1VQCA

Gene v protein mutant with val 35 replaced by ile 35 and ile 47 replaced by phe 47 (v35i, i47f)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYIDLGNEYPVLVKFTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
total genus 11
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqcA00
5M5XH 4JI5Q 1AE3A 3CCVA 3OTOQ 2ATWA 4YWLA 3FKIH 3RR5A 3GTQH 1HR0W 3HOZH 1YIJA 1E7ZA 2UU9L 4JCVE 2K5VA 3EIVA 3Q8DA 3JAMi 1QVGA 1PH6A 1M1KC 1HNWQ 4QY7A 3PUYA 5JJLA 2JA6H 1X54A 2VQEQ 2HQLA 1VQ5A 4A3IH 3H3VI 5HY6A 2IT1A 1G51A 5M3MH 1V1QA 4DR1Q 1PH8A 4A3KG 1HZBA 2HHHL 3PO2G 5FLMH 2KENA 2RHQB 3HKSA 4JI0L 4JBKA 4DK6C 3I4MH 1CKOA 3RZDH 1X3GA 4B3SQ 3NENA 2R93G 4K0KL 4A4IA 1TWFH 2JK8A 2NZHA 3KF6A 4DR2L 3GTGH 4JI1Q 3ULJA 4RG1A 4QJFA 4LF8L 3AYHB 1JE5A 1WYDA 5IYCG 2E8GA 5AJ3L 4DR7Q 4JYAQ 3U4ZA 3DM3A 4DV6L 3BU2A 1B8AA 3KFUA 1PH3A 1IZ6A 1HNXL 1SR3A 1C7YA 2ASBA 2JE6I 1R9TH 3ERSX 2Y0SG 4QL5A 1J6QA 2AKWB 1D8LA 3KDFA 2A19A 4NXML 4JI8Q 1CKNB 4UP8A 2ZTCA 3KLWA 5GADC 3S1RH 4HIMA 3ER0A 1VQ4A 4POGA 2UXBQ 1AH9A 1H95A 1QZGA 2UUBL 4LFCL 2N8NA 4XIGS 3HOVH 1EQQA 2UXDQ 2NN6G 3GDEA 3J80i 4A3GH 4R4TA 2YTYA 3WWVA 1VQIA 1Q82C 1TWGH 4AQYL 4A3FH 5GQOA 3UDIA 1QUQA 4GS3A 3PO2H 2JQOA 4UP7A 3GTMH 3RZOH 3M7NA 3E9IA 2YTVA 3I2ZA 2NVTH 1A63A 5J3BA 2HIVA 3CPWA 4LF9Q 1XNQL 2L15A 2EIFA 2PI2E 3K7AH 1K8GA 4BXXG 2UU9Q 2ZJRA 1VQDA 2PMZE 4PZ6A 4DV4L 4IO9A 1XMQL 2VQFL 1N33L 3M4OH 3S2HH 4GN3B 3EN2A 3SGIA 4LF6L 2VNUD 3CCQA 3B6YA 4Y52H 1EWIA 2HHHQ 1KXLA 1GO3E 1EYGA 3CP0A 5JEAG 4GKKL 2I5LX 4JI0Q 2JA7H 4MZ9A 1VQFA 3KF6B 2ZJQA 3F8TA 3H15A 3BJUA 1HZAA 3UDXA 3M3YH 3PCOB 4DAYB 4DR2Q 3PV0A 3OTOL 1OXUA 1VQOA 1TWAH 1PA6A 1V43A 1BBUA 2K5NA 4DV6Q 1YBYA 2CWAA 1PH5A 1YHAA 3BZKA 2WAQE 4A3JH 4QGUA 1HNXQ 1KD1C 2R7DA 3KDFB 3MEFA 1Y1VH 4KLKA 2E2IH 5GAHC 1FL0A 4DR1L 3I56A 3TQYA 4KHPL 4NXMQ 3PF4A 3K80C 4UP9A 1HZCA 1K9MC 2UXCQ 1TWHH 3NBHB 1Q7YC 2R7ZG 4BXXH 1I6HH 5E7NA 5JEAJ 2UUBQ 4LFCQ 4X62Q 4EX5A 1TXYA 1SN8A 4JI1L 1X56A 5IP9H 4X65L 3E9HA 2CKZB 2XTIA 3LGJA 4JYAL 1SFOH 5GAEC 3ULPA 4A3LG 3J80c 1I50H 1NMFA 3AFQA 1UE1A 2JA6G 2D0OA 3UDFA 1C9OA 5IY0A 4A3IG 2N78A 4O0AA 5M3MG 1B70B 4YCUA 3JC66 1RL2A 4P75A 2QA4A 3L0OA 5FLMG 2EXDA 3E0EA 1IBML 1XNQQ 2I0QA 1W3SA 1BKBA 4BBRG 4DKAC 2K50A 5C0XG 4DV4Q 1JMCA 1EUJA 3CW2C 2NVQH 3PUVA 2MQHA 1N33Q 3J81i 1YZ6A 4X6AH 3GO5A 3PSIA 1BVSA 4OWXB 1LM0A 1A0IA 4GLXA 4OX9Q 1O7IA 5EAYA 3S1QH 4B3RL 3AFPA 3STBD 4BBSG 2B3GA 3L7ZC 4LWCA 4LFAQ 3S24A 1K73C 4TVAB 2AMCB 4DR5Q 3U50C 3S14H 4GKKQ 1VS0A 5DLQE 1VQGA 2R7ZH 2UUAL 1GD7A 1VQCA 3G6EA 4DV3Q 4BY1H 4LF9L 1OXVA 2BA1A 3U58A 4R4OA 3CC2A 4A3LH 1DGSA 4WJ4A 1WJJA 1XTDA 1MIUA 1IXRA 2R7FA 4UY8C 3HOVG 2YYZA 5C0XJ 4A3GG 4GLVB 4P72A 2K52A 2KHJA 2MFIA 3A5ZB 5C3EG 2WP8J 4LF4L 4KHPQ 2IY5B 1L1OA 4A3FG 1PH9A 1G6PA 2NZOA 1VQKA 4OO1I 2QEXA 4A3BH 1CSQA 3F2CA 1YJ9A 4LF7Q 2K75A 2V1CC 4BBRH 1VQ6A 4R4IA 4DUZQ 3HFZB 1YVCA 3CCJA 3PGZA 5ELNA 5IT9c 4OWWB 4UPAA 1PH7A 2VUMG 4X65Q 1KHIA 1Z47A 2IHEA 3K7UC 3F2BA 4PMWA 1PYBA 2YV5A 1L1OC 3OYYA 4YY3Q 2A1AA 4BBSH 2BH8A 1EIYB 1PYSB 2MNAA 3GTLH 3ZJYC 1RIPA 3M4PA 3ICEA 4LFBQ 4JOIA 2I5MX 3FP9A 3NEMA 4QQBX 1K8AC 2QGQA 1D7QA 1IBMQ 4NB3A 2MO0A 2PQAA 3I55A 4J15A 2UXCL 2JA7G 4IFDG 1I5FA 1XJVA 2VS1A 1S3OA 3GTJH 1LYLA 1HH2P 1U0LA 1HNZL 3TEHB 4X62L 1OXSC 2ZJPA 3J81c 2EQSA 4GOPA 3CD6A 3J7A5 5C3EH 2Q2TA 5C4XH 4B3RQ 1ASYA 2A8VA 4MTNA 4YCVA 1U5KA 1NY4A 4A3JG 4L5SA 4A3DG 3CPFA 1PVOA 5IYDH 4LUVA 1Y1VG 1YEZA 3CXCA 1J5EL 2VL6A 2UUAQ 2Y0SE 3HOYH 3HOUH 3G48A 1VQ9A 4DR6Q 1L2FA 2N3SA 3G4SA 4DV0Q 2VUMH 4GOPC 3I4OA 2KCTA 3DLLA 3J81j 1OTCA 1S40A 1P16A 1X3FA 1PHJA 1K83H 1UE7A 5IP9G 3JAMc 4Y7NH 3UDGA 1Q86C 1JB7A 2E2HH 4OWTB 4NXNL 1L1OB 4OX9L 1PH4A 4LF4Q 4LW1A 4JI3L 4JV5L 1KL9A 2OQKA 1W2BA 4L5QA 4LFAL 1AE2A 1X3EA 4JI6L 3CAMA 4JI7L 1N32L 2K4KA 4DR5L 4AH6A 4DV7Q 2ZTEA 1PFSA 2VW9A 4DPGA 2IX1A 4DV3L 4GLAC 4IJHA 2F3IA 3W1BA 3KYHC 1C0AA 4GNXA 3OW2A 1GM5A 1E22A 1VQPA 1VQHA 5M5YH 2CWPA 3CF5A 3MXNB 3M85A 1XMOL 4DV5L 2ES2A 4JI4L 1UWVA 1KC8C 4A3DH 1HZ9A 5IP7H 4IOCA 1G291 2E5LQ 4ME3A 2PQAB 4JI2L 3A74A 3S17H 2Q2UA 4LF7L 1IBKL 1N36L 1E1OA 2R6GA 1Q46A 4C2MH 4DNIA 4GNXC 3TS0A 2E2JH 4JC0A 4DUYQ 2ZTDA 4DUZL 2OTLA 4QIWE 2RF4A 1HNZQ 4BY1G 4GOPB 4R4QA 2IX0A 2GN5A 1BBWA 3UE0A 1P8LA 1YHBA 3AQQA 2H5XA 2KBNA 1QUQB 4YY3L 3M9BA 4DR3L 3PIOA 3RNUA 1Q81C 1N9WA 5GROA 1EFWA 1KRSA 4A75A 4DV1L 1J5EQ 4LFBL 4BY7H 1UEBA 3HKZG 2RCNA 3PUXA 4A3BG 2LXKA 2RHSB 5BR8L 2Z0SA 1SMXA 2ID0A 1KRTA 1WFQA 4IPDA 4HIKA 2NN6I 4C3IH 3UE1A 4A3MH 3TRZA 3CCRA 4ALPA 3VDYA 2IHFA 1V9PA 3HOWG 1Q12A 1S72A 5LMUL 1EQRA 1SROA 1HJPA 3GD7A 4NXNQ 4PG3A 4JI3Q 3CCLA 4JV5Q 1K0RA 3KJPA 1N32Q 4HJ5A 4JI6Q 4JI7Q 2ALYB 4JBWA 4BA2I 4HIDA 3H3VH 3KJOA 1X9NA 2JA9A 1N8RC 1MJCA 3EBEA 4LUOA 3PUZA 1Z9FA 1SRUA 4GNXB 4DR4L 4DR6L 1I3QH 5FJ8G 4DV0L 2D62A 4HJ8A 4HJAA 4JBMA 4B3TL 3I4NH 4YWMA 1CKNA 5LMNL 1XMOQ 4IOAA 4AYBG 4JI4Q 4DV5Q 2UUCL 1PH2A 3RLOA 1KQSA 4IJLA 5C4XG 1CKMA 2D0PA 2PNHA 5M3FG 3RN5A 1GVPA 3HOXG 3S2DH 4JI2Q 1XPRA 2B63G 5IYDG 2JA5H 2NVXH 1NMGA 4X64Q 3CCMA 1IBKQ 1NE3A 4P71A 1N36Q 4X66L 2OQ0A 4NPSA 3H0GG 3D31A 1YI2A 4DV7L 2F4VL 2DGYA 3F1ZA 3HOYG 2NVYH 3HOUG 2ZM6Q 1YHQA 4HIOA 2VZAA 3BZCA 4A93H 3KOJA 3HOWH 5LMNW 1SE8A 4LF5L 3PUWA 3S1NH 3A5UA 2YU9H 5ELOA 3CCSA 3F2DA 3D0FA 2VY3A 4DR3Q 2R92H 2Q2IA 2KCMA 3NELA 4AYBE 1VQNA 4DV1Q 4DK3C 1VQLA 2E5LL 2JA8G 1I94L 3PO3H 2OTJA 5BR8Q 4APVA 1Y1WH 3CC4A 1NTGA 1VCIA 3K0XA 4YCWA 5FJ8H 1JJ2A 2BH2A 4GKJL 4DUYL 1LTLA 3A0JA 1NBWA 4DV2L 4PZ8A 3KF8B 1WCMG 3G71A 3RN2A 1TWCH 5LMUQ 1VQ7A 1YITA 4PZ7A 1QZHA 4JOIC 2GVAA 5M3FH 1IBLL 3HOXH 1Y14B 4A3EH 3FHWA 2B63H 2LSSA 1XNRL 5IYBH 1KAWA 2OCEA 3M4QA 5IP7G 3H0GH 5C44H 2KHIA 2K14A 1UE5A 3ULLA 4DAMA 4OONA 3T1YL 1QVFA 5C0XI 3TS2A 4DR4Q 1OXXK 1VQMA 2WB1G 4GN5A 5K36G 4B3TQ 5LMNQ 2HIXA 4LUZA 4YHHQ 2CCZA 2AHOB 1N34Q 4IFDJ 1X65A 3CQZH 1HR0Q 3CC7A 2UUCQ 1MJEA 2F52A 4GN4B 1VQEA 4HJ9A 4B3MQ 5H1SE 1EOVA 3IRBA 4AIMA 1YJWA 2JA8H 2CFMA 4A3KH 1FJGQ 4JBJA 2MO1A 2YTXA 4X66Q 4TQUS 1JJCB 2F4VQ 3GTKH 4BY7G 4H02A 2R93H 1QVCA 3T1HL 4R1JA 4A76A 1VQBA 2DUDA 4LF5Q 1WCMH 4C3JH 3PIPA 4A3MG 5IYCH 2WB1E 1IL2A 3STBC 2WAQG 1E24A 1E3PA 2WFWA 1T9HA 3K8AA 1EIFA 2LXJA 4IPGA 2GVBA 4C3HH 2OWOA 3S1MH 3J7ZC 3CCUA 4JG2A 2CQOA 2K5HA 1GKHA 1Q1BA 3CMEA 1I94Q 4IPCA 4X64L 4MNOA 1VQJA 5FLXc 2Z6KA 4GKJQ 5IWAL 1IYJB 3CCEA 2Q2HA 3RLFA 2ZM6L 2BA0A 4DV2Q 4OO1G 4K0KQ 4JI5L 1E1TA 1PV4A 1VQ8A 4A3CG 3I4NG 1YNXA 4POFA 4LF8Q 1FVIA 5AJ3Q 1IBLQ 4KI0A 3W1GA 5HGQA 3I7FA 3W5OA 4O2DA 1HNWL 1XNRQ 1CSPA 2Z6KC 2VQEL 4P74A 1WOCA 2N49A 3U4VA 4IFDI 1OXTA 3GTOH 2AWOA 2JA5G 3T1YQ 4RMFA 1M90C 1JT8A 4LNQA 4OXPA 4KHZA 5JJIA 2C35B 2XGTA 1K3RA 4A93G 4B3SL 1CUKA 3CMAA 3AEVA 1UE6A 3FKIG 4R4CA 5C4JH 1WI5A 3K81C 3GTPH 3HOZG 2I5HA 4DR7L 5JJKA 4XTCS 3L2PA 2PI2A 3PF5A 1XPOA 1L0WA 3S15H 2R92G 4AQYQ 1VQAA 4BA1I 1X6OA 4HJ7A 1PH1A 1KIXA 1NJIC 3PO3G 2B29A 3T1HQ 1Y1WG 5GAGC 1B7YB 1LUZA 1YJNA 3HKZE 4JI8L 4L5RC 5IE8A 3I4MG 3S16H 4A3CH 4YHHL 1N34L 2UXBL 1MKHA 2HT1A 4FDBA 2FXQA 1A8VA 1XMQQ 2VQFQ 1HR0L 1ASZA 2JEAI 2UXDL 2JJQA 4YWKA 3RLNA 1XPUA 1SLJA 4LF6Q 4B3ML 4WJ3M 1A62A 4IPHA 4L5TA 1FGUA 4A3EG 2AWNA 4P73A 1X55A 1FJGL 1Q8KA 1Q1EA 5IYBG 1JJGA 5C44G 5M5WH 4EQ5A 2JEBI 5IWAQ 3TREA
chains in the Genus database with same CATH superfamily
4ZRZA 4JVZA 5DM63 3RR5A 4IUNA 3CRLC 4DFAA 2UU9L 4ZLTF 3EIVA 1QVGA 3GTKB 5I2XA 3A8JE 1HNWQ 4QY7A 2JA6H 1WCMB 3H3VI 2Z1CA 2MPMA 4C3JB 1G51A 1V1QA 4WORA 2L1BA 2HHHL 2B2UC 3OIPA 4DK6C 2R93G 4B3SQ 3DWPA 3KF6A 4QJFA 4LF8L 5AJ3L 3DM3A 1PTOC 1PH3A 1IZ6A 2ASBA 2JE6I 3VYTA 4QL5A 1UAPA 1J6QA 2DJGC 1D8LA 3KDFA 3TZUA 3KLWA 2SDFA 2A68D 5GADC 4HIMA 2UXBQ 4U673 1AH9A 1QZGA 2N8NA 2UXDQ 3HOVH 1EQQA 3J80i 1EY6A 2YTYA 3K5NA 3NQTA 4IURA 4A3FH 2KUMA 5GQOA 1NR2A 3LNNA 4HCSA 2NVTH 1JOQA 2HIVA 4X3SA 4UDUC 3JAME 1K8GA 4BXXG 2ZJRA 2F0HA 3W2DA 5JAVA 3E0JA 2VQFL 3M4OH 3S2HH 3D4WA 1PTOB 1CK1A 3G7LA 2I5LX 2DY8A 2B2YC 2ZJQA 1GUOA 4DAYB 4HSVA 5IOCA 5CV8A 3VA7A 5M5WB 2K5NA 1YBYA 1CI3M 1PH5A 2I07B 2E2IH 2R7DA 3MEFA 2QCPX 4DR1L 2F0VA 3HOZB 3TQYA 3IFDA 1T5XD 2OXPA 2NZ1D 1BUVT 3RUZA 1K9MC 5C3WA 5K5PA 5JEAJ 4A3IB 4CJ0B 2Z4IA 2UUBQ 4LFCQ 5T1IA 3E9HA 3LGJA 5ISRA 1SFOH 5GAEC 3ULPA 1LTAD 2JA6G 2D0OA 4O0AA 2RQXA 1PFMA 2IL8A 2JSOA 4YCUA 4P75A 1U4PA 2QA4A 2EXDA 1XNQQ 2I0QA 3P1HA 1W3SA 1BKBA 2Q8RE 1SYFA 1JMCA 2NVQH 4K5WA 4QF4A 5KGUA 1S5FD 5ELDA 4RGMA 1BVSA 4GLXA 4IUPA 4OX9Q 5EAYA 3S1QH 2RSOA 3STBD 3S24A 2HDLA 1LACA 5DLQE 1DONA 4A3GB 3G6EA 4RKLA 1LABA 4LF9L 1OXVA 2NUCA 3GTMB 3RZOB 4WJ4A 1WJJA 4E6IA 2R7FA 3HOVG 2YYZA 5C0XJ 5D14A 1NSNS 3A5ZB 3K7AB 2IY5B 4A3FG 1PH9A 2NZOA 3MWYW 1VQKA 1TS5A 2Y0SB 3PGZA 5IT9c 3T53B 4OWWB 4UPAA 2B2TA 2J0TD 3J7AV 3K7UC 5T1GA 4FYDA 1PYBA 2JA7B 1L1OC 2A1AA 4BBSH 1LV9A 1PYSB 3MXNA 2MNAA 3GTLH 4ZKCB 1QWYA 3FP9A 3NEMA 2OF1A 1K8AC 2QGQA 1IBMQ 4NB3A 5E4WC 3I55A 1FR3A 1I5FA 3J81E 2VS1A 1S3OA 1Y1VB 1HH2P 1EIHA 1XWEA 3TEHB 4X62L 2AQ3B 3QIAA 1MSHA 2EQSA 3CD6A 1ASYA 2A8VA 1TWHB 4FNFA 4YCVA 2F0NA 1KDAA 1PLFA 2F3WA 3SDZA 5KYLA 3NPPA 4LUVA 5DM73 2MJ8A 1DJRD 2KEEA 5FKAC 2Y0SE 1VQ9A 1H9SB 4DK1A 1EZ6A 4GOPC 3DLLA 3J81L 1OTCA 1UE7A 1K3BC 1LTTD 4OEMB 4OWTB 1L1OB 1KTKA 3NHHA 4LF4Q 4LW1A 4JV5L 2R61A 2AUJD 1AE2A 5ELBA 4N9TA 4DR5L 3H09A 4IFDH 1HQMC 3MFYA 4IJHA 4K6DA 1QILA 4UAIA 1HFNA 5M5YH 3CF5A 5LL6S 3MVVA 2R7ZB 1KNEA 4G7OC 3TP8A 4A3DH 4BY1B 1HZ9A 3R2TA 4IOCA 3C2PA 1F9RA 4LF7L 4DF7A 2E2JH 3BG3A 4DUYQ 5K36H 1Y8OB 4X3TA 1II3A 1TR5A 4GOPB 2IX0A 2GN5A 1D1IA 5EKKA 4A3BB 1P8LA 3AQQA 2B8GA 4R8IA 5HURA 3PIOA 4OGQC 3RNUA 1Q81C 1JC7A 1EFWA 2CH4A 4DV1L 3T16A 1D5ZC 1UEBA 3A56A 2RCNA 3HKZG 4G57A 5E1FA 2RHSB 1Q90A 2Z0SA 1SYBA 3RMHA 3TRZA 3T13A 3HOWG 4HR7B 1S72A 4B9XA 1EQRA 3E5SA 3CCLA 5FK9C 3PMFA 2NTSA 1X9NA 5EKIA 1S5ED 3ZYYX 3PUZA 5C4XB 4DR4L 4CJ1B 1I3QH 5FJ8G 4DV0L 4JBMA 3HGBA 2D2CC 1HUNA 1EEFD 1UEAB 3OOCA 2EJFC 2ZT9C 4K14A 1PH2A 3HOUB 4NDXA 3RLOA 4V190 1EYDA 4RCOA 5M3FG 1GVPA 3O13A 2EDGA 3OWFA 1NE3A 1K83B 3I72A 4Y7NB 1YI2A 4DGZA 4DV7L 3F1ZA 2E2HB 4A93H 4HIOA 5LMNW 4LF5L 5I9PA 3PUWA 5IIFA 1U4MA 5ELOA 4B08A 1C8CA 2KCMA 1F2MA 3FPUB 2PW5A 1I94L 3PO3H 5BR8Q 1Y1WH 1NTGA 2CQAA 2LFNA 3LWEA 4YCWA 1LTLA 3A0JA 4XYOA 1RJTA 4EVOA 3H3VC 1VQ7A 2DY7A 1YITA 4PZ7A 4F8MA 1EYCA 2PZWA 1MSGA 2HCIA 3VYUA 1IBLL 4A3EH 3FHWA 5J39A 1ZEQX 3GQBA 1PYWD 3OW7A 2Z6BA 3M4QA 4G4KA 1QNUA 3H0GH 4FP5D 3A54A 2H4OA 1BO0A 1Y8PB 1ENFA 4OONA 3T1YL 2D5DA 5C0XI 3TS2A 1OXXK 5I2YA 2WB1G 5JOBA 5K36G 1EWHA 5LMNQ 2CCZA 1N34Q 4BY7B 2JYOA 1MJEA 2A69C 1VQEA 4B3MQ 1EOVA 3IRBA 4AIMA 2JA8H 2CFMA 5EGTA 4C3IB 1FJGQ 3D4RA 4JBJA 4PNYA 3SE0A 1EL0A 3T4AC 1QVCA 4R1JA 4KKUA 2KCCA 5IYCH 1ESRA 1T9HA 2OWOA 2LXJA 2ENBA 3MFGA 3J7ZC 4JG2A 2CQOA 4C56C 1GKHA 5AFWA 4X64L 4MNOA 5FLXc 3ONAB 5IWAL 3CCEA 3RLFA 4DV2Q 4RHSA 1VQ8A 2NVXB 1YNXA 4POFA 4LF8Q 1FVIA 5AJ3Q 1BCPB 5HGQA 1SYEA 2Z6KC 2HDMA 1TS3A 4IFDI 2YU9B 3GTOH 2AWOA 1TY0A 3MXPA 3TMEA 1JT8A 1M90C 1H9MA 3A7AB 4LNQA 2R92B 1D1KA 1BQQT 1K3RA 2E74C 4A93G 1NNXA 4WRDA 4RFBA 1RCVD 2F3VA 2K1BA 1QJOA 3IAYA 1WTWA 2PI2A 3NUCA 4CKEA 1BR9A 3PO3G 1Y1WG 4OL7A 5GAGC 1IYVA 5DAUA 4L5RC 4A3CH 3S16H 4YHHL 2FXQA 2VQFQ 4HAEA 3DEOA 4YWKA 3MC0B 3RLNA 1SLJA 3KUPA 2NWGA 1EYAA 2HD3A 4A3EG 1XXGA 1Q1EA 2RVLA 1HQRD 2MHVA 3CQZB 3EQLC 1L0XB 1AE3A 1HRJA 2ATWA 3GTQH 1HR0W 3D4DA 4RCNA 1EFID 5A2QL 1M1KC 4ME5A 3BVGA 2R93B 2CHBD 5JJLA 2VQEQ 2HQLA 1FNWA 2EYMA 1UNSA 5HY6A 4DR1Q 2DN8A 4B9WA 2RSNA 3D8GA 4KTAA 3PO2G 5FLMH 5IT9E 4C3HB 3TP6A 4JI0L 3I4MH 3RZDH 3NENA 2JXMB 2F0FA 4K0KL 4DR2L 1ESFA 3EJIA 3ULJA 4EGVA 4KKTA 1PRTC 3AYHB 1WYDA 5IYCG 4DR7Q 4NMZA 3U4ZA 2PMZB 3WOFA 1XX8A 1CQVA 1HNXL 5CV6A 3G6JB 3ERSX 1EY5A 2AKWB 4V0BA 1SNQA 4NXML 2R3ZA 4UP8A 2ZTCA 3BZDB 1JB3A 3NBHA 1H95A 4BWGB 4XIGS 1VQIA 2QF7A 1Q82C 4LMQD 1BNZA 2WAQB 1D5MC 2AQ2B 3I2ZA 1I4HA 1PXUA 1CA5A 3CPWA 4LF9Q 1DD2A 1GOZA 3L9AX 1YNNC 1VQDA 2PMZE 4PZ6A 1N33L 1PRTB 3EN2A 4LF6L 3URYA 1ZXTA 4Y52H 1HTLD 4N8X1 1HHVA 2ICIA 1PZKD 4HMIA 4MZ9A 1XTCD 2K04A 3BJUA 1HZAA 3UDXA 3M3YH 1VQOA 3PV0A 3OTOL 2MUYA 4EQNA 2K5WA 2RDFA 1PTOF 2KOLA 2BOSA 4DV6Q 1SE3A 2CWAA 2SOBA 1YHAA 3BZKA 2WAQE 4QGUA 1KD1C 3QJYA 1O78A 2PNRC 1PDQA 1B3QA 4XDXA 1HZCA 3K5MA 1SE2A 1Q7YC 2JA6B 4BXXH 4DNRB 1I6HH 3J80E 2EOTA 4X62Q 4N8FA 1X56A 2EYFA 4M8AA 4JYAL 3NE5B 1I50H 3AFQA 3KLRA 3NBIA 5IY0A 2LY7A 4LK1C 1B70B 1RL2A 2J7ZA 2RA4A 3L0OA 5FLMG 1T5EA 3K5LA 4BBRG 1QG7A 4JPBW 2K50A 4DV4Q 1EUJA 3J80L 1MI2A 3PSIA 2PO4A 1SDFA 1O7IA 3SXHA 3HP3A 4B3RL 3L7ZC 4TVAB 2AMCB 4DR5Q 3S14H 4LJZC 5IGEA 4GKKQ 1LT6D 3HOVB 1VQGA 2UUAL 3NP8A 1A2UA 4IN3A 4A3FB 2TSSA 2WIIB 1BXTA 1DGSA 4UY8C 2NVTB 4GLVB 1ML0D 2K52A 2KHJA 2MFIA 1Q8IA 5C3EG 3FRPB 2WP8J 2C5CA 4KHPQ 2E2DC 3VR3A 4WFN3 2F0OA 3KBGA 4LF7Q 3M4OB 3S2HB 5CMDA 1VQ6A 2ZXRA 4ZKBB 3HFZB 4RAUC 2PQEA 5LHY1 5EQ0A 3P7JA 2VUMG 4X65Q 1KHIA 1Z47A 3F2BA 2YV5A 1VMCA 2BH8A 1CZGA 3Q22A 4K2LA 3ICEA 1ZKOA 4ILWA 1TIID 1RD9D 2K03A 1C48A 2DNCA 1XJVA 4O42A 4XQNA 2E2IB 3GTJH 1LYLA 1EQVA 1KAAA 1U0LA 1HNZL 3K0YA 1OXSC 2E75C 2ZJPA 3J7A5 1LTBD 1I4GA 4QUFA 2QW7A 3QO2A 4BS9A 1NY4A 4L5SA 5G3LD 1PVOA 2B2WA 1YEZA 5DNFA 1IKLA 1G2TA 3HOYH 1SFOB 3C3LA 2CW0C 2N3SA 4DV0Q 1GUSA 3F2UA 2DJFC 4L63B 1B2TA 1S40A 1P16A 1ICWA 4KJNA 4XYQA 2A74C 2RBMA 4JI3L 3BVMA 1N32L 4U68A 4LFAL 5CC4A 2NVQB 3GP7A 2K4KA 4KY7A 4ZAIA 4DV7Q 2KVMA 1PFSA 4L6TB 1STYA 1W6KA 2VW9A 4F87A 4DV3L 3S1QB 3W1BA 1DOLA 3JAML 3DHQA 5KRUA 1VQPA 4CDEC 1ENAA 2CWPA 4RGTA 1XMOL 2ES2A 1UWVA 5FLXE 1G291 2PQAB 1PFBA 1PTOD 3S17H 1IBKL 1N36L 1Q46A 4GNXC 2ZXPA 3TS0A 2EXZA 4JK1C 3OWEB 2N88A 4DUZL 2OTLA 3HKZB 1QUQB 4YY3L 2GA4B 1BF4A 2KHSA 1KLUD 4IALA 1SJHD 1J5EQ 3TZDA 1AFPA 1AZQA 1LTRD 1O7ZA 3PUXA 2LXKA 2F0UA 2ID0A 3V2TA 2BCOA 4BBSB 1WFQA 3HS0C 3GTLB 4HIKA 4A3MH 4KY5A 3CCRA 3EROA 3NQIA 3SVMA 1PZID 1HJPA 2KJXA 4NXNQ 1ET9A 1QB5D 3MAQA 1RTOA 1F2YA 3KJPA 3BDOA 4HCEA 4JI6Q 1IYUA 5HGTA 4JI7Q 4JBWA 2L0CA 1RF2D 1I6VC 3NTIA 2FINB 3EBEA 4OO1H 4GNXB 1J9OA 5D3DA 4HJAA 4HJ8A 1MD2D 4B3TL 4IUUA 3TSSA 4AYBG 4JI4Q 4K5VA 3C1EA 3E3XA 3QR8A 2UUCL 2A5HA 4IJLA 4BA2I 5CV9A 1JWUD 3HOXG 1SNMA 1GUNA 4JI2Q 2B63G 1MGSA 4X64Q 2F4VL 3HOYG 3GV3A 1YHQA 1Y8NB 2VZAA 3BZCA 3KOJA 3HOWH 2A6HC 5M9OA 2PZTA 4OIKA 2K5QA 3QOJA 3A8KE 2K28A 1CHQD 3CCSA 1V1PA 4DR3Q 2Q2IA 1SE4A 1E2WA 1VQLA 2E5LL 1S5DD 3DWQA 5M5YB 1V8QA 1X32A 4MIUA 5FJ8H 2BH2A 4GKJL 4A3DB 1GHKA 2XN9C 3KF8B 2IJ0A 1WCMG 1TWCH 5LMUQ 1D6EC 4JOIC 2GVAA 1E2ZA 5M3FH 2E2JB 2WB1B 1JCKB 4KK7A 2K6AA 1EY7A 2KHIA 1UE5A 1SNDA 4DAMA 1QVFA 1A6XA 4GN5A 3OIQA 4LUZA 4YHHQ 4IFDJ 1X65A 2X6GA 2G5DA 3CC7A 2F52A 4XT3B 1JOOA 1YJWA 4DN4M 1STGA 2B2VC 4A3KH 4X66Q 4TQUS 1JJCB 2QKIC 5CORA 2M2LA 4H02A 3T1HL 4DU9A 1AW7A 2OT2A 3CU7A 3FMCA 3PIPA 4A3MG 3MXUA 3RD4A 4X3KA 2WB1E 1IL2A 2WFWA 1E3PA 4P73A 2A6HD 3S1MH 2F0PA 1I3QB 2ZM6L 2BA0A 4OO1G 4K0KQ 1K28A 1STAA 1E1TA 2RDHA 3SR1A 1PV4A 5EBDA 2BDOA 3WDNA 1M8AA 2NN6H 3M7GA 1GUWA 4KI0A 4ZUIA 1HFGA 3W5OA 3H94A 4A93B 4O2DA 1HNWL 1XNRQ 5M5XB 2O4XA 3ND9A 4CKBA 3U4VA 1OXTA 2NTTA 4CJ2C 1HUMA 3J7AF 4H44C 3TBIB 1EU4A 4B3SL 3PO3B 1O7YA 3FKIG 1Y1WB 3GTPH 1WI5A 2HCCA 3K81C 4PMBA 3HOZG 1X3QA 4XTCS 2Q8TA 3L2PA 1XPOA 2F0SA 2L11A 4P2CB 4HJ7A 3CRKC 1H9KA 1YJNA 1WD0A 1CHPD 4H0LC 4A3EB 3TP5A 5DEHA 4DAVA 2BE5C 1R9TB 2UXBL 3H0GB 1CZWA 1ASZA 2JEAI 4M1UB 2JJQA 2UXDL 4LF6Q 4IPHA 3BVZA 1WTQA 2KA7A 1JJGA 1GHJA 2JEBI 3DM1A 5M5XH 1I4RA 4JI5Q 4X3UA 2JA8B 4MN3A 3OTOQ 2K01A 4YWLA 3Q23A 2B2UA 1RDPD 5D3IB 2SNMA 4EQOA 2K5VA 2WV6D 3Q8DA 1PH6A 3PUYA 5EKLA 1X54A 1EY9A 2IWHA 2IT1A 5M3MH 4KN4C 4A3KG 1STBA 2KENA 4ID6A 3HKSA 5CV4A 4RGOS 4ZQ3A 1X3GA 1LT5D 1V1OA 4A4IA 1TWFH 3Q24A 1KDCA 4F88A 3T51B 3GTGH 1C4QA 4RG1A 4DAYA 1JE5A 4JYAQ 1DM0B 3VYSA 4RHRA 3KFUA 1SR3A 1R9TH 4HEDA 2WKCA 2Y0SG 5I9OA 2Z8LA 5BN5A 1X3PA 2A19A 1AN8A 4JI8Q 3S1RH 3ER0A 1VQ4A 3HEJA 2UUBL 4LFCL 1BCPC 3GTOB 1CT1D 2NN6G 4R4TA 4RWSC 1TWGH 1EU3A 4AQYL 3UDIA 1QUQA 4GS3A 3PO2H 4UP7A 3M7NA 5EBCA 1FD7D 1IW7C 1A63A 1Z6HA 3D6CA 4CGYB 1XNQL 2L15A 2EIFA 2XRQD 1B4OA 1A2TA 2B2YA 2UU9Q 1Z7TA 4CDCC 1TY2A 4IO9A 3L3OC 3U9SA 1XMQL 2OEOA 3SGIA 2VB2X 3S16B 4MTKA 1G8ZD 1VF5C 2HHHQ 1GO3E 3CP0A 5JPMC 1VQFA 3KF6B 3QG1A 2N55A 1PRTF 3I70A 1TWAH 5IGGA 1BBUA 4A3JH 3KDFB 4KLKA 2ZXOA 5GAHC 3GTQB 1LTGD 1OO9B 1EY8A 1JWSD 3K80C 1BBXC 2K5DA 2V4DA 4HMJA 2R7ZG 5E7NA 3MHBA 4RH6A 4EX5A 1TXYA 1SN8A 4JI1L 1ZYRC 4CKCA 1TVXA 3AU7A 5KNCA 2CKZB 5ELFA 4A3LG 4UHVA 3I4MB 3RZDB 4HTHA 1UE1A 1BCPD 3UDFA 3S9WA 2A69D 3VA5A 3T56B 2N78A 5D65A 5M3MG 1WTVA 1IBML 3E0EA 1G91A 2EYPA 3CW2C 5KNDA 3PUVA 2MQHA 3GO5A 1SNPA 1LM0A 3NK9A 3AFPA 1EY4A 2WKDA 3AB9A 4LFAQ 2O2LD 1F9QA 4MHEA 1VS0A 4OELB 3H6MA 1D2BA 1GD7A 3LX0A 2AQ1B 4DV3Q 1H9SA 1GXDC 4R4OA 1MIUA 1S5CD 1EQTA 4J6HA 2F0EA 4P72A 1CM9A 4LF4L 2PYKA 1L1OA 1G6PA 1CSQA 2K75A 2V1CC 4BBRH 4QCLA 4KD4A 4DUZQ 1AP0A 5ELCA 3SK4A 4QB4A 1PH7A 3K6OA 4YY3Q 1JQYD 2L12A 3M3YB 2XIWA 2RKSA 3M4PA 4KY6A 4JOIA 5IT9L 4C1NI 4J15A 2UXCL 2B2TC 1TKWB 5IGFA 5G3LF 5C4ZA 4ZUJA 1A15A 4Q0FA 2WINB 1JOKA 4GZYC 3J81c 4EQPA 4GOPA 4NP5A 5C3EH 2G9HD 4A3JG 5KIXA 1I6HB 3CPFA 5IYDH 2LMCB 4FVMA 3UI2A 2B2VA 1G2SA 1L2FA 1I50B 2VUMH 1YNJC 1U4RA 3I4OA 2KCTA 4J8QA 2F0WA 4QIWB 1PHJA 5IGBA 1JB7A 5EPJA 1PH4A 1KL9A 2OQKA 1W2BA 4L5QA 1X3EA 1GJXA 4H7BA 4AH6A 2ZTEA 2IX1A 4GLAC 1C0AA 3BS1A 3BDCA 1EY0A 4CHTB 1VQHA 3S14B 3MXNB 4ZK9B 1QCBD 4ABNA 1KC8C 1PRTD 5IP7H 5F2DA 2E5LQ 1UUPA 3A74A 1F9PA 2F1MA 3QOLA 3KK7A 1MHWC 4C2MH 3OMCA 1S4ZA 2ZTDA 4QIWE 2RF4A 2MP1A 2XWBB 4R4QA 2EZVA 3UE0A 1YHBA 2KBNA 3VR6A 1ONLA 4XXEA 4G7HC 1EOTA 1FYCA 3KBXA 5GROA 1KRSA 4A75A 4LFBL 3OMGA 1RODA 4DXFA 4R8NA 4O1NA 2F0JA 5BR8L 1SMXA 1TS2A 1KRTA 1HA6A 1G6ZA 1F77A 2RDGA 1Q3LA 3UE1A 3VDYA 2EJGC 1ILQA 2M9VA 2QDBA 4RGNA 1YNND 2AUKA 3TDQA 4JV5Q 1K0RA 4HJ5A 3GTJB 4AYBB 4HIDA 3KJOA 2EYOA 4CDDC 5CBEE 1EWCA 2A68C 2EPBA 1MJCA 1Z9FA 2EJMA 2IX3A 4DR6L 3I73A 3HOXB 2IW3A 3I4NH 4YWMA 5LMNL 3IL8A 4IOAA 1AEXA 3HOYB 3H91A 1KQSA 2D0PA 5ELEA 3S2DH 5IYDG 2JA5H 3W3AA 3E6ZX 3CCMA 4IQZA 1SYCA 1LTSD 1K0SA 2NVYH 2ZM6Q 1SE8A 3S1NH 4Q5VA 3MA2B 5TSSA 3F2DA 3D0FA 2VY3A 4AYBE 1VQNA 4DV1Q 4DK3C 5C5MA 2PCFB 3FEWX 4APVA 4KKSA 3K0XA 5KYIA 1LO5D 4I7AA 1JJ2A 3X3NA 3I3CA 4OHJA 4DV2L 3A7LA 4XT1B 3RN2A 2KQ3A 3S17B 1NR4A 3I4LA 3N6RA 5A35A 1QZHA 3HOXH 1Y14B 4C3HG 2B63H 2LSSA 1KAWA 2OCEA 5IP7G 5C44H 2E76C 3ND8A 2K14A 1WTPA 5C6AA 4DR4Q 1VQMA 3M4YA 2B39A 2QEJC 1VMPA 4XQJA 3MXGA 3DEPA 5FO8B 3BDLA 2A6EC 4HJ9A 4H13C 4KN7C 1B9MA 4A3MB 3TN2A 3HRZC 2YTXA 3V96A 1WVLA 3GTKH 5C4JB 1STNA 4A76A 4K8JA 1TT2A 2DUDA 4IUTA 4LF5Q 3S15B 1WCMH 4R9WA 2G9DA 4K2KA 4C3JH 3BYTB 3STBC 2WAQG 1E24A 3K8AA 4DV5L 1EIYB 3IFTA 4IPGA 2GVBA 1VDZA 3CCUA 3VR4A 1Q1BA 1IL8A 3CMEA 3J7YW 1I94Q 4IPCA 4CBVA 5C3XA 2Z6KA 1IYJB 3DXJC 1TQOA 3MTSA 4RKBA 5BN3A 1GUTA 5IODA 3P75A 3I4NG 1A3UA 1SMYC 1IBLQ 3W1GA 2K32A 2C9OA 3HOWB 1CSPA 2VQEL 1ENCA 5FLXL 4P74A 2F0DA 4FXGC 4KJOA 3FKIB 2JA5G 3T1YQ 4RMFA 4OXPA 1I4PA 5CV7A 2XGTA 1RTNA 5FO7B 3CMAA 1K8MA 2CW0D 3ERQA 3K5OA 1UE6A 3AEVA 1GUGA 5KNBA 5C4JH 1FNUA 4DR7L 3S15H 1R4PB 1L0WA 4AQYQ 4BA1I 1X6OA 2A6ED 1TWCB 5JEAH 5KEEA 1PH1A 1KIXA 2L55A 4ULLA 1LUZA 2L9HA 5M3FB 3HKZE 1PTOH 3OHXC 5E4XA 3NSWA 5IE8A 1SAPA 3EFXD 2HT1A 1XMQQ 1HR0L 4QMGA 1LTID 2P5ZX 1XPUA 3NWSA 4WJ3M 3QWNA 1Q8KA 1HA5A 2FMMA 5C44G 5M5WH 1B1ZA 5IWAQ 4QUCA 1LT4D 3CCVA 4A3KB 3FKIH 3HOZH 1YIJA 1E7ZA 4JCVE 3JAMi 4J1MA 1XYIA 1DYQA 1VQ5A 4A3IH 1PH8A 1HCZA 1SMYD 1CTMA 3I8ZA 1HZBA 1O7LA 2XVSA 2K05A 2EE1A 2RHQB 4JBKA 2CVRA 3S1MB 1CKOA 3EVQA 2PZUA 1STHA 5C0XH 3BYYB 3DWAA 2HQEA 2JK8A 2NZHA 4JI1Q 4C3JG 2F0QA 2E8GA 4DV6L 3BU2A 1B8AA 1C7YA 5J22A 1ET6A 1CKNB 4POGA 2O5IC 1VF7A 1ICFB 4G7ZC 1K8OA 3GDEA 1RHPA 2IPKD 3PIP3 4A3GH 3WWVA 3X3MA 2JQOA 3GTMH 3RZOH 3E9IA 2F0GA 2YTVA 3FVQA 3GTPB 2M00A 1LLRD 1NAPA 1L0YB 5J3BA 4FO2A 2PI2E 3K7AH 1B44D 1U9RA 4DV4L 2BDNA 1I4QA 3LWUA 4GN3B 1TS4A 4KMUC 1SBBB 2VNUD 2FHTA 3CCQA 3B6YA 4DNTB 3OPOA 3PIO3 3NWTA 1EWIA 1KXLA 4ZYSA 5J1ZA 1EYGA 5JEAG 4GKKL 4JI0Q 2JA7H 2RCFA 4XQQA 3F8TA 3H15A 4PMCA 3PCOB 4DR2Q 3NXWA 1OXUA 1SYGA 1PA6A 2XSCA 1V43A 1FNVA 1WTXA 1HNXQ 3VR5A 1Y1VH 1FL0A 4KHPL 3I56A 4NXMQ 3PF4A 4UP9A 2WACA 1JE4A 1CFMA 2UXCQ 1BDOA 1TWHH 2F0TA 3NBHB 3R93A 1NUCA 2XWJB 1BCPF 2K7VA 2HUGA 5M3MB 1EZ8A 5IP9H 2KECA 4X65L 4HN7A 2XTIA 1JICA 3A55A 5JVH3 3J80c 5NUCA 1NMFA 2O5JC 1TWFB 1EEID 2VB3X 1C9OA 4ODGA 4A3IG 3GTGB 1RKNA 3PQIA 3JC66 1O80A 1JORA 2XRSD 2KCNA 4DKAC 5C0XG 4FF3A 3Q6SA 4WJWA 1N33Q 5CGKA 1YZ6A 3J81i 4X6AH 4OWXB 1A0IA 1HPCA 1KABA 4BBSG 2B3GA 4LWCA 3S1RB 2EVBA 1K73C 3NTHA 5BN4A 3U50C 5C5LA 2R7ZH 1VQCA 4RA8A 5LL6X 4JW0A 1TWGB 4BY1H 2BA1A 4KHVA 5CYUA 1IHZA 2EY1A 5JJZA 3PO2B 2FMCA 1EIGA 3U58A 3CC2A 3AMUA 4A3LH 1XTDA 1IXRA 4A3GG 2ICEC 4YIJA 1DXMA 3IKJA 4DK0A 4FF2A 2QEXA 4A3BH 3F2CA 1YJ9A 4OO1I 1MBYA 3P20A 4I65A 1WTOA 4R4IA 1KDBA 1YVCA 3N52A 3CCJA 5ELNA 2JP1A 4F7XA 2IHEA 4PMWA 3OYYA 3MEHA 1WD1A 3ZJYC 1RIPA 1E0BA 4LFBQ 1U4LA 1TWAB 2I5MX 3K58A 4QQBX 1D7QA 2MO0A 2PQAA 2SNSA 2JA7G 4IFDG 4A3JB 4Z9CB 2LKVA 3SEBA 5EPKA 4I7ZC 2Q2TA 5C4XH 4B3RQ 2BE5D 2F0IA 4MTNA 1U5KA 5E3FA 3OSOA 4A3DG 5C4HA 1Y1VG 1DOKA 3CXCA 1J5EL 2VL6A 2UUAQ 3HOUH 3G48A 3FDTA 2L5TA 2NB0A 1SJED 1KLGD 4DR6Q 2H1EA 3G4SA 2F4IA 3V05A 4DXGA 4L8JA 3J81j 3Q0AA 2SEBD 1S5BD 1F9SA 2EY5A 1X3FA 1K83H 5IP9G 3JAMc 1WTRA 4Y7NH 3UDGA 4TRDA 1Q86C 2EYJA 4FF1A 4IUQA 2B2WC 4NXNL 3GV6A 5JPNC 2E2HH 4OX9L 2F0MA 4K6LA 1QNKA 1M4VA 3CAMA 4JI6L 4JI7L 4HSPA 5FOBB 4DPGA 5COYA 2F3IA 3KYHC 5I6YA 2CH4W 2QDLA 4GNXA 4C1NK 3OW2A 1E22A 1GM5A 3M85A 4JI4L 4S3SA 2LS01 3R3OA 3SK5A 2EY2A 3KLSA 4LAAA 4TSSA 4ME3A 4JI2L 2Z9HA 2Q2UA 1E1OA 2R6GA 4DNIA 3EA6A 4JC0A 4K5XA 5EJWA 1SNCA 1HNZQ 4BY1G 2FJ2A 1BBWA 2TMPA 3KLSX 3SK8A 2KEDA 2H5XA 3M9BA 4BBRB 4DR3L 1N9WA 3HZXA 1I4XA 3VYRA 5L37A 4BY7H 4A3BG 2NBFA 4IPDA 1A3TA 2NN6I 4C3IH 3SHLA 4ALPA 1IW7D 2IHFA 1V9PA 1Q12A 1B53A 1Y69U 4DA2A 5LMUL 3GD7A 1SROA 3KF8A 4PG3A 3C1FA 1D5XC 4JI3Q 1N32Q 2ALYB 3H3VH 1SSOA 3A8IE 2JA9A 1N8RC 4LUOA 5C3EB 1SRUA 1DZ1A 2D62A 1PMRA 3TP7A 1CKNA 1XMOQ 3K57A 5A2QE 1LT3D 4DV5Q 5CV5A 5C4XG 1DCZA 1CKMA 1FGBD 2PNHA 2EYHA 3RN5A 2VUMB 1XPRA 5CBAE 2NVXH 1NMGA 1IBKQ 4P71A 1N36Q 4X66L 2OQ0A 4NPSA 3H0GG 3D31A 2DGYA 3HOUG 4NW2A 2J4XA 3U9OA 3A5UA 2YU9H 3HG9A 2L4NA 2F0LA 4IUVA 2R92H 1ZYRD 3NELA 1HXYD 2JA8G 2DNEA 1JR0D 2OTJA 3NTKA 3CC4A 4IZ8A 1VCIA 3DMUA 2EY6A 4DUYL 4KV6A 4OIJA 1NBWA 4PZ8A 4PQXA 3D6WA 3G71A 1JWMD 4FXKC 4DAPA 1WTHA 5JVG3 4PV1C 3DUZA 1R4QB 4C2MB 3VR2A 1H9RA 1XNRL 5IYBH 3ULLA 2F0KA 2K33A 1KNAA 3SK6A 4B3TQ 1DOMA 2HIXA 1AZPA 2AHOB 4K8IA 3CQZH 3ITPA 1HR0Q 2UUCQ 3I91A 3QB3A 4GN4B 1CQFA 1PFNA 5H1SE 1F2ZA 1HTPA 1SNOA 2MO1A 2Z4HA 3I90A 1QOHA 2F4VQ 2F03A 4BY7G 2R93H 1VQBA 4FF4A 1SEBD 3FPPA 2EYLA 2I46A 4C3IG 1V1PB 1EIFA 4C3HH 3R8BA 5CR3A 1H9JA 2K5HA 3I4NB 2PW7A 2NYZD 1VQJA 4GKJQ 1B3AA 2Q2HA 2QILA 3K59A 1SYDA 1PZJD 1SXTA 4JI5L 3S2DB 1E2VA 3CKIB 4A3CG 2JA5B 2Q8IB 2JN4A 2MGSA 3I7FA 2NVYB 5I4DA 2X69A 1B9NA 1WOCA 3S1NB 2N49A 4ZCKA 2D9UA 2PPBC 4KHZA 3R2IA 5JJIA 2C35B 3WOEA 2XNAC 1F2LA 1CUKA 1QE6A 5I6WA 1STEA 4R4CA 1TU2B 5EPLA 1YNJD 2I5HA 1W6JA 1IKMA 5JJKA 3PF5A 2R92G 1VQAA 4N9PA 1NJIC 2B29A 3CHBD 3T1HQ 5IGCA 5FO9B 4FXDA 1B7YB 3MZ5A 4JI8L 2A73B 1J8IA 1A3VA 2B63B 3I4MG 4KD3A 2FFKB 2X6LA 1N34L 5C44B 1ILPA 1MKHA 3D3RA 4FDBA 1A8VA 1NCVA 4B3ML 1B50A 1BOSA 1A62A 4L5TA 1FGUA 1CA6A 2AWNA 2B8FA 4NKLA 1X55A 1FJGL 4CDFC 5IYBG 3C46A 5IGDA 2VXWA 4EQ5A 4TKOB 3TREA
chains in the Genus database with same CATH topology
5M5XH 4JI5Q 1AE3A 3CCVA 3OTOQ 2ATWA 4YWLA 3FKIH 3RR5A 3GTQH 1HR0W 3HOZH 1YIJA 1E7ZA 2UU9L 4JCVE 2K5VA 3EIVA 3Q8DA 3JAMi 1QVGA 1PH6A 1M1KC 1HNWQ 4QY7A 3PUYA 5JJLA 2JA6H 1X54A 2VQEQ 2HQLA 1VQ5A 4A3IH 3H3VI 5HY6A 2IT1A 1G51A 5M3MH 1V1QA 4DR1Q 1PH8A 4A3KG 1HZBA 2HHHL 3PO2G 5FLMH 2KENA 2RHQB 3HKSA 4JI0L 4JBKA 4DK6C 3I4MH 1CKOA 3RZDH 1X3GA 4B3SQ 3NENA 2R93G 4K0KL 4A4IA 1TWFH 2JK8A 2NZHA 3KF6A 4DR2L 3GTGH 4JI1Q 3ULJA 4RG1A 4QJFA 4LF8L 3AYHB 1JE5A 1WYDA 5IYCG 2E8GA 5AJ3L 4DR7Q 4JYAQ 3U4ZA 3DM3A 4DV6L 3BU2A 1B8AA 3KFUA 1PH3A 1IZ6A 1HNXL 1SR3A 1C7YA 2ASBA 2JE6I 1R9TH 3ERSX 2Y0SG 4QL5A 1J6QA 2AKWB 1D8LA 3KDFA 2A19A 4NXML 4JI8Q 1CKNB 4UP8A 2ZTCA 3KLWA 5GADC 3S1RH 4HIMA 3ER0A 1VQ4A 4POGA 2UXBQ 1AH9A 1H95A 1QZGA 2UUBL 4LFCL 2N8NA 4XIGS 3HOVH 1EQQA 2UXDQ 2NN6G 3GDEA 3J80i 4A3GH 4R4TA 2YTYA 3WWVA 1VQIA 1Q82C 1TWGH 4AQYL 4A3FH 5GQOA 3UDIA 1QUQA 4GS3A 3PO2H 2JQOA 4UP7A 3GTMH 3RZOH 3M7NA 3E9IA 2YTVA 3I2ZA 2NVTH 1A63A 5J3BA 2HIVA 3CPWA 4LF9Q 1XNQL 2L15A 2EIFA 2PI2E 3K7AH 1K8GA 4BXXG 2UU9Q 2ZJRA 1VQDA 2PMZE 4PZ6A 4DV4L 4IO9A 1XMQL 2VQFL 1N33L 3M4OH 3S2HH 4GN3B 3EN2A 3SGIA 4LF6L 2VNUD 3CCQA 3B6YA 4Y52H 1EWIA 2HHHQ 1KXLA 1GO3E 1EYGA 3CP0A 5JEAG 4GKKL 2I5LX 4JI0Q 2JA7H 4MZ9A 1VQFA 3KF6B 2ZJQA 3F8TA 3H15A 3BJUA 1HZAA 3UDXA 3M3YH 3PCOB 4DAYB 4DR2Q 3PV0A 3OTOL 1OXUA 1VQOA 1TWAH 1PA6A 1V43A 1BBUA 2K5NA 4DV6Q 1YBYA 2CWAA 1PH5A 1YHAA 3BZKA 2WAQE 4A3JH 4QGUA 1HNXQ 1KD1C 2R7DA 3KDFB 3MEFA 1Y1VH 4KLKA 2E2IH 5GAHC 1FL0A 4DR1L 3I56A 3TQYA 4KHPL 4NXMQ 3PF4A 3K80C 4UP9A 1HZCA 1K9MC 2UXCQ 1TWHH 3NBHB 1Q7YC 2R7ZG 4BXXH 1I6HH 5E7NA 5JEAJ 2UUBQ 4LFCQ 4X62Q 4EX5A 1TXYA 1SN8A 4JI1L 1X56A 5IP9H 4X65L 3E9HA 2CKZB 2XTIA 3LGJA 4JYAL 1SFOH 5GAEC 3ULPA 4A3LG 3J80c 1I50H 1NMFA 3AFQA 1UE1A 2JA6G 2D0OA 3UDFA 1C9OA 5IY0A 4A3IG 2N78A 4O0AA 5M3MG 1B70B 4YCUA 3JC66 1RL2A 4P75A 2QA4A 3L0OA 5FLMG 2EXDA 3E0EA 1IBML 1XNQQ 2I0QA 1W3SA 1BKBA 4BBRG 4DKAC 2K50A 5C0XG 4DV4Q 1JMCA 1EUJA 3CW2C 2NVQH 3PUVA 2MQHA 1N33Q 3J81i 1YZ6A 4X6AH 3GO5A 3PSIA 1BVSA 4OWXB 1LM0A 1A0IA 4GLXA 4OX9Q 1O7IA 5EAYA 3S1QH 4B3RL 3AFPA 3STBD 4BBSG 2B3GA 3L7ZC 4LWCA 4LFAQ 3S24A 1K73C 4TVAB 2AMCB 4DR5Q 3U50C 3S14H 4GKKQ 1VS0A 5DLQE 1VQGA 2R7ZH 2UUAL 1GD7A 1VQCA 3G6EA 4DV3Q 4BY1H 4LF9L 1OXVA 2BA1A 3U58A 4R4OA 3CC2A 4A3LH 1DGSA 4WJ4A 1WJJA 1XTDA 1MIUA 1IXRA 2R7FA 4UY8C 3HOVG 2YYZA 5C0XJ 4A3GG 4GLVB 4P72A 2K52A 2KHJA 2MFIA 3A5ZB 5C3EG 2WP8J 4LF4L 4KHPQ 2IY5B 1L1OA 4A3FG 1PH9A 1G6PA 2NZOA 1VQKA 4OO1I 2QEXA 4A3BH 1CSQA 3F2CA 1YJ9A 4LF7Q 2K75A 2V1CC 4BBRH 1VQ6A 4R4IA 4DUZQ 3HFZB 1YVCA 3CCJA 3PGZA 5ELNA 5IT9c 4OWWB 4UPAA 1PH7A 2VUMG 4X65Q 1KHIA 1Z47A 2IHEA 3K7UC 3F2BA 4PMWA 1PYBA 2YV5A 1L1OC 3OYYA 4YY3Q 2A1AA 4BBSH 2BH8A 1EIYB 1PYSB 2MNAA 3GTLH 3ZJYC 1RIPA 3M4PA 3ICEA 4LFBQ 4JOIA 2I5MX 3FP9A 3NEMA 4QQBX 1K8AC 2QGQA 1D7QA 1IBMQ 4NB3A 2MO0A 2PQAA 3I55A 4J15A 2UXCL 2JA7G 4IFDG 1I5FA 1XJVA 2VS1A 1S3OA 3GTJH 1LYLA 1HH2P 1U0LA 1HNZL 3TEHB 4X62L 1OXSC 2ZJPA 3J81c 2EQSA 4GOPA 3CD6A 3J7A5 5C3EH 2Q2TA 5C4XH 4B3RQ 1ASYA 2A8VA 4MTNA 4YCVA 1U5KA 1NY4A 4A3JG 4L5SA 4A3DG 3CPFA 1PVOA 5IYDH 4LUVA 1Y1VG 1YEZA 3CXCA 1J5EL 2VL6A 2UUAQ 2Y0SE 3HOYH 3HOUH 3G48A 1VQ9A 4DR6Q 1L2FA 2N3SA 3G4SA 4DV0Q 2VUMH 4GOPC 3I4OA 2KCTA 3DLLA 3J81j 1OTCA 1S40A 1P16A 1X3FA 1PHJA 1K83H 1UE7A 5IP9G 3JAMc 4Y7NH 3UDGA 1Q86C 1JB7A 2E2HH 4OWTB 4NXNL 1L1OB 4OX9L 1PH4A 4LF4Q 4LW1A 4JI3L 4JV5L 1KL9A 2OQKA 1W2BA 4L5QA 4LFAL 1AE2A 1X3EA 4JI6L 3CAMA 4JI7L 1N32L 2K4KA 4DR5L 4AH6A 4DV7Q 2ZTEA 1PFSA 2VW9A 4DPGA 2IX1A 4DV3L 4GLAC 4IJHA 2F3IA 3W1BA 3KYHC 1C0AA 4GNXA 3OW2A 1GM5A 1E22A 1VQPA 1VQHA 5M5YH 2CWPA 3CF5A 3MXNB 3M85A 1XMOL 4DV5L 2ES2A 4JI4L 1UWVA 1KC8C 4A3DH 1HZ9A 5IP7H 4IOCA 1G291 2E5LQ 4ME3A 2PQAB 4JI2L 3A74A 3S17H 2Q2UA 4LF7L 1IBKL 1N36L 1E1OA 2R6GA 1Q46A 4C2MH 4DNIA 4GNXC 3TS0A 2E2JH 4JC0A 4DUYQ 2ZTDA 4DUZL 2OTLA 4QIWE 2RF4A 1HNZQ 4BY1G 4GOPB 4R4QA 2IX0A 2GN5A 1BBWA 3UE0A 1P8LA 1YHBA 3AQQA 2H5XA 2KBNA 1QUQB 4YY3L 3M9BA 4DR3L 3PIOA 3RNUA 1Q81C 1N9WA 5GROA 1EFWA 1KRSA 4A75A 4DV1L 1J5EQ 4LFBL 4BY7H 1UEBA 3HKZG 2RCNA 3PUXA 4A3BG 2LXKA 2RHSB 5BR8L 2Z0SA 1SMXA 2ID0A 1KRTA 1WFQA 4IPDA 4HIKA 2NN6I 4C3IH 3UE1A 4A3MH 3TRZA 3CCRA 4ALPA 3VDYA 2IHFA 1V9PA 3HOWG 1Q12A 1S72A 5LMUL 1EQRA 1SROA 1HJPA 3GD7A 4NXNQ 4PG3A 4JI3Q 3CCLA 4JV5Q 1K0RA 3KJPA 1N32Q 4HJ5A 4JI6Q 4JI7Q 2ALYB 4JBWA 4BA2I 4HIDA 3H3VH 3KJOA 1X9NA 2JA9A 1N8RC 1MJCA 3EBEA 4LUOA 3PUZA 1Z9FA 1SRUA 4GNXB 4DR4L 4DR6L 1I3QH 5FJ8G 4DV0L 2D62A 4HJ8A 4HJAA 4JBMA 4B3TL 3I4NH 4YWMA 1CKNA 5LMNL 1XMOQ 4IOAA 4AYBG 4JI4Q 4DV5Q 2UUCL 1PH2A 3RLOA 1KQSA 4IJLA 5C4XG 1CKMA 2D0PA 2PNHA 5M3FG 3RN5A 1GVPA 3HOXG 3S2DH 4JI2Q 1XPRA 2B63G 5IYDG 2JA5H 2NVXH 1NMGA 4X64Q 3CCMA 1IBKQ 1NE3A 4P71A 1N36Q 4X66L 2OQ0A 4NPSA 3H0GG 3D31A 1YI2A 4DV7L 2F4VL 2DGYA 3F1ZA 3HOYG 2NVYH 3HOUG 2ZM6Q 1YHQA 4HIOA 2VZAA 3BZCA 4A93H 3KOJA 3HOWH 5LMNW 1SE8A 4LF5L 3PUWA 3S1NH 3A5UA 2YU9H 5ELOA 3CCSA 3F2DA 3D0FA 2VY3A 4DR3Q 2R92H 2Q2IA 2KCMA 3NELA 4AYBE 1VQNA 4DV1Q 4DK3C 1VQLA 2E5LL 2JA8G 1I94L 3PO3H 2OTJA 5BR8Q 4APVA 1Y1WH 3CC4A 1NTGA 1VCIA 3K0XA 4YCWA 5FJ8H 1JJ2A 2BH2A 4GKJL 4DUYL 1LTLA 3A0JA 1NBWA 4DV2L 4PZ8A 3KF8B 1WCMG 3G71A 3RN2A 1TWCH 5LMUQ 1VQ7A 1YITA 4PZ7A 1QZHA 4JOIC 2GVAA 5M3FH 1IBLL 3HOXH 1Y14B 4A3EH 3FHWA 2B63H 2LSSA 1XNRL 5IYBH 1KAWA 2OCEA 3M4QA 5IP7G 3H0GH 5C44H 2KHIA 2K14A 1UE5A 3ULLA 4DAMA 4OONA 3T1YL 1QVFA 5C0XI 3TS2A 4DR4Q 1OXXK 1VQMA 2WB1G 4GN5A 5K36G 4B3TQ 5LMNQ 2HIXA 4LUZA 4YHHQ 2CCZA 2AHOB 1N34Q 4IFDJ 1X65A 3CQZH 1HR0Q 3CC7A 2UUCQ 1MJEA 2F52A 4GN4B 1VQEA 4HJ9A 4B3MQ 5H1SE 1EOVA 3IRBA 4AIMA 1YJWA 2JA8H 2CFMA 4A3KH 1FJGQ 4JBJA 2MO1A 2YTXA 4X66Q 4TQUS 1JJCB 2F4VQ 3GTKH 4BY7G 4H02A 2R93H 1QVCA 3T1HL 4R1JA 4A76A 1VQBA 2DUDA 4LF5Q 1WCMH 4C3JH 3PIPA 4A3MG 5IYCH 2WB1E 1IL2A 3STBC 2WAQG 1E24A 1E3PA 2WFWA 1T9HA 3K8AA 1EIFA 2LXJA 4IPGA 2GVBA 4C3HH 2OWOA 3S1MH 3J7ZC 3CCUA 4JG2A 2CQOA 2K5HA 1GKHA 1Q1BA 3CMEA 1I94Q 4IPCA 4X64L 4MNOA 1VQJA 5FLXc 2Z6KA 4GKJQ 5IWAL 1IYJB 3CCEA 2Q2HA 3RLFA 2ZM6L 2BA0A 4DV2Q 4OO1G 4K0KQ 4JI5L 1E1TA 1PV4A 1VQ8A 4A3CG 3I4NG 1YNXA 4POFA 4LF8Q 1FVIA 5AJ3Q 1IBLQ 4KI0A 3W1GA 5HGQA 3I7FA 3W5OA 4O2DA 1HNWL 1XNRQ 1CSPA 2Z6KC 2VQEL 4P74A 1WOCA 2N49A 3U4VA 4IFDI 1OXTA 3GTOH 2AWOA 2JA5G 3T1YQ 4RMFA 1M90C 1JT8A 4LNQA 4OXPA 4KHZA 5JJIA 2C35B 2XGTA 1K3RA 4A93G 4B3SL 1CUKA 3CMAA 3AEVA 1UE6A 3FKIG 4R4CA 5C4JH 1WI5A 3K81C 3GTPH 3HOZG 2I5HA 4DR7L 5JJKA 4XTCS 3L2PA 2PI2A 3PF5A 1XPOA 1L0WA 3S15H 2R92G 4AQYQ 1VQAA 4BA1I 1X6OA 4HJ7A 1PH1A 1KIXA 1NJIC 3PO3G 2B29A 3T1HQ 1Y1WG 5GAGC 1B7YB 1LUZA 1YJNA 3HKZE 4JI8L 4L5RC 5IE8A 3I4MG 3S16H 4A3CH 4YHHL 1N34L 2UXBL 1MKHA 2HT1A 4FDBA 2FXQA 1A8VA 1XMQQ 2VQFQ 1HR0L 1ASZA 2JEAI 2UXDL 2JJQA 4YWKA 3RLNA 1XPUA 1SLJA 4LF6Q 4B3ML 4WJ3M 1A62A 4IPHA 4L5TA 1FGUA 4A3EG 2AWNA 4P73A 1X55A 1FJGL 1Q8KA 1Q1EA 5IYBG 1JJGA 5C44G 5M5WH 4EQ5A 2JEBI 5IWAQ 3TREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5X H;  4JI5 Q;  1AE3 A;  3CCV A;  3OTO Q;  2ATW A;  4YWL A;  3FKI H;  3RR5 A;  3GTQ H;  1HR0 W;  3HOZ H;  1YIJ A;  1E7Z A;  2UU9 L;  4JCV E;  2K5V A;  3EIV A;  3Q8D A;  3JAM i;  1QVG A;  1PH6 A;  1M1K C;  1HNW Q;  4QY7 A;  3PUY A;  5JJL A;  2JA6 H;  1X54 A;  2VQE Q;  2HQL A;  1VQ5 A;  4A3I H;  3H3V I;  5HY6 A;  2IT1 A;  1G51 A;  5M3M H;  1V1Q A;  4DR1 Q;  1PH8 A;  4A3K G;  1HZB A;  2HHH L;  3PO2 G;  5FLM H;  2KEN A;  2RHQ B;  3HKS A;  4JI0 L;  4JBK A;  4DK6 C;  3I4M H;  1CKO A;  3RZD H;  1X3G A;  4B3S Q;  3NEN A;  2R93 G;  4K0K L;  4A4I A;  1TWF H;  2JK8 A;  2NZH A;  3KF6 A;  4DR2 L;  3GTG H;  4JI1 Q;  3ULJ A;  4RG1 A;  4QJF A;  4LF8 L;  3AYH B;  1JE5 A;  1WYD A;  5IYC G;  2E8G A;  5AJ3 L;  4DR7 Q;  4JYA Q;  3U4Z A;  3DM3 A;  4DV6 L;  3BU2 A;  1B8A A;  3KFU A;  1PH3 A;  1IZ6 A;  1HNX L;  1SR3 A;  1C7Y A;  2ASB A;  2JE6 I;  1R9T H;  3ERS X;  2Y0S G;  4QL5 A;  1J6Q A;  2AKW B;  1D8L A;  3KDF A;  2A19 A;  4NXM L;  4JI8 Q;  1CKN B;  4UP8 A;  2ZTC A;  3KLW A;  5GAD C;  3S1R H;  4HIM A;  3ER0 A;  1VQ4 A;  4POG A;  2UXB Q;  1AH9 A;  1H95 A;  1QZG A;  2UUB L;  4LFC L;  2N8N A;  4XIG S;  3HOV H;  1EQQ A;  2UXD Q;  2NN6 G;  3GDE A;  3J80 i;  4A3G H;  4R4T A;  2YTY A;  3WWV A;  1VQI A;  1Q82 C;  1TWG H;  4AQY L;  4A3F H;  5GQO A;  3UDI A;  1QUQ A;  4GS3 A;  3PO2 H;  2JQO A;  4UP7 A;  3GTM H;  3RZO H;  3M7N A;  3E9I A;  2YTV A;  3I2Z A;  2NVT H;  1A63 A;  5J3B A;  2HIV A;  3CPW A;  4LF9 Q;  1XNQ L;  2L15 A;  2EIF A;  2PI2 E;  3K7A H;  1K8G A;  4BXX G;  2UU9 Q;  2ZJR A;  1VQD A;  2PMZ E;  4PZ6 A;  4DV4 L;  4IO9 A;  1XMQ L;  2VQF L;  1N33 L;  3M4O H;  3S2H H;  4GN3 B;  3EN2 A;  3SGI A;  4LF6 L;  2VNU D;  3CCQ A;  3B6Y A;  4Y52 H;  1EWI A;  2HHH Q;  1KXL A;  1GO3 E;  1EYG A;  3CP0 A;  5JEA G;  4GKK L;  2I5L X;  4JI0 Q;  2JA7 H;  4MZ9 A;  1VQF A;  3KF6 B;  2ZJQ A;  3F8T A;  3H15 A;  3BJU A;  1HZA A;  3UDX A;  3M3Y H;  3PCO B;  4DAY B;  4DR2 Q;  3PV0 A;  3OTO L;  1OXU A;  1VQO A;  1TWA H;  1PA6 A;  1V43 A;  1BBU A;  2K5N A;  4DV6 Q;  1YBY A;  2CWA A;  1PH5 A;  1YHA A;  3BZK A;  2WAQ E;  4A3J H;  4QGU A;  1HNX Q;  1KD1 C;  2R7D A;  3KDF B;  3MEF A;  1Y1V H;  4KLK A;  2E2I H;  5GAH C;  1FL0 A;  4DR1 L;  3I56 A;  3TQY A;  4KHP L;  4NXM Q;  3PF4 A;  3K80 C;  4UP9 A;  1HZC A;  1K9M C;  2UXC Q;  1TWH H;  3NBH B;  1Q7Y C;  2R7Z G;  4BXX H;  1I6H H;  5E7N A;  5JEA J;  2UUB Q;  4LFC Q;  4X62 Q;  4EX5 A;  1TXY A;  1SN8 A;  4JI1 L;  1X56 A;  5IP9 H;  4X65 L;  3E9H A;  2CKZ B;  2XTI A;  3LGJ A;  4JYA L;  1SFO H;  5GAE C;  3ULP A;  4A3L G;  3J80 c;  1I50 H;  1NMF A;  3AFQ A;  1UE1 A;  2JA6 G;  2D0O A;  3UDF A;  1C9O A;  5IY0 A;  4A3I G;  2N78 A;  4O0A A;  5M3M G;  1B70 B;  4YCU A;  3JC6 6;  1RL2 A;  4P75 A;  2QA4 A;  3L0O A;  5FLM G;  2EXD A;  3E0E A;  1IBM L;  1XNQ Q;  2I0Q A;  1W3S A;  1BKB A;  4BBR G;  4DKA C;  2K50 A;  5C0X G;  4DV4 Q;  1JMC A;  1EUJ A;  3CW2 C;  2NVQ H;  3PUV A;  2MQH A;  1N33 Q;  3J81 i;  1YZ6 A;  4X6A H;  3GO5 A;  3PSI A;  1BVS A;  4OWX B;  1LM0 A;  1A0I A;  4GLX A;  4OX9 Q;  1O7I A;  5EAY A;  3S1Q H;  4B3R L;  3AFP A;  3STB D;  4BBS G;  2B3G A;  3L7Z C;  4LWC A;  4LFA Q;  3S24 A;  1K73 C;  4TVA B;  2AMC B;  4DR5 Q;  3U50 C;  3S14 H;  4GKK Q;  1VS0 A;  5DLQ E;  1VQG A;  2R7Z H;  2UUA L;  1GD7 A;  1VQC A;  3G6E A;  4DV3 Q;  4BY1 H;  4LF9 L;  1OXV A;  2BA1 A;  3U58 A;  4R4O A;  3CC2 A;  4A3L H;  1DGS A;  4WJ4 A;  1WJJ A;  1XTD A;  1MIU A;  1IXR A;  2R7F A;  4UY8 C;  3HOV G;  2YYZ A;  5C0X J;  4A3G G;  4GLV B;  4P72 A;  2K52 A;  2KHJ A;  2MFI A;  3A5Z B;  5C3E G;  2WP8 J;  4LF4 L;  4KHP Q;  2IY5 B;  1L1O A;  4A3F G;  1PH9 A;  1G6P A;  2NZO A;  1VQK A;  4OO1 I;  2QEX A;  4A3B H;  1CSQ A;  3F2C A;  1YJ9 A;  4LF7 Q;  2K75 A;  2V1C C;  4BBR H;  1VQ6 A;  4R4I A;  4DUZ Q;  3HFZ B;  1YVC A;  3CCJ A;  3PGZ A;  5ELN A;  5IT9 c;  4OWW B;  4UPA A;  1PH7 A;  2VUM G;  4X65 Q;  1KHI A;  1Z47 A;  2IHE A;  3K7U C;  3F2B A;  4PMW A;  1PYB A;  2YV5 A;  1L1O C;  3OYY A;  4YY3 Q;  2A1A A;  4BBS H;  2BH8 A;  1EIY B;  1PYS B;  2MNA A;  3GTL H;  3ZJY C;  1RIP A;  3M4P A;  3ICE A;  4LFB Q;  4JOI A;  2I5M X;  3FP9 A;  3NEM A;  4QQB X;  1K8A C;  2QGQ A;  1D7Q A;  1IBM Q;  4NB3 A;  2MO0 A;  2PQA A;  3I55 A;  4J15 A;  2UXC L;  2JA7 G;  4IFD G;  1I5F A;  1XJV A;  2VS1 A;  1S3O A;  3GTJ H;  1LYL A;  1HH2 P;  1U0L A;  1HNZ L;  3TEH B;  4X62 L;  1OXS C;  2ZJP A;  3J81 c;  2EQS A;  4GOP A;  3CD6 A;  3J7A 5;  5C3E H;  2Q2T A;  5C4X H;  4B3R Q;  1ASY A;  2A8V A;  4MTN A;  4YCV A;  1U5K A;  1NY4 A;  4A3J G;  4L5S A;  4A3D G;  3CPF A;  1PVO A;  5IYD H;  4LUV A;  1Y1V G;  1YEZ A;  3CXC A;  1J5E L;  2VL6 A;  2UUA Q;  2Y0S E;  3HOY H;  3HOU H;  3G48 A;  1VQ9 A;  4DR6 Q;  1L2F A;  2N3S A;  3G4S A;  4DV0 Q;  2VUM H;  4GOP C;  3I4O A;  2KCT A;  3DLL A;  3J81 j;  1OTC A;  1S40 A;  1P16 A;  1X3F A;  1PHJ A;  1K83 H;  1UE7 A;  5IP9 G;  3JAM c;  4Y7N H;  3UDG A;  1Q86 C;  1JB7 A;  2E2H H;  4OWT B;  4NXN L;  1L1O B;  4OX9 L;  1PH4 A;  4LF4 Q;  4LW1 A;  4JI3 L;  4JV5 L;  1KL9 A;  2OQK A;  1W2B A;  4L5Q A;  4LFA L;  1AE2 A;  1X3E A;  4JI6 L;  3CAM A;  4JI7 L;  1N32 L;  2K4K A;  4DR5 L;  4AH6 A;  4DV7 Q;  2ZTE A;  1PFS A;  2VW9 A;  4DPG A;  2IX1 A;  4DV3 L;  4GLA C;  4IJH A;  2F3I A;  3W1B A;  3KYH C;  1C0A A;  4GNX A;  3OW2 A;  1GM5 A;  1E22 A;  1VQP A;  1VQH A;  5M5Y H;  2CWP A;  3CF5 A;  3MXN B;  3M85 A;  1XMO L;  4DV5 L;  2ES2 A;  4JI4 L;  1UWV A;  1KC8 C;  4A3D H;  1HZ9 A;  5IP7 H;  4IOC A;  1G29 1;  2E5L Q;  4ME3 A;  2PQA B;  4JI2 L;  3A74 A;  3S17 H;  2Q2U A;  4LF7 L;  1IBK L;  1N36 L;  1E1O A;  2R6G A;  1Q46 A;  4C2M H;  4DNI A;  4GNX C;  3TS0 A;  2E2J H;  4JC0 A;  4DUY Q;  2ZTD A;  4DUZ L;  2OTL A;  4QIW E;  2RF4 A;  1HNZ Q;  4BY1 G;  4GOP B;  4R4Q A;  2IX0 A;  2GN5 A;  1BBW A;  3UE0 A;  1P8L A;  1YHB A;  3AQQ A;  2H5X A;  2KBN A;  1QUQ B;  4YY3 L;  3M9B A;  4DR3 L;  3PIO A;  3RNU A;  1Q81 C;  1N9W A;  5GRO A;  1EFW A;  1KRS A;  4A75 A;  4DV1 L;  1J5E Q;  4LFB L;  4BY7 H;  1UEB A;  3HKZ G;  2RCN A;  3PUX A;  4A3B G;  2LXK A;  2RHS B;  5BR8 L;  2Z0S A;  1SMX A;  2ID0 A;  1KRT A;  1WFQ A;  4IPD A;  4HIK A;  2NN6 I;  4C3I H;  3UE1 A;  4A3M H;  3TRZ A;  3CCR A;  4ALP A;  3VDY A;  2IHF A;  1V9P A;  3HOW G;  1Q12 A;  1S72 A;  5LMU L;  1EQR A;  1SRO A;  1HJP A;  3GD7 A;  4NXN Q;  4PG3 A;  4JI3 Q;  3CCL A;  4JV5 Q;  1K0R A;  3KJP A;  1N32 Q;  4HJ5 A;  4JI6 Q;  4JI7 Q;  2ALY B;  4JBW A;  4BA2 I;  4HID A;  3H3V H;  3KJO A;  1X9N A;  2JA9 A;  1N8R C;  1MJC A;  3EBE A;  4LUO A;  3PUZ A;  1Z9F A;  1SRU A;  4GNX B;  4DR4 L;  4DR6 L;  1I3Q H;  5FJ8 G;  4DV0 L;  2D62 A;  4HJ8 A;  4HJA A;  4JBM A;  4B3T L;  3I4N H;  4YWM A;  1CKN A;  5LMN L;  1XMO Q;  4IOA A;  4AYB G;  4JI4 Q;  4DV5 Q;  2UUC L;  1PH2 A;  3RLO A;  1KQS A;  4IJL A;  5C4X G;  1CKM A;  2D0P A;  2PNH A;  5M3F G;  3RN5 A;  1GVP A;  3HOX G;  3S2D H;  4JI2 Q;  1XPR A;  2B63 G;  5IYD G;  2JA5 H;  2NVX H;  1NMG A;  4X64 Q;  3CCM A;  1IBK Q;  1NE3 A;  4P71 A;  1N36 Q;  4X66 L;  2OQ0 A;  4NPS A;  3H0G G;  3D31 A;  1YI2 A;  4DV7 L;  2F4V L;  2DGY A;  3F1Z A;  3HOY G;  2NVY H;  3HOU G;  2ZM6 Q;  1YHQ A;  4HIO A;  2VZA A;  3BZC A;  4A93 H;  3KOJ A;  3HOW H;  5LMN W;  1SE8 A;  4LF5 L;  3PUW A;  3S1N H;  3A5U A;  2YU9 H;  5ELO A;  3CCS A;  3F2D A;  3D0F A;  2VY3 A;  4DR3 Q;  2R92 H;  2Q2I A;  2KCM A;  3NEL A;  4AYB E;  1VQN A;  4DV1 Q;  4DK3 C;  1VQL A;  2E5L L;  2JA8 G;  1I94 L;  3PO3 H;  2OTJ A;  5BR8 Q;  4APV A;  1Y1W H;  3CC4 A;  1NTG A;  1VCI A;  3K0X A;  4YCW A;  5FJ8 H;  1JJ2 A;  2BH2 A;  4GKJ L;  4DUY L;  1LTL A;  3A0J A;  1NBW A;  4DV2 L;  4PZ8 A;  3KF8 B;  1WCM G;  3G71 A;  3RN2 A;  1TWC H;  5LMU Q;  1VQ7 A;  1YIT A;  4PZ7 A;  1QZH A;  4JOI C;  2GVA A;  5M3F H;  1IBL L;  3HOX H;  1Y14 B;  4A3E H;  3FHW A;  2B63 H;  2LSS A;  1XNR L;  5IYB H;  1KAW A;  2OCE A;  3M4Q A;  5IP7 G;  3H0G H;  5C44 H;  2KHI A;  2K14 A;  1UE5 A;  3ULL A;  4DAM A;  4OON A;  3T1Y L;  1QVF A;  5C0X I;  3TS2 A;  4DR4 Q;  1OXX K;  1VQM A;  2WB1 G;  4GN5 A;  5K36 G;  4B3T Q;  5LMN Q;  2HIX A;  4LUZ A;  4YHH Q;  2CCZ A;  2AHO B;  1N34 Q;  4IFD J;  1X65 A;  3CQZ H;  1HR0 Q;  3CC7 A;  2UUC Q;  1MJE A;  2F52 A;  4GN4 B;  1VQE A;  4HJ9 A;  4B3M Q;  5H1S E;  1EOV A;  3IRB A;  4AIM A;  1YJW A;  2JA8 H;  2CFM A;  4A3K H;  1FJG Q;  4JBJ A;  2MO1 A;  2YTX A;  4X66 Q;  4TQU S;  1JJC B;  2F4V Q;  3GTK H;  4BY7 G;  4H02 A;  2R93 H;  1QVC A;  3T1H L;  4R1J A;  4A76 A;  1VQB A;  2DUD A;  4LF5 Q;  1WCM H;  4C3J H;  3PIP A;  4A3M G;  5IYC H;  2WB1 E;  1IL2 A;  3STB C;  2WAQ G;  1E24 A;  1E3P A;  2WFW A;  1T9H A;  3K8A A;  1EIF A;  2LXJ A;  4IPG A;  2GVB A;  4C3H H;  2OWO A;  3S1M H;  3J7Z C;  3CCU A;  4JG2 A;  2CQO A;  2K5H A;  1GKH A;  1Q1B A;  3CME A;  1I94 Q;  4IPC A;  4X64 L;  4MNO A;  1VQJ A;  5FLX c;  2Z6K A;  4GKJ Q;  5IWA L;  1IYJ B;  3CCE A;  2Q2H A;  3RLF A;  2ZM6 L;  2BA0 A;  4DV2 Q;  4OO1 G;  4K0K Q;  4JI5 L;  1E1T A;  1PV4 A;  1VQ8 A;  4A3C G;  3I4N G;  1YNX A;  4POF A;  4LF8 Q;  1FVI A;  5AJ3 Q;  1IBL Q;  4KI0 A;  3W1G A;  5HGQ A;  3I7F A;  3W5O A;  4O2D A;  1HNW L;  1XNR Q;  1CSP A;  2Z6K C;  2VQE L;  4P74 A;  1WOC A;  2N49 A;  3U4V A;  4IFD I;  1OXT A;  3GTO H;  2AWO A;  2JA5 G;  3T1Y Q;  4RMF A;  1M90 C;  1JT8 A;  4LNQ A;  4OXP A;  4KHZ A;  5JJI A;  2C35 B;  2XGT A;  1K3R A;  4A93 G;  4B3S L;  1CUK A;  3CMA A;  3AEV A;  1UE6 A;  3FKI G;  4R4C A;  5C4J H;  1WI5 A;  3K81 C;  3GTP H;  3HOZ G;  2I5H A;  4DR7 L;  5JJK A;  4XTC S;  3L2P A;  2PI2 A;  3PF5 A;  1XPO A;  1L0W A;  3S15 H;  2R92 G;  4AQY Q;  1VQA A;  4BA1 I;  1X6O A;  4HJ7 A;  1PH1 A;  1KIX A;  1NJI C;  3PO3 G;  2B29 A;  3T1H Q;  1Y1W G;  5GAG C;  1B7Y B;  1LUZ A;  1YJN A;  3HKZ E;  4JI8 L;  4L5R C;  5IE8 A;  3I4M G;  3S16 H;  4A3C H;  4YHH L;  1N34 L;  2UXB L;  1MKH A;  2HT1 A;  4FDB A;  2FXQ A;  1A8V A;  1XMQ Q;  2VQF Q;  1HR0 L;  1ASZ A;  2JEA I;  2UXD L;  2JJQ A;  4YWK A;  3RLN A;  1XPU A;  1SLJ A;  4LF6 Q;  4B3M L;  4WJ3 M;  1A62 A;  4IPH A;  4L5T A;  1FGU A;  4A3E G;  2AWN A;  4P73 A;  1X55 A;  1FJG L;  1Q8K A;  1Q1E A;  5IYB G;  1JJG A;  5C44 G;  5M5W H;  4EQ5 A;  2JEB I;  5IWA Q;  3TRE A; 
#chains in the Genus database with same CATH topology
 4ZRZ A;  4JVZ A;  5DM6 3;  3RR5 A;  4IUN A;  3CRL C;  4DFA A;  2UU9 L;  4ZLT F;  3EIV A;  1QVG A;  3GTK B;  5I2X A;  3A8J E;  1HNW Q;  4QY7 A;  2JA6 H;  1WCM B;  3H3V I;  2Z1C A;  2MPM A;  4C3J B;  1G51 A;  1V1Q A;  4WOR A;  2L1B A;  2HHH L;  2B2U C;  3OIP A;  4DK6 C;  2R93 G;  4B3S Q;  3DWP A;  3KF6 A;  4QJF A;  4LF8 L;  5AJ3 L;  3DM3 A;  1PTO C;  1PH3 A;  1IZ6 A;  2ASB A;  2JE6 I;  3VYT A;  4QL5 A;  1UAP A;  1J6Q A;  2DJG C;  1D8L A;  3KDF A;  3TZU A;  3KLW A;  2SDF A;  2A68 D;  5GAD C;  4HIM A;  2UXB Q;  4U67 3;  1AH9 A;  1QZG A;  2N8N A;  2UXD Q;  3HOV H;  1EQQ A;  3J80 i;  1EY6 A;  2YTY A;  3K5N A;  3NQT A;  4IUR A;  4A3F H;  2KUM A;  5GQO A;  1NR2 A;  3LNN A;  4HCS A;  2NVT H;  1JOQ A;  2HIV A;  4X3S A;  4UDU C;  3JAM E;  1K8G A;  4BXX G;  2ZJR A;  2F0H A;  3W2D A;  5JAV A;  3E0J A;  2VQF L;  3M4O H;  3S2H H;  3D4W A;  1PTO B;  1CK1 A;  3G7L A;  2I5L X;  2DY8 A;  2B2Y C;  2ZJQ A;  1GUO A;  4DAY B;  4HSV A;  5IOC A;  5CV8 A;  3VA7 A;  5M5W B;  2K5N A;  1YBY A;  1CI3 M;  1PH5 A;  2I07 B;  2E2I H;  2R7D A;  3MEF A;  2QCP X;  4DR1 L;  2F0V A;  3HOZ B;  3TQY A;  3IFD A;  1T5X D;  2OXP A;  2NZ1 D;  1BUV T;  3RUZ A;  1K9M C;  5C3W A;  5K5P A;  5JEA J;  4A3I B;  4CJ0 B;  2Z4I A;  2UUB Q;  4LFC Q;  5T1I A;  3E9H A;  3LGJ A;  5ISR A;  1SFO H;  5GAE C;  3ULP A;  1LTA D;  2JA6 G;  2D0O A;  4O0A A;  2RQX A;  1PFM A;  2IL8 A;  2JSO A;  4YCU A;  4P75 A;  1U4P A;  2QA4 A;  2EXD A;  1XNQ Q;  2I0Q A;  3P1H A;  1W3S A;  1BKB A;  2Q8R E;  1SYF A;  1JMC A;  2NVQ H;  4K5W A;  4QF4 A;  5KGU A;  1S5F D;  5ELD A;  4RGM A;  1BVS A;  4GLX A;  4IUP A;  4OX9 Q;  5EAY A;  3S1Q H;  2RSO A;  3STB D;  3S24 A;  2HDL A;  1LAC A;  5DLQ E;  1DON A;  4A3G B;  3G6E A;  4RKL A;  1LAB A;  4LF9 L;  1OXV A;  2NUC A;  3GTM B;  3RZO B;  4WJ4 A;  1WJJ A;  4E6I A;  2R7F A;  3HOV G;  2YYZ A;  5C0X J;  5D14 A;  1NSN S;  3A5Z B;  3K7A B;  2IY5 B;  4A3F G;  1PH9 A;  2NZO A;  3MWY W;  1VQK A;  1TS5 A;  2Y0S B;  3PGZ A;  5IT9 c;  3T53 B;  4OWW B;  4UPA A;  2B2T A;  2J0T D;  3J7A V;  3K7U C;  5T1G A;  4FYD A;  1PYB A;  2JA7 B;  1L1O C;  2A1A A;  4BBS H;  1LV9 A;  1PYS B;  3MXN A;  2MNA A;  3GTL H;  4ZKC B;  1QWY A;  3FP9 A;  3NEM A;  2OF1 A;  1K8A C;  2QGQ A;  1IBM Q;  4NB3 A;  5E4W C;  3I55 A;  1FR3 A;  1I5F A;  3J81 E;  2VS1 A;  1S3O A;  1Y1V B;  1HH2 P;  1EIH A;  1XWE A;  3TEH B;  4X62 L;  2AQ3 B;  3QIA A;  1MSH A;  2EQS A;  3CD6 A;  1ASY A;  2A8V A;  1TWH B;  4FNF A;  4YCV A;  2F0N A;  1KDA A;  1PLF A;  2F3W A;  3SDZ A;  5KYL A;  3NPP A;  4LUV A;  5DM7 3;  2MJ8 A;  1DJR D;  2KEE A;  5FKA C;  2Y0S E;  1VQ9 A;  1H9S B;  4DK1 A;  1EZ6 A;  4GOP C;  3DLL A;  3J81 L;  1OTC A;  1UE7 A;  1K3B C;  1LTT D;  4OEM B;  4OWT B;  1L1O B;  1KTK A;  3NHH A;  4LF4 Q;  4LW1 A;  4JV5 L;  2R61 A;  2AUJ D;  1AE2 A;  5ELB A;  4N9T A;  4DR5 L;  3H09 A;  4IFD H;  1HQM C;  3MFY A;  4IJH A;  4K6D A;  1QIL A;  4UAI A;  1HFN A;  5M5Y H;  3CF5 A;  5LL6 S;  3MVV A;  2R7Z B;  1KNE A;  4G7O C;  3TP8 A;  4A3D H;  4BY1 B;  1HZ9 A;  3R2T A;  4IOC A;  3C2P A;  1F9R A;  4LF7 L;  4DF7 A;  2E2J H;  3BG3 A;  4DUY Q;  5K36 H;  1Y8O B;  4X3T A;  1II3 A;  1TR5 A;  4GOP B;  2IX0 A;  2GN5 A;  1D1I A;  5EKK A;  4A3B B;  1P8L A;  3AQQ A;  2B8G A;  4R8I A;  5HUR A;  3PIO A;  4OGQ C;  3RNU A;  1Q81 C;  1JC7 A;  1EFW A;  2CH4 A;  4DV1 L;  3T16 A;  1D5Z C;  1UEB A;  3A56 A;  2RCN A;  3HKZ G;  4G57 A;  5E1F A;  2RHS B;  1Q90 A;  2Z0S A;  1SYB A;  3RMH A;  3TRZ A;  3T13 A;  3HOW G;  4HR7 B;  1S72 A;  4B9X A;  1EQR A;  3E5S A;  3CCL A;  5FK9 C;  3PMF A;  2NTS A;  1X9N A;  5EKI A;  1S5E D;  3ZYY X;  3PUZ A;  5C4X B;  4DR4 L;  4CJ1 B;  1I3Q H;  5FJ8 G;  4DV0 L;  4JBM A;  3HGB A;  2D2C C;  1HUN A;  1EEF D;  1UEA B;  3OOC A;  2EJF C;  2ZT9 C;  4K14 A;  1PH2 A;  3HOU B;  4NDX A;  3RLO A;  4V19 0;  1EYD A;  4RCO A;  5M3F G;  1GVP A;  3O13 A;  2EDG A;  3OWF A;  1NE3 A;  1K83 B;  3I72 A;  4Y7N B;  1YI2 A;  4DGZ A;  4DV7 L;  3F1Z A;  2E2H B;  4A93 H;  4HIO A;  5LMN W;  4LF5 L;  5I9P A;  3PUW A;  5IIF A;  1U4M A;  5ELO A;  4B08 A;  1C8C A;  2KCM A;  1F2M A;  3FPU B;  2PW5 A;  1I94 L;  3PO3 H;  5BR8 Q;  1Y1W H;  1NTG A;  2CQA A;  2LFN A;  3LWE A;  4YCW A;  1LTL A;  3A0J A;  4XYO A;  1RJT A;  4EVO A;  3H3V C;  1VQ7 A;  2DY7 A;  1YIT A;  4PZ7 A;  4F8M A;  1EYC A;  2PZW A;  1MSG A;  2HCI A;  3VYU A;  1IBL L;  4A3E H;  3FHW A;  5J39 A;  1ZEQ X;  3GQB A;  1PYW D;  3OW7 A;  2Z6B A;  3M4Q A;  4G4K A;  1QNU A;  3H0G H;  4FP5 D;  3A54 A;  2H4O A;  1BO0 A;  1Y8P B;  1ENF A;  4OON A;  3T1Y L;  2D5D A;  5C0X I;  3TS2 A;  1OXX K;  5I2Y A;  2WB1 G;  5JOB A;  5K36 G;  1EWH A;  5LMN Q;  2CCZ A;  1N34 Q;  4BY7 B;  2JYO A;  1MJE A;  2A69 C;  1VQE A;  4B3M Q;  1EOV A;  3IRB A;  4AIM A;  2JA8 H;  2CFM A;  5EGT A;  4C3I B;  1FJG Q;  3D4R A;  4JBJ A;  4PNY A;  3SE0 A;  1EL0 A;  3T4A C;  1QVC A;  4R1J A;  4KKU A;  2KCC A;  5IYC H;  1ESR A;  1T9H A;  2OWO A;  2LXJ A;  2ENB A;  3MFG A;  3J7Z C;  4JG2 A;  2CQO A;  4C56 C;  1GKH A;  5AFW A;  4X64 L;  4MNO A;  5FLX c;  3ONA B;  5IWA L;  3CCE A;  3RLF A;  4DV2 Q;  4RHS A;  1VQ8 A;  2NVX B;  1YNX A;  4POF A;  4LF8 Q;  1FVI A;  5AJ3 Q;  1BCP B;  5HGQ A;  1SYE A;  2Z6K C;  2HDM A;  1TS3 A;  4IFD I;  2YU9 B;  3GTO H;  2AWO A;  1TY0 A;  3MXP A;  3TME A;  1JT8 A;  1M90 C;  1H9M A;  3A7A B;  4LNQ A;  2R92 B;  1D1K A;  1BQQ T;  1K3R A;  2E74 C;  4A93 G;  1NNX A;  4WRD A;  4RFB A;  1RCV D;  2F3V A;  2K1B A;  1QJO A;  3IAY A;  1WTW A;  2PI2 A;  3NUC A;  4CKE A;  1BR9 A;  3PO3 G;  1Y1W G;  4OL7 A;  5GAG C;  1IYV A;  5DAU A;  4L5R C;  4A3C H;  3S16 H;  4YHH L;  2FXQ A;  2VQF Q;  4HAE A;  3DEO A;  4YWK A;  3MC0 B;  3RLN A;  1SLJ A;  3KUP A;  2NWG A;  1EYA A;  2HD3 A;  4A3E G;  1XXG A;  1Q1E A;  2RVL A;  1HQR D;  2MHV A;  3CQZ B;  3EQL C;  1L0X B;  1AE3 A;  1HRJ A;  2ATW A;  3GTQ H;  1HR0 W;  3D4D A;  4RCN A;  1EFI D;  5A2Q L;  1M1K C;  4ME5 A;  3BVG A;  2R93 B;  2CHB D;  5JJL A;  2VQE Q;  2HQL A;  1FNW A;  2EYM A;  1UNS A;  5HY6 A;  4DR1 Q;  2DN8 A;  4B9W A;  2RSN A;  3D8G A;  4KTA A;  3PO2 G;  5FLM H;  5IT9 E;  4C3H B;  3TP6 A;  4JI0 L;  3I4M H;  3RZD H;  3NEN A;  2JXM B;  2F0F A;  4K0K L;  4DR2 L;  1ESF A;  3EJI A;  3ULJ A;  4EGV A;  4KKT A;  1PRT C;  3AYH B;  1WYD A;  5IYC G;  4DR7 Q;  4NMZ A;  3U4Z A;  2PMZ B;  3WOF A;  1XX8 A;  1CQV A;  1HNX L;  5CV6 A;  3G6J B;  3ERS X;  1EY5 A;  2AKW B;  4V0B A;  1SNQ A;  4NXM L;  2R3Z A;  4UP8 A;  2ZTC A;  3BZD B;  1JB3 A;  3NBH A;  1H95 A;  4BWG B;  4XIG S;  1VQI A;  2QF7 A;  1Q82 C;  4LMQ D;  1BNZ A;  2WAQ B;  1D5M C;  2AQ2 B;  3I2Z A;  1I4H A;  1PXU A;  1CA5 A;  3CPW A;  4LF9 Q;  1DD2 A;  1GOZ A;  3L9A X;  1YNN C;  1VQD A;  2PMZ E;  4PZ6 A;  1N33 L;  1PRT B;  3EN2 A;  4LF6 L;  3URY A;  1ZXT A;  4Y52 H;  1HTL D;  4N8X 1;  1HHV A;  2ICI A;  1PZK D;  4HMI A;  4MZ9 A;  1XTC D;  2K04 A;  3BJU A;  1HZA A;  3UDX A;  3M3Y H;  1VQO A;  3PV0 A;  3OTO L;  2MUY A;  4EQN A;  2K5W A;  2RDF A;  1PTO F;  2KOL A;  2BOS A;  4DV6 Q;  1SE3 A;  2CWA A;  2SOB A;  1YHA A;  3BZK A;  2WAQ E;  4QGU A;  1KD1 C;  3QJY A;  1O78 A;  2PNR C;  1PDQ A;  1B3Q A;  4XDX A;  1HZC A;  3K5M A;  1SE2 A;  1Q7Y C;  2JA6 B;  4BXX H;  4DNR B;  1I6H H;  3J80 E;  2EOT A;  4X62 Q;  4N8F A;  1X56 A;  2EYF A;  4M8A A;  4JYA L;  3NE5 B;  1I50 H;  3AFQ A;  3KLR A;  3NBI A;  5IY0 A;  2LY7 A;  4LK1 C;  1B70 B;  1RL2 A;  2J7Z A;  2RA4 A;  3L0O A;  5FLM G;  1T5E A;  3K5L A;  4BBR G;  1QG7 A;  4JPB W;  2K50 A;  4DV4 Q;  1EUJ A;  3J80 L;  1MI2 A;  3PSI A;  2PO4 A;  1SDF A;  1O7I A;  3SXH A;  3HP3 A;  4B3R L;  3L7Z C;  4TVA B;  2AMC B;  4DR5 Q;  3S14 H;  4LJZ C;  5IGE A;  4GKK Q;  1LT6 D;  3HOV B;  1VQG A;  2UUA L;  3NP8 A;  1A2U A;  4IN3 A;  4A3F B;  2TSS A;  2WII B;  1BXT A;  1DGS A;  4UY8 C;  2NVT B;  4GLV B;  1ML0 D;  2K52 A;  2KHJ A;  2MFI A;  1Q8I A;  5C3E G;  3FRP B;  2WP8 J;  2C5C A;  4KHP Q;  2E2D C;  3VR3 A;  4WFN 3;  2F0O A;  3KBG A;  4LF7 Q;  3M4O B;  3S2H B;  5CMD A;  1VQ6 A;  2ZXR A;  4ZKB B;  3HFZ B;  4RAU C;  2PQE A;  5LHY 1;  5EQ0 A;  3P7J A;  2VUM G;  4X65 Q;  1KHI A;  1Z47 A;  3F2B A;  2YV5 A;  1VMC A;  2BH8 A;  1CZG A;  3Q22 A;  4K2L A;  3ICE A;  1ZKO A;  4ILW A;  1TII D;  1RD9 D;  2K03 A;  1C48 A;  2DNC A;  1XJV A;  4O42 A;  4XQN A;  2E2I B;  3GTJ H;  1LYL A;  1EQV A;  1KAA A;  1U0L A;  1HNZ L;  3K0Y A;  1OXS C;  2E75 C;  2ZJP A;  3J7A 5;  1LTB D;  1I4G A;  4QUF A;  2QW7 A;  3QO2 A;  4BS9 A;  1NY4 A;  4L5S A;  5G3L D;  1PVO A;  2B2W A;  1YEZ A;  5DNF A;  1IKL A;  1G2T A;  3HOY H;  1SFO B;  3C3L A;  2CW0 C;  2N3S A;  4DV0 Q;  1GUS A;  3F2U A;  2DJF C;  4L63 B;  1B2T A;  1S40 A;  1P16 A;  1ICW A;  4KJN A;  4XYQ A;  2A74 C;  2RBM A;  4JI3 L;  3BVM A;  1N32 L;  4U68 A;  4LFA L;  5CC4 A;  2NVQ B;  3GP7 A;  2K4K A;  4KY7 A;  4ZAI A;  4DV7 Q;  2KVM A;  1PFS A;  4L6T B;  1STY A;  1W6K A;  2VW9 A;  4F87 A;  4DV3 L;  3S1Q B;  3W1B A;  1DOL A;  3JAM L;  3DHQ A;  5KRU A;  1VQP A;  4CDE C;  1ENA A;  2CWP A;  4RGT A;  1XMO L;  2ES2 A;  1UWV A;  5FLX E;  1G29 1;  2PQA B;  1PFB A;  1PTO D;  3S17 H;  1IBK L;  1N36 L;  1Q46 A;  4GNX C;  2ZXP A;  3TS0 A;  2EXZ A;  4JK1 C;  3OWE B;  2N88 A;  4DUZ L;  2OTL A;  3HKZ B;  1QUQ B;  4YY3 L;  2GA4 B;  1BF4 A;  2KHS A;  1KLU D;  4IAL A;  1SJH D;  1J5E Q;  3TZD A;  1AFP A;  1AZQ A;  1LTR D;  1O7Z A;  3PUX A;  2LXK A;  2F0U A;  2ID0 A;  3V2T A;  2BCO A;  4BBS B;  1WFQ A;  3HS0 C;  3GTL B;  4HIK A;  4A3M H;  4KY5 A;  3CCR A;  3ERO A;  3NQI A;  3SVM A;  1PZI D;  1HJP A;  2KJX A;  4NXN Q;  1ET9 A;  1QB5 D;  3MAQ A;  1RTO A;  1F2Y A;  3KJP A;  3BDO A;  4HCE A;  4JI6 Q;  1IYU A;  5HGT A;  4JI7 Q;  4JBW A;  2L0C A;  1RF2 D;  1I6V C;  3NTI A;  2FIN B;  3EBE A;  4OO1 H;  4GNX B;  1J9O A;  5D3D A;  4HJA A;  4HJ8 A;  1MD2 D;  4B3T L;  4IUU A;  3TSS A;  4AYB G;  4JI4 Q;  4K5V A;  3C1E A;  3E3X A;  3QR8 A;  2UUC L;  2A5H A;  4IJL A;  4BA2 I;  5CV9 A;  1JWU D;  3HOX G;  1SNM A;  1GUN A;  4JI2 Q;  2B63 G;  1MGS A;  4X64 Q;  2F4V L;  3HOY G;  3GV3 A;  1YHQ A;  1Y8N B;  2VZA A;  3BZC A;  3KOJ A;  3HOW H;  2A6H C;  5M9O A;  2PZT A;  4OIK A;  2K5Q A;  3QOJ A;  3A8K E;  2K28 A;  1CHQ D;  3CCS A;  1V1P A;  4DR3 Q;  2Q2I A;  1SE4 A;  1E2W A;  1VQL A;  2E5L L;  1S5D D;  3DWQ A;  5M5Y B;  1V8Q A;  1X32 A;  4MIU A;  5FJ8 H;  2BH2 A;  4GKJ L;  4A3D B;  1GHK A;  2XN9 C;  3KF8 B;  2IJ0 A;  1WCM G;  1TWC H;  5LMU Q;  1D6E C;  4JOI C;  2GVA A;  1E2Z A;  5M3F H;  2E2J B;  2WB1 B;  1JCK B;  4KK7 A;  2K6A A;  1EY7 A;  2KHI A;  1UE5 A;  1SND A;  4DAM A;  1QVF A;  1A6X A;  4GN5 A;  3OIQ A;  4LUZ A;  4YHH Q;  4IFD J;  1X65 A;  2X6G A;  2G5D A;  3CC7 A;  2F52 A;  4XT3 B;  1JOO A;  1YJW A;  4DN4 M;  1STG A;  2B2V C;  4A3K H;  4X66 Q;  4TQU S;  1JJC B;  2QKI C;  5COR A;  2M2L A;  4H02 A;  3T1H L;  4DU9 A;  1AW7 A;  2OT2 A;  3CU7 A;  3FMC A;  3PIP A;  4A3M G;  3MXU A;  3RD4 A;  4X3K A;  2WB1 E;  1IL2 A;  2WFW A;  1E3P A;  4P73 A;  2A6H D;  3S1M H;  2F0P A;  1I3Q B;  2ZM6 L;  2BA0 A;  4OO1 G;  4K0K Q;  1K28 A;  1STA A;  1E1T A;  2RDH A;  3SR1 A;  1PV4 A;  5EBD A;  2BDO A;  3WDN A;  1M8A A;  2NN6 H;  3M7G A;  1GUW A;  4KI0 A;  4ZUI A;  1HFG A;  3W5O A;  3H94 A;  4A93 B;  4O2D A;  1HNW L;  1XNR Q;  5M5X B;  2O4X A;  3ND9 A;  4CKB A;  3U4V A;  1OXT A;  2NTT A;  4CJ2 C;  1HUM A;  3J7A F;  4H44 C;  3TBI B;  1EU4 A;  4B3S L;  3PO3 B;  1O7Y A;  3FKI G;  1Y1W B;  3GTP H;  1WI5 A;  2HCC A;  3K81 C;  4PMB A;  3HOZ G;  1X3Q A;  4XTC S;  2Q8T A;  3L2P A;  1XPO A;  2F0S A;  2L11 A;  4P2C B;  4HJ7 A;  3CRK C;  1H9K A;  1YJN A;  1WD0 A;  1CHP D;  4H0L C;  4A3E B;  3TP5 A;  5DEH A;  4DAV A;  2BE5 C;  1R9T B;  2UXB L;  3H0G B;  1CZW A;  1ASZ A;  2JEA I;  4M1U B;  2JJQ A;  2UXD L;  4LF6 Q;  4IPH A;  3BVZ A;  1WTQ A;  2KA7 A;  1JJG A;  1GHJ A;  2JEB I;  3DM1 A;  5M5X H;  1I4R A;  4JI5 Q;  4X3U A;  2JA8 B;  4MN3 A;  3OTO Q;  2K01 A;  4YWL A;  3Q23 A;  2B2U A;  1RDP D;  5D3I B;  2SNM A;  4EQO A;  2K5V A;  2WV6 D;  3Q8D A;  1PH6 A;  3PUY A;  5EKL A;  1X54 A;  1EY9 A;  2IWH A;  2IT1 A;  5M3M H;  4KN4 C;  4A3K G;  1STB A;  2KEN A;  4ID6 A;  3HKS A;  5CV4 A;  4RGO S;  4ZQ3 A;  1X3G A;  1LT5 D;  1V1O A;  4A4I A;  1TWF H;  3Q24 A;  1KDC A;  4F88 A;  3T51 B;  3GTG H;  1C4Q A;  4RG1 A;  4DAY A;  1JE5 A;  4JYA Q;  1DM0 B;  3VYS A;  4RHR A;  3KFU A;  1SR3 A;  1R9T H;  4HED A;  2WKC A;  2Y0S G;  5I9O A;  2Z8L A;  5BN5 A;  1X3P A;  2A19 A;  1AN8 A;  4JI8 Q;  3S1R H;  3ER0 A;  1VQ4 A;  3HEJ A;  2UUB L;  4LFC L;  1BCP C;  3GTO B;  1CT1 D;  2NN6 G;  4R4T A;  4RWS C;  1TWG H;  1EU3 A;  4AQY L;  3UDI A;  1QUQ A;  4GS3 A;  3PO2 H;  4UP7 A;  3M7N A;  5EBC A;  1FD7 D;  1IW7 C;  1A63 A;  1Z6H A;  3D6C A;  4CGY B;  1XNQ L;  2L15 A;  2EIF A;  2XRQ D;  1B4O A;  1A2T A;  2B2Y A;  2UU9 Q;  1Z7T A;  4CDC C;  1TY2 A;  4IO9 A;  3L3O C;  3U9S A;  1XMQ L;  2OEO A;  3SGI A;  2VB2 X;  3S16 B;  4MTK A;  1G8Z D;  1VF5 C;  2HHH Q;  1GO3 E;  3CP0 A;  5JPM C;  1VQF A;  3KF6 B;  3QG1 A;  2N55 A;  1PRT F;  3I70 A;  1TWA H;  5IGG A;  1BBU A;  4A3J H;  3KDF B;  4KLK A;  2ZXO A;  5GAH C;  3GTQ B;  1LTG D;  1OO9 B;  1EY8 A;  1JWS D;  3K80 C;  1BBX C;  2K5D A;  2V4D A;  4HMJ A;  2R7Z G;  5E7N A;  3MHB A;  4RH6 A;  4EX5 A;  1TXY A;  1SN8 A;  4JI1 L;  1ZYR C;  4CKC A;  1TVX A;  3AU7 A;  5KNC A;  2CKZ B;  5ELF A;  4A3L G;  4UHV A;  3I4M B;  3RZD B;  4HTH A;  1UE1 A;  1BCP D;  3UDF A;  3S9W A;  2A69 D;  3VA5 A;  3T56 B;  2N78 A;  5D65 A;  5M3M G;  1WTV A;  1IBM L;  3E0E A;  1G91 A;  2EYP A;  3CW2 C;  5KND A;  3PUV A;  2MQH A;  3GO5 A;  1SNP A;  1LM0 A;  3NK9 A;  3AFP A;  1EY4 A;  2WKD A;  3AB9 A;  4LFA Q;  2O2L D;  1F9Q A;  4MHE A;  1VS0 A;  4OEL B;  3H6M A;  1D2B A;  1GD7 A;  3LX0 A;  2AQ1 B;  4DV3 Q;  1H9S A;  1GXD C;  4R4O A;  1MIU A;  1S5C D;  1EQT A;  4J6H A;  2F0E A;  4P72 A;  1CM9 A;  4LF4 L;  2PYK A;  1L1O A;  1G6P A;  1CSQ A;  2K75 A;  2V1C C;  4BBR H;  4QCL A;  4KD4 A;  4DUZ Q;  1AP0 A;  5ELC A;  3SK4 A;  4QB4 A;  1PH7 A;  3K6O A;  4YY3 Q;  1JQY D;  2L12 A;  3M3Y B;  2XIW A;  2RKS A;  3M4P A;  4KY6 A;  4JOI A;  5IT9 L;  4C1N I;  4J15 A;  2UXC L;  2B2T C;  1TKW B;  5IGF A;  5G3L F;  5C4Z A;  4ZUJ A;  1A15 A;  4Q0F A;  2WIN B;  1JOK A;  4GZY C;  3J81 c;  4EQP A;  4GOP A;  4NP5 A;  5C3E H;  2G9H D;  4A3J G;  5KIX A;  1I6H B;  3CPF A;  5IYD H;  2LMC B;  4FVM A;  3UI2 A;  2B2V A;  1G2S A;  1L2F A;  1I50 B;  2VUM H;  1YNJ C;  1U4R A;  3I4O A;  2KCT A;  4J8Q A;  2F0W A;  4QIW B;  1PHJ A;  5IGB A;  1JB7 A;  5EPJ A;  1PH4 A;  1KL9 A;  2OQK A;  1W2B A;  4L5Q A;  1X3E A;  1GJX A;  4H7B A;  4AH6 A;  2ZTE A;  2IX1 A;  4GLA C;  1C0A A;  3BS1 A;  3BDC A;  1EY0 A;  4CHT B;  1VQH A;  3S14 B;  3MXN B;  4ZK9 B;  1QCB D;  4ABN A;  1KC8 C;  1PRT D;  5IP7 H;  5F2D A;  2E5L Q;  1UUP A;  3A74 A;  1F9P A;  2F1M A;  3QOL A;  3KK7 A;  1MHW C;  4C2M H;  3OMC A;  1S4Z A;  2ZTD A;  4QIW E;  2RF4 A;  2MP1 A;  2XWB B;  4R4Q A;  2EZV A;  3UE0 A;  1YHB A;  2KBN A;  3VR6 A;  1ONL A;  4XXE A;  4G7H C;  1EOT A;  1FYC A;  3KBX A;  5GRO A;  1KRS A;  4A75 A;  4LFB L;  3OMG A;  1ROD A;  4DXF A;  4R8N A;  4O1N A;  2F0J A;  5BR8 L;  1SMX A;  1TS2 A;  1KRT A;  1HA6 A;  1G6Z A;  1F77 A;  2RDG A;  1Q3L A;  3UE1 A;  3VDY A;  2EJG C;  1ILQ A;  2M9V A;  2QDB A;  4RGN A;  1YNN D;  2AUK A;  3TDQ A;  4JV5 Q;  1K0R A;  4HJ5 A;  3GTJ B;  4AYB B;  4HID A;  3KJO A;  2EYO A;  4CDD C;  5CBE E;  1EWC A;  2A68 C;  2EPB A;  1MJC A;  1Z9F A;  2EJM A;  2IX3 A;  4DR6 L;  3I73 A;  3HOX B;  2IW3 A;  3I4N H;  4YWM A;  5LMN L;  3IL8 A;  4IOA A;  1AEX A;  3HOY B;  3H91 A;  1KQS A;  2D0P A;  5ELE A;  3S2D H;  5IYD G;  2JA5 H;  3W3A A;  3E6Z X;  3CCM A;  4IQZ A;  1SYC A;  1LTS D;  1K0S A;  2NVY H;  2ZM6 Q;  1SE8 A;  3S1N H;  4Q5V A;  3MA2 B;  5TSS A;  3F2D A;  3D0F A;  2VY3 A;  4AYB E;  1VQN A;  4DV1 Q;  4DK3 C;  5C5M A;  2PCF B;  3FEW X;  4APV A;  4KKS A;  3K0X A;  5KYI A;  1LO5 D;  4I7A A;  1JJ2 A;  3X3N A;  3I3C A;  4OHJ A;  4DV2 L;  3A7L A;  4XT1 B;  3RN2 A;  2KQ3 A;  3S17 B;  1NR4 A;  3I4L A;  3N6R A;  5A35 A;  1QZH A;  3HOX H;  1Y14 B;  4C3H G;  2B63 H;  2LSS A;  1KAW A;  2OCE A;  5IP7 G;  5C44 H;  2E76 C;  3ND8 A;  2K14 A;  1WTP A;  5C6A A;  4DR4 Q;  1VQM A;  3M4Y A;  2B39 A;  2QEJ C;  1VMP A;  4XQJ A;  3MXG A;  3DEP A;  5FO8 B;  3BDL A;  2A6E C;  4HJ9 A;  4H13 C;  4KN7 C;  1B9M A;  4A3M B;  3TN2 A;  3HRZ C;  2YTX A;  3V96 A;  1WVL A;  3GTK H;  5C4J B;  1STN A;  4A76 A;  4K8J A;  1TT2 A;  2DUD A;  4IUT A;  4LF5 Q;  3S15 B;  1WCM H;  4R9W A;  2G9D A;  4K2K A;  4C3J H;  3BYT B;  3STB C;  2WAQ G;  1E24 A;  3K8A A;  4DV5 L;  1EIY B;  3IFT A;  4IPG A;  2GVB A;  1VDZ A;  3CCU A;  3VR4 A;  1Q1B A;  1IL8 A;  3CME A;  3J7Y W;  1I94 Q;  4IPC A;  4CBV A;  5C3X A;  2Z6K A;  1IYJ B;  3DXJ C;  1TQO A;  3MTS A;  4RKB A;  5BN3 A;  1GUT A;  5IOD A;  3P75 A;  3I4N G;  1A3U A;  1SMY C;  1IBL Q;  3W1G A;  2K32 A;  2C9O A;  3HOW B;  1CSP A;  2VQE L;  1ENC A;  5FLX L;  4P74 A;  2F0D A;  4FXG C;  4KJO A;  3FKI B;  2JA5 G;  3T1Y Q;  4RMF A;  4OXP A;  1I4P A;  5CV7 A;  2XGT A;  1RTN A;  5FO7 B;  3CMA A;  1K8M A;  2CW0 D;  3ERQ A;  3K5O A;  1UE6 A;  3AEV A;  1GUG A;  5KNB A;  5C4J H;  1FNU A;  4DR7 L;  3S15 H;  1R4P B;  1L0W A;  4AQY Q;  4BA1 I;  1X6O A;  2A6E D;  1TWC B;  5JEA H;  5KEE A;  1PH1 A;  1KIX A;  2L55 A;  4ULL A;  1LUZ A;  2L9H A;  5M3F B;  3HKZ E;  1PTO H;  3OHX C;  5E4X A;  3NSW A;  5IE8 A;  1SAP A;  3EFX D;  2HT1 A;  1XMQ Q;  1HR0 L;  4QMG A;  1LTI D;  2P5Z X;  1XPU A;  3NWS A;  4WJ3 M;  3QWN A;  1Q8K A;  1HA5 A;  2FMM A;  5C44 G;  5M5W H;  1B1Z A;  5IWA Q;  4QUC A;  1LT4 D;  3CCV A;  4A3K B;  3FKI H;  3HOZ H;  1YIJ A;  1E7Z A;  4JCV E;  3JAM i;  4J1M A;  1XYI A;  1DYQ A;  1VQ5 A;  4A3I H;  1PH8 A;  1HCZ A;  1SMY D;  1CTM A;  3I8Z A;  1HZB A;  1O7L A;  2XVS A;  2K05 A;  2EE1 A;  2RHQ B;  4JBK A;  2CVR A;  3S1M B;  1CKO A;  3EVQ A;  2PZU A;  1STH A;  5C0X H;  3BYY B;  3DWA A;  2HQE A;  2JK8 A;  2NZH A;  4JI1 Q;  4C3J G;  2F0Q A;  2E8G A;  4DV6 L;  3BU2 A;  1B8A A;  1C7Y A;  5J22 A;  1ET6 A;  1CKN B;  4POG A;  2O5I C;  1VF7 A;  1ICF B;  4G7Z C;  1K8O A;  3GDE A;  1RHP A;  2IPK D;  3PIP 3;  4A3G H;  3WWV A;  3X3M A;  2JQO A;  3GTM H;  3RZO H;  3E9I A;  2F0G A;  2YTV A;  3FVQ A;  3GTP B;  2M00 A;  1LLR D;  1NAP A;  1L0Y B;  5J3B A;  4FO2 A;  2PI2 E;  3K7A H;  1B44 D;  1U9R A;  4DV4 L;  2BDN A;  1I4Q A;  3LWU A;  4GN3 B;  1TS4 A;  4KMU C;  1SBB B;  2VNU D;  2FHT A;  3CCQ A;  3B6Y A;  4DNT B;  3OPO A;  3PIO 3;  3NWT A;  1EWI A;  1KXL A;  4ZYS A;  5J1Z A;  1EYG A;  5JEA G;  4GKK L;  4JI0 Q;  2JA7 H;  2RCF A;  4XQQ A;  3F8T A;  3H15 A;  4PMC A;  3PCO B;  4DR2 Q;  3NXW A;  1OXU A;  1SYG A;  1PA6 A;  2XSC A;  1V43 A;  1FNV A;  1WTX A;  1HNX Q;  3VR5 A;  1Y1V H;  1FL0 A;  4KHP L;  3I56 A;  4NXM Q;  3PF4 A;  4UP9 A;  2WAC A;  1JE4 A;  1CFM A;  2UXC Q;  1BDO A;  1TWH H;  2F0T A;  3NBH B;  3R93 A;  1NUC A;  2XWJ B;  1BCP F;  2K7V A;  2HUG A;  5M3M B;  1EZ8 A;  5IP9 H;  2KEC A;  4X65 L;  4HN7 A;  2XTI A;  1JIC A;  3A55 A;  5JVH 3;  3J80 c;  5NUC A;  1NMF A;  2O5J C;  1TWF B;  1EEI D;  2VB3 X;  1C9O A;  4ODG A;  4A3I G;  3GTG B;  1RKN A;  3PQI A;  3JC6 6;  1O80 A;  1JOR A;  2XRS D;  2KCN A;  4DKA C;  5C0X G;  4FF3 A;  3Q6S A;  4WJW A;  1N33 Q;  5CGK A;  1YZ6 A;  3J81 i;  4X6A H;  4OWX B;  1A0I A;  1HPC A;  1KAB A;  4BBS G;  2B3G A;  4LWC A;  3S1R B;  2EVB A;  1K73 C;  3NTH A;  5BN4 A;  3U50 C;  5C5L A;  2R7Z H;  1VQC A;  4RA8 A;  5LL6 X;  4JW0 A;  1TWG B;  4BY1 H;  2BA1 A;  4KHV A;  5CYU A;  1IHZ A;  2EY1 A;  5JJZ A;  3PO2 B;  2FMC A;  1EIG A;  3U58 A;  3CC2 A;  3AMU A;  4A3L H;  1XTD A;  1IXR A;  4A3G G;  2ICE C;  4YIJ A;  1DXM A;  3IKJ A;  4DK0 A;  4FF2 A;  2QEX A;  4A3B H;  3F2C A;  1YJ9 A;  4OO1 I;  1MBY A;  3P20 A;  4I65 A;  1WTO A;  4R4I A;  1KDB A;  1YVC A;  3N52 A;  3CCJ A;  5ELN A;  2JP1 A;  4F7X A;  2IHE A;  4PMW A;  3OYY A;  3MEH A;  1WD1 A;  3ZJY C;  1RIP A;  1E0B A;  4LFB Q;  1U4L A;  1TWA B;  2I5M X;  3K58 A;  4QQB X;  1D7Q A;  2MO0 A;  2PQA A;  2SNS A;  2JA7 G;  4IFD G;  4A3J B;  4Z9C B;  2LKV A;  3SEB A;  5EPK A;  4I7Z C;  2Q2T A;  5C4X H;  4B3R Q;  2BE5 D;  2F0I A;  4MTN A;  1U5K A;  5E3F A;  3OSO A;  4A3D G;  5C4H A;  1Y1V G;  1DOK A;  3CXC A;  1J5E L;  2VL6 A;  2UUA Q;  3HOU H;  3G48 A;  3FDT A;  2L5T A;  2NB0 A;  1SJE D;  1KLG D;  4DR6 Q;  2H1E A;  3G4S A;  2F4I A;  3V05 A;  4DXG A;  4L8J A;  3J81 j;  3Q0A A;  2SEB D;  1S5B D;  1F9S A;  2EY5 A;  1X3F A;  1K83 H;  5IP9 G;  3JAM c;  1WTR A;  4Y7N H;  3UDG A;  4TRD A;  1Q86 C;  2EYJ A;  4FF1 A;  4IUQ A;  2B2W C;  4NXN L;  3GV6 A;  5JPN C;  2E2H H;  4OX9 L;  2F0M A;  4K6L A;  1QNK A;  1M4V A;  3CAM A;  4JI6 L;  4JI7 L;  4HSP A;  5FOB B;  4DPG A;  5COY A;  2F3I A;  3KYH C;  5I6Y A;  2CH4 W;  2QDL A;  4GNX A;  4C1N K;  3OW2 A;  1E22 A;  1GM5 A;  3M85 A;  4JI4 L;  4S3S A;  2LS0 1;  3R3O A;  3SK5 A;  2EY2 A;  3KLS A;  4LAA A;  4TSS A;  4ME3 A;  4JI2 L;  2Z9H A;  2Q2U A;  1E1O A;  2R6G A;  4DNI A;  3EA6 A;  4JC0 A;  4K5X A;  5EJW A;  1SNC A;  1HNZ Q;  4BY1 G;  2FJ2 A;  1BBW A;  2TMP A;  3KLS X;  3SK8 A;  2KED A;  2H5X A;  3M9B A;  4BBR B;  4DR3 L;  1N9W A;  3HZX A;  1I4X A;  3VYR A;  5L37 A;  4BY7 H;  4A3B G;  2NBF A;  4IPD A;  1A3T A;  2NN6 I;  4C3I H;  3SHL A;  4ALP A;  1IW7 D;  2IHF A;  1V9P A;  1Q12 A;  1B53 A;  1Y69 U;  4DA2 A;  5LMU L;  3GD7 A;  1SRO A;  3KF8 A;  4PG3 A;  3C1F A;  1D5X C;  4JI3 Q;  1N32 Q;  2ALY B;  3H3V H;  1SSO A;  3A8I E;  2JA9 A;  1N8R C;  4LUO A;  5C3E B;  1SRU A;  1DZ1 A;  2D62 A;  1PMR A;  3TP7 A;  1CKN A;  1XMO Q;  3K57 A;  5A2Q E;  1LT3 D;  4DV5 Q;  5CV5 A;  5C4X G;  1DCZ A;  1CKM A;  1FGB D;  2PNH A;  2EYH A;  3RN5 A;  2VUM B;  1XPR A;  5CBA E;  2NVX H;  1NMG A;  1IBK Q;  4P71 A;  1N36 Q;  4X66 L;  2OQ0 A;  4NPS A;  3H0G G;  3D31 A;  2DGY A;  3HOU G;  4NW2 A;  2J4X A;  3U9O A;  3A5U A;  2YU9 H;  3HG9 A;  2L4N A;  2F0L A;  4IUV A;  2R92 H;  1ZYR D;  3NEL A;  1HXY D;  2JA8 G;  2DNE A;  1JR0 D;  2OTJ A;  3NTK A;  3CC4 A;  4IZ8 A;  1VCI A;  3DMU A;  2EY6 A;  4DUY L;  4KV6 A;  4OIJ A;  1NBW A;  4PZ8 A;  4PQX A;  3D6W A;  3G71 A;  1JWM D;  4FXK C;  4DAP A;  1WTH A;  5JVG 3;  4PV1 C;  3DUZ A;  1R4Q B;  4C2M B;  3VR2 A;  1H9R A;  1XNR L;  5IYB H;  3ULL A;  2F0K A;  2K33 A;  1KNA A;  3SK6 A;  4B3T Q;  1DOM A;  2HIX A;  1AZP A;  2AHO B;  4K8I A;  3CQZ H;  3ITP A;  1HR0 Q;  2UUC Q;  3I91 A;  3QB3 A;  4GN4 B;  1CQF A;  1PFN A;  5H1S E;  1F2Z A;  1HTP A;  1SNO A;  2MO1 A;  2Z4H A;  3I90 A;  1QOH A;  2F4V Q;  2F03 A;  4BY7 G;  2R93 H;  1VQB A;  4FF4 A;  1SEB D;  3FPP A;  2EYL A;  2I46 A;  4C3I G;  1V1P B;  1EIF A;  4C3H H;  3R8B A;  5CR3 A;  1H9J A;  2K5H A;  3I4N B;  2PW7 A;  2NYZ D;  1VQJ A;  4GKJ Q;  1B3A A;  2Q2H A;  2QIL A;  3K59 A;  1SYD A;  1PZJ D;  1SXT A;  4JI5 L;  3S2D B;  1E2V A;  3CKI B;  4A3C G;  2JA5 B;  2Q8I B;  2JN4 A;  2MGS A;  3I7F A;  2NVY B;  5I4D A;  2X69 A;  1B9N A;  1WOC A;  3S1N B;  2N49 A;  4ZCK A;  2D9U A;  2PPB C;  4KHZ A;  3R2I A;  5JJI A;  2C35 B;  3WOE A;  2XNA C;  1F2L A;  1CUK A;  1QE6 A;  5I6W A;  1STE A;  4R4C A;  1TU2 B;  5EPL A;  1YNJ D;  2I5H A;  1W6J A;  1IKM A;  5JJK A;  3PF5 A;  2R92 G;  1VQA A;  4N9P A;  1NJI C;  2B29 A;  3CHB D;  3T1H Q;  5IGC A;  5FO9 B;  4FXD A;  1B7Y B;  3MZ5 A;  4JI8 L;  2A73 B;  1J8I A;  1A3V A;  2B63 B;  3I4M G;  4KD3 A;  2FFK B;  2X6L A;  1N34 L;  5C44 B;  1ILP A;  1MKH A;  3D3R A;  4FDB A;  1A8V A;  1NCV A;  4B3M L;  1B50 A;  1BOS A;  1A62 A;  4L5T A;  1FGU A;  1CA6 A;  2AWN A;  2B8F A;  4NKL A;  1X55 A;  1FJG L;  4CDF C;  5IYB G;  3C46 A;  5IGD A;  2VXW A;  4EQ5 A;  4TKO B;  3TRE A; 
#chains in the Genus database with same CATH homology
 5M5X H;  4JI5 Q;  1AE3 A;  3CCV A;  3OTO Q;  2ATW A;  4YWL A;  3FKI H;  3RR5 A;  3GTQ H;  1HR0 W;  3HOZ H;  1YIJ A;  1E7Z A;  2UU9 L;  4JCV E;  2K5V A;  3EIV A;  3Q8D A;  3JAM i;  1QVG A;  1PH6 A;  1M1K C;  1HNW Q;  4QY7 A;  3PUY A;  5JJL A;  2JA6 H;  1X54 A;  2VQE Q;  2HQL A;  1VQ5 A;  4A3I H;  3H3V I;  5HY6 A;  2IT1 A;  1G51 A;  5M3M H;  1V1Q A;  4DR1 Q;  1PH8 A;  4A3K G;  1HZB A;  2HHH L;  3PO2 G;  5FLM H;  2KEN A;  2RHQ B;  3HKS A;  4JI0 L;  4JBK A;  4DK6 C;  3I4M H;  1CKO A;  3RZD H;  1X3G A;  4B3S Q;  3NEN A;  2R93 G;  4K0K L;  4A4I A;  1TWF H;  2JK8 A;  2NZH A;  3KF6 A;  4DR2 L;  3GTG H;  4JI1 Q;  3ULJ A;  4RG1 A;  4QJF A;  4LF8 L;  3AYH B;  1JE5 A;  1WYD A;  5IYC G;  2E8G A;  5AJ3 L;  4DR7 Q;  4JYA Q;  3U4Z A;  3DM3 A;  4DV6 L;  3BU2 A;  1B8A A;  3KFU A;  1PH3 A;  1IZ6 A;  1HNX L;  1SR3 A;  1C7Y A;  2ASB A;  2JE6 I;  1R9T H;  3ERS X;  2Y0S G;  4QL5 A;  1J6Q A;  2AKW B;  1D8L A;  3KDF A;  2A19 A;  4NXM L;  4JI8 Q;  1CKN B;  4UP8 A;  2ZTC A;  3KLW A;  5GAD C;  3S1R H;  4HIM A;  3ER0 A;  1VQ4 A;  4POG A;  2UXB Q;  1AH9 A;  1H95 A;  1QZG A;  2UUB L;  4LFC L;  2N8N A;  4XIG S;  3HOV H;  1EQQ A;  2UXD Q;  2NN6 G;  3GDE A;  3J80 i;  4A3G H;  4R4T A;  2YTY A;  3WWV A;  1VQI A;  1Q82 C;  1TWG H;  4AQY L;  4A3F H;  5GQO A;  3UDI A;  1QUQ A;  4GS3 A;  3PO2 H;  2JQO A;  4UP7 A;  3GTM H;  3RZO H;  3M7N A;  3E9I A;  2YTV A;  3I2Z A;  2NVT H;  1A63 A;  5J3B A;  2HIV A;  3CPW A;  4LF9 Q;  1XNQ L;  2L15 A;  2EIF A;  2PI2 E;  3K7A H;  1K8G A;  4BXX G;  2UU9 Q;  2ZJR A;  1VQD A;  2PMZ E;  4PZ6 A;  4DV4 L;  4IO9 A;  1XMQ L;  2VQF L;  1N33 L;  3M4O H;  3S2H H;  4GN3 B;  3EN2 A;  3SGI A;  4LF6 L;  2VNU D;  3CCQ A;  3B6Y A;  4Y52 H;  1EWI A;  2HHH Q;  1KXL A;  1GO3 E;  1EYG A;  3CP0 A;  5JEA G;  4GKK L;  2I5L X;  4JI0 Q;  2JA7 H;  4MZ9 A;  1VQF A;  3KF6 B;  2ZJQ A;  3F8T A;  3H15 A;  3BJU A;  1HZA A;  3UDX A;  3M3Y H;  3PCO B;  4DAY B;  4DR2 Q;  3PV0 A;  3OTO L;  1OXU A;  1VQO A;  1TWA H;  1PA6 A;  1V43 A;  1BBU A;  2K5N A;  4DV6 Q;  1YBY A;  2CWA A;  1PH5 A;  1YHA A;  3BZK A;  2WAQ E;  4A3J H;  4QGU A;  1HNX Q;  1KD1 C;  2R7D A;  3KDF B;  3MEF A;  1Y1V H;  4KLK A;  2E2I H;  5GAH C;  1FL0 A;  4DR1 L;  3I56 A;  3TQY A;  4KHP L;  4NXM Q;  3PF4 A;  3K80 C;  4UP9 A;  1HZC A;  1K9M C;  2UXC Q;  1TWH H;  3NBH B;  1Q7Y C;  2R7Z G;  4BXX H;  1I6H H;  5E7N A;  5JEA J;  2UUB Q;  4LFC Q;  4X62 Q;  4EX5 A;  1TXY A;  1SN8 A;  4JI1 L;  1X56 A;  5IP9 H;  4X65 L;  3E9H A;  2CKZ B;  2XTI A;  3LGJ A;  4JYA L;  1SFO H;  5GAE C;  3ULP A;  4A3L G;  3J80 c;  1I50 H;  1NMF A;  3AFQ A;  1UE1 A;  2JA6 G;  2D0O A;  3UDF A;  1C9O A;  5IY0 A;  4A3I G;  2N78 A;  4O0A A;  5M3M G;  1B70 B;  4YCU A;  3JC6 6;  1RL2 A;  4P75 A;  2QA4 A;  3L0O A;  5FLM G;  2EXD A;  3E0E A;  1IBM L;  1XNQ Q;  2I0Q A;  1W3S A;  1BKB A;  4BBR G;  4DKA C;  2K50 A;  5C0X G;  4DV4 Q;  1JMC A;  1EUJ A;  3CW2 C;  2NVQ H;  3PUV A;  2MQH A;  1N33 Q;  3J81 i;  1YZ6 A;  4X6A H;  3GO5 A;  3PSI A;  1BVS A;  4OWX B;  1LM0 A;  1A0I A;  4GLX A;  4OX9 Q;  1O7I A;  5EAY A;  3S1Q H;  4B3R L;  3AFP A;  3STB D;  4BBS G;  2B3G A;  3L7Z C;  4LWC A;  4LFA Q;  3S24 A;  1K73 C;  4TVA B;  2AMC B;  4DR5 Q;  3U50 C;  3S14 H;  4GKK Q;  1VS0 A;  5DLQ E;  1VQG A;  2R7Z H;  2UUA L;  1GD7 A;  1VQC A;  3G6E A;  4DV3 Q;  4BY1 H;  4LF9 L;  1OXV A;  2BA1 A;  3U58 A;  4R4O A;  3CC2 A;  4A3L H;  1DGS A;  4WJ4 A;  1WJJ A;  1XTD A;  1MIU A;  1IXR A;  2R7F A;  4UY8 C;  3HOV G;  2YYZ A;  5C0X J;  4A3G G;  4GLV B;  4P72 A;  2K52 A;  2KHJ A;  2MFI A;  3A5Z B;  5C3E G;  2WP8 J;  4LF4 L;  4KHP Q;  2IY5 B;  1L1O A;  4A3F G;  1PH9 A;  1G6P A;  2NZO A;  1VQK A;  4OO1 I;  2QEX A;  4A3B H;  1CSQ A;  3F2C A;  1YJ9 A;  4LF7 Q;  2K75 A;  2V1C C;  4BBR H;  1VQ6 A;  4R4I A;  4DUZ Q;  3HFZ B;  1YVC A;  3CCJ A;  3PGZ A;  5ELN A;  5IT9 c;  4OWW B;  4UPA A;  1PH7 A;  2VUM G;  4X65 Q;  1KHI A;  1Z47 A;  2IHE A;  3K7U C;  3F2B A;  4PMW A;  1PYB A;  2YV5 A;  1L1O C;  3OYY A;  4YY3 Q;  2A1A A;  4BBS H;  2BH8 A;  1EIY B;  1PYS B;  2MNA A;  3GTL H;  3ZJY C;  1RIP A;  3M4P A;  3ICE A;  4LFB Q;  4JOI A;  2I5M X;  3FP9 A;  3NEM A;  4QQB X;  1K8A C;  2QGQ A;  1D7Q A;  1IBM Q;  4NB3 A;  2MO0 A;  2PQA A;  3I55 A;  4J15 A;  2UXC L;  2JA7 G;  4IFD G;  1I5F A;  1XJV A;  2VS1 A;  1S3O A;  3GTJ H;  1LYL A;  1HH2 P;  1U0L A;  1HNZ L;  3TEH B;  4X62 L;  1OXS C;  2ZJP A;  3J81 c;  2EQS A;  4GOP A;  3CD6 A;  3J7A 5;  5C3E H;  2Q2T A;  5C4X H;  4B3R Q;  1ASY A;  2A8V A;  4MTN A;  4YCV A;  1U5K A;  1NY4 A;  4A3J G;  4L5S A;  4A3D G;  3CPF A;  1PVO A;  5IYD H;  4LUV A;  1Y1V G;  1YEZ A;  3CXC A;  1J5E L;  2VL6 A;  2UUA Q;  2Y0S E;  3HOY H;  3HOU H;  3G48 A;  1VQ9 A;  4DR6 Q;  1L2F A;  2N3S A;  3G4S A;  4DV0 Q;  2VUM H;  4GOP C;  3I4O A;  2KCT A;  3DLL A;  3J81 j;  1OTC A;  1S40 A;  1P16 A;  1X3F A;  1PHJ A;  1K83 H;  1UE7 A;  5IP9 G;  3JAM c;  4Y7N H;  3UDG A;  1Q86 C;  1JB7 A;  2E2H H;  4OWT B;  4NXN L;  1L1O B;  4OX9 L;  1PH4 A;  4LF4 Q;  4LW1 A;  4JI3 L;  4JV5 L;  1KL9 A;  2OQK A;  1W2B A;  4L5Q A;  4LFA L;  1AE2 A;  1X3E A;  4JI6 L;  3CAM A;  4JI7 L;  1N32 L;  2K4K A;  4DR5 L;  4AH6 A;  4DV7 Q;  2ZTE A;  1PFS A;  2VW9 A;  4DPG A;  2IX1 A;  4DV3 L;  4GLA C;  4IJH A;  2F3I A;  3W1B A;  3KYH C;  1C0A A;  4GNX A;  3OW2 A;  1GM5 A;  1E22 A;  1VQP A;  1VQH A;  5M5Y H;  2CWP A;  3CF5 A;  3MXN B;  3M85 A;  1XMO L;  4DV5 L;  2ES2 A;  4JI4 L;  1UWV A;  1KC8 C;  4A3D H;  1HZ9 A;  5IP7 H;  4IOC A;  1G29 1;  2E5L Q;  4ME3 A;  2PQA B;  4JI2 L;  3A74 A;  3S17 H;  2Q2U A;  4LF7 L;  1IBK L;  1N36 L;  1E1O A;  2R6G A;  1Q46 A;  4C2M H;  4DNI A;  4GNX C;  3TS0 A;  2E2J H;  4JC0 A;  4DUY Q;  2ZTD A;  4DUZ L;  2OTL A;  4QIW E;  2RF4 A;  1HNZ Q;  4BY1 G;  4GOP B;  4R4Q A;  2IX0 A;  2GN5 A;  1BBW A;  3UE0 A;  1P8L A;  1YHB A;  3AQQ A;  2H5X A;  2KBN A;  1QUQ B;  4YY3 L;  3M9B A;  4DR3 L;  3PIO A;  3RNU A;  1Q81 C;  1N9W A;  5GRO A;  1EFW A;  1KRS A;  4A75 A;  4DV1 L;  1J5E Q;  4LFB L;  4BY7 H;  1UEB A;  3HKZ G;  2RCN A;  3PUX A;  4A3B G;  2LXK A;  2RHS B;  5BR8 L;  2Z0S A;  1SMX A;  2ID0 A;  1KRT A;  1WFQ A;  4IPD A;  4HIK A;  2NN6 I;  4C3I H;  3UE1 A;  4A3M H;  3TRZ A;  3CCR A;  4ALP A;  3VDY A;  2IHF A;  1V9P A;  3HOW G;  1Q12 A;  1S72 A;  5LMU L;  1EQR A;  1SRO A;  1HJP A;  3GD7 A;  4NXN Q;  4PG3 A;  4JI3 Q;  3CCL A;  4JV5 Q;  1K0R A;  3KJP A;  1N32 Q;  4HJ5 A;  4JI6 Q;  4JI7 Q;  2ALY B;  4JBW A;  4BA2 I;  4HID A;  3H3V H;  3KJO A;  1X9N A;  2JA9 A;  1N8R C;  1MJC A;  3EBE A;  4LUO A;  3PUZ A;  1Z9F A;  1SRU A;  4GNX B;  4DR4 L;  4DR6 L;  1I3Q H;  5FJ8 G;  4DV0 L;  2D62 A;  4HJ8 A;  4HJA A;  4JBM A;  4B3T L;  3I4N H;  4YWM A;  1CKN A;  5LMN L;  1XMO Q;  4IOA A;  4AYB G;  4JI4 Q;  4DV5 Q;  2UUC L;  1PH2 A;  3RLO A;  1KQS A;  4IJL A;  5C4X G;  1CKM A;  2D0P A;  2PNH A;  5M3F G;  3RN5 A;  1GVP A;  3HOX G;  3S2D H;  4JI2 Q;  1XPR A;  2B63 G;  5IYD G;  2JA5 H;  2NVX H;  1NMG A;  4X64 Q;  3CCM A;  1IBK Q;  1NE3 A;  4P71 A;  1N36 Q;  4X66 L;  2OQ0 A;  4NPS A;  3H0G G;  3D31 A;  1YI2 A;  4DV7 L;  2F4V L;  2DGY A;  3F1Z A;  3HOY G;  2NVY H;  3HOU G;  2ZM6 Q;  1YHQ A;  4HIO A;  2VZA A;  3BZC A;  4A93 H;  3KOJ A;  3HOW H;  5LMN W;  1SE8 A;  4LF5 L;  3PUW A;  3S1N H;  3A5U A;  2YU9 H;  5ELO A;  3CCS A;  3F2D A;  3D0F A;  2VY3 A;  4DR3 Q;  2R92 H;  2Q2I A;  2KCM A;  3NEL A;  4AYB E;  1VQN A;  4DV1 Q;  4DK3 C;  1VQL A;  2E5L L;  2JA8 G;  1I94 L;  3PO3 H;  2OTJ A;  5BR8 Q;  4APV A;  1Y1W H;  3CC4 A;  1NTG A;  1VCI A;  3K0X A;  4YCW A;  5FJ8 H;  1JJ2 A;  2BH2 A;  4GKJ L;  4DUY L;  1LTL A;  3A0J A;  1NBW A;  4DV2 L;  4PZ8 A;  3KF8 B;  1WCM G;  3G71 A;  3RN2 A;  1TWC H;  5LMU Q;  1VQ7 A;  1YIT A;  4PZ7 A;  1QZH A;  4JOI C;  2GVA A;  5M3F H;  1IBL L;  3HOX H;  1Y14 B;  4A3E H;  3FHW A;  2B63 H;  2LSS A;  1XNR L;  5IYB H;  1KAW A;  2OCE A;  3M4Q A;  5IP7 G;  3H0G H;  5C44 H;  2KHI A;  2K14 A;  1UE5 A;  3ULL A;  4DAM A;  4OON A;  3T1Y L;  1QVF A;  5C0X I;  3TS2 A;  4DR4 Q;  1OXX K;  1VQM A;  2WB1 G;  4GN5 A;  5K36 G;  4B3T Q;  5LMN Q;  2HIX A;  4LUZ A;  4YHH Q;  2CCZ A;  2AHO B;  1N34 Q;  4IFD J;  1X65 A;  3CQZ H;  1HR0 Q;  3CC7 A;  2UUC Q;  1MJE A;  2F52 A;  4GN4 B;  1VQE A;  4HJ9 A;  4B3M Q;  5H1S E;  1EOV A;  3IRB A;  4AIM A;  1YJW A;  2JA8 H;  2CFM A;  4A3K H;  1FJG Q;  4JBJ A;  2MO1 A;  2YTX A;  4X66 Q;  4TQU S;  1JJC B;  2F4V Q;  3GTK H;  4BY7 G;  4H02 A;  2R93 H;  1QVC A;  3T1H L;  4R1J A;  4A76 A;  1VQB A;  2DUD A;  4LF5 Q;  1WCM H;  4C3J H;  3PIP A;  4A3M G;  5IYC H;  2WB1 E;  1IL2 A;  3STB C;  2WAQ G;  1E24 A;  1E3P A;  2WFW A;  1T9H A;  3K8A A;  1EIF A;  2LXJ A;  4IPG A;  2GVB A;  4C3H H;  2OWO A;  3S1M H;  3J7Z C;  3CCU A;  4JG2 A;  2CQO A;  2K5H A;  1GKH A;  1Q1B A;  3CME A;  1I94 Q;  4IPC A;  4X64 L;  4MNO A;  1VQJ A;  5FLX c;  2Z6K A;  4GKJ Q;  5IWA L;  1IYJ B;  3CCE A;  2Q2H A;  3RLF A;  2ZM6 L;  2BA0 A;  4DV2 Q;  4OO1 G;  4K0K Q;  4JI5 L;  1E1T A;  1PV4 A;  1VQ8 A;  4A3C G;  3I4N G;  1YNX A;  4POF A;  4LF8 Q;  1FVI A;  5AJ3 Q;  1IBL Q;  4KI0 A;  3W1G A;  5HGQ A;  3I7F A;  3W5O A;  4O2D A;  1HNW L;  1XNR Q;  1CSP A;  2Z6K C;  2VQE L;  4P74 A;  1WOC A;  2N49 A;  3U4V A;  4IFD I;  1OXT A;  3GTO H;  2AWO A;  2JA5 G;  3T1Y Q;  4RMF A;  1M90 C;  1JT8 A;  4LNQ A;  4OXP A;  4KHZ A;  5JJI A;  2C35 B;  2XGT A;  1K3R A;  4A93 G;  4B3S L;  1CUK A;  3CMA A;  3AEV A;  1UE6 A;  3FKI G;  4R4C A;  5C4J H;  1WI5 A;  3K81 C;  3GTP H;  3HOZ G;  2I5H A;  4DR7 L;  5JJK A;  4XTC S;  3L2P A;  2PI2 A;  3PF5 A;  1XPO A;  1L0W A;  3S15 H;  2R92 G;  4AQY Q;  1VQA A;  4BA1 I;  1X6O A;  4HJ7 A;  1PH1 A;  1KIX A;  1NJI C;  3PO3 G;  2B29 A;  3T1H Q;  1Y1W G;  5GAG C;  1B7Y B;  1LUZ A;  1YJN A;  3HKZ E;  4JI8 L;  4L5R C;  5IE8 A;  3I4M G;  3S16 H;  4A3C H;  4YHH L;  1N34 L;  2UXB L;  1MKH A;  2HT1 A;  4FDB A;  2FXQ A;  1A8V A;  1XMQ Q;  2VQF Q;  1HR0 L;  1ASZ A;  2JEA I;  2UXD L;  2JJQ A;  4YWK A;  3RLN A;  1XPU A;  1SLJ A;  4LF6 Q;  4B3M L;  4WJ3 M;  1A62 A;  4IPH A;  4L5T A;  1FGU A;  4A3E G;  2AWN A;  4P73 A;  1X55 A;  1FJG L;  1Q8K A;  1Q1E A;  5IYB G;  1JJG A;  5C44 G;  5M5W H;  4EQ5 A;  2JEB I;  5IWA Q;  3TRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...