 1WA8B 4JYYA 3CJHB 3N2KB 4DR7B 4DV5B 1FFXA 3U10A 1K97A 4P2ZA 1HNWB 2IH1C 1FD9A 3OT7A 4OGQB 2WLNA 1Y4MA 3F5WC 2EULA
chains in the Genus database with same CATH topology
3SPCA 2EZOA 3G4SV 1VQNV 1RPRA 4QE9A 5KUMA 1VQ7V 3FB5C 3E35A 3W7TA 2OTLV 4YXWG 1VQMV 2JEXA 1ROPA 3AG2B 5CA3A 1BMFG 3G6EV 1P7BA 3OAAG 1KECA 2GHYA 4RUFA 1QCEA 3ABLB 3SPIA 3WFVA 2P7TC 3CXCU 1GM7A 4JTAB 5EC2C 4R50A 1AI4A 4QIWF 3E89A 4FIPC 1H8EG 2ATKC 1DTOA 1AJNA 3AG2C 4ZKIA 4BIZA 3T4DA 3UM7A 1MOFA 4MVQA 3B8NA 4UUJC 3W7XA 3ABLC 2JDIG 2ZXWB 3QO8A 4GX0A 4MW3A 4G28B 4TT3G 3SYCA 4RAIA 3ZRSA 1I5YA 2A79B 2P90A 1TUEB 1PD3A 4KUMA 3F7YC 1R6NA 1ORQC 4FK5C 1NJIW 5DN6G 1H38A 1OZ0A 3CD6V 3SYOA 2JEUA 4GX5A 1NBMG 2HG5C 5EBLC 3E2EA 1KP2A 2ZXWC 2V7QG 1JJ2U 5L3DA 4PELA 1OCCB 5H9CA 1M56B 2W0FC 2ZD9A 4JGSA 1Q7YW 3T2MA 2X0LA 4I9WA 3B8MA 2B1GA 2R9RB 3T1CA 1R3IC 3OMIB 1S3JA 1FS0G 1F23A 3LDEA 2QA4V 5B1OA 3CPWU 1QLEB 1QR9A 3AG3B 4JYBA 3B77A 5B3SB 3CC7V 3W7UA 5H6QA 1OCCC 2QTOA 2LFSA 3E8FA 3LSSA 4L87A 2HR3A 3AG1B 1FXHA 3RVYA 2OCCB 1YIJV 3CCLV 1DF5A 5DM6V 2JJ2G 1R3KC 1S72V 3CCVV 3E8GA 3AG3C 3H01A 1VQKV 3RW0A 2D3OW 1P4RA 4PDVA 4MS2A 5B3SC 1NH2D 5L3EA 1EZJA 4FMTA 4TSFG 5H6RA 5CBFA 3LUTB 3CYOA 3BY6A 1OCZB 2OCCC 3E8BA 5IDJA 4MT8A 1K5QA 1YTFD 3JD2A 1V55B 4ASUG 2DQ3A 2DW4A 3OUSA 4GCZA 3ABMB 3OUFA 1FFTB 3FYEB 5LGNA 4PDLA 2DYSB 4QPJA 3ZJZA 1KKDA 4P9OA 2ZDIC 1KD1W 2QKSA 4Z1MG 1DF4A 3ASOB 3VBBA 1OCZC 2DYRB 3K3WA 4PDRA 5CBHA 4RUEA 2HJFC 2F43G 3ABUA 5IYBO 1AI7A 1V55C 2WAMA 5LBQA 1Q81W 1M90W 3M99B 4FPPA 3T4ZA 3LSQA 3ABMC 3OE7G 1SZTA 1Q86W 1FXVA 4HYOA 2DYSC 1PL0A 4GX2A 4PA9A 2Q6AA 4GT1A 2WWWA 3G71V 3ASOC 1S77D 4KFMA 2DYRC 1MG1A 3HPLC 3OMAB 4QE7A 4N21A 2KB1A 1CPYA 3OM3B 5LHHA 3ZN0A 4OXSA 3QO7A 4PDMA 2HFEC 2ZDIA 3K79A 2IU0A 2EINC 2DWDC 1OCRB 2EBOA 1AI6A 1K4CC 1GKFA 2DWEC 4BIUA 1YJNV 1CEZA 1VQ8V 3X2QB 1S0VA 4JAVA 3D3IA 2X6BA 5CBGA 1R6KA 1QR8A 1NH2B 2Q67A 1GTOA 1K4DC 1R73A 2W6JG 3OEEG 1B6QA 2IJJA 3QO5A 3ZRWB 3TCUA 1YSCA 2EIJB 3K03A 4H37A 3QNEA 1OCRC 3KG2A 1VQ9V 3JYCA 3VOUA 3X2QC 1PNLA 2JJ1G 4MVSA 3JD3A 3GWOA 4MVMA 1YTFB 1E79G 5FL7G 1EFRG 1SERA 1S76D 3OR6C 3RVZA 4U7OA 4R7CA 2QE7G 4GX1A 4PA4A 2EZPA 2XAJA 1H8HG 4P30A 2XASA 2EIJC 1W2BU 2WLMA 4LP8A 5HFLA 3EFFK 4CZZA 4XDLA 3ETDA 3MD0A 3OR7C 4UV9A 1N8RW 3MHSC 3D36A 2WLLB 1F4NA 2QM8A 2EILB 1THZA 1YJ9V 3ML0A 2HVKC 3ABTA 5EBWC 3W7SA 1HWYA 2P67A 4I5SA 3STLC 3ZMZA 2K1EA 2BOBC 1QBZA 3FYIB 1JX9A 1VQ4V 5B1AB 4X8AA 4CBCA 1NVPB 1FXKB 1JOYA 2XAHA 1M1KW 2H94A 1S5HC 1ZWIC 3IGAC 2Q68A 4G27B 3ZRWA 1KC8W 2EILC 4TWKA 2JIZG 4PA3A 1Y66A 2NLJC 2X6CA 2QM7A 4JASA 4N23A 1COWG 1NKDA 2A0LA 3MHHC 5C93A 3I56V 4RQFA 5B1AC 2IJKA 2WLJA 3OMNB 1GM9A 1FXKC 1UJWB 3A0RA 1NR1A 4EKWA 4RO2A 3CC2V 2W6IG 4WFFA 3OW2U 1K8AW 4KP4A 1LNQA 2Z3YA 3K04A 4JTDB 4J9YB 1DLBA 3FB8C 1AROP 5EBMC 2AHZA 1MSWD 1KQSU 2ZR3A 2EJRA 2IJHA 3CCJV 5LHGA 1AR1B 2WLLA 1IXMA 1M9NA 2B5UA 1ENVA 1NR7A 2YSUB 1GM8A 5L3BA 2XAFA 1OCOB 4DO2A 2UXXA 4ZBMA 1PNKA 4PA7A 1QVGU 5CMUA 3ZMUA 1FXKA 4UV8A 1YI2V 2JK5C 3CCEV 1OHHG 2FTKA 1VQ5V 4QJFB 3ABKB 4WFGA 1K73W 2EINB 2HVJC 1JPXA 3CMEV 1R3JC 1YHQV 5B1NA 4HZ3A 3LDCA 3STZC 1OCOC 4QPKA 3JD0A 3JD1A 2C2AA 2IU3A 1NVPD 3ZMSA 1MABG 4BW5A 4JPRA 1JVMA 2WPDG 1GMGA 4WFHA 1BL8A 1KP3A 1K5SA 1JCHA 1K7DA 4J9ZB 4JAUA 4XDKA 3ZN1A 1XL6A 3ABKC 3SJQC 1G4YB 2ZR2A 2LFRA 1NQTA 4R6ZA 3SYAA 3IC7A 2Y48A 5KA5A 5EK0A 3ASNB 3ZMVA 5KA6A 1PNMA 4H33A 5L3FA 2YEVB 1W0JG 2HKOA 3OFNG 1AI5A 4MW8A 2LP7A 1M57B 4UVBA 1YJWV 1K92A 3I55V 1JQ0A 2WSSG 1GO3F 2DQ0A 2ITCC 3ETGA 2Z5UA 3FB6C 2UXNA 3K9AA 2PI4A 2GSMB 4RQEA 3CCUV 3P30A 3K06A 2WLKA 3FB7C 1K3EA 3OGCC 4HAMA 1AJPA 3ASNC 3ZRXA 2OT5A 3SPJA 2WLIB 3K08A 1M57C 2IJIA 4WFEA 3IFXA 3OEHG 5B1BB 3SYPA 3F7VC 2EIMB 4LBEC 3SPGA 2MK3A 5LGTA 2B1IA 1BHBA 3DTUB 1J95A 1RM1B 4MVOA 3CCSV 3LDDA 3P32A 2XNDG 3ZCCA 3CCMV 1G8MA 2NNUA 4MSWC 4Q20A 1W0KG 2V1DA 4X88A 5CN0A 5E1AC 2OTJV 3JD4A 3TK1A 2CK3G 5B1BC 2EIMC 1SETA 1GK9A 5BZBA 4MVUA 4MVZA 2A9HA 3ETEA 1I5XA 1RM1C 2P6JA 1WPXA 4R8CA 1H2GA 4MTOA 2XAGA 1VQLV 1VQOV 2YEVA 3AG4B 4P9PA 1PKXA 3SPHA 4DXWA 1XL4A 5EC1C 2QEXV 2HLDG 3ZIAG 4MTXA 3HB3B 3K0DA 3ZRVA 3W7WA 1YITV 1V54B 4WFBV 1VQ6V 3NXSA 3CP1A 1E1QG 4LC1A 1AJQA 4UXNA 5L3GA 4WF9V 3E8HA 5LHIA 3AG4C 2WLIA 2ITDC 3WG7B 2IH3C 4UVCA 1M56C 3BEHA 2R9IA 4JTCB 2IW5A 5HFMA 1V54C 1VQPV 1CP9A 3E86A 4MTFA 3GB7C 4QNHB 1K33A 1E1RG 4F4LA 2XOKG 1QLEC 4E2LA 1SESA 1Q82W 5LGUA 2WLHA 1F51A 1SRYA 4FJCC 4JF3A 3WG7C 2BOCC 2Q69A 1QLNA 3SYQA 2M7WA 4G2KA 2Y69B 4XBFA 5IY5B 4WFAV 3FKSG 3R65A 3AG1C 4JYCA 3CC4V 3JCZA 3K0GA 1BHAA 1F4MA 1RPOA 3CCQV 1EBOA 1QVFU 4X89A 4XDJA 2PI5A 2XAQA 3TETA 1K9MW 3PJSK 4MTGA 3AEIA 3UKMA 5KUKA 3LNMB 4UVAA 4WCEV 2Y69C 5IY5C 4LCUC 3EHBB 1K34A 1R3LC 1WLEA 2EIKB 5L3CA 5GW7A 2X7RB 2X6AA 5J9PC 1L1FA 3E83A 2AHYA 4BAYA 2ZQMA 1K97A 2H8PC 4P2ZA 3RBZA 3DGEA 5IYCO 5IYDO 4U7NA 3CCRV 3ZMTA 2IH1C 3CMAV 4MVRA 2WLNA 1Y4MA 4PA6A 2EIKC 3F5WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R73 A;  3G4S V;  3G71 V;  1YIJ V;  3CCL V;  1KC8 W;  3I55 V;  4WCE V;  5DM6 V;  1S72 V;  1VQN V;  1Q7Y W;  1VQ7 V;  2OTL V;  3CCJ V;  3CCV V;  1VQK V;  1VQM V;  1YIT V;  4WFB V;  1Q82 W;  2OTJ V;  2D3O W;  1N8R W;  1VQ6 V;  1VQ9 V;  1KD1 W;  3CCU V;  2QA4 V;  3G6E V;  3I56 V;  4WF9 V;  1YJ9 V;  3CPW U;  4WFA V;  3CC4 V;  3CXC U;  1Q81 W;  1NJI W;  1QVG U;  3CC7 V;  1YJN V;  3CCR V;  1M90 W;  3CC2 V;  1VQ8 V;  1VQL V;  1VQ4 V;  3OW2 U;  1VQO V;  1K8A W;  1YI2 V;  1YJW V;  3CMA V;  3CCQ V;  3CCE V;  3CD6 V;  1QVF U;  1VQ5 V;  3CCS V;  1Q86 W;  1M1K W;  2QEX V;  1W2B U;  1VQP V;  1K9M W;  1K73 W;  1JJ2 U;  1KQS U;  3CME V;  1YHQ V;  3CCM V; 
#chains in the Genus database with same CATH topology
 5JCO A;  3SPC A;  1RPR A;  4YJ2 A;  5KHG A;  3JSN A;  1VQM V;  1X59 A;  3AG2 B;  1BMF G;  1AI4 A;  4QIW F;  5D5Q A;  3HKE A;  3JAM N;  2P22 C;  3E22 B;  3E89 A;  1H8E G;  1QU7 A;  5B5E Z;  5DEC A;  4ZKI A;  3UM7 A;  1MOF A;  4UUJ C;  3ABL C;  3H1H H;  2ZXW B;  4GX0 A;  1N33 B;  4JZG A;  4JI8 B;  3ZHS A;  4JI5 B;  4I4T A;  4I0X B;  1D5A A;  4FFB B;  3JAS A;  1M56 B;  1SKV A;  4BW9 A;  4CS2 A;  1Q7Y W;  4AI8 A;  3T2M A;  2X0L A;  2CTQ A;  3T1C A;  5IWA O;  5C8Y A;  1TVK B;  4LF9 O;  5B1O A;  3HKB B;  1YCI A;  4JI4 O;  4JI1 B;  3H1J H;  4KXR A;  5H6Q A;  1WPB A;  2QTO A;  2LFS A;  3E8F A;  4FZ1 A;  2HR3 A;  1FXH A;  1HNZ B;  3CCL V;  4B3M B;  1XNQ B;  3E8G A;  3FD9 A;  2D3O W;  4BIO A;  5B3S C;  4UCR A;  4F6R B;  2VQF O;  3LUT B;  4LWS B;  1DK1 A;  1OCZ B;  3E8B A;  4DV7 B;  5LP6 B;  3JD2 A;  3C3S A;  1EN4 A;  2XHB A;  4UB6 Z;  4FLU A;  3JAT B;  1V55 B;  2OYQ A;  4NXM B;  2VRZ A;  4AQY B;  4X65 O;  4DK1 A;  4QPJ A;  1KKD A;  2UXD B;  1XMO B;  3ABU A;  5LBQ A;  3M99 B;  4FPP A;  1NU1 H;  4EFB A;  1XRE A;  1N36 B;  4CC6 A;  3CSX A;  1FXV A;  2BSK B;  2DYS C;  1PL0 A;  1ZL8 B;  2Q6A A;  4GT1 A;  2WWW A;  2M6Y A;  2E5L B;  2DYR C;  3HPL C;  2KB1 A;  3OM3 B;  1Q6U A;  2HFE C;  1W59 A;  2ZKO A;  4UCU A;  4BIU A;  1YJN V;  1CEZ A;  1VQ8 V;  4HNA A;  1S0V A;  1HNX O;  5IE9 A;  1NZ6 A;  5CBG A;  1VF6 A;  1WB7 A;  1PV0 A;  2EX3 A;  2Q67 A;  2FYU H;  3HKD A;  3TCU A;  1TUB B;  2EIJ B;  4FM0 A;  3QNE A;  1OCR C;  2Q4P A;  1SQP H;  1Q6I A;  3UT5 A;  3VOU A;  2JJ1 G;  1YTF B;  1NT2 B;  1EFR G;  3OR6 C;  4U7O A;  2UXB B;  3ZHU A;  4P30 A;  3APQ A;  2WLM A;  2G38 A;  3CX5 F;  5HFL A;  1M5I A;  4XDL A;  3ETD A;  1IBL O;  5J2U B;  2EIL B;  3ML0 A;  5CB4 B;  2HVK C;  4EFE A;  4NXN B;  3ZMZ A;  1IBM B;  1A32 A;  1QBZ A;  3FYI B;  1JX9 A;  4DUZ O;  3AK1 A;  5B1A B;  1VQ4 V;  5LA6 A;  4X8A A;  1EN5 A;  2H94 A;  1S5H C;  3IJ4 A;  3ZRW A;  3Q4H B;  1Y66 A;  1XMQ B;  5C93 A;  3I56 V;  4RQF A;  1H2N A;  2IJK A;  1SQG A;  1FXK C;  1UJW B;  3A0R A;  4K3A A;  4JAA A;  1LNQ A;  1P49 A;  3K04 A;  2R72 A;  3CRM A;  2CDY A;  1GN6 A;  2VS0 A;  3A2F A;  1MSW D;  1M4U A;  2IJH A;  1Z2G A;  4D7S A;  2WLL A;  2B5U A;  1GM8 A;  2XAF A;  1OCO B;  4I9Q A;  3RYI B;  1B04 A;  4NTW A;  4O4I B;  4PA7 A;  4U3F H;  1FXK A;  3SJB C;  1YI2 V;  5AG2 A;  3LSU A;  3ABK B;  1SS3 A;  2EIN B;  2HVJ C;  3QTC A;  4A5U B;  5B1N A;  1XI1 A;  4X1K B;  3STZ C;  1ZLZ A;  1K5S A;  1XEQ A;  1K7D A;  1XL6 A;  5FNV B;  4IHJ B;  4R6Z A;  1D2D A;  2RMK B;  2Y48 A;  4DRX A;  4JV5 O;  3ZMV A;  4FLZ A;  2CE4 A;  5L3F A;  2HKO A;  3OFN G;  4NVP A;  4B3T O;  4DR3 O;  5KHI A;  1SA0 A;  1GO3 F;  2WSS G;  4W4K A;  2YXY A;  2Z5U A;  3K9A A;  4RQE A;  5LYJ B;  3TXS A;  1K3E A;  3ASN C;  4KHP O;  3ZRX A;  2OT5 A;  2WLI B;  3K08 A;  1M57 C;  2IJI A;  3SYP A;  5LGT A;  1IBK O;  3K9S A;  5CA1 A;  1Z5W A;  4O4J A;  1G8M A;  2LW7 A;  5JJJ B;  2YC0 A;  1HR0 B;  4ZOL A;  4LF8 O;  1NI8 A;  2JGU A;  2ZT9 B;  2EIM C;  3JAL A;  5BZB A;  4DV1 B;  2A9H A;  2P6J A;  2XAG A;  2YEV A;  1I0H A;  2ZM6 O;  3T1H B;  3H9V A;  5EC1 C;  3ZIA G;  1VP7 A;  4JI6 B;  4TV8 A;  4LF4 B;  3HB3 B;  2UUC O;  4X1Y A;  2CTW A;  1WNS A;  4H0L B;  1YIT V;  3CP1 A;  1JMK C;  3BRC A;  4UXN A;  4DR4 B;  3AG4 C;  1BGY H;  1WN7 A;  2LO1 A;  3L75 H;  1FFX B;  5HFM A;  1N0N A;  2QM4 A;  1V54 C;  3S3X A;  4MTF A;  1E1R G;  4DR2 B;  3AG7 A;  1XDC A;  3IAY A;  5KAI Z;  3RN4 A;  4FJC C;  1F51 A;  4YJ2 B;  3C90 A;  1Y74 A;  2JGD A;  2QGN A;  2Q69 A;  4LFA O;  1J5E B;  4XBF A;  3R65 A;  3AG1 C;  4JYC A;  3C3T A;  1AB3 A;  3OTO B;  1BHA A;  3HKE B;  4XDJ A;  2XAQ A;  1I08 A;  1SF9 A;  4O2B A;  3AEI A;  4UVA A;  3EHB B;  4DV0 O;  2X6A A;  1R6T A;  5J9P C;  3E83 A;  3JAK A;  4BAY A;  2ADQ B;  4BWA A;  2H8P C;  4IGG A;  4PJ0 Z;  3RBZ A;  4U7N A;  1DGS A;  3ZMT A;  3JAW A;  3SJA C;  4J7K A;  4BR6 A;  4PA6 A;  4TOI A;  4I4T B;  5BR8 O;  1VQN V;  3JAS B;  5KUM A;  1NS1 A;  3UQ8 A;  3FB5 C;  2YIB D;  3M7M X;  4U3J A;  4UB8 Z;  3G6E V;  4OX9 O;  4JI7 B;  5C8Y B;  4YHH O;  4RUF A;  3ABL B;  4I55 A;  2P7T C;  2RN9 A;  3VQV A;  2Q8V A;  1U96 A;  3KCX A;  2ATK C;  1DTO A;  1AJN A;  2DJV A;  3HKC A;  4YIP A;  2Q7E A;  1ZUQ A;  2JDI G;  3QO8 A;  1H2M A;  4B08 A;  1I5Y A;  1PD3 A;  4KUM A;  1ORQ C;  2QDO A;  1US6 A;  1H38 A;  1AVM A;  2P4K A;  2E3C A;  3CD6 V;  4QGP A;  3SYO A;  1JJO A;  3EXA A;  3E2E A;  1JJ2 U;  2QR4 A;  2V7Q G;  1XNR O;  3DXR A;  2R9A A;  1SQF A;  3MDS A;  4LFB B;  2QA4 V;  3CPW U;  5B3S B;  2YIA A;  3W7U A;  3BCC H;  3RGB A;  1U97 A;  4FLX A;  4DR6 B;  4DV2 B;  4O4H A;  1DF5 A;  1BCC H;  5DM6 V;  3CCV V;  4EB6 A;  2E75 B;  3B4S A;  5KX5 A;  3MAQ A;  1NH2 D;  4DR7 O;  4DV5 O;  1EZJ A;  3AK3 A;  4TSF G;  1HNW O;  1VIB A;  3JCU Z;  1PL4 A;  4DW1 A;  4MT8 A;  4HNA B;  2F93 B;  2DQ3 A;  2DW4 A;  3HKD B;  3I5D A;  3FYE B;  5LGN A;  3CRQ A;  2DYS B;  4P9O A;  3VQX A;  1DF4 A;  3VBB A;  2DYR B;  5CBH A;  3UT5 B;  2FB5 A;  1AI7 A;  3BFR A;  4L8J A;  2P06 A;  1EN6 A;  4C7U A;  2QKC A;  1Q3E A;  2KKW A;  4HYO A;  3L72 H;  4X62 B;  4GLX A;  3G71 V;  3ASO C;  1MG1 A;  2BTQ A;  1N32 B;  4QE7 A;  4FM2 A;  3N27 A;  1BT8 A;  5LHH A;  4IIJ A;  2F4V B;  3ZN0 A;  3QO7 A;  4JI5 O;  2IU0 A;  2DWD C;  1OCR B;  1K4C C;  1GKF A;  1NTM H;  2DWE C;  2RNB A;  3D3I A;  5LA6 B;  1XUQ A;  1QR8 A;  4NTX A;  4DV4 B;  3OEE G;  2IJJ A;  3QO5 A;  1HP8 A;  3ZRW B;  4YJ3 A;  3X2Q C;  2Q0A A;  4MVS A;  3GWO A;  2LJ2 A;  5LMN B;  1SER A;  2ZNJ A;  1S76 D;  2V4D A;  4GX1 A;  3U11 A;  1H8H G;  1HNZ O;  2UXC B;  4B3M O;  4LP8 A;  1XNQ O;  4GKK O;  2F95 B;  3J81 N;  5FPR A;  5K1P A;  3H1I H;  2ZE7 A;  3A0H Z;  3WB2 A;  4UCS A;  2WLL B;  2QM8 A;  2PYJ A;  3W7S A;  1HWY A;  3STL C;  4TV9 A;  2K1E A;  4X64 B;  4LFC O;  3B40 A;  4NXM O;  1FXK B;  4AQY O;  3DC5 A;  1VF5 B;  1XHZ A;  4TUY A;  4TQD A;  4TQF A;  5EYP A;  4OPH A;  1YVW A;  4JAS A;  4LF5 B;  3MHH C;  1NKD A;  2A0L A;  4IT5 A;  1N34 B;  1XMO O;  2WLJ A;  1GM9 A;  1RSO B;  1N36 O;  1SQX H;  2YIC A;  4RO2 A;  5EIB D;  2W6I G;  1P7G A;  1K8A W;  3M8A A;  4DRX B;  1LUV A;  4JTD B;  4J9Y B;  5EBM C;  2AHZ A;  3CB2 A;  2L6L A;  2EJR A;  3CCJ V;  1AR1 B;  1SA0 B;  1M9N A;  3LNN A;  1NR7 A;  2VWK A;  2YS8 A;  3RWR D;  1SQQ H;  4JI4 B;  5FPO A;  1TGO A;  5CMU A;  1Y6X A;  4QJF B;  4AIL C;  1YXB A;  1K73 W;  1JPX A;  5CA1 B;  3CME V;  1YHQ V;  3K59 A;  4H44 B;  2DN9 A;  3LDC A;  4X9Q A;  3ZHQ A;  4OPA A;  4O4J B;  3JD1 A;  2P5O A;  1GN2 A;  4PI2 A;  1MAB G;  4ZOL B;  3CRR A;  4J9Z B;  1JCH A;  4XDK A;  2UXB O;  3KKY A;  3JAL B;  1G4Y B;  1NQT A;  1XBL A;  3ASN B;  2RDC A;  2WA3 A;  2YEV B;  1W0J G;  4MW8 A;  1M57 B;  1YJW V;  3BHP A;  5GON A;  5IT9 N;  4TV8 B;  2DQ0 A;  2ITC C;  3ETG A;  4X1Y B;  3P30 A;  2WLK A;  3FB7 C;  4NXN O;  4HAM A;  4JYA B;  2Y4U A;  1IBM O;  1S5J A;  3SPJ A;  5KHH A;  3IFX A;  4ZIB A;  2EIM B;  4LBE C;  4LF7 B;  1J95 A;  3LDD A;  3P32 A;  1FKA O;  1Y76 A;  3ZCC A;  3CCM V;  1XMQ O;  3T1Y B;  4MSW C;  2NNU A;  4Q20 A;  1W0K G;  2V1D A;  3O65 A;  4X88 A;  5CN0 A;  4X66 O;  2OTJ V;  1ZTE A;  2CK3 G;  1Y74 B;  2JGD B;  2R70 A;  4DUY B;  4MVU A;  1I5X A;  3ZHR A;  1WPX A;  4R8C A;  4IL6 Z;  3AG4 B;  4P9P A;  2PTM A;  2QEX V;  1V9P A;  4JI0 B;  4MTX A;  3ZRV A;  4O2B B;  3W7W A;  5GTI Z;  3BA9 A;  2PF4 E;  4B3R B;  1V54 B;  3WU2 Z;  3NXS A;  3QG5 A;  1E1Q G;  4LC1 A;  4GKJ O;  4LH7 A;  4B3S B;  5L3G A;  2YI8 A;  1VAR A;  1M56 C;  2GV9 A;  3BEH A;  3JAK B;  2KSD A;  1BE3 H;  3JAW B;  1CP9 A;  1IZ3 A;  1K33 A;  4QNH B;  2LGQ A;  2VQE B;  1WAZ A;  3QVN A;  5LXT A;  2ZCE A;  1IBL B;  2GDS A;  3ZHV A;  4U3J B;  2A7W A;  1L0N H;  4J10 A;  4WFA V;  3CC4 V;  2CAZ C;  3K0G A;  1H2S B;  4I55 B;  4X1I A;  2Q5Z A;  3AK2 A;  3N2G A;  1RPO A;  2YID A;  4DUZ B;  1H2K A;  3K57 A;  2PI5 A;  2OCH A;  4DV6 B;  3PJS K;  2CH7 A;  2UUB B;  3HKC B;  3SR2 C;  2Y69 C;  5KMG A;  3VQW A;  1WLE A;  1IXB A;  4NYK A;  5GW7 A;  4JI2 O;  1VEW A;  1X4T A;  1RSO A;  3OTF A;  2AHY A;  1EZV H;  3DGE A;  2DE0 X;  3WB0 A;  3DSQ A;  3THO A;  3CMA V;  4MVR A;  4ZHQ A;  3DC6 A;  4O2A A;  2EIK C;  1HR0 O;  5E79 Z;  4QE9 A;  1GN3 A;  1JR9 A;  2A06 H;  3W7T A;  4YXW G;  2NR5 A;  3DXR B;  4DV1 O;  1JA8 A;  3JAR A;  2H3O A;  3OAA G;  1PM9 A;  1HW7 A;  3WFV A;  3T1H O;  2UU9 B;  3G6B A;  5EC2 C;  4DV3 B;  3ZHT A;  4JI6 O;  1OJH A;  4FIP C;  4LH6 A;  4LF4 O;  1FJG B;  2F66 C;  4BIZ A;  3CE2 A;  4DR1 B;  4O4H B;  3B8N A;  2N05 A;  4DR4 O;  2YUA A;  4GUN A;  4MW3 A;  4EB6 B;  4G28 B;  1I94 O;  5KX5 B;  1WB8 A;  2A79 B;  3F7Y C;  1R6N A;  1SC5 B;  5DN6 G;  1JFF A;  1AIL A;  4JI3 O;  1XOU A;  4GX5 A;  2HG5 C;  4DR2 O;  5EBL C;  1L0L H;  1KP2 A;  2GBO A;  5H9C A;  2W0F C;  2ZD9 A;  4JGS A;  1B3Q A;  4I9W A;  2B1G A;  2R9R B;  1YZB A;  1R3I C;  4X20 A;  3LDE A;  4LNU A;  1F23 A;  3K5O A;  4H13 B;  3OTO O;  1QLE B;  3B77 A;  1YDX A;  5JVD A;  3BAA A;  3SDL A;  1OCC C;  1L8D A;  4L87 A;  3OD4 A;  4J41 A;  1IBK B;  1FYJ A;  3K5M A;  4CH3 A;  1S72 V;  1R3K C;  1IUR A;  5CA0 A;  1VQK V;  3AG3 C;  1NTZ H;  2BTQ B;  2Q7H A;  1N0J A;  4IIJ B;  4FMT A;  3BA8 A;  5H6R A;  2ARH A;  4GZR B;  3BY6 A;  4AHC A;  2OCC C;  1YTF D;  2E74 B;  2ZM6 B;  4ASU G;  5IJ0 A;  2ETN A;  4O4L A;  3F5T A;  3OUS A;  4PDL A;  2UUC B;  2MW2 B;  3L9D A;  3ZJZ A;  4YJ3 B;  2QKS A;  3ASO B;  2HJD A;  4PDR A;  3S3W A;  2UUA B;  2HJF C;  1SQV H;  2Q9L A;  2BE3 A;  1Q81 W;  2WAM A;  1M90 W;  2YIB A;  3T4Z A;  4FFK A;  3FAV A;  3LSQ A;  4ABM A;  3ABM C;  3OE7 G;  2RCV A;  3P3N A;  4B7E A;  1SQB H;  5LL6 Y;  4KFM A;  2K9P A;  2AW9 A;  1Q5O A;  4K35 A;  1B06 A;  2EIN C;  2EBO A;  4ZI7 A;  4TV9 B;  3X2Q B;  1I7F A;  4JAV A;  4YIO A;  1Y67 A;  3BVO A;  1R6K A;  4LF6 B;  3CRC A;  2HHH B;  1GTO A;  1R73 A;  2W6J G;  1N4C A;  1QQC A;  4LFB O;  2ILM A;  1B6Q A;  3D36 C;  4TUY B;  1BS3 A;  4H37 A;  5EYP B;  3KG2 A;  1VQ9 V;  2AXT Z;  1BQ0 A;  2QKA A;  4D6T H;  5FL7 G;  4R7C A;  4DR6 O;  4DR5 B;  4PA4 A;  4DV2 O;  2EZP A;  2LQT A;  2XAS A;  3EVK A;  2BCC H;  4CZZ A;  3O9O A;  3MD0 A;  1KKC A;  3OR7 C;  2XUM A;  1N8R W;  1AP6 A;  3D36 A;  1EM1 A;  3ABT A;  5EBW C;  2P67 A;  4I5S A;  2PY5 A;  2BOB C;  1D5N A;  4CBC A;  1JOY A;  4K0K B;  5EZY A;  2OIG A;  3CHX A;  1ZWI C;  4CS3 A;  2Q68 A;  4G27 B;  1KC8 W;  2ODM A;  4TWK A;  2JIZ G;  4PA3 A;  2OWO A;  2QM7 A;  1COW G;  4FM1 A;  3OMN B;  1NR1 A;  4EKW A;  5IYZ A;  5BXZ A;  3CC2 V;  3GWK C;  2ZIO A;  4WFF A;  3OW2 U;  4KP4 A;  2Z3Y A;  2LGW A;  3ZX6 A;  3FB8 C;  2KG7 A;  2FKX A;  3ETQ A;  3CS5 A;  3K58 A;  1MZE A;  1N32 O;  1ZSP A;  2NN4 A;  1XNR B;  1RP3 B;  2ZR3 A;  2Y4T A;  5GON B;  2AGA A;  2F4V O;  4B7K A;  4FLV A;  1ZAU A;  2YSU B;  4DO2 A;  5KLV H;  4ZBM A;  1PNK A;  1QVG U;  3ZMU A;  5J2T A;  3D8C A;  4K8Z A;  3CCE V;  1VQ5 V;  1F7Y A;  4DV4 O;  2P4V A;  5DED A;  1R3J C;  3ICX A;  1Y76 B;  1N33 O;  2XTA A;  5GTH Z;  5TIS Z;  1OV9 A;  1NVP D;  3PN1 A;  3ZMS A;  5LMN O;  4BW5 A;  5LOV A;  5LMU B;  1JVM A;  2WPD G;  4JI8 O;  4WFH A;  1BL8 A;  1KP3 A;  2CUG A;  3ZN1 A;  1FPO A;  3SJQ C;  4YY3 B;  5EK0 A;  4ICG A;  1UFI A;  2UXC O;  4W4L A;  3R66 A;  3L73 H;  1PNM A;  1IVS A;  4H33 A;  1KBH A;  1AI5 A;  1KYO F;  4UVB A;  2F23 A;  3I55 V;  1HDJ A;  1MMM A;  1AR5 A;  2PI4 A;  4JI1 O;  3CCU V;  3K06 A;  1TA8 A;  3J7A U;  1AJP A;  4J7J A;  4X64 O;  3A0B Z;  1MZF A;  5ITZ A;  4WFE A;  1KB9 F;  2B1I A;  4MVO A;  3CCS V;  2GUZ A;  1T5E A;  2D2C B;  5EIB C;  5K1X A;  2JS3 A;  4LF5 O;  3SJC C;  1N34 O;  1IX9 A;  2Z0A A;  5E1A C;  5B66 Z;  4CH4 A;  3TK1 A;  5B1B C;  2CTR A;  5LXT B;  2HP8 A;  1RM1 C;  3ETE A;  4DV7 O;  1QNM A;  2F1M A;  4X1I B;  1PKX A;  3RYF A;  1XL4 A;  4DXW A;  3N2G B;  3RYC A;  3APO A;  1PPJ H;  2HLD G;  1GN4 A;  1XHX A;  2CH7 B;  2JS5 A;  2AZ0 A;  2IM9 A;  4I50 A;  3D3Q A;  5KMG B;  1AJQ A;  2UXD O;  5JQG A;  1R1B A;  4WF9 V;  5LHI A;  2ITD C;  5KHK A;  2IH3 C;  4UVC A;  4PV1 B;  3RYH A;  4JTC B;  1VQP V;  2E5L O;  4ZHQ B;  3UO3 A;  4O2A B;  3UO2 A;  4GKK B;  1SES A;  1LUW A;  1Q82 W;  3CEI A;  4JF3 A;  1SRY A;  3WG7 C;  5BMV A;  2ZIM A;  2M7W A;  4G2K A;  2Y69 B;  5IWA B;  2ZE5 A;  4WBN A;  3JAR B;  4LF9 B;  3GVM A;  3JCZ A;  4DYL A;  4PHZ A;  1F4M A;  1Q8I A;  3CCQ V;  4LFC B;  1QVF U;  4X89 A;  2B9Z A;  3TET A;  3CXH F;  4MTG A;  5KUK A;  1P84 F;  4WCE V;  5IY5 C;  4JYA O;  1K34 A;  2EIK B;  2RJZ A;  1Z5V A;  2IBZ H;  3P3P A;  4Z1V A;  1BSM A;  2X7R B;  1UPG A;  1O9H A;  1L1F A;  4LF7 O;  1VF6 C;  2ZQM A;  5IYD O;  3CCR V;  5IYC O;  2VQF B;  3NR7 A;  4J11 A;  5A2Q N;  1JFF B;  3T1Y O;  2YDE A;  2BTO A;  2E76 B;  4JZ2 A;  5IJ9 A;  4PI0 A;  2EZO A;  3G4S V;  1VQ7 V;  2OTL V;  3E35 A;  2JEX A;  1ROP A;  5CA3 A;  4X65 B;  4DUY O;  5JH7 A;  2QWQ B;  1XIL A;  1P7B A;  4X20 B;  1KEC A;  4LNU B;  4F6E A;  2GHY A;  1QCE A;  3SPI A;  3CXC U;  1GM7 A;  4JTA B;  4R50 A;  5JVD B;  4FZ0 A;  4LR3 A;  4JI0 O;  1KUQ A;  1GRJ A;  2PZS A;  5JWP A;  1AP5 A;  3AG2 C;  3T4D A;  4B3R O;  1AR4 A;  4MVQ A;  3W7X A;  4B3S O;  1URF A;  5CA0 B;  4TT3 G;  3SYC A;  1WA8 A;  4RAI A;  3CJH A;  3N2K A;  2ADP A;  1TAE A;  4FVM A;  3ZRS A;  2P90 A;  1TUE B;  4FK5 C;  1NJI W;  5A9G A;  1KU9 A;  1OZ0 A;  3G67 A;  2JEU A;  1NBM G;  4K8X A;  2ZXW C;  3G80 A;  1HNX B;  2VQE O;  1QHT A;  5L3D A;  4J42 A;  1OCC B;  4PEL A;  5BY1 A;  4UCO A;  1YF2 A;  2QWP B;  5IJ0 B;  2PYL A;  5JJN B;  4O4L B;  3B8M A;  3OMI B;  1S3J A;  1FS0 G;  2XT9 A;  1SZX A;  2VWJ A;  1QR9 A;  3AG3 B;  4JYB A;  3H1L H;  1NTK H;  3CC7 V;  3E22 A;  5F2V O;  3K5N A;  4DV6 O;  3LSS A;  2UUB O;  2EJ7 A;  3AG1 B;  3FAV B;  3RVY A;  4CH5 A;  2QWN B;  2OCC B;  1YIJ V;  2JJ2 G;  2CGO A;  3H01 A;  3RW0 A;  1P4R A;  2QTS A;  4PDV A;  4MS2 A;  4DW0 A;  4X66 B;  3KCY A;  5L3E A;  2KQX A;  5CBF A;  4I0X A;  3CYO A;  4FFB A;  1MNG A;  4ZI7 B;  5IDJ A;  1K5Q A;  2YI9 A;  2PUS A;  1LR1 A;  3ZS8 C;  2JVD A;  2RQ6 A;  4GCZ A;  3ABM B;  3OUF A;  1FFT B;  1TVK A;  3HKB A;  2ZDI C;  3ZED A;  1KD1 W;  1IDS A;  1G1X B;  4Z1M G;  2UU9 O;  1OCZ C;  3K3W A;  4GKJ B;  4RUE A;  4DV3 O;  2F43 G;  5LP6 C;  5IYB O;  1V55 C;  1FJG O;  4PD4 F;  4CH6 A;  4DR1 O;  1SZT A;  1Q86 W;  4PA9 A;  4GX2 A;  3JSL A;  1S77 D;  3OMA B;  4N21 A;  2O57 A;  1CPY A;  4F6R A;  4OXS A;  4PDM A;  3ZBH A;  2GTA A;  2QJ1 A;  2ZDI A;  3K79 A;  4LWS A;  1AI6 A;  5D5P A;  1O9G A;  3CRA A;  1Q90 D;  4NTY A;  5LP6 A;  2N04 A;  3JAT A;  3RT3 C;  2X6B A;  3L71 H;  1NH2 B;  1K4D C;  5EZY B;  3H1K H;  1XQ8 A;  1YSC A;  3K03 A;  3JYC A;  1PNL A;  2ZIN A;  3JD3 A;  4MVM A;  1E79 G;  4JI2 B;  1WP8 A;  3RVZ A;  3FX7 A;  2QE7 G;  5IYZ B;  5H2F Z;  2BSK A;  2XAJ A;  4NKG B;  1ZL8 A;  4J7Z A;  1W2B U;  2EIJ C;  4JV5 B;  2ZE6 A;  2KG7 B;  3EFF K;  1Q6H A;  4B3T B;  4UV9 A;  4DR3 B;  1J5E O;  3MHS C;  1ZX3 A;  4CC5 A;  1MA1 A;  2HEP A;  1F4N A;  2CTP A;  4I7Z B;  1THZ A;  5FLX N;  1YJ9 V;  3K5L A;  4KHP B;  1NVP B;  5J2T B;  1MSD A;  2XAH A;  1M1K W;  1PP9 H;  3IGA C;  3B09 A;  2A3Q A;  1TUB A;  2EIL C;  2ZE8 A;  1RFY A;  2NLJ C;  1S5L Z;  2Y0I A;  2X6C A;  2UUA O;  2Q7G A;  4N23 A;  4EEQ A;  4IYH A;  5B1A C;  4LF8 B;  5LOV B;  2L35 A;  1I94 B;  3SGI A;  2Q0O C;  4IYI A;  4FLT A;  3FFQ A;  4DK0 A;  4J80 A;  4Q6G A;  3TJT A;  3BAB A;  1DLB A;  4JI3 B;  1ARO P;  1WP7 A;  2YXL A;  1KQS U;  3HR0 A;  4CS4 A;  2DMX A;  5LHG A;  5J2U A;  4KL1 A;  1IXM A;  4JI7 O;  2QWO B;  1ENV A;  3RFR A;  5CB4 A;  5L3B A;  1VMG A;  2PGG A;  2UXX A;  2Y0P A;  2FL4 A;  1BQZ A;  4UCV A;  4D7T A;  4LF6 O;  4UV8 A;  3CWB H;  5ITZ B;  2JK5 C;  2YXH A;  2HHH O;  1OHH G;  2FTK A;  3QF7 A;  5KAF Z;  4WFG A;  3Q4H A;  2GUZ B;  3BPZ A;  4HZ3 A;  3L70 H;  3L74 H;  4GYC B;  1OCO C;  4QPK A;  3JD0 A;  2C2A A;  2IU3 A;  1YEW A;  1CXZ B;  4JPR A;  1GMG A;  4DR5 O;  4JAU A;  3ABK C;  2ZR2 A;  2LFR A;  4LFA B;  3KZI Z;  3SYA A;  3IC7 A;  3A8T A;  5KA5 A;  5KA6 A;  2DOS A;  2QWR B;  3RYF B;  3RYC B;  2LP7 A;  1K92 A;  1JQ0 A;  2N74 A;  3FB6 C;  2UXN A;  2GSM B;  4I50 B;  3OGC C;  3RYI A;  2LW1 A;  4O4I A;  2GTS A;  5JQG B;  4UCT A;  4DV0 B;  2ZNI A;  3IC9 A;  4K0K O;  5B1B B;  3OEH G;  3F7V C;  3SPG A;  2MK3 A;  1BHB A;  3DTU B;  1RM1 B;  1M93 A;  3RYH B;  4FLW A;  4X1K A;  2XND G;  1GAX A;  4E4E A;  3UCS C;  5BR8 B;  3JD4 A;  1VF7 A;  5BMV B;  2WA4 A;  5FNV A;  1SET A;  1GK9 A;  4IHJ A;  4MVZ A;  4OX9 B;  4WBN B;  3J80 N;  4YHH B;  1H2G A;  4MTO A;  1G6U A;  2Q73 A;  1VQL V;  1VQO V;  3SPH A;  1FAF A;  3OGI B;  3VQY A;  4NB5 A;  3K0D A;  4WFB V;  5LYJ A;  1Q43 A;  3U0Z A;  3WB1 A;  4RWU A;  4HBN A;  1VQ6 V;  2OIE A;  3E8H A;  2WLI A;  3WG7 B;  2JRI A;  2R9I A;  2CGN A;  2IW5 A;  1GH6 A;  4X62 O;  1BZK A;  3E86 A;  1H2L A;  3GB7 C;  4F4L A;  4NR1 A;  2XOK G;  1QLE C;  5H5N A;  4E2L A;  5IJ9 B;  3TXQ A;  5LGU A;  5LMU O;  2WLH A;  2BOC C;  5JJE B;  1QLN A;  3SYQ A;  4FLY A;  5JH7 B;  5IY5 B;  2AZ2 A;  3FKS G;  4YY3 O;  1KMI Z;  3TGU H;  2QSA A;  4Z2W A;  1EBO A;  5JCO C;  2FML A;  1K9M W;  3B2E E;  3UKM A;  3LNM B;  5KHJ A;  4LCU C;  1WJZ A;  4UFZ A;  1R3L C;  5L3C A;  2W0X A;  1WA8 B;  4JYY A;  3CJH B;  3N2K B;  4DR7 B;  4DV5 B;  1FFX A;  3U10 A;  1K97 A;  4P2Z A;  1HNW B;  2IH1 C;  1FD9 A;  3OT7 A;  4OGQ B;  2WLN A;  1Y4M A;  3F5W C;  2EUL A; 
#chains in the Genus database with same CATH homology
 3SPC A;  2EZO A;  3G4S V;  1VQN V;  1RPR A;  4QE9 A;  5KUM A;  1VQ7 V;  3FB5 C;  3E35 A;  3W7T A;  2OTL V;  4YXW G;  1VQM V;  2JEX A;  1ROP A;  3AG2 B;  5CA3 A;  1BMF G;  3G6E V;  1P7B A;  3OAA G;  1KEC A;  2GHY A;  4RUF A;  1QCE A;  3ABL B;  3SPI A;  3WFV A;  2P7T C;  3CXC U;  1GM7 A;  4JTA B;  5EC2 C;  4R50 A;  1AI4 A;  4QIW F;  3E89 A;  4FIP C;  1H8E G;  2ATK C;  1DTO A;  1AJN A;  3AG2 C;  4ZKI A;  4BIZ A;  3T4D A;  3UM7 A;  1MOF A;  4MVQ A;  3B8N A;  4UUJ C;  3W7X A;  3ABL C;  2JDI G;  2ZXW B;  3QO8 A;  4GX0 A;  4MW3 A;  4G28 B;  4TT3 G;  3SYC A;  4RAI A;  3ZRS A;  1I5Y A;  2A79 B;  2P90 A;  1TUE B;  1PD3 A;  4KUM A;  3F7Y C;  1R6N A;  1ORQ C;  4FK5 C;  1NJI W;  5DN6 G;  1H38 A;  1OZ0 A;  3CD6 V;  3SYO A;  2JEU A;  4GX5 A;  1NBM G;  2HG5 C;  5EBL C;  3E2E A;  1KP2 A;  2ZXW C;  2V7Q G;  1JJ2 U;  5L3D A;  4PEL A;  1OCC B;  5H9C A;  1M56 B;  2W0F C;  2ZD9 A;  4JGS A;  1Q7Y W;  3T2M A;  2X0L A;  4I9W A;  3B8M A;  2B1G A;  2R9R B;  3T1C A;  1R3I C;  3OMI B;  1S3J A;  1FS0 G;  1F23 A;  3LDE A;  2QA4 V;  5B1O A;  3CPW U;  1QLE B;  1QR9 A;  3AG3 B;  4JYB A;  3B77 A;  5B3S B;  3CC7 V;  3W7U A;  5H6Q A;  1OCC C;  2QTO A;  2LFS A;  3E8F A;  3LSS A;  4L87 A;  2HR3 A;  3AG1 B;  1FXH A;  3RVY A;  2OCC B;  1YIJ V;  3CCL V;  1DF5 A;  5DM6 V;  2JJ2 G;  1R3K C;  1S72 V;  3CCV V;  3E8G A;  3AG3 C;  3H01 A;  1VQK V;  3RW0 A;  2D3O W;  1P4R A;  4PDV A;  4MS2 A;  5B3S C;  1NH2 D;  5L3E A;  1EZJ A;  4FMT A;  4TSF G;  5H6R A;  5CBF A;  3LUT B;  3CYO A;  3BY6 A;  1OCZ B;  2OCC C;  3E8B A;  5IDJ A;  4MT8 A;  1K5Q A;  1YTF D;  3JD2 A;  1V55 B;  4ASU G;  2DQ3 A;  2DW4 A;  3OUS A;  4GCZ A;  3ABM B;  3OUF A;  1FFT B;  3FYE B;  5LGN A;  4PDL A;  2DYS B;  4QPJ A;  3ZJZ A;  1KKD A;  4P9O A;  2ZDI C;  1KD1 W;  2QKS A;  4Z1M G;  1DF4 A;  3ASO B;  3VBB A;  1OCZ C;  2DYR B;  3K3W A;  4PDR A;  5CBH A;  4RUE A;  2HJF C;  2F43 G;  3ABU A;  5IYB O;  1AI7 A;  1V55 C;  2WAM A;  5LBQ A;  1Q81 W;  1M90 W;  3M99 B;  4FPP A;  3T4Z A;  3LSQ A;  3ABM C;  3OE7 G;  1SZT A;  1Q86 W;  1FXV A;  4HYO A;  2DYS C;  1PL0 A;  4GX2 A;  4PA9 A;  2Q6A A;  4GT1 A;  2WWW A;  3G71 V;  3ASO C;  1S77 D;  4KFM A;  2DYR C;  1MG1 A;  3HPL C;  3OMA B;  4QE7 A;  4N21 A;  2KB1 A;  1CPY A;  3OM3 B;  5LHH A;  3ZN0 A;  4OXS A;  3QO7 A;  4PDM A;  2HFE C;  2ZDI A;  3K79 A;  2IU0 A;  2EIN C;  2DWD C;  1OCR B;  2EBO A;  1AI6 A;  1K4C C;  1GKF A;  2DWE C;  4BIU A;  1YJN V;  1CEZ A;  1VQ8 V;  3X2Q B;  1S0V A;  4JAV A;  3D3I A;  2X6B A;  5CBG A;  1R6K A;  1QR8 A;  1NH2 B;  2Q67 A;  1GTO A;  1K4D C;  1R73 A;  2W6J G;  3OEE G;  1B6Q A;  2IJJ A;  3QO5 A;  3ZRW B;  3TCU A;  1YSC A;  2EIJ B;  3K03 A;  4H37 A;  3QNE A;  1OCR C;  3KG2 A;  1VQ9 V;  3JYC A;  3VOU A;  3X2Q C;  1PNL A;  2JJ1 G;  4MVS A;  3JD3 A;  3GWO A;  4MVM A;  1YTF B;  1E79 G;  5FL7 G;  1EFR G;  1SER A;  1S76 D;  3OR6 C;  3RVZ A;  4U7O A;  4R7C A;  2QE7 G;  4GX1 A;  4PA4 A;  2EZP A;  2XAJ A;  1H8H G;  4P30 A;  2XAS A;  2EIJ C;  1W2B U;  2WLM A;  4LP8 A;  5HFL A;  3EFF K;  4CZZ A;  4XDL A;  3ETD A;  3MD0 A;  3OR7 C;  4UV9 A;  1N8R W;  3MHS C;  3D36 A;  2WLL B;  1F4N A;  2QM8 A;  2EIL B;  1THZ A;  1YJ9 V;  3ML0 A;  2HVK C;  3ABT A;  5EBW C;  3W7S A;  1HWY A;  2P67 A;  4I5S A;  3STL C;  3ZMZ A;  2K1E A;  2BOB C;  1QBZ A;  3FYI B;  1JX9 A;  1VQ4 V;  5B1A B;  4X8A A;  4CBC A;  1NVP B;  1FXK B;  1JOY A;  2XAH A;  1M1K W;  2H94 A;  1S5H C;  1ZWI C;  3IGA C;  2Q68 A;  4G27 B;  3ZRW A;  1KC8 W;  2EIL C;  4TWK A;  2JIZ G;  4PA3 A;  1Y66 A;  2NLJ C;  2X6C A;  2QM7 A;  4JAS A;  4N23 A;  1COW G;  1NKD A;  2A0L A;  3MHH C;  5C93 A;  3I56 V;  4RQF A;  5B1A C;  2IJK A;  2WLJ A;  3OMN B;  1GM9 A;  1FXK C;  1UJW B;  3A0R A;  1NR1 A;  4EKW A;  4RO2 A;  3CC2 V;  2W6I G;  4WFF A;  3OW2 U;  1K8A W;  4KP4 A;  1LNQ A;  2Z3Y A;  3K04 A;  4JTD B;  4J9Y B;  1DLB A;  3FB8 C;  1ARO P;  5EBM C;  2AHZ A;  1MSW D;  1KQS U;  2ZR3 A;  2EJR A;  2IJH A;  3CCJ V;  5LHG A;  1AR1 B;  2WLL A;  1IXM A;  1M9N A;  2B5U A;  1ENV A;  1NR7 A;  2YSU B;  1GM8 A;  5L3B A;  2XAF A;  1OCO B;  4DO2 A;  2UXX A;  4ZBM A;  1PNK A;  4PA7 A;  1QVG U;  5CMU A;  3ZMU A;  1FXK A;  4UV8 A;  1YI2 V;  2JK5 C;  3CCE V;  1OHH G;  2FTK A;  1VQ5 V;  4QJF B;  3ABK B;  4WFG A;  1K73 W;  2EIN B;  2HVJ C;  1JPX A;  3CME V;  1R3J C;  1YHQ V;  5B1N A;  4HZ3 A;  3LDC A;  3STZ C;  1OCO C;  4QPK A;  3JD0 A;  3JD1 A;  2C2A A;  2IU3 A;  1NVP D;  3ZMS A;  1MAB G;  4BW5 A;  4JPR A;  1JVM A;  2WPD G;  1GMG A;  4WFH A;  1BL8 A;  1KP3 A;  1K5S A;  1JCH A;  1K7D A;  4J9Z B;  4JAU A;  4XDK A;  3ZN1 A;  1XL6 A;  3ABK C;  3SJQ C;  1G4Y B;  2ZR2 A;  2LFR A;  1NQT A;  4R6Z A;  3SYA A;  3IC7 A;  2Y48 A;  5KA5 A;  5EK0 A;  3ASN B;  3ZMV A;  5KA6 A;  1PNM A;  4H33 A;  5L3F A;  2YEV B;  1W0J G;  2HKO A;  3OFN G;  1AI5 A;  4MW8 A;  2LP7 A;  1M57 B;  4UVB A;  1YJW V;  1K92 A;  3I55 V;  1JQ0 A;  2WSS G;  1GO3 F;  2DQ0 A;  2ITC C;  3ETG A;  2Z5U A;  3FB6 C;  2UXN A;  3K9A A;  2PI4 A;  2GSM B;  4RQE A;  3CCU V;  3P30 A;  3K06 A;  2WLK A;  3FB7 C;  1K3E A;  3OGC C;  4HAM A;  1AJP A;  3ASN C;  3ZRX A;  2OT5 A;  3SPJ A;  2WLI B;  3K08 A;  1M57 C;  2IJI A;  4WFE A;  3IFX A;  3OEH G;  5B1B B;  3SYP A;  3F7V C;  2EIM B;  4LBE C;  3SPG A;  2MK3 A;  5LGT A;  2B1I A;  1BHB A;  3DTU B;  1J95 A;  1RM1 B;  4MVO A;  3CCS V;  3LDD A;  3P32 A;  2XND G;  3ZCC A;  3CCM V;  1G8M A;  2NNU A;  4MSW C;  4Q20 A;  1W0K G;  2V1D A;  4X88 A;  5CN0 A;  5E1A C;  2OTJ V;  3JD4 A;  3TK1 A;  2CK3 G;  5B1B C;  2EIM C;  1SET A;  1GK9 A;  5BZB A;  4MVU A;  4MVZ A;  2A9H A;  3ETE A;  1I5X A;  1RM1 C;  2P6J A;  1WPX A;  4R8C A;  1H2G A;  4MTO A;  2XAG A;  1VQL V;  1VQO V;  2YEV A;  3AG4 B;  4P9P A;  1PKX A;  3SPH A;  4DXW A;  1XL4 A;  5EC1 C;  2QEX V;  2HLD G;  3ZIA G;  4MTX A;  3HB3 B;  3K0D A;  3ZRV A;  3W7W A;  1YIT V;  1V54 B;  4WFB V;  1VQ6 V;  3NXS A;  3CP1 A;  1E1Q G;  4LC1 A;  1AJQ A;  4UXN A;  5L3G A;  4WF9 V;  3E8H A;  5LHI A;  3AG4 C;  2WLI A;  2ITD C;  3WG7 B;  2IH3 C;  4UVC A;  1M56 C;  3BEH A;  2R9I A;  4JTC B;  2IW5 A;  5HFM A;  1V54 C;  1VQP V;  1CP9 A;  3E86 A;  4MTF A;  3GB7 C;  4QNH B;  1K33 A;  1E1R G;  4F4L A;  2XOK G;  1QLE C;  4E2L A;  1SES A;  1Q82 W;  5LGU A;  2WLH A;  1F51 A;  1SRY A;  4FJC C;  4JF3 A;  3WG7 C;  2BOC C;  2Q69 A;  1QLN A;  3SYQ A;  2M7W A;  4G2K A;  2Y69 B;  4XBF A;  5IY5 B;  4WFA V;  3FKS G;  3R65 A;  3AG1 C;  4JYC A;  3CC4 V;  3JCZ A;  3K0G A;  1BHA A;  1F4M A;  1RPO A;  3CCQ V;  1EBO A;  1QVF U;  4X89 A;  4XDJ A;  2PI5 A;  2XAQ A;  3TET A;  1K9M W;  3PJS K;  4MTG A;  3AEI A;  3UKM A;  5KUK A;  3LNM B;  4UVA A;  4WCE V;  2Y69 C;  5IY5 C;  4LCU C;  3EHB B;  1K34 A;  1R3L C;  1WLE A;  2EIK B;  5L3C A;  5GW7 A;  2X7R B;  2X6A A;  5J9P C;  1L1F A;  3E83 A;  2AHY A;  4BAY A;  2ZQM A;  1K97 A;  2H8P C;  4P2Z A;  3RBZ A;  3DGE A;  5IYC O;  5IYD O;  4U7N A;  3CCR V;  3ZMT A;  2IH1 C;  3CMA V;  4MVR A;  2WLN A;  1Y4M A;  4PA6 A;  2EIK C;  3F5W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...