1VQCA

Gene v protein mutant with val 35 replaced by ile 35 and ile 47 replaced by phe 47 (v35i, i47f)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYIDLGNEYPVLVKFTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
total genus 11
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqcA00
1R9TH 4JI3L 1EQRA 1YHAA 2LXJA 2Z0SA 1PYSB 4GLVB 2UU9L 4OO1I 2JA7H 1YNXA 1GO3E 4LFAL 4JI8Q 4R4TA 2ASBA 4POFA 1J5EQ 3K0XA 2CQOA 5BR8L 4LF5L 1GM5A 1BBWA 1XTDA 3EBEA 3RLFA 2QA4A 4BXXH 1LYLA 1XMOL 1HZBA 4O2DA 4B3TQ 3PO2H 4UY8C 3I4MH 3UDXA 3AFQA 3HOYG 1CKNB 3A5UA 3CCVA 3PF4A 4JI7Q 4NPSA 4BA2I 1NJIC 2YTXA 4JOIA 3CCQA 3VDYA 3KF6A 4KHPL 4J15A 1VQDA 3I55A 1K73C 4JI6L 1NY4A 1Q7YC 4O0AA 1PH2A 4GN5A 3MEFA 2KHIA 2VQFL 1L1OA 2K14A 1NMGA 2MFIA 3H0GH 4DKAC 2CCZA 2JA6H 4DR2L 1P16A 1FJGL 3GTMH 5HGQA 1OXVA 1N32L 1A0IA 1Y1VG 3NELA 2NVTH 1GKHA 1BBUA 3CPWA 2WB1G 1XNQL 4IFDJ 3ERSX 5JEAJ 3L0OA 2Y0SG 4IOCA 4NXML 4YCVA 1YJNA 1HNWQ 4QGUA 1AE2A 3E0EA 2F4VL 4JI2L 1E22A 2B63H 3KJOA 3M85A 1YJWA 1WJJA 4K0KQ 4EQ5A 2ZTDA 4LFCQ 1CSPA 3A5ZB 1J6QA 4JI8L 4C2MH 3U50C 1J5EL 1PYBA 1CSQA 3D0FA 4LF4L 4A3KG 4GS3A 1ASYA 4BY7H 5ELOA 1WCMH 2K4KA 1WOCA 2Y0SE 4JBJA 4A4IA 1KIXA 5JJLA 3Q8DA 3AQQA 3GTOH 1HNZQ 2IX1A 2PMZE 1FVIA 3G48A 5IWAQ 1WYDA 3RN2A 5IE8A 4B3TL 4WJ3M 4A3EG 1VQ8A 1I3QH 1WFQA 3AYHB 1D8LA 1NBWA 3RLOA 4JI7L 3M4OH 3A74A 1SR3A 4DPGA 2I0QA 3T1HQ 4POGA 2NVYH 1N33Q 1BVSA 4P75A 4NXMQ 2VS1A 4R1JA 1H95A 1A62A 5C3EG 2C35B 3RZDH 1IBKQ 5IYDH 5IYBG 3I4OA 2KHJA 1MIUA 4PMWA 4DK3C 4JV5Q 2IY5B 3M9BA 1GVPA 2R7ZH 1Y1WH 2WFWA 2K52A 1SROA 3MXNB 3UE0A 3G4SA 4BY1G 4GOPA 1VCIA 1WI5A 1HNWL 5IP7H 4YHHQ 4KHZA 1NTGA 3PCOB 4K0KL 4TQUS 4MNOA 4LFCL 4C3HH 1JMCA 1Q12A 3HOZG 1SMXA 4NXNQ 1UE6A 3S1NH 3HOVG 3S24A 1CKOA 3EN2A 4A3DH 1KRSA 1I94Q 3F8TA 1Z9FA 3D31A 2HIXA 5IWAL 4GOPB 4GNXB 3CP0A 4KLKA 4JBMA 4BBRH 1YZ6A 2D0PA 4IPCA 4HJAA 2OTJA 1HH2P 5C0XI 3HOWG 3T1HL 4B3SQ 4RMFA 1AE3A 2A19A 4P73A 5IP9G 1N33L 2E2JH 1L0WA 1Z47A 2VUMG 4A3GH 1TXYA 2UUCQ 3EIVA 3CCSA 4A3JH 2K50A 1IBKL 5M3FG 2JA8G 3KJPA 1SLJA 3TQYA 1OTCA 4HIOA 2BH2A 3TS2A 1K3RA 2A8VA 2PI2E 4IJHA 1W2BA 4L5RC 4DR7L 4JV5L 3UE1A 2Q2HA 2JQOA 4AH6A 1FL0A 2AMCB 1K83H 2ID0A 2MNAA 4YWMA 2JA7G 1X6OA 4L5QA 1PH6A 1MJEA 1C7YA 1IBLL 4A93H 4YHHL 4JI6Q 1CKMA 1PV4A 3BU2A 1N34Q 1IZ6A 1LTLA 1U5KA 2EXDA 2K75A 2RHQB 3K8AA 3KF8B 4DV2L 1D7QA 4BXXG 3STBD 5IY0A 4GLAC 1X65A 1S3OA 2NN6G 3PO2G 3FP9A 2WP8J 3CXCA 3CF5A 3RNUA 1QVGA 1I94L 4QQBX 2RCNA 2VL6A 1Q46A 3CW2C 3F2BA 1X3EA 5FLXc 4R4OA 4GOPC 4GNXC 1B70B 3BZCA 2UXCL 2MO0A 2AWNA 4JI0Q 1DGSA 1HZCA 2F4VQ 4JI2Q 4B3SL 1E1OA 1LUZA 2XGTA 3GO5A 3J7ZC 3H0GG 3KOJA 5E7NA 1RL2A 2JA6G 2UUCL 1JT8A 4OWTB 3T1YQ 5H1SE 3NBHB 1M1KC 4LF4Q 3TREA 1SFOH 2NVQH 4HIKA 3JAMc 4A76A 1B7YB 1L2FA 3I56A 2OQ0A 3H15A 3GDEA 5JJKA 1MJCA 2EQSA 1P8LA 4OXPA 5GAHC 2B63G 3HOUH 1VQOA 4LF9Q 4FDBA 3S2HH 2K5HA 3S1QH 1FGUA 1VQHA 2I5MX 5M3MH 4QY7A 3BJUA 3OYYA 4WJ4A 1ASZA 4BY7G 1N34L 3S15H 1HZ9A 3SGIA 1UE5A 2WAQG 1VQPA 4ME3A 3J81i 1W3SA 3CCMA 4DV4Q 2H5XA 3PGZA 3KF6B 4IFDG 4A3IH 4JI0L 3HFZB 4BA1I 4LWCA 5JEAG 1L1OB 2WAQE 4JI5L 4OONA 4JCVE 5EAYA 3CPFA 5LMNW 3T1YL 3W1BA 3W1GA 4DV0L 1XPOA 2VZAA 5DLQE 5IYCH 5C4JH 2KCTA 4DR1Q 3NEMA 2JEAI 3LGJA 1YJ9A 2R7ZG 3M3YH 1Y1WG 4JI4L 1XPRA 1G51A 4DV5Q 4A3MH 1XJVA 1X3FA 1G6PA 5K36G 4LUVA 5IP7G 1N36L 2CFMA 4ALPA 2JA9A 4A3LG 4YCWA 4UP9A 4A3CH 4DR5Q 1HR0Q 3UDFA 4LF9L 2RF4A 4GN4B 1OXUA 1X55A 1KQSA 2AHOB 2BH8A 3PIOA 3HOYH 4C3JH 3HOXG 2A1AA 3KDFA 1PVOA 3W5OA 4GKKQ 3CCEA 3ZJYC 1Q82C 1QVFA 2R7DA 2N49A 5ELNA 4DR7Q 2JJQA 4BBRG 1O7IA 4DV4L 4HIMA 2HQLA 4A3FG 3OTOQ 3FHWA 3STBC 1HJPA 4JOIC 4DR3Q 1QVCA 2V1CC 3KLWA 3TEHB 4X65Q 1IBLQ 4TVAB 5C4XG 1LM0A 2EIFA 1NMFA 2N8NA 2F3IA 4A3GG 3TRZA 4PZ7A 3HKZE 1L1OC 4LFBL 2R92G 2PQAA 1OXXK 1PH9A 1JJGA 2Z6KA 4DV2Q 2E2IH 4DK6C 3PF5A 2JK8A 2HT1A 3PSIA 4QJFA 4DR1L 3GD7A 3K7UC 4IPDA 1TWCH 1X54A 1PFSA 4UP8A 1Q86C 4DV5L 2YV5A 4EX5A 4JG2A 1RIPA 3CMAA 3CCUA 1AH9A 1Q81C 4A93G 2UXCQ 3OW2A 1KL9A 1EOVA 2PNHA 4C3IH 3M4QA 4LUOA 4DR5L 1HR0L 2R93H 2K5VA 3I4MG 1S40A 1K9MC 4A3EH 2E5LQ 1HR0W 1IL2A 5C44H 3GTLH 3KYHC 1YHQA 1YBYA 3WWVA 2KBNA 2R7FA 4UP7A 3PO3G 5C0XJ 4GKKL 2NZHA 2F52A 4A3BG 4HJ5A 4LF8Q 1YEZA 2ZJQA 3AEVA 5C3EH 1X56A 3PUWA 3GTQH 5IYBH 1IBMQ 1TWGH 3OTOL 2YYZA 3K7AH 4XTCS 2UXBL 4DR3L 4X65L 4X66Q 1QUQA 1KD1C 1TWHH 3H3VI 3FKIH 4Y52H 4UPAA 2JA5H 2L15A 4BY1H 3PV0A 1N9WA 4X62Q 1C9OA 3DM3A 1UWVA 4OWWB 1QZHA 1G291 5GAGC 4OX9Q 3L7ZC 1M90C 3J81c 1SE8A 1TWFH 3ER0A 3HOUG 4AQYQ 4Y7NH 2Q2UA 4B3RQ 1XMQQ 4MTNA 4JC0A 1Y14B 3CMEA 5LMNQ 2NN6I 1Q1BA 3UDIA 1YHBA 4DV7Q 2NVXH 4JI5Q 2ZM6Q 2E5LL 4DUZQ 1I50H 2RHSB 1XPUA 2DGYA 4NB3A 3CCJA 4DV0Q 1PH4A 2K5NA 1YITA 4IPHA 4BBSH 1EYGA 4LF8L 4PZ8A 1GD7A 4PZ6A 4JI4Q 2MQHA 4OO1G 2VW9A 3M7NA 1EWIA 4B3ML 5M3FH 4A3IG 3CCLA 1IBML 2JA8H 3I2ZA 4LW1A 3I4NH 2IT1A 3CC7A 1N36Q 3GTPH 3ICEA 1KC8C 2MO1A 4X66L 1SN8A 3M4PA 3CC4A 1EUJA 3HKSA 1SRUA 3A0JA 3CAMA 4JBWA 1CKNA 3K80C 1VQ5A 5IYCG 1XNRL 1WCMG 1N32Q 2JE6I 4X62L 4HJ9A 2I5LX 1V43A 2OCEA 1YIJA 4A3MG 3F1ZA 4IOAA 4OX9L 4DR6Q 1QZGA 2CKZB 5IT9c 4AYBE 4DUYQ 4A3CG 1I6HH 3ULLA 5FLMH 3G71A 4AQYL 3RN5A 4B3RL 3PUVA 1U0LA 3PUZA 3I7FA 1XMQL 2KENA 3ULPA 1BKBA 1VQFA 4IPGA 5FJ8H 4A75A 3GTKH 3BZKA 5LMNL 4DV7L 2ZJRA 3S1RH 1X9NA 4JYAQ 2QGQA 4LFBQ 4DAYB 2Q2IA 5IYDG 5M5YH 3PUYA 2ZM6L 2VQEQ 4P74A 4DUZL 1PHJA 4BBSG 4YCUA 4YY3Q 2UXDQ 2OWOA 3J80i 4IFDI 4MZ9A 4HJ8A 3TS0A 3PUXA 4X6AH 2CWPA 4GN3B 5AJ3Q 1YI2A 4PG3A 2AWOA 4R4QA 5GROA 4GKJQ 4P71A 1UE1A 3UDGA 1IXRA 1S72A 1UEBA 3F2DA 2IHEA 2XTIA 4YWLA 1VQIA 3GTJH 4HIDA 4LF7Q 1V1QA 3NENA 4DR4L 2E8GA 1VQMA 4DV6Q 1VQNA 5GQOA 2VNUD 4A3DG 5GADC 1CUKA 3CCRA 2D0OA 2ZTCA 3HKZG 3E9HA 2LXKA 2UUAQ 1JJCB 3JAMi 2WB1E 4YWKA 2BA0A 4DR6L 4JI1Q 4DUYL 2R93G 2UXBQ 1E24A 2ZTEA 1JB7A 4P72A 1EIYB 1VS0A 2GVAA 2YTVA 1Y1VH 1VQJA 5LMUQ 1UE7A 3AFPA 5C44G 1EFWA 3J7A5 3U4ZA 3L2PA 4A3JG 3KDFB 4JYAL 3RR5A 5M5XH 2VQEL 2YU9H 2OQKA 1E1TA 1I5FA 3RZOH 3E9IA 2GN5A 3PIPA 4HJ7A 1A63A 4IO9A 4YY3L 4IJLA 4R4IA 4GLXA 1X3GA 2R6GA 2UXDL 2VY3A 2ATWA 2I5HA 3CD6A 5AJ3L 1VQ4A 4H02A 4LF6Q 1PH1A 1VQBA 5HY6A 4L5SA 4GKJL 4DV3Q 3S17H 4A3KH 3GTGH 1YVCA 4DV1Q 1VQGA 3FKIG 2HIVA 2UUBQ 4LF7L 1MKHA 2JEBI 2JA5G 3CC2A 2N3SA 3U4VA 2IX0A 2PQAB 3JC66 4GNXA 4DAMA 1K0RA 2ALYB 2QEXA 4DV6L 3B6YA 4A3LH 1T9HA 2KCMA 1PH5A 1HNXQ 1Q1EA 2UUAL 1K8GA 2FXQA 1V9PA 2NZOA 3IRBA 5C0XG 3HOXH 3S2DH 1KXLA 2Q2TA 4B3MQ 4DR4Q 4JI1L 2B3GA 1HNZL 2HHHQ 3KFUA 1OXSC 3ULJA 4X64Q 1TWAH 4APVA 5LMUL 1JE5A 4A3FH 4JI3Q 1JJ2A 4LNQA 1E7ZA 3J81j 1EIFA 1VQCA 2UU9Q 4QIWE 3CQZH 1N8RC 2GVBA 1XNRQ 3G6EA 4LFAQ 2DUDA 2PI2A 3K81C 5C4XH 3S16H 2BA1A 5M5WH 2ES2A 1KHIA 4XIGS 2ZJPA 5GAEC 1VQ6A 1KAWA 5BR8Q 1PH3A 4LF5Q 2R92H 2B29A 1A8VA 1IYJB 1VQAA 3I4NG 4KI0A 4LF6L 3HOZH 4R4CA 1XMOQ 1QUQB 4DV3L 4OWXB 3DLLA 4DV1L 1K8AC 3HOVH 3RLNA 1OXTA 3S1MH 1VQEA 1HZAA 2UUBL 5M3MG 2OTLA 1EQQA 2Z6KC 3U58A 2YTYA 2IHFA 4QL5A 1PH7A 4KHPQ 5JJIA 1VQKA 1VQ9A 1VQLA 1VQ7A 2LSSA 3HOWH 1HNXL 2E2HH 1KRTA 5IP9H 4AIMA 2VQFQ 2VUMH 4NXNL 3F2CA 4L5TA 4RG1A 3J80c 5FLMG 4DR2Q 2N78A 1PH8A 1NE3A 1FJGQ 4JBKA 3PO3H 3S14H 3H3VH 1PA6A 2D62A 1Q8KA 4A3BH 2CWAA 5J3BA 1XNQQ 4LUZA 1B8AA 5FJ8G 1C0AA 1E3PA 2HHHL 4DNIA 4X64L 2AKWB 4AYBG
chains in the Genus database with same CATH superfamily
2Z4HA 3MTSA 1YHAA 2F0JA 2JA7H 1EY4A 1JWUD 4R4TA 4RFBA 1IYUA 2B39A 4DFAA 2CQOA 5BR8L 4LF5L 1BBWA 1XTDA 2PYKA 2QA4A 2L12A 4BXXH 4NMZA 1SMYC 3EROA 3A5UA 1HUNA 5M5YB 3CCQA 2JXMB 3I55A 1K73C 1NY4A 1Q7YC 1PH2A 3PIO3 3LWEA 2KHIA 1L1OA 2K14A 5T1GA 2MFIA 2BDOA 1LT6D 2CCZA 4HSVA 5KNBA 4DR2L 2JA6H 5KRUA 1OXVA 1D1KA 1HCZA 2KUMA 1Y1VG 3NELA 3D6CA 1BBUA 1TT2A 2RA4A 2WB1G 1XWEA 2PW7A 3KUPA 4ID6A 2F0LA 2L0CA 3L0OA 2Y0SG 1CA5A 1YJNA 1AE2A 4HMJA 1E22A 2B63H 3VYTA 4K2LA 2PCFB 3U50C 1PYBA 4CKCA 4OIJA 1ASYA 2K4KA 4JBJA 1JICA 3Q8DA 1CHQD 1BUVT 3AQQA 4PMCA 1HNZQ 2PMZE 2IX1A 1KABA 1Y1VB 1I3QB 3I3CA 3AYHB 5EPJA 3NQTA 3M4OH 2Y0SB 3DWPA 4ZYSA 1SR3A 2I0QA 4POGA 3MXNA 2NVYH 1LV9A 4XQQA 2HDLA 3CRLC 1IBKQ 1SNQA 4DNTB 5IYDH 3I4OA 5CBAE 4PMWA 4DK3C 2EYHA 4XXEA 2KOLA 2K52A 1BDOA 4GOPA 1VCIA 1E0BA 5IP7H 1EY6A 1CFMA 1NTGA 4K5XA 4TQUS 1JMCA 1STHA 1SMXA 2RSOA 5DAUA 3VR4A 2FINB 1KRSA 1I94Q 1PRTD 3F8TA 1Z9FA 3EA6A 1SE4A 2HIXA 2K32A 1TY2A 2J4XA 4H7BA 2E2DC 1LT3D 1AZPA 2D0PA 1HH2P 4EQOA 5C0XI 1TS4A 3S16B 4P73A 5IP9G 5M5WB 4A3GB 3EIVA 2R92B 3CCSA 2K50A 1IBKL 5M3FG 3MZ5A 1MHWC 4QCLA 3TS2A 1EYAA 2A8VA 4L5RC 4I65A 4DR7L 1PZID 4AH6A 1HQRD 1Y8OB 1IYVA 1K83H 3WOFA 1X6OA 5K5PA 2DY8A 1PH6A 1C7YA 1IBLL 1EIHA 4A93H 1IW7C 5E1FA 3BU2A 1U5KA 2EXDA 5CORA 4DV2L 2PQEA 4GLAC 1X65A 1DXMA 1I94L 2VL6A 3CW2C 1Q46A 4RHSA 1R9TB 4KTAA 5I2XA 2F4VQ 1TS3A 3J7YW 3X3NA 3J7ZC 3H0GG 3V05A 4OWTB 1BNZA 1M1KC 4LF4Q 3TREA 4I7AA 1WTXA 3JAMc 4A76A 1B7YB 3W3AA 4FF3A 4G7OC 1A6XA 4EGVA 2EXZA 3SDZA 3S1QB 1EEFD 3KLSX 4LF9Q 4FDBA 3NE5B 1DONA 1FGUA 2I5MX 1PXUA 1RCVD 5M3MH 4WJ4A 3H0GB 3I70A 3GTMB 3SGIA 1YNND 2WIIB 4EQNA 4MN3A 1W3SA 2BCOA 1SNPA 2H5XA 1G6ZA 3PGZA 4B9WA 4R8IA 4BA1I 1ICFB 4HCSA 1L1OB 2WAQE 2F3VA 5FKAC 3EJIA 2EYJA 4KY6A 2RDHA 1WCMB 3PIP3 3WOEA 1B44D 2KECA 2N88A 5DLQE 2JEAI 5JPMC 1WTVA 4NP5A 3CKIB 1FR3A 2E74C 2ICEC 1N36L 1EQTA 4A3LG 1CK1A 2X69A 4LF9L 1X55A 3R3OA 1HTPA 3HOXG 1FD7D 1BOSA 1EQVA 2LMCB 3FMCA 3KDFA 1PTOH 4GKKQ 1PVOA 2K28A 1SEBD 3C1FA 2F0PA 2X6GA 4BBRG 4A3FG 3OTOQ 2CVRA 2LKVA 1EYDA 2EIFA 5A35A 1U4PA 3A8KE 4PZ7A 1JOQA 2K5WA 1NCVA 2E2IH 2ICIA 4A3DB 2JK8A 1STGA 5I9OA 3HKZB 3T51B 3MXPA 1TWCH 1K8MA 1Q86C 5HGTA 4BBRB 2YV5A 2UXCQ 3OW2A 2AQ1B 1D5MC 2R93H 3NSWA 4LUOA 4S3SA 1KLUD 1A2UA 4WRDA 2OT2A 2E2JB 1B9NA 3CU7A 5JPNC 4GZYC 3R2IA 1HHVA 2B8FA 1LABA 4FF1A 1YHQA 4CJ2C 1A15A 3DEPA 4UP7A 3PO3G 4GKKL 2CW0C 4XT1B 1MGSA 4LF8Q 3BVGA 3AEVA 2I46A 3GTQH 1EEID 1YNNC 1TWGH 3HG9A 3OTOL 2YYZA 3FPUB 2B2WA 4X66Q 1QUQA 3FKIB 4Y52H 4UPAA 5FO7B 4KKSA 1N9WA 4X62Q 2JSOA 4KJOA 3DMUA 1LTBD 1VMCA 1G291 1SE8A 2QF7A 1QE6A 1TWFH 4UHVA 3ER0A 3SE0A 1U4LA 1II3A 4Y7NH 2Q2UA 3QIAA 4DA2A 4G57A 4QUCA 1STNA 4JC0A 1Y14B 5JVG3 2NVXH 4K2KA 2F0MA 5J1ZA 2ZM6Q 1LTAD 4DUZQ 2RHSB 1XPUA 1PH4A 1DYQA 4LF8L 1KLGD 4PZ8A 2PNRC 4OO1G 5M3FH 3I4NH 2IT1A 1H9SA 3D4DA 4X66L 3Q6SA 3HKSA 1SRUA 4WORA 4X3TA 1VQ5A 2JE6I 4X62L 5BN3A 1TKWB 1YIJA 4UAIA 4IOAA 1B4OA 1CHPD 5KGUA 2CKZB 2F0NA 4AYBE 5IT9c 4DUYQ 3C46A 4QMGA 1PLFA 3R8BA 3G71A 4DK0A 1DOMA 3S1RH 4JK1C 4LFBQ 4IALA 2ZM6L 4DUZL 1PHJA 2XVSA 2Z1CA 1DCZA 2CQAA 2OWOA 3J80i 3TS0A 2CWPA 4GN3B 4JVZA 1ZEQX 4GKJQ 3M4YA 1UE1A 1IXRA 1G91A 2IHEA 2XTIA 4YWLA 4C3HG 3VR3A 2PW5A 4IUNA 2ZXRA 1KNEA 1I4RA 2UUAQ 2LXKA 2FMCA 1ENFA 1JJCB 4YIJA 2WKCA 3JAMi 4YWKA 2BA0A 3V96A 4E6IA 1SYEA 4DUYL 2QDBA 2MJ8A 2UXBQ 4ODGA 1EY9A 5M5XB 3KDFB 2KCCA 3RR5A 3RZOH 2N55A 2YU9H 1E1TA 3F2UA 5CC4A 2GN5A 1JR0D 4IJLA 1Z6HA 2R6GA 2VY3A 2QCPX 2I5HA 3NHHA 1VQ4A 2PZTA 1O78A 4GKJL 3S17H 4A3KH 1SNCA 5KNCA 2JEBI 2JA5G 1RD9D 2N3SA 4A3EB 3VYRA 4DAMA 1B50A 1K0RA 3LNNA 3T56B 4A3LH 1PTOC 3HRZC 1Q90A 1IHZA 2PZWA 1HNXQ 2UUAL 3BDLA 3S2DB 2FXQA 3HOXH 1LTGD 5KYLA 2B3GA 5ISRA 3URYA 4APVA 4A3FH 2JA5B 1JJ2A 1E7ZA 3J81j 1VQCA 1CM9A 2Z8LA 3MFGA 3G6EA 1V1OA 2DUDA 2PI2A 1KAWA 2B2TC 1I4XA 4CBVA 3HOZB 1DD2A 4MHEA 4DNRB 2F0GA 5DM63 4KI0A 1QUQB 3DWQA 1K8AC 3DLLA 3HOVH 1VQEA 1HZAA 4HMIA 5IODA 4K5WA 1CZGA 4RH6A 1YNJC 3U58A 5BN4A 5FO9B 2VB2X 2JN4A 2EPBA 3HOWH 1HNXL 2X6LA 2E2HH 2F1MA 3N52A 2VQFQ 4L5TA 3BYYB 4RG1A 3NBHA 3PO3H 1S5DD 3H3VH 1PA6A 2D62A 1Q8KA 1C0AA 2PZUA 1SBBB 4FNFA 2Z6BA 4AYBG 4NXMQ 1EQRA 1F2LA 2JA7B 2LXJA 4LK1C 1BR9A 2AUKA 2FJ2A 2NBFA 2ASBA 2F0VA 1V8QA 3EBEA 3RLFA 1H9SB 1KDAA 1NR4A 3AFQA 3HOYG 3CCVA 3PF4A 5FK9C 2YTXA 2Q8TA 3VA5A 4JI6L 1I4QA 4O0AA 1VF5C 2JA6B 1XXGA 2VQFL 4DKAC 1NMGA 1RHPA 3I91A 5HGQA 1N32L 2NVTH 1GKHA 4IFDJ 2EJMA 4RAUC 1L0XB 4NXML 1HTLD 1WTHA 2B63B 1HNWQ 2CH4W 4JI2L 3KJOA 4K0KQ 4DN4M 4EQ5A 3QOJA 4LFCQ 4C2MH 3D0FA 1U9RA 1F2MA 3J7AV 4BY7H 2TSSA 3WDNA 2Y0SE 3MC0B 5JJLA 3GTOH 1QNKA 2SNSA 1FVIA 2XNAC 1D8LA 1NBWA 4DPGA 1IL8A 1IKMA 1BVSA 4P75A 5CGKA 1MBYA 3G6JB 3NTKA 3RZDH 2A69C 3TP5A 2K5DA 5IYBG 2KHJA 1CQVA 1E2ZA 2IY5B 1TIID 4J1MA 2R7ZH 1Y1WH 2WFWA 4BY1G 4KN4C 2B2VC 1TQOA 4KKUA 3OIPA 1HNWL 4YHHQ 3PCOB 4K0KL 1ZYRC 4KMUC 1F77A 4LFCL 4C3HH 2A74C 4BS9A 1Q12A 4NXNQ 2A5HA 3HS0C 3S1NH 3EN2A 1HQMC 1ML0D 5KIXA 3CP0A 4KLKA 3TP8A 4IPCA 4HJAA 2OTJA 1BCPB 5C4XB 2F0QA 4RMFA 2A19A 5ELEA 3H09A 3VR6A 1OTCA 1SLJA 3TQYA 4HIOA 4Z9CB 1QNUA 2O5IC 3S1MB 1EY0A 5EKLA 1K83B 4YWMA 2WKDA 3MFYA 1MJEA 4YHHL 3NTHA 2HCCA 3P7JA 1SE3A 2L1BA 2DN8A 2NN6G 3PO2G 3KLRA 3CF5A 1T5EA 2RCNA 4GOPC 4GNXC 1EZ8A 2MO0A 4TRDA 3AB9A 1DGSA 1LUZA 1RL2A 3T1YQ 3TN2A 3NBHB 3MXUA 5A2QL 1SFOH 2NVQH 2A6HD 3HEJA 4IQZA 3PO2B 2KVMA 5A2QE 2IJ0A 2BOSA 1EOTA 2EQSA 5GAHC 4OXPA 3I4LA 3HOUH 2EY2A 1SE2A 2F0OA 3OYYA 2BDNA 3A8JE 3S15H 2BE5D 1M8AA 1J8IA 4DAYA 3H3VC 5CBEE 2KEEA 3J81i 4DV4Q 4XT3B 1A3TA 4B08A 4IFDG 3HFZB 2MPMA 3N6RA 1ICWA 3BDOA 3OMCA 1D2BA 4RHRA 3U9SA 3P1HA 2EY5A 3LX0A 4JI5L 4XYQA 1VF7A 3T1YL 3W1BA 4HCEA 1EY7A 1XPOA 4CDFC 5IYCH 1YJ9A 5D3DA 1XPRA 4DV5Q 4A3MH 1XJVA 1X3FA 1RJTA 5K36G 4LUVA 4A3CH 3TP6A 5EGTA 2AHOB 4G7ZC 3HOYH 5DEHA 1EZ6A 1WTWA 1TS2A 1SAPA 1GUTA 5E3FA 4DR7Q 1TS5A 1O7IA 4DV4L 4LAAA 4JOIC 4DR3Q 2V1CC 1PZKD 4N8FA 1IBLQ 4TSSA 1LM0A 2N8NA 4A3GG 4FXKC 5EBCA 2RDGA 2OEOA 3HKZE 4ZQ3A 2R92G 1RTNA 3OHXC 2Z6KA 2B8GA 4DV2Q 2FFKB 1EL0A 5CV6A 1W6KA 3NK9A 3PSIA 1I4GA 4ZK9B 3OW7A 3K7UC 4IPDA 5TSSA 1X54A 4UP8A 4DV5L 1WTOA 3CMAA 4IUPA 3IL8A 1AH9A 1Q81C 2R93B 1AP0A 4C3IH 1BO0A 3I4MG 1S40A 1RODA 1K9MC 2E5LQ 5C44H 4A3JB 3GTLH 3BVMA 1YBYA 2KBNA 2NTSA 5C0XJ 4HJ5A 1YEZA 1X56A 3E3XA 1BCPF 5IYBH 1QB5D 4IUUA 3SK8A 4DR3L 1D1IA 2HCIA 3H3VI 5IGDA 1BXTA 3I4MB 4BY1H 5IGGA 1O7LA 5EBDA 5JAVA 3DM3A 1WTPA 3TBIB 5ELBA 1QZHA 3L7ZC 1ZXTA 5CYUA 3BG3A 3KBGA 3IFDA 1GUSA 1CI3M 4DGZA 1BF4A 2E5LL 2F0FA 2AQ3B 4NB3A 4CGYB 5LL6X 1NNXA 4IPHA 4BBSH 2F0WA 1EYGA 4KD4A 4MIUA 1GD7A 4PZ6A 1PFBA 4DR4L 4B3ML 4A3IG 1N36Q 3ICEA 3OIQA 1KC8C 2XIWA 3S2HB 3M4PA 3NWSA 3AMUA 3CC4A 1EUJA 4JBWA 3E6ZX 3CAMA 1RKNA 5C4HA 1TY0A 1XNRL 1WCMG 1B3QA 2KJXA 2OCEA 5C6AA 1SJHD 4IUQA 1CT1D 1I6HH 3NBIA 2RCFA 2LY7A 2KHSA 4A3IB 3PUZA 1PRTC 5D14A 2OXPA 1VQFA 4JYAQ 1C48A 2QGQA 4DAYB 5M5YH 2F0DA 5C4JB 4YCUA 4YY3Q 3M3YB 4QB4A 3PUXA 4X6AH 5T1IA 1OO9B 1T5XD 5AJ3Q 5GROA 1GHKA 4X3KA 1S72A 1UEBA 2VB3X 4LJZC 3OWFA 3NENA 4CJ1B 1QWYA 4DV6Q 1ENAA 4C3JB 2J7ZA 2LFNA 3H6MA 3K5LA 4A3DG 1CUKA 1DOLA 4MTKA 2D0OA 3HKZG 3E9HA 2R3ZA 1HUMA 4JI1Q 1BCPD 4P72A 3DXJC 1VS0A 5IGCA 3D8GA 2YTVA 1Y1VH 3CHBD 1VQJA 5JJZA 1UE7A 3J7A5 3FDTA 3U4ZA 3L2PA 4JYAL 1UEAB 2H4OA 2G9HD 3NPPA 3VR2A 3H91A 3NQIA 4YY3L 4R4IA 1C4QA 2ATWA 3CD6A 5AJ3L 4DF7A 4H02A 4LF6Q 4L5SA 4DV3Q 1LTRD 3GTGH 1VQGA 1SXTA 3FKIG 3CC2A 1F9RA 5K36H 2DJFC 2F0KA 4X3UA 2QEXA 4DV6L 3B6YA 1PH5A 1B2TA 1JQYD 5C3EB 3IRBA 5C0XG 2Q2TA 3NXWA 3K7AB 4JI1L 1F2ZA 4OHJA 2GA4B 1TWHB 1JWMD 4F7XA 1OXSC 2HHHQ 3KFUA 4JI3Q 2EY6A 4N9TA 3W2DA 3TZDA 3NWTA 3S16H 2C5CA 5M5WH 1VQ6A 2EY1A 3VYSA 1EU3A 2R92H 3DUZA 2B29A 1VQAA 4QIWB 4LF6L 3HOVB 4DV3L 1QOHA 5FO8B 4CJ0B 3RLNA 4PQXA 2K5QA 2PO4A 3MAQA 2OTLA 3MVVA 2NWGA 1UAPA 2IHFA 1I50B 4C1NK 4KHPQ 3T13A 5JJIA 2RSNA 4IUTA 3L3OC 1GJXA 5CV7A 3SK5A 1VQ9A 1VQLA 2E2HB 5IP9H 4AIMA 3F2CA 2Q8IB 5FLMG 2JA8B 1PH8A 1NE3A 1B53A 2B2YC 4JBKA 3S14H 3GTPB 3SXHA 2CWAA 1XNQQ 5EKKA 1B8AA 5FJ8G 2HHHL 2SOBA 4JI3L 1R9TH 4M1UB 1EY5A 1JORA 1PYSB 2KEDA 1YNXA 1GO3E 1J5EQ 3BVZA 1GM5A 3HGBA 1HZBA 4O2DA 5LL6S 4OELB 4UY8C 2EYLA 1STEA 3P20A 4JI7Q 4NPSA 2L9HA 1NJIC 3VDYA 4L63B 4DXFA 2IWHA 5CMDA 4KHPL 1VQDA 5CR3A 3MEFA 3H0GH 4ZCKA 1I6VC 1S5FD 3GTMH 3QG1A 1XYIA 1LT5D 5JVH3 1A0IA 3GTJB 3CPWA 1XNQL 3ERSX 5JEAJ 3A8IE 3ITPA 3Q23A 1H9MA 4IOCA 2QW7A 4YCVA 4QGUA 3C1EA 3E0EA 1JWSD 2ZTDA 1CSPA 3A5ZB 1J6QA 2D9UA 1J5EL 3K58A 4BY7B 1CA6A 4GS3A 5ELOA 1WCMH 1WOCA 4R8NA 4A4IA 4ZLTF 3BZDB 3RN2A 1WYDA 4WJ3M 3DEOA 4A3EG 1WFQA 4JI7L 4FYDA 1N33Q 3TSSA 4R1JA 4UDUC 1SYDA 1H95A 1KDCA 5IGEA 2C35B 3EVQA 5COYA 5C3XA 1KAAA 3RD4A 3PQIA 3FRPB 1Y1WB 1NSNS 1GVPA 3M7GA 3M9BA 2NZ1D 1SROA 5DM73 3G4SA 5M9OA 1XTCD 4KHZA 1HFNA 1WD0A 3HOZG 3S24A 2ENBA 1CKOA 1GXDC 4A3DH 1EYCA 1CQFA 3D31A 3NUCA 4BBRH 1YZ6A 4I7ZC 3J80L 3MXGA 4N8X1 3J80E 4CHTB 1N33L 2E2JH 1L0WA 2VUMG 5EPLA 4HSPA 1ET6A 3J7AF 2C9OA 2BH2A 1K3RA 1Y8PB 2HUGA 2PI2E 1A2TA 4RWSC 2O5JC 2DJGC 3C3LA 2A6ED 3ND8A 1FL0A 2ID0A 2JA7G 2XSCA 4JI6Q 3HZXA 3ERQA 2F0IA 1CKMA 2K6AA 3A7LA 1IZ6A 1LTLA 2VUMB 1D7QA 4BXXG 3STBD 5IY0A 1S3OA 1N32Q 4A3BB 3FP9A 2WP8J 1X3QA 3ONAB 3F2BA 1WTRA 1X3EA 1TU2B 4R4OA 4NDXA 5E4WC 3BZCA 4JI0Q 2IX3A 1MI2A 1U4MA 4JI2Q 1E1OA 1NR2A 3GO5A 3Q0AA 3KOJA 5E7NA 2JA6G 1JT8A 1E2WA 5H1SE 1HA5A 3TZUA 4DAVA 1JOOA 4HIKA 3I56A 5IGBA 4NW2A 3QO2A 3H15A 3GDEA 1MJCA 1P8LA 2B63G 1LT4D 1SNDA 3S15B 5ELDA 5HURA 2E76C 5EJWA 3K59A 2H1EA 3CCMA 3G7LA 1TVXA 1RTOA 2O4XA 4OO1H 4JI0L 5JEAG 5IIFA 4IUVA 5KYIA 5DNFA 4RGOS 1JE4A 2K1BA 5C5MA 4JCVE 5EAYA 3CPFA 1PFNA 4DV0L 1I4PA 2WINB 2KCTA 3NEMA 1F9SA 4OL7A 3LGJA 5KNDA 4JI4L 1KTKA 4PMBA 1G51A 3KK7A 3M4OB 5IP7G 2CFMA 4IURA 3DM1A 3QB3A 2NVYB 1HR0Q 3UDFA 2B2UA 3QOLA 2JYOA 2RF4A 3LWUA 5I9PA 1OXUA 2D2CC 3I72A 1G2SA 1STBA 1QILA 2EYFA 3CCEA 1Q82C 4KJNA 2N49A 2B2TA 2A68D 2DY7A 2HQLA 1HFGA 3OOCA 3FHWA 3STBC 1QVCA 4X65Q 3TEHB 5C4XG 1NMFA 2KA7A 2F3IA 2HD3A 2K7VA 3TRZA 4NKLA 3BS1A 1L1OC 2PQAA 3IKJA 4DK6C 2LS01 2HT1A 4QJFA 4G7HC 1SMYD 1H9KA 5J39A 1PFSA 4EX5A 4JG2A 3CCUA 1KNAA 5AFWA 4C3IB 4A93G 1KL9A 3Q22A 3M4QA 4DK1A 1HR0L 1ESFA 4KKTA 4ZRZA 3VR5A 5FLXL 4A3EH 3GTLB 3K5NA 1IL2A 1ILPA 3KYHC 5FLXE 2R7FA 4HTHA 1NAPA 1K28A 2ZJQA 1W6JA 1C8CA 2QKIC 5KEEA 4XTCS 3E0JA 2RQXA 4X65L 4KY7A 4IN3A 1WTQA 4A93B 3OSOA 2TMPA 2JA5H 2L15A 1BQQT 5D65A 1LACA 3PV0A 1C9OA 1UWVA 3MHBA 5GAGC 4OX9Q 2G9DA 1M90C 2OF1A 4H0LC 1JOKA 4AQYQ 1SNOA 3SK6A 4KD3A 1XMQQ 2EYMA 3CRKC 4MTNA 5CV5A 1ESRA 4JI5Q 2R61A 3CCJA 4FVMA 1QJOA 4J6HA 3T4AC 2QILA 1GOZA 2MQHA 3M7NA 2ZT9C 3I2ZA 4K5VA 1SN8A 2A68C 5M3MB 3A0JA 1K8OA 5C4ZA 1CKNA 1XX8A 4HJ9A 4F87A 4ZAIA 4TKOB 4OX9L 2EE1A 1I6HB 3ULLA 4AQYL 4CKBA 3PUVA 1U0LA 1XMQL 2KENA 3ULPA 4J8QA 4IPGA 4A75A 3GTKH 4RGMA 3BZKA 4ABNA 2ZJRA 1X9NA 2Q2IA 4P74A 1PFMA 2B2VA 5L37A 1AFPA 2SEBD 3NTIA 1Y69U 3A56A 2UXDQ 4ULLA 1GUWA 3A54A 3Q24A 4HJ8A 1YI2A 4PG3A 4RGTA 2CH4A 4OEMB 4L8JA 4EQPA 1SNMA 5I6YA 1IW7D 3F2DA 4KV6A 1V1QA 1X3PA 4K6LA 1VQMA 5ELCA 1VQNA 2L11A 1PTOB 1K0SA 2XRQD 5GADC 4CDCC 2K05A 1H9RA 2R93G 1JB7A 2ZTEA 1EIYB 2GVAA 2WB1B 5LMUQ 1SYBA 4A3JG 4R9WA 2E2IB 2OQKA 4RKLA 5JEAH 1A63A 4HJ7A 4GLXA 3IAYA 2UXDL 1O7YA 1NUCA 1TWCB 3HP3A 2K33A 3GTGB 2F0HA 5HY6A 1PH1A 1RF2D 3PMFA 1MSHA 5IOCA 1YVCA 3S9WA 1LTTD 2A6HC 3UI2A 2UUBQ 3K5OA 1FNWA 3U4VA 2IX0A 2PQAB 4GNXA 3J81L 1D5XC 2ALYB 1I4HA 2KCMA 1JC7A 3J81E 1Q1EA 3GTQB 2BE5C 1S5ED 1TWGB 1KXLA 4DR4Q 4B3MQ 4KN7C 1HNZL 1EU4A 4X64Q 3K57A 1TWAH 5LMUL 4LNQA 4K8JA 1EIFA 2UU9Q 4QIWE 3CQZH 2GVBA 1XNRQ 4LFAQ 3K81C 5C4XH 2BA1A 3VA7A 1KHIA 2ZJPA 5GAEC 1PH3A 1TWFB 3I4NG 3KF8A 4WFN3 1XMOQ 4Y7NB 4K6DA 1M4VA 3S1MH 4RA8A 2AUJD 2UUBL 2NVXB 5I6WA 1PH7A 1ONLA 2RBMA 1HRJA 1VQKA 1ILQA 1PDQA 2EJGC 1VQ7A 2LSSA 2P5ZX 1S4ZA 4BWGB 3EQLC 3J80c 2HDMA 1FJGQ 3S14B 5M3FB 3I4NB 5J3BA 1R4QB 4LUZA 1WD1A 4LMQD 1E3PA 1EWHA 1TR5A 2IW3A 4DNIA 3O13A 4XQNA 4X64L 2AKWB 1KQSA 1AW7A 4FP5D 4GLVB 2Z0SA 4XQJA 2UU9L 1ZKOA 4OO1I 3P75A 4LFAL 4JI8Q 3GQBA 4POFA 2F0SA 3K0XA 4CDEC 1UUPA 2RDFA 1Y8NB 2B2WC 1LYLA 1XMOL 1SYGA 2XWBB 4B3TQ 2NN6H 3PO2H 3UDXA 2WV6D 3S1RB 1CKNB 3K5MA 3NP8A 4C3JG 4BA2I 4JOIA 3KF6A 2CW0D 1AN8A 4H13C 1SYFA 4J15A 4GN5A 5ELFA 2MGSA 2EZVA 1P16A 1FJGL 1S5BD 2K03A 3D4WA 3MEHA 1SSOA 5F2DA 2HQEA 1CTMA 1D5ZC 1R4PB 1F9QA 5EPKA 2F4VL 2ZXPA 1YJWA 3M85A 1WJJA 1DJRD 1O80A 3OWEB 4JI8L 1CSQA 2FMMA 4LF4L 2QDLA 4A3KG 4P2CB 3BYTB 1PYWD 4OGQC 1KIXA 3G48A 4B3TL 5IWAQ 5JOBA 5IE8A 1H9JA 2V4DA 1PTOF 2EYPA 1I3QH 1VQ8A 3RLOA 3RZOB 1UNSA 3A74A 2YU9B 4C1NI 3T1HQ 2PMZB 4IFDH 1G2TA 2VS1A 3SVMA 1A62A 5C3EG 2RKSA 4G4KA 3S17B 4A3KB 4F88A 2MUYA 1MIUA 4JV5Q 1Q3LA 2F0UA 4FXDA 3MXNB 3UE0A 1SJED 1WI5A 2M9VA 4QUFA 3TDQA 3TMEA 4V0BA 2CHBD 1D6EC 1F9PA 4N9PA 4MNOA 4Q0FA 3HOXB 3KLSA 1UE6A 3HOVG 4WJWA 3SEBA 1STAA 1B1ZA 4KK7A 4U68A 5IWAL 4GOPB 4GNXB 4A3FB 4JBMA 5CV8A 1LTID 3GV3A 3D4RA 2IL8A 3T1HL 4B3SQ 3HOWG 1AE3A 2DNEA 3SK4A 1Z47A 4A3GH 1TXYA 2UUCQ 4A3JH 2JA8G 3EFXD 3KJPA 3I90A 3I8ZA 4IJHA 1W2BA 5J22A 4Q5VA 4JV5L 3UE1A 2Q2HA 4V190 2JQOA 2AMCB 2F4IA 2MNAA 2VXWA 2XRSD 4L5QA 5C5LA 4DXGA 1AZQA 2G5DA 2O2LD 1GHJA 4ZUJA 3HOWB 1PV4A 1N34Q 3I4MH 2VNUD 2RHQB 2K75A 3K8AA 3KF8B 3QWNA 1K3BC 1U4RA 1KDBA 3PO3B 3DWAA 3CXCA 3RNUA 1A3VA 4HAEA 1QVGA 4QQBX 4O1NA 5FLXc 1B70B 1L0YB 2UXCL 3FPPA 2AWNA 3RMHA 1HZCA 1BCPC 1V1PA 4B3SL 2XGTA 1E2VA 2UUCL 1GUGA 3V2TA 3E5SA 1FGBD 4ZKBB 2WACA 1Z7TA 1L2FA 1MSGA 2OQ0A 4M8AA 1LTSD 1PTOD 1IKLA 1VQOA 1VMPA 2F03A 2K5HA 3S1QH 3S2HH 1VQHA 2SNMA 4QY7A 3BJUA 3R93A 4JW0A 1ASZA 4BY7G 1N34L 2MHVA 4XYOA 1HZ9A 1UE5A 2WAQG 1VQPA 4ME3A 2NVTB 5NUCA 2NYZD 3KF6B 2SDFA 4A3IH 2EOTA 4LWCA 3AU7A 1PZJD 5EKIA 4C2MB 2L55A 4OONA 2EVBA 5LMNW 2NTTA 3T16A 3W1GA 2VZAA 5C4JH 3ND9A 4DR1Q 3RUZA 3GTOB 2WAQB 3M3YH 2R7ZG 1Y1WG 1A3UA 4JPBW 1YNJD 1G6PA 2J0TD 2NUCA 5IGFA 4ALPA 2JA9A 4YCWA 4UP9A 4DR5Q 1B9MA 4B9XA 4GN4B 2BH8A 3PIOA 2XN9C 3RZDB 4C3JH 2A1AA 3W5OA 3D6WA 4PNYA 1BBXC 3GP7A 1SDFA 3ZJYC 1QVFA 2R7DA 5ELNA 2JJQA 5E4XA 2R7ZB 4HIMA 3TP7A 1ET9A 1HXYD 1LO5D 1HJPA 3KLWA 3MA2B 5G3LF 4TVAB 1EWCA 1DZ1A 3FEWX 4C3HB 4LFBL 1PH9A 1OXXK 1JJGA 1G8ZD 3S1NB 3U9OA 2Z4IA 3PF5A 1EY8A 3X3MA 4DR1L 3GD7A 1B3AA 5D3IB 4XDXA 2EYOA 1RIPA 2B2YA 4PV1C 1EOVA 2PNHA 4DR5L 4OIKA 2K5VA 3BDCA 3OMGA 3K0YA 1HR0W 5EQ0A 3WWVA 2F0EA 4C56C 2NZHA 2F52A 4A3BG 1F2YA 1GUNA 5C3EH 3PUWA 1IBMQ 4FXGC 3K7AH 2B2UC 2K04A 2UXBL 1KD1C 1VDZA 1TWHH 3JAML 3FKIH 2NB0A 4ME5A 2F3WA 3JAME 3C2PA 3GV6A 4KHVA 4HEDA 1ENCA 4OWWB 1FNUA 3KBXA 2PPBC 4DU9A 3J81c 1PMRA 3HOUG 5C0XH 4B3RQ 3T53B 4X3SA 1FYCA 1PRTB 3DHQA 3CMEA 4K8IA 2NN6I 1Q1BA 3UDIA 1YHBA 5LMNQ 4DV7Q 2A69D 4CKEA 1I50H 2DGYA 4DV0Q 1SFOB 2NVQB 2K5NA 1YITA 2QEJC 4JI4Q 3MWYW 1DM0B 2VW9A 1EWIA 2JA8H 3CCLA 1HA6A 1IBML 4LW1A 3CC7A 3GTPH 3HOUB 1V1PB 1AEXA 2MO1A 1ZYRD 1SYCA 2KQ3A 2E75C 1J9OA 2FHTA 4EVOA 3QJYA 3K80C 2DNCA 5IYCG 2JP1A 2M2LA 2I5LX 1V43A 2XWJB 4A3MG 3F1ZA 1JB3A 1HPCA 4DR6Q 1QZGA 4A3CG 5LHY1 5FLMH 2Q8RE 2EJFC 4FO2A 3RN5A 1GUOA 3FVQA 3I73A 3L9AX 3I7FA 4B3RL 3ZYYX 3GTKB 4H44C 5G3LD 1BKBA 5FJ8H 1WVLA 4AYBB 4ZKCB 5LMNL 4DV7L 2VQEQ 5C3WA 5IYDG 3PUYA 2L4NA 4IFDI 4MZ9A 2EDGA 4DAPA 4RCOA 4A3MB 2AWOA 4R4QA 4P71A 1RDPD 3UDGA 2K01A 4L6TB 1VQIA 3GTJH 4F8MA 4HIDA 2I07B 4LF7Q 3HOYB 2E8GA 2A6EC 1QG7A 2RVLA 5GQOA 2F0TA 3CCRA 2ZTCA 2WB1E 4QF4A 5CV9A 4DR6L 2D5DA 2AQ2B 4C3IG 4RGNA 4FF2A 1E24A 3QR8A 3A7AB 5C44G 3AFPA 1EIGA 1EFWA 5M5XH 2VQEL 1I5FA 3E9IA 3PIPA 4IO9A 1X3GA 1LLRD 4U673 5JJKA 1DOKA 1VQBA 4RCNA 4DV1Q 3IFTA 4RKBA 2HIVA 4LF7L 1MKHA 1S5CD 3JC66 4K14A 1EFID 5FOBB 5C44B 1T9HA 4KY5A 4HR7B 1K8GA 1X32A 1STYA 4O42A 1V9PA 2NZOA 3S2DH 3VYUA 3OPOA 2IPKD 1TWAB 3ULJA 1Q8IA 2M00A 5CV4A 1JE5A 1JCKB 3SHLA 3CQZB 4BY1B 1O7ZA 1N8RC 1QCBD 4CDDC 4BBSG 1FNVA 1CZWA 2ES2A 4XIGS 3K6OA 5BR8Q 4LF5Q 1A8VA 1IYJB 3HOZH 4R4CA 3D3RA 4OWXB 4DV1L 3A55A 1OXTA 2KCNA 4ILWA 4ZUIA 5M3MG 4IZ8A 4HN7A 1EQQA 2Z6KC 3SR1A 2YTYA 5IT9L 2ZXOA 4QL5A 2A73B 2L5TA 5IT9E 1MD2D 4FF4A 4BBSB 3H94A 1KRTA 5I2YA 2VUMH 4NXNL 4DR2Q 2N78A 5BN5A 1PRTF 2MP1A 2Z9HA 5I4DA 4A3BH 3R2TA
chains in the Genus database with same CATH topology
1R9TH 4JI3L 1EQRA 1YHAA 2LXJA 2Z0SA 1PYSB 4GLVB 2UU9L 4OO1I 2JA7H 1YNXA 1GO3E 4LFAL 4JI8Q 4R4TA 2ASBA 4POFA 1J5EQ 3K0XA 2CQOA 5BR8L 4LF5L 1GM5A 1BBWA 1XTDA 3EBEA 3RLFA 2QA4A 4BXXH 1LYLA 1XMOL 1HZBA 4O2DA 4B3TQ 3PO2H 4UY8C 3I4MH 3UDXA 3AFQA 3HOYG 1CKNB 3A5UA 3CCVA 3PF4A 4JI7Q 4NPSA 4BA2I 1NJIC 2YTXA 4JOIA 3CCQA 3VDYA 3KF6A 4KHPL 4J15A 1VQDA 3I55A 1K73C 4JI6L 1NY4A 1Q7YC 4O0AA 1PH2A 4GN5A 3MEFA 2KHIA 2VQFL 1L1OA 2K14A 1NMGA 2MFIA 3H0GH 4DKAC 2CCZA 2JA6H 4DR2L 1P16A 1FJGL 3GTMH 5HGQA 1OXVA 1N32L 1A0IA 1Y1VG 3NELA 2NVTH 1GKHA 1BBUA 3CPWA 2WB1G 1XNQL 4IFDJ 3ERSX 5JEAJ 3L0OA 2Y0SG 4IOCA 4NXML 4YCVA 1YJNA 1HNWQ 4QGUA 1AE2A 3E0EA 2F4VL 4JI2L 1E22A 2B63H 3KJOA 3M85A 1YJWA 1WJJA 4K0KQ 4EQ5A 2ZTDA 4LFCQ 1CSPA 3A5ZB 1J6QA 4JI8L 4C2MH 3U50C 1J5EL 1PYBA 1CSQA 3D0FA 4LF4L 4A3KG 4GS3A 1ASYA 4BY7H 5ELOA 1WCMH 2K4KA 1WOCA 2Y0SE 4JBJA 4A4IA 1KIXA 5JJLA 3Q8DA 3AQQA 3GTOH 1HNZQ 2IX1A 2PMZE 1FVIA 3G48A 5IWAQ 1WYDA 3RN2A 5IE8A 4B3TL 4WJ3M 4A3EG 1VQ8A 1I3QH 1WFQA 3AYHB 1D8LA 1NBWA 3RLOA 4JI7L 3M4OH 3A74A 1SR3A 4DPGA 2I0QA 3T1HQ 4POGA 2NVYH 1N33Q 1BVSA 4P75A 4NXMQ 2VS1A 4R1JA 1H95A 1A62A 5C3EG 2C35B 3RZDH 1IBKQ 5IYDH 5IYBG 3I4OA 2KHJA 1MIUA 4PMWA 4DK3C 4JV5Q 2IY5B 3M9BA 1GVPA 2R7ZH 1Y1WH 2WFWA 2K52A 1SROA 3MXNB 3UE0A 3G4SA 4BY1G 4GOPA 1VCIA 1WI5A 1HNWL 5IP7H 4YHHQ 4KHZA 1NTGA 3PCOB 4K0KL 4TQUS 4MNOA 4LFCL 4C3HH 1JMCA 1Q12A 3HOZG 1SMXA 4NXNQ 1UE6A 3S1NH 3HOVG 3S24A 1CKOA 3EN2A 4A3DH 1KRSA 1I94Q 3F8TA 1Z9FA 3D31A 2HIXA 5IWAL 4GOPB 4GNXB 3CP0A 4KLKA 4JBMA 4BBRH 1YZ6A 2D0PA 4IPCA 4HJAA 2OTJA 1HH2P 5C0XI 3HOWG 3T1HL 4B3SQ 4RMFA 1AE3A 2A19A 4P73A 5IP9G 1N33L 2E2JH 1L0WA 1Z47A 2VUMG 4A3GH 1TXYA 2UUCQ 3EIVA 3CCSA 4A3JH 2K50A 1IBKL 5M3FG 2JA8G 3KJPA 1SLJA 3TQYA 1OTCA 4HIOA 2BH2A 3TS2A 1K3RA 2A8VA 2PI2E 4IJHA 1W2BA 4L5RC 4DR7L 4JV5L 3UE1A 2Q2HA 2JQOA 4AH6A 1FL0A 2AMCB 1K83H 2ID0A 2MNAA 4YWMA 2JA7G 1X6OA 4L5QA 1PH6A 1MJEA 1C7YA 1IBLL 4A93H 4YHHL 4JI6Q 1CKMA 1PV4A 3BU2A 1N34Q 1IZ6A 1LTLA 1U5KA 2EXDA 2K75A 2RHQB 3K8AA 3KF8B 4DV2L 1D7QA 4BXXG 3STBD 5IY0A 4GLAC 1X65A 1S3OA 2NN6G 3PO2G 3FP9A 2WP8J 3CXCA 3CF5A 3RNUA 1QVGA 1I94L 4QQBX 2RCNA 2VL6A 1Q46A 3CW2C 3F2BA 1X3EA 5FLXc 4R4OA 4GOPC 4GNXC 1B70B 3BZCA 2UXCL 2MO0A 2AWNA 4JI0Q 1DGSA 1HZCA 2F4VQ 4JI2Q 4B3SL 1E1OA 1LUZA 2XGTA 3GO5A 3J7ZC 3H0GG 3KOJA 5E7NA 1RL2A 2JA6G 2UUCL 1JT8A 4OWTB 3T1YQ 5H1SE 3NBHB 1M1KC 4LF4Q 3TREA 1SFOH 2NVQH 4HIKA 3JAMc 4A76A 1B7YB 1L2FA 3I56A 2OQ0A 3H15A 3GDEA 5JJKA 1MJCA 2EQSA 1P8LA 4OXPA 5GAHC 2B63G 3HOUH 1VQOA 4LF9Q 4FDBA 3S2HH 2K5HA 3S1QH 1FGUA 1VQHA 2I5MX 5M3MH 4QY7A 3BJUA 3OYYA 4WJ4A 1ASZA 4BY7G 1N34L 3S15H 1HZ9A 3SGIA 1UE5A 2WAQG 1VQPA 4ME3A 3J81i 1W3SA 3CCMA 4DV4Q 2H5XA 3PGZA 3KF6B 4IFDG 4A3IH 4JI0L 3HFZB 4BA1I 4LWCA 5JEAG 1L1OB 2WAQE 4JI5L 4OONA 4JCVE 5EAYA 3CPFA 5LMNW 3T1YL 3W1BA 3W1GA 4DV0L 1XPOA 2VZAA 5DLQE 5IYCH 5C4JH 2KCTA 4DR1Q 3NEMA 2JEAI 3LGJA 1YJ9A 2R7ZG 3M3YH 1Y1WG 4JI4L 1XPRA 1G51A 4DV5Q 4A3MH 1XJVA 1X3FA 1G6PA 5K36G 4LUVA 5IP7G 1N36L 2CFMA 4ALPA 2JA9A 4A3LG 4YCWA 4UP9A 4A3CH 4DR5Q 1HR0Q 3UDFA 4LF9L 2RF4A 4GN4B 1OXUA 1X55A 1KQSA 2AHOB 2BH8A 3PIOA 3HOYH 4C3JH 3HOXG 2A1AA 3KDFA 1PVOA 3W5OA 4GKKQ 3CCEA 3ZJYC 1Q82C 1QVFA 2R7DA 2N49A 5ELNA 4DR7Q 2JJQA 4BBRG 1O7IA 4DV4L 4HIMA 2HQLA 4A3FG 3OTOQ 3FHWA 3STBC 1HJPA 4JOIC 4DR3Q 1QVCA 2V1CC 3KLWA 3TEHB 4X65Q 1IBLQ 4TVAB 5C4XG 1LM0A 2EIFA 1NMFA 2N8NA 2F3IA 4A3GG 3TRZA 4PZ7A 3HKZE 1L1OC 4LFBL 2R92G 2PQAA 1OXXK 1PH9A 1JJGA 2Z6KA 4DV2Q 2E2IH 4DK6C 3PF5A 2JK8A 2HT1A 3PSIA 4QJFA 4DR1L 3GD7A 3K7UC 4IPDA 1TWCH 1X54A 1PFSA 4UP8A 1Q86C 4DV5L 2YV5A 4EX5A 4JG2A 1RIPA 3CMAA 3CCUA 1AH9A 1Q81C 4A93G 2UXCQ 3OW2A 1KL9A 1EOVA 2PNHA 4C3IH 3M4QA 4LUOA 4DR5L 1HR0L 2R93H 2K5VA 3I4MG 1S40A 1K9MC 4A3EH 2E5LQ 1HR0W 1IL2A 5C44H 3GTLH 3KYHC 1YHQA 1YBYA 3WWVA 2KBNA 2R7FA 4UP7A 3PO3G 5C0XJ 4GKKL 2NZHA 2F52A 4A3BG 4HJ5A 4LF8Q 1YEZA 2ZJQA 3AEVA 5C3EH 1X56A 3PUWA 3GTQH 5IYBH 1IBMQ 1TWGH 3OTOL 2YYZA 3K7AH 4XTCS 2UXBL 4DR3L 4X65L 4X66Q 1QUQA 1KD1C 1TWHH 3H3VI 3FKIH 4Y52H 4UPAA 2JA5H 2L15A 4BY1H 3PV0A 1N9WA 4X62Q 1C9OA 3DM3A 1UWVA 4OWWB 1QZHA 1G291 5GAGC 4OX9Q 3L7ZC 1M90C 3J81c 1SE8A 1TWFH 3ER0A 3HOUG 4AQYQ 4Y7NH 2Q2UA 4B3RQ 1XMQQ 4MTNA 4JC0A 1Y14B 3CMEA 5LMNQ 2NN6I 1Q1BA 3UDIA 1YHBA 4DV7Q 2NVXH 4JI5Q 2ZM6Q 2E5LL 4DUZQ 1I50H 2RHSB 1XPUA 2DGYA 4NB3A 3CCJA 4DV0Q 1PH4A 2K5NA 1YITA 4IPHA 4BBSH 1EYGA 4LF8L 4PZ8A 1GD7A 4PZ6A 4JI4Q 2MQHA 4OO1G 2VW9A 3M7NA 1EWIA 4B3ML 5M3FH 4A3IG 3CCLA 1IBML 2JA8H 3I2ZA 4LW1A 3I4NH 2IT1A 3CC7A 1N36Q 3GTPH 3ICEA 1KC8C 2MO1A 4X66L 1SN8A 3M4PA 3CC4A 1EUJA 3HKSA 1SRUA 3A0JA 3CAMA 4JBWA 1CKNA 3K80C 1VQ5A 5IYCG 1XNRL 1WCMG 1N32Q 2JE6I 4X62L 4HJ9A 2I5LX 1V43A 2OCEA 1YIJA 4A3MG 3F1ZA 4IOAA 4OX9L 4DR6Q 1QZGA 2CKZB 5IT9c 4AYBE 4DUYQ 4A3CG 1I6HH 3ULLA 5FLMH 3G71A 4AQYL 3RN5A 4B3RL 3PUVA 1U0LA 3PUZA 3I7FA 1XMQL 2KENA 3ULPA 1BKBA 1VQFA 4IPGA 5FJ8H 4A75A 3GTKH 3BZKA 5LMNL 4DV7L 2ZJRA 3S1RH 1X9NA 4JYAQ 2QGQA 4LFBQ 4DAYB 2Q2IA 5IYDG 5M5YH 3PUYA 2ZM6L 2VQEQ 4P74A 4DUZL 1PHJA 4BBSG 4YCUA 4YY3Q 2UXDQ 2OWOA 3J80i 4IFDI 4MZ9A 4HJ8A 3TS0A 3PUXA 4X6AH 2CWPA 4GN3B 5AJ3Q 1YI2A 4PG3A 2AWOA 4R4QA 5GROA 4GKJQ 4P71A 1UE1A 3UDGA 1IXRA 1S72A 1UEBA 3F2DA 2IHEA 2XTIA 4YWLA 1VQIA 3GTJH 4HIDA 4LF7Q 1V1QA 3NENA 4DR4L 2E8GA 1VQMA 4DV6Q 1VQNA 5GQOA 2VNUD 4A3DG 5GADC 1CUKA 3CCRA 2D0OA 2ZTCA 3HKZG 3E9HA 2LXKA 2UUAQ 1JJCB 3JAMi 2WB1E 4YWKA 2BA0A 4DR6L 4JI1Q 4DUYL 2R93G 2UXBQ 1E24A 2ZTEA 1JB7A 4P72A 1EIYB 1VS0A 2GVAA 2YTVA 1Y1VH 1VQJA 5LMUQ 1UE7A 3AFPA 5C44G 1EFWA 3J7A5 3U4ZA 3L2PA 4A3JG 3KDFB 4JYAL 3RR5A 5M5XH 2VQEL 2YU9H 2OQKA 1E1TA 1I5FA 3RZOH 3E9IA 2GN5A 3PIPA 4HJ7A 1A63A 4IO9A 4YY3L 4IJLA 4R4IA 4GLXA 1X3GA 2R6GA 2UXDL 2VY3A 2ATWA 2I5HA 3CD6A 5AJ3L 1VQ4A 4H02A 4LF6Q 1PH1A 1VQBA 5HY6A 4L5SA 4GKJL 4DV3Q 3S17H 4A3KH 3GTGH 1YVCA 4DV1Q 1VQGA 3FKIG 2HIVA 2UUBQ 4LF7L 1MKHA 2JEBI 2JA5G 3CC2A 2N3SA 3U4VA 2IX0A 2PQAB 3JC66 4GNXA 4DAMA 1K0RA 2ALYB 2QEXA 4DV6L 3B6YA 4A3LH 1T9HA 2KCMA 1PH5A 1HNXQ 1Q1EA 2UUAL 1K8GA 2FXQA 1V9PA 2NZOA 3IRBA 5C0XG 3HOXH 3S2DH 1KXLA 2Q2TA 4B3MQ 4DR4Q 4JI1L 2B3GA 1HNZL 2HHHQ 3KFUA 1OXSC 3ULJA 4X64Q 1TWAH 4APVA 5LMUL 1JE5A 4A3FH 4JI3Q 1JJ2A 4LNQA 1E7ZA 3J81j 1EIFA 1VQCA 2UU9Q 4QIWE 3CQZH 1N8RC 2GVBA 1XNRQ 3G6EA 4LFAQ 2DUDA 2PI2A 3K81C 5C4XH 3S16H 2BA1A 5M5WH 2ES2A 1KHIA 4XIGS 2ZJPA 5GAEC 1VQ6A 1KAWA 5BR8Q 1PH3A 4LF5Q 2R92H 2B29A 1A8VA 1IYJB 1VQAA 3I4NG 4KI0A 4LF6L 3HOZH 4R4CA 1XMOQ 1QUQB 4DV3L 4OWXB 3DLLA 4DV1L 1K8AC 3HOVH 3RLNA 1OXTA 3S1MH 1VQEA 1HZAA 2UUBL 5M3MG 2OTLA 1EQQA 2Z6KC 3U58A 2YTYA 2IHFA 4QL5A 1PH7A 4KHPQ 5JJIA 1VQKA 1VQ9A 1VQLA 1VQ7A 2LSSA 3HOWH 1HNXL 2E2HH 1KRTA 5IP9H 4AIMA 2VQFQ 2VUMH 4NXNL 3F2CA 4L5TA 4RG1A 3J80c 5FLMG 4DR2Q 2N78A 1PH8A 1NE3A 1FJGQ 4JBKA 3PO3H 3S14H 3H3VH 1PA6A 2D62A 1Q8KA 4A3BH 2CWAA 5J3BA 1XNQQ 4LUZA 1B8AA 5FJ8G 1C0AA 1E3PA 2HHHL 4DNIA 4X64L 2AKWB 4AYBG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9T H;  4JI3 L;  1EQR A;  1YHA A;  2LXJ A;  2Z0S A;  1PYS B;  4GLV B;  2UU9 L;  4OO1 I;  2JA7 H;  1YNX A;  1GO3 E;  4LFA L;  4JI8 Q;  4R4T A;  2ASB A;  4POF A;  1J5E Q;  3K0X A;  2CQO A;  5BR8 L;  4LF5 L;  1GM5 A;  1BBW A;  1XTD A;  3EBE A;  3RLF A;  2QA4 A;  4BXX H;  1LYL A;  1XMO L;  1HZB A;  4O2D A;  4B3T Q;  3PO2 H;  4UY8 C;  3I4M H;  3UDX A;  3AFQ A;  3HOY G;  1CKN B;  3A5U A;  3CCV A;  3PF4 A;  4JI7 Q;  4NPS A;  4BA2 I;  1NJI C;  2YTX A;  4JOI A;  3CCQ A;  3VDY A;  3KF6 A;  4KHP L;  4J15 A;  1VQD A;  3I55 A;  1K73 C;  4JI6 L;  1NY4 A;  1Q7Y C;  4O0A A;  1PH2 A;  4GN5 A;  3MEF A;  2KHI A;  2VQF L;  1L1O A;  2K14 A;  1NMG A;  2MFI A;  3H0G H;  4DKA C;  2CCZ A;  2JA6 H;  4DR2 L;  1P16 A;  1FJG L;  3GTM H;  5HGQ A;  1OXV A;  1N32 L;  1A0I A;  1Y1V G;  3NEL A;  2NVT H;  1GKH A;  1BBU A;  3CPW A;  2WB1 G;  1XNQ L;  4IFD J;  3ERS X;  5JEA J;  3L0O A;  2Y0S G;  4IOC A;  4NXM L;  4YCV A;  1YJN A;  1HNW Q;  4QGU A;  1AE2 A;  3E0E A;  2F4V L;  4JI2 L;  1E22 A;  2B63 H;  3KJO A;  3M85 A;  1YJW A;  1WJJ A;  4K0K Q;  4EQ5 A;  2ZTD A;  4LFC Q;  1CSP A;  3A5Z B;  1J6Q A;  4JI8 L;  4C2M H;  3U50 C;  1J5E L;  1PYB A;  1CSQ A;  3D0F A;  4LF4 L;  4A3K G;  4GS3 A;  1ASY A;  4BY7 H;  5ELO A;  1WCM H;  2K4K A;  1WOC A;  2Y0S E;  4JBJ A;  4A4I A;  1KIX A;  5JJL A;  3Q8D A;  3AQQ A;  3GTO H;  1HNZ Q;  2IX1 A;  2PMZ E;  1FVI A;  3G48 A;  5IWA Q;  1WYD A;  3RN2 A;  5IE8 A;  4B3T L;  4WJ3 M;  4A3E G;  1VQ8 A;  1I3Q H;  1WFQ A;  3AYH B;  1D8L A;  1NBW A;  3RLO A;  4JI7 L;  3M4O H;  3A74 A;  1SR3 A;  4DPG A;  2I0Q A;  3T1H Q;  4POG A;  2NVY H;  1N33 Q;  1BVS A;  4P75 A;  4NXM Q;  2VS1 A;  4R1J A;  1H95 A;  1A62 A;  5C3E G;  2C35 B;  3RZD H;  1IBK Q;  5IYD H;  5IYB G;  3I4O A;  2KHJ A;  1MIU A;  4PMW A;  4DK3 C;  4JV5 Q;  2IY5 B;  3M9B A;  1GVP A;  2R7Z H;  1Y1W H;  2WFW A;  2K52 A;  1SRO A;  3MXN B;  3UE0 A;  3G4S A;  4BY1 G;  4GOP A;  1VCI A;  1WI5 A;  1HNW L;  5IP7 H;  4YHH Q;  4KHZ A;  1NTG A;  3PCO B;  4K0K L;  4TQU S;  4MNO A;  4LFC L;  4C3H H;  1JMC A;  1Q12 A;  3HOZ G;  1SMX A;  4NXN Q;  1UE6 A;  3S1N H;  3HOV G;  3S24 A;  1CKO A;  3EN2 A;  4A3D H;  1KRS A;  1I94 Q;  3F8T A;  1Z9F A;  3D31 A;  2HIX A;  5IWA L;  4GOP B;  4GNX B;  3CP0 A;  4KLK A;  4JBM A;  4BBR H;  1YZ6 A;  2D0P A;  4IPC A;  4HJA A;  2OTJ A;  1HH2 P;  5C0X I;  3HOW G;  3T1H L;  4B3S Q;  4RMF A;  1AE3 A;  2A19 A;  4P73 A;  5IP9 G;  1N33 L;  2E2J H;  1L0W A;  1Z47 A;  2VUM G;  4A3G H;  1TXY A;  2UUC Q;  3EIV A;  3CCS A;  4A3J H;  2K50 A;  1IBK L;  5M3F G;  2JA8 G;  3KJP A;  1SLJ A;  3TQY A;  1OTC A;  4HIO A;  2BH2 A;  3TS2 A;  1K3R A;  2A8V A;  2PI2 E;  4IJH A;  1W2B A;  4L5R C;  4DR7 L;  4JV5 L;  3UE1 A;  2Q2H A;  2JQO A;  4AH6 A;  1FL0 A;  2AMC B;  1K83 H;  2ID0 A;  2MNA A;  4YWM A;  2JA7 G;  1X6O A;  4L5Q A;  1PH6 A;  1MJE A;  1C7Y A;  1IBL L;  4A93 H;  4YHH L;  4JI6 Q;  1CKM A;  1PV4 A;  3BU2 A;  1N34 Q;  1IZ6 A;  1LTL A;  1U5K A;  2EXD A;  2K75 A;  2RHQ B;  3K8A A;  3KF8 B;  4DV2 L;  1D7Q A;  4BXX G;  3STB D;  5IY0 A;  4GLA C;  1X65 A;  1S3O A;  2NN6 G;  3PO2 G;  3FP9 A;  2WP8 J;  3CXC A;  3CF5 A;  3RNU A;  1QVG A;  1I94 L;  4QQB X;  2RCN A;  2VL6 A;  1Q46 A;  3CW2 C;  3F2B A;  1X3E A;  5FLX c;  4R4O A;  4GOP C;  4GNX C;  1B70 B;  3BZC A;  2UXC L;  2MO0 A;  2AWN A;  4JI0 Q;  1DGS A;  1HZC A;  2F4V Q;  4JI2 Q;  4B3S L;  1E1O A;  1LUZ A;  2XGT A;  3GO5 A;  3J7Z C;  3H0G G;  3KOJ A;  5E7N A;  1RL2 A;  2JA6 G;  2UUC L;  1JT8 A;  4OWT B;  3T1Y Q;  5H1S E;  3NBH B;  1M1K C;  4LF4 Q;  3TRE A;  1SFO H;  2NVQ H;  4HIK A;  3JAM c;  4A76 A;  1B7Y B;  1L2F A;  3I56 A;  2OQ0 A;  3H15 A;  3GDE A;  5JJK A;  1MJC A;  2EQS A;  1P8L A;  4OXP A;  5GAH C;  2B63 G;  3HOU H;  1VQO A;  4LF9 Q;  4FDB A;  3S2H H;  2K5H A;  3S1Q H;  1FGU A;  1VQH A;  2I5M X;  5M3M H;  4QY7 A;  3BJU A;  3OYY A;  4WJ4 A;  1ASZ A;  4BY7 G;  1N34 L;  3S15 H;  1HZ9 A;  3SGI A;  1UE5 A;  2WAQ G;  1VQP A;  4ME3 A;  3J81 i;  1W3S A;  3CCM A;  4DV4 Q;  2H5X A;  3PGZ A;  3KF6 B;  4IFD G;  4A3I H;  4JI0 L;  3HFZ B;  4BA1 I;  4LWC A;  5JEA G;  1L1O B;  2WAQ E;  4JI5 L;  4OON A;  4JCV E;  5EAY A;  3CPF A;  5LMN W;  3T1Y L;  3W1B A;  3W1G A;  4DV0 L;  1XPO A;  2VZA A;  5DLQ E;  5IYC H;  5C4J H;  2KCT A;  4DR1 Q;  3NEM A;  2JEA I;  3LGJ A;  1YJ9 A;  2R7Z G;  3M3Y H;  1Y1W G;  4JI4 L;  1XPR A;  1G51 A;  4DV5 Q;  4A3M H;  1XJV A;  1X3F A;  1G6P A;  5K36 G;  4LUV A;  5IP7 G;  1N36 L;  2CFM A;  4ALP A;  2JA9 A;  4A3L G;  4YCW A;  4UP9 A;  4A3C H;  4DR5 Q;  1HR0 Q;  3UDF A;  4LF9 L;  2RF4 A;  4GN4 B;  1OXU A;  1X55 A;  1KQS A;  2AHO B;  2BH8 A;  3PIO A;  3HOY H;  4C3J H;  3HOX G;  2A1A A;  3KDF A;  1PVO A;  3W5O A;  4GKK Q;  3CCE A;  3ZJY C;  1Q82 C;  1QVF A;  2R7D A;  2N49 A;  5ELN A;  4DR7 Q;  2JJQ A;  4BBR G;  1O7I A;  4DV4 L;  4HIM A;  2HQL A;  4A3F G;  3OTO Q;  3FHW A;  3STB C;  1HJP A;  4JOI C;  4DR3 Q;  1QVC A;  2V1C C;  3KLW A;  3TEH B;  4X65 Q;  1IBL Q;  4TVA B;  5C4X G;  1LM0 A;  2EIF A;  1NMF A;  2N8N A;  2F3I A;  4A3G G;  3TRZ A;  4PZ7 A;  3HKZ E;  1L1O C;  4LFB L;  2R92 G;  2PQA A;  1OXX K;  1PH9 A;  1JJG A;  2Z6K A;  4DV2 Q;  2E2I H;  4DK6 C;  3PF5 A;  2JK8 A;  2HT1 A;  3PSI A;  4QJF A;  4DR1 L;  3GD7 A;  3K7U C;  4IPD A;  1TWC H;  1X54 A;  1PFS A;  4UP8 A;  1Q86 C;  4DV5 L;  2YV5 A;  4EX5 A;  4JG2 A;  1RIP A;  3CMA A;  3CCU A;  1AH9 A;  1Q81 C;  4A93 G;  2UXC Q;  3OW2 A;  1KL9 A;  1EOV A;  2PNH A;  4C3I H;  3M4Q A;  4LUO A;  4DR5 L;  1HR0 L;  2R93 H;  2K5V A;  3I4M G;  1S40 A;  1K9M C;  4A3E H;  2E5L Q;  1HR0 W;  1IL2 A;  5C44 H;  3GTL H;  3KYH C;  1YHQ A;  1YBY A;  3WWV A;  2KBN A;  2R7F A;  4UP7 A;  3PO3 G;  5C0X J;  4GKK L;  2NZH A;  2F52 A;  4A3B G;  4HJ5 A;  4LF8 Q;  1YEZ A;  2ZJQ A;  3AEV A;  5C3E H;  1X56 A;  3PUW A;  3GTQ H;  5IYB H;  1IBM Q;  1TWG H;  3OTO L;  2YYZ A;  3K7A H;  4XTC S;  2UXB L;  4DR3 L;  4X65 L;  4X66 Q;  1QUQ A;  1KD1 C;  1TWH H;  3H3V I;  3FKI H;  4Y52 H;  4UPA A;  2JA5 H;  2L15 A;  4BY1 H;  3PV0 A;  1N9W A;  4X62 Q;  1C9O A;  3DM3 A;  1UWV A;  4OWW B;  1QZH A;  1G29 1;  5GAG C;  4OX9 Q;  3L7Z C;  1M90 C;  3J81 c;  1SE8 A;  1TWF H;  3ER0 A;  3HOU G;  4AQY Q;  4Y7N H;  2Q2U A;  4B3R Q;  1XMQ Q;  4MTN A;  4JC0 A;  1Y14 B;  3CME A;  5LMN Q;  2NN6 I;  1Q1B A;  3UDI A;  1YHB A;  4DV7 Q;  2NVX H;  4JI5 Q;  2ZM6 Q;  2E5L L;  4DUZ Q;  1I50 H;  2RHS B;  1XPU A;  2DGY A;  4NB3 A;  3CCJ A;  4DV0 Q;  1PH4 A;  2K5N A;  1YIT A;  4IPH A;  4BBS H;  1EYG A;  4LF8 L;  4PZ8 A;  1GD7 A;  4PZ6 A;  4JI4 Q;  2MQH A;  4OO1 G;  2VW9 A;  3M7N A;  1EWI A;  4B3M L;  5M3F H;  4A3I G;  3CCL A;  1IBM L;  2JA8 H;  3I2Z A;  4LW1 A;  3I4N H;  2IT1 A;  3CC7 A;  1N36 Q;  3GTP H;  3ICE A;  1KC8 C;  2MO1 A;  4X66 L;  1SN8 A;  3M4P A;  3CC4 A;  1EUJ A;  3HKS A;  1SRU A;  3A0J A;  3CAM A;  4JBW A;  1CKN A;  3K80 C;  1VQ5 A;  5IYC G;  1XNR L;  1WCM G;  1N32 Q;  2JE6 I;  4X62 L;  4HJ9 A;  2I5L X;  1V43 A;  2OCE A;  1YIJ A;  4A3M G;  3F1Z A;  4IOA A;  4OX9 L;  4DR6 Q;  1QZG A;  2CKZ B;  5IT9 c;  4AYB E;  4DUY Q;  4A3C G;  1I6H H;  3ULL A;  5FLM H;  3G71 A;  4AQY L;  3RN5 A;  4B3R L;  3PUV A;  1U0L A;  3PUZ A;  3I7F A;  1XMQ L;  2KEN A;  3ULP A;  1BKB A;  1VQF A;  4IPG A;  5FJ8 H;  4A75 A;  3GTK H;  3BZK A;  5LMN L;  4DV7 L;  2ZJR A;  3S1R H;  1X9N A;  4JYA Q;  2QGQ A;  4LFB Q;  4DAY B;  2Q2I A;  5IYD G;  5M5Y H;  3PUY A;  2ZM6 L;  2VQE Q;  4P74 A;  4DUZ L;  1PHJ A;  4BBS G;  4YCU A;  4YY3 Q;  2UXD Q;  2OWO A;  3J80 i;  4IFD I;  4MZ9 A;  4HJ8 A;  3TS0 A;  3PUX A;  4X6A H;  2CWP A;  4GN3 B;  5AJ3 Q;  1YI2 A;  4PG3 A;  2AWO A;  4R4Q A;  5GRO A;  4GKJ Q;  4P71 A;  1UE1 A;  3UDG A;  1IXR A;  1S72 A;  1UEB A;  3F2D A;  2IHE A;  2XTI A;  4YWL A;  1VQI A;  3GTJ H;  4HID A;  4LF7 Q;  1V1Q A;  3NEN A;  4DR4 L;  2E8G A;  1VQM A;  4DV6 Q;  1VQN A;  5GQO A;  2VNU D;  4A3D G;  5GAD C;  1CUK A;  3CCR A;  2D0O A;  2ZTC A;  3HKZ G;  3E9H A;  2LXK A;  2UUA Q;  1JJC B;  3JAM i;  2WB1 E;  4YWK A;  2BA0 A;  4DR6 L;  4JI1 Q;  4DUY L;  2R93 G;  2UXB Q;  1E24 A;  2ZTE A;  1JB7 A;  4P72 A;  1EIY B;  1VS0 A;  2GVA A;  2YTV A;  1Y1V H;  1VQJ A;  5LMU Q;  1UE7 A;  3AFP A;  5C44 G;  1EFW A;  3J7A 5;  3U4Z A;  3L2P A;  4A3J G;  3KDF B;  4JYA L;  3RR5 A;  5M5X H;  2VQE L;  2YU9 H;  2OQK A;  1E1T A;  1I5F A;  3RZO H;  3E9I A;  2GN5 A;  3PIP A;  4HJ7 A;  1A63 A;  4IO9 A;  4YY3 L;  4IJL A;  4R4I A;  4GLX A;  1X3G A;  2R6G A;  2UXD L;  2VY3 A;  2ATW A;  2I5H A;  3CD6 A;  5AJ3 L;  1VQ4 A;  4H02 A;  4LF6 Q;  1PH1 A;  1VQB A;  5HY6 A;  4L5S A;  4GKJ L;  4DV3 Q;  3S17 H;  4A3K H;  3GTG H;  1YVC A;  4DV1 Q;  1VQG A;  3FKI G;  2HIV A;  2UUB Q;  4LF7 L;  1MKH A;  2JEB I;  2JA5 G;  3CC2 A;  2N3S A;  3U4V A;  2IX0 A;  2PQA B;  3JC6 6;  4GNX A;  4DAM A;  1K0R A;  2ALY B;  2QEX A;  4DV6 L;  3B6Y A;  4A3L H;  1T9H A;  2KCM A;  1PH5 A;  1HNX Q;  1Q1E A;  2UUA L;  1K8G A;  2FXQ A;  1V9P A;  2NZO A;  3IRB A;  5C0X G;  3HOX H;  3S2D H;  1KXL A;  2Q2T A;  4B3M Q;  4DR4 Q;  4JI1 L;  2B3G A;  1HNZ L;  2HHH Q;  3KFU A;  1OXS C;  3ULJ A;  4X64 Q;  1TWA H;  4APV A;  5LMU L;  1JE5 A;  4A3F H;  4JI3 Q;  1JJ2 A;  4LNQ A;  1E7Z A;  3J81 j;  1EIF A;  1VQC A;  2UU9 Q;  4QIW E;  3CQZ H;  1N8R C;  2GVB A;  1XNR Q;  3G6E A;  4LFA Q;  2DUD A;  2PI2 A;  3K81 C;  5C4X H;  3S16 H;  2BA1 A;  5M5W H;  2ES2 A;  1KHI A;  4XIG S;  2ZJP A;  5GAE C;  1VQ6 A;  1KAW A;  5BR8 Q;  1PH3 A;  4LF5 Q;  2R92 H;  2B29 A;  1A8V A;  1IYJ B;  1VQA A;  3I4N G;  4KI0 A;  4LF6 L;  3HOZ H;  4R4C A;  1XMO Q;  1QUQ B;  4DV3 L;  4OWX B;  3DLL A;  4DV1 L;  1K8A C;  3HOV H;  3RLN A;  1OXT A;  3S1M H;  1VQE A;  1HZA A;  2UUB L;  5M3M G;  2OTL A;  1EQQ A;  2Z6K C;  3U58 A;  2YTY A;  2IHF A;  4QL5 A;  1PH7 A;  4KHP Q;  5JJI A;  1VQK A;  1VQ9 A;  1VQL A;  1VQ7 A;  2LSS A;  3HOW H;  1HNX L;  2E2H H;  1KRT A;  5IP9 H;  4AIM A;  2VQF Q;  2VUM H;  4NXN L;  3F2C A;  4L5T A;  4RG1 A;  3J80 c;  5FLM G;  4DR2 Q;  2N78 A;  1PH8 A;  1NE3 A;  1FJG Q;  4JBK A;  3PO3 H;  3S14 H;  3H3V H;  1PA6 A;  2D62 A;  1Q8K A;  4A3B H;  2CWA A;  5J3B A;  1XNQ Q;  4LUZ A;  1B8A A;  5FJ8 G;  1C0A A;  1E3P A;  2HHH L;  4DNI A;  4X64 L;  2AKW B;  4AYB G; 
#chains in the Genus database with same CATH topology
 2Z4H A;  3MTS A;  1YHA A;  2F0J A;  2JA7 H;  1EY4 A;  1JWU D;  4R4T A;  4RFB A;  1IYU A;  2B39 A;  4DFA A;  2CQO A;  5BR8 L;  4LF5 L;  1BBW A;  1XTD A;  2PYK A;  2QA4 A;  2L12 A;  4BXX H;  4NMZ A;  1SMY C;  3ERO A;  3A5U A;  1HUN A;  5M5Y B;  3CCQ A;  2JXM B;  3I55 A;  1K73 C;  1NY4 A;  1Q7Y C;  1PH2 A;  3PIO 3;  3LWE A;  2KHI A;  1L1O A;  2K14 A;  5T1G A;  2MFI A;  2BDO A;  1LT6 D;  2CCZ A;  4HSV A;  5KNB A;  4DR2 L;  2JA6 H;  5KRU A;  1OXV A;  1D1K A;  1HCZ A;  2KUM A;  1Y1V G;  3NEL A;  3D6C A;  1BBU A;  1TT2 A;  2RA4 A;  2WB1 G;  1XWE A;  2PW7 A;  3KUP A;  4ID6 A;  2F0L A;  2L0C A;  3L0O A;  2Y0S G;  1CA5 A;  1YJN A;  1AE2 A;  4HMJ A;  1E22 A;  2B63 H;  3VYT A;  4K2L A;  2PCF B;  3U50 C;  1PYB A;  4CKC A;  4OIJ A;  1ASY A;  2K4K A;  4JBJ A;  1JIC A;  3Q8D A;  1CHQ D;  1BUV T;  3AQQ A;  4PMC A;  1HNZ Q;  2PMZ E;  2IX1 A;  1KAB A;  1Y1V B;  1I3Q B;  3I3C A;  3AYH B;  5EPJ A;  3NQT A;  3M4O H;  2Y0S B;  3DWP A;  4ZYS A;  1SR3 A;  2I0Q A;  4POG A;  3MXN A;  2NVY H;  1LV9 A;  4XQQ A;  2HDL A;  3CRL C;  1IBK Q;  1SNQ A;  4DNT B;  5IYD H;  3I4O A;  5CBA E;  4PMW A;  4DK3 C;  2EYH A;  4XXE A;  2KOL A;  2K52 A;  1BDO A;  4GOP A;  1VCI A;  1E0B A;  5IP7 H;  1EY6 A;  1CFM A;  1NTG A;  4K5X A;  4TQU S;  1JMC A;  1STH A;  1SMX A;  2RSO A;  5DAU A;  3VR4 A;  2FIN B;  1KRS A;  1I94 Q;  1PRT D;  3F8T A;  1Z9F A;  3EA6 A;  1SE4 A;  2HIX A;  2K32 A;  1TY2 A;  2J4X A;  4H7B A;  2E2D C;  1LT3 D;  1AZP A;  2D0P A;  1HH2 P;  4EQO A;  5C0X I;  1TS4 A;  3S16 B;  4P73 A;  5IP9 G;  5M5W B;  4A3G B;  3EIV A;  2R92 B;  3CCS A;  2K50 A;  1IBK L;  5M3F G;  3MZ5 A;  1MHW C;  4QCL A;  3TS2 A;  1EYA A;  2A8V A;  4L5R C;  4I65 A;  4DR7 L;  1PZI D;  4AH6 A;  1HQR D;  1Y8O B;  1IYV A;  1K83 H;  3WOF A;  1X6O A;  5K5P A;  2DY8 A;  1PH6 A;  1C7Y A;  1IBL L;  1EIH A;  4A93 H;  1IW7 C;  5E1F A;  3BU2 A;  1U5K A;  2EXD A;  5COR A;  4DV2 L;  2PQE A;  4GLA C;  1X65 A;  1DXM A;  1I94 L;  2VL6 A;  3CW2 C;  1Q46 A;  4RHS A;  1R9T B;  4KTA A;  5I2X A;  2F4V Q;  1TS3 A;  3J7Y W;  3X3N A;  3J7Z C;  3H0G G;  3V05 A;  4OWT B;  1BNZ A;  1M1K C;  4LF4 Q;  3TRE A;  4I7A A;  1WTX A;  3JAM c;  4A76 A;  1B7Y B;  3W3A A;  4FF3 A;  4G7O C;  1A6X A;  4EGV A;  2EXZ A;  3SDZ A;  3S1Q B;  1EEF D;  3KLS X;  4LF9 Q;  4FDB A;  3NE5 B;  1DON A;  1FGU A;  2I5M X;  1PXU A;  1RCV D;  5M3M H;  4WJ4 A;  3H0G B;  3I70 A;  3GTM B;  3SGI A;  1YNN D;  2WII B;  4EQN A;  4MN3 A;  1W3S A;  2BCO A;  1SNP A;  2H5X A;  1G6Z A;  3PGZ A;  4B9W A;  4R8I A;  4BA1 I;  1ICF B;  4HCS A;  1L1O B;  2WAQ E;  2F3V A;  5FKA C;  3EJI A;  2EYJ A;  4KY6 A;  2RDH A;  1WCM B;  3PIP 3;  3WOE A;  1B44 D;  2KEC A;  2N88 A;  5DLQ E;  2JEA I;  5JPM C;  1WTV A;  4NP5 A;  3CKI B;  1FR3 A;  2E74 C;  2ICE C;  1N36 L;  1EQT A;  4A3L G;  1CK1 A;  2X69 A;  4LF9 L;  1X55 A;  3R3O A;  1HTP A;  3HOX G;  1FD7 D;  1BOS A;  1EQV A;  2LMC B;  3FMC A;  3KDF A;  1PTO H;  4GKK Q;  1PVO A;  2K28 A;  1SEB D;  3C1F A;  2F0P A;  2X6G A;  4BBR G;  4A3F G;  3OTO Q;  2CVR A;  2LKV A;  1EYD A;  2EIF A;  5A35 A;  1U4P A;  3A8K E;  4PZ7 A;  1JOQ A;  2K5W A;  1NCV A;  2E2I H;  2ICI A;  4A3D B;  2JK8 A;  1STG A;  5I9O A;  3HKZ B;  3T51 B;  3MXP A;  1TWC H;  1K8M A;  1Q86 C;  5HGT A;  4BBR B;  2YV5 A;  2UXC Q;  3OW2 A;  2AQ1 B;  1D5M C;  2R93 H;  3NSW A;  4LUO A;  4S3S A;  1KLU D;  1A2U A;  4WRD A;  2OT2 A;  2E2J B;  1B9N A;  3CU7 A;  5JPN C;  4GZY C;  3R2I A;  1HHV A;  2B8F A;  1LAB A;  4FF1 A;  1YHQ A;  4CJ2 C;  1A15 A;  3DEP A;  4UP7 A;  3PO3 G;  4GKK L;  2CW0 C;  4XT1 B;  1MGS A;  4LF8 Q;  3BVG A;  3AEV A;  2I46 A;  3GTQ H;  1EEI D;  1YNN C;  1TWG H;  3HG9 A;  3OTO L;  2YYZ A;  3FPU B;  2B2W A;  4X66 Q;  1QUQ A;  3FKI B;  4Y52 H;  4UPA A;  5FO7 B;  4KKS A;  1N9W A;  4X62 Q;  2JSO A;  4KJO A;  3DMU A;  1LTB D;  1VMC A;  1G29 1;  1SE8 A;  2QF7 A;  1QE6 A;  1TWF H;  4UHV A;  3ER0 A;  3SE0 A;  1U4L A;  1II3 A;  4Y7N H;  2Q2U A;  3QIA A;  4DA2 A;  4G57 A;  4QUC A;  1STN A;  4JC0 A;  1Y14 B;  5JVG 3;  2NVX H;  4K2K A;  2F0M A;  5J1Z A;  2ZM6 Q;  1LTA D;  4DUZ Q;  2RHS B;  1XPU A;  1PH4 A;  1DYQ A;  4LF8 L;  1KLG D;  4PZ8 A;  2PNR C;  4OO1 G;  5M3F H;  3I4N H;  2IT1 A;  1H9S A;  3D4D A;  4X66 L;  3Q6S A;  3HKS A;  1SRU A;  4WOR A;  4X3T A;  1VQ5 A;  2JE6 I;  4X62 L;  5BN3 A;  1TKW B;  1YIJ A;  4UAI A;  4IOA A;  1B4O A;  1CHP D;  5KGU A;  2CKZ B;  2F0N A;  4AYB E;  5IT9 c;  4DUY Q;  3C46 A;  4QMG A;  1PLF A;  3R8B A;  3G71 A;  4DK0 A;  1DOM A;  3S1R H;  4JK1 C;  4LFB Q;  4IAL A;  2ZM6 L;  4DUZ L;  1PHJ A;  2XVS A;  2Z1C A;  1DCZ A;  2CQA A;  2OWO A;  3J80 i;  3TS0 A;  2CWP A;  4GN3 B;  4JVZ A;  1ZEQ X;  4GKJ Q;  3M4Y A;  1UE1 A;  1IXR A;  1G91 A;  2IHE A;  2XTI A;  4YWL A;  4C3H G;  3VR3 A;  2PW5 A;  4IUN A;  2ZXR A;  1KNE A;  1I4R A;  2UUA Q;  2LXK A;  2FMC A;  1ENF A;  1JJC B;  4YIJ A;  2WKC A;  3JAM i;  4YWK A;  2BA0 A;  3V96 A;  4E6I A;  1SYE A;  4DUY L;  2QDB A;  2MJ8 A;  2UXB Q;  4ODG A;  1EY9 A;  5M5X B;  3KDF B;  2KCC A;  3RR5 A;  3RZO H;  2N55 A;  2YU9 H;  1E1T A;  3F2U A;  5CC4 A;  2GN5 A;  1JR0 D;  4IJL A;  1Z6H A;  2R6G A;  2VY3 A;  2QCP X;  2I5H A;  3NHH A;  1VQ4 A;  2PZT A;  1O78 A;  4GKJ L;  3S17 H;  4A3K H;  1SNC A;  5KNC A;  2JEB I;  2JA5 G;  1RD9 D;  2N3S A;  4A3E B;  3VYR A;  4DAM A;  1B50 A;  1K0R A;  3LNN A;  3T56 B;  4A3L H;  1PTO C;  3HRZ C;  1Q90 A;  1IHZ A;  2PZW A;  1HNX Q;  2UUA L;  3BDL A;  3S2D B;  2FXQ A;  3HOX H;  1LTG D;  5KYL A;  2B3G A;  5ISR A;  3URY A;  4APV A;  4A3F H;  2JA5 B;  1JJ2 A;  1E7Z A;  3J81 j;  1VQC A;  1CM9 A;  2Z8L A;  3MFG A;  3G6E A;  1V1O A;  2DUD A;  2PI2 A;  1KAW A;  2B2T C;  1I4X A;  4CBV A;  3HOZ B;  1DD2 A;  4MHE A;  4DNR B;  2F0G A;  5DM6 3;  4KI0 A;  1QUQ B;  3DWQ A;  1K8A C;  3DLL A;  3HOV H;  1VQE A;  1HZA A;  4HMI A;  5IOD A;  4K5W A;  1CZG A;  4RH6 A;  1YNJ C;  3U58 A;  5BN4 A;  5FO9 B;  2VB2 X;  2JN4 A;  2EPB A;  3HOW H;  1HNX L;  2X6L A;  2E2H H;  2F1M A;  3N52 A;  2VQF Q;  4L5T A;  3BYY B;  4RG1 A;  3NBH A;  3PO3 H;  1S5D D;  3H3V H;  1PA6 A;  2D62 A;  1Q8K A;  1C0A A;  2PZU A;  1SBB B;  4FNF A;  2Z6B A;  4AYB G;  4NXM Q;  1EQR A;  1F2L A;  2JA7 B;  2LXJ A;  4LK1 C;  1BR9 A;  2AUK A;  2FJ2 A;  2NBF A;  2ASB A;  2F0V A;  1V8Q A;  3EBE A;  3RLF A;  1H9S B;  1KDA A;  1NR4 A;  3AFQ A;  3HOY G;  3CCV A;  3PF4 A;  5FK9 C;  2YTX A;  2Q8T A;  3VA5 A;  4JI6 L;  1I4Q A;  4O0A A;  1VF5 C;  2JA6 B;  1XXG A;  2VQF L;  4DKA C;  1NMG A;  1RHP A;  3I91 A;  5HGQ A;  1N32 L;  2NVT H;  1GKH A;  4IFD J;  2EJM A;  4RAU C;  1L0X B;  4NXM L;  1HTL D;  1WTH A;  2B63 B;  1HNW Q;  2CH4 W;  4JI2 L;  3KJO A;  4K0K Q;  4DN4 M;  4EQ5 A;  3QOJ A;  4LFC Q;  4C2M H;  3D0F A;  1U9R A;  1F2M A;  3J7A V;  4BY7 H;  2TSS A;  3WDN A;  2Y0S E;  3MC0 B;  5JJL A;  3GTO H;  1QNK A;  2SNS A;  1FVI A;  2XNA C;  1D8L A;  1NBW A;  4DPG A;  1IL8 A;  1IKM A;  1BVS A;  4P75 A;  5CGK A;  1MBY A;  3G6J B;  3NTK A;  3RZD H;  2A69 C;  3TP5 A;  2K5D A;  5IYB G;  2KHJ A;  1CQV A;  1E2Z A;  2IY5 B;  1TII D;  4J1M A;  2R7Z H;  1Y1W H;  2WFW A;  4BY1 G;  4KN4 C;  2B2V C;  1TQO A;  4KKU A;  3OIP A;  1HNW L;  4YHH Q;  3PCO B;  4K0K L;  1ZYR C;  4KMU C;  1F77 A;  4LFC L;  4C3H H;  2A74 C;  4BS9 A;  1Q12 A;  4NXN Q;  2A5H A;  3HS0 C;  3S1N H;  3EN2 A;  1HQM C;  1ML0 D;  5KIX A;  3CP0 A;  4KLK A;  3TP8 A;  4IPC A;  4HJA A;  2OTJ A;  1BCP B;  5C4X B;  2F0Q A;  4RMF A;  2A19 A;  5ELE A;  3H09 A;  3VR6 A;  1OTC A;  1SLJ A;  3TQY A;  4HIO A;  4Z9C B;  1QNU A;  2O5I C;  3S1M B;  1EY0 A;  5EKL A;  1K83 B;  4YWM A;  2WKD A;  3MFY A;  1MJE A;  4YHH L;  3NTH A;  2HCC A;  3P7J A;  1SE3 A;  2L1B A;  2DN8 A;  2NN6 G;  3PO2 G;  3KLR A;  3CF5 A;  1T5E A;  2RCN A;  4GOP C;  4GNX C;  1EZ8 A;  2MO0 A;  4TRD A;  3AB9 A;  1DGS A;  1LUZ A;  1RL2 A;  3T1Y Q;  3TN2 A;  3NBH B;  3MXU A;  5A2Q L;  1SFO H;  2NVQ H;  2A6H D;  3HEJ A;  4IQZ A;  3PO2 B;  2KVM A;  5A2Q E;  2IJ0 A;  2BOS A;  1EOT A;  2EQS A;  5GAH C;  4OXP A;  3I4L A;  3HOU H;  2EY2 A;  1SE2 A;  2F0O A;  3OYY A;  2BDN A;  3A8J E;  3S15 H;  2BE5 D;  1M8A A;  1J8I A;  4DAY A;  3H3V C;  5CBE E;  2KEE A;  3J81 i;  4DV4 Q;  4XT3 B;  1A3T A;  4B08 A;  4IFD G;  3HFZ B;  2MPM A;  3N6R A;  1ICW A;  3BDO A;  3OMC A;  1D2B A;  4RHR A;  3U9S A;  3P1H A;  2EY5 A;  3LX0 A;  4JI5 L;  4XYQ A;  1VF7 A;  3T1Y L;  3W1B A;  4HCE A;  1EY7 A;  1XPO A;  4CDF C;  5IYC H;  1YJ9 A;  5D3D A;  1XPR A;  4DV5 Q;  4A3M H;  1XJV A;  1X3F A;  1RJT A;  5K36 G;  4LUV A;  4A3C H;  3TP6 A;  5EGT A;  2AHO B;  4G7Z C;  3HOY H;  5DEH A;  1EZ6 A;  1WTW A;  1TS2 A;  1SAP A;  1GUT A;  5E3F A;  4DR7 Q;  1TS5 A;  1O7I A;  4DV4 L;  4LAA A;  4JOI C;  4DR3 Q;  2V1C C;  1PZK D;  4N8F A;  1IBL Q;  4TSS A;  1LM0 A;  2N8N A;  4A3G G;  4FXK C;  5EBC A;  2RDG A;  2OEO A;  3HKZ E;  4ZQ3 A;  2R92 G;  1RTN A;  3OHX C;  2Z6K A;  2B8G A;  4DV2 Q;  2FFK B;  1EL0 A;  5CV6 A;  1W6K A;  3NK9 A;  3PSI A;  1I4G A;  4ZK9 B;  3OW7 A;  3K7U C;  4IPD A;  5TSS A;  1X54 A;  4UP8 A;  4DV5 L;  1WTO A;  3CMA A;  4IUP A;  3IL8 A;  1AH9 A;  1Q81 C;  2R93 B;  1AP0 A;  4C3I H;  1BO0 A;  3I4M G;  1S40 A;  1ROD A;  1K9M C;  2E5L Q;  5C44 H;  4A3J B;  3GTL H;  3BVM A;  1YBY A;  2KBN A;  2NTS A;  5C0X J;  4HJ5 A;  1YEZ A;  1X56 A;  3E3X A;  1BCP F;  5IYB H;  1QB5 D;  4IUU A;  3SK8 A;  4DR3 L;  1D1I A;  2HCI A;  3H3V I;  5IGD A;  1BXT A;  3I4M B;  4BY1 H;  5IGG A;  1O7L A;  5EBD A;  5JAV A;  3DM3 A;  1WTP A;  3TBI B;  5ELB A;  1QZH A;  3L7Z C;  1ZXT A;  5CYU A;  3BG3 A;  3KBG A;  3IFD A;  1GUS A;  1CI3 M;  4DGZ A;  1BF4 A;  2E5L L;  2F0F A;  2AQ3 B;  4NB3 A;  4CGY B;  5LL6 X;  1NNX A;  4IPH A;  4BBS H;  2F0W A;  1EYG A;  4KD4 A;  4MIU A;  1GD7 A;  4PZ6 A;  1PFB A;  4DR4 L;  4B3M L;  4A3I G;  1N36 Q;  3ICE A;  3OIQ A;  1KC8 C;  2XIW A;  3S2H B;  3M4P A;  3NWS A;  3AMU A;  3CC4 A;  1EUJ A;  4JBW A;  3E6Z X;  3CAM A;  1RKN A;  5C4H A;  1TY0 A;  1XNR L;  1WCM G;  1B3Q A;  2KJX A;  2OCE A;  5C6A A;  1SJH D;  4IUQ A;  1CT1 D;  1I6H H;  3NBI A;  2RCF A;  2LY7 A;  2KHS A;  4A3I B;  3PUZ A;  1PRT C;  5D14 A;  2OXP A;  1VQF A;  4JYA Q;  1C48 A;  2QGQ A;  4DAY B;  5M5Y H;  2F0D A;  5C4J B;  4YCU A;  4YY3 Q;  3M3Y B;  4QB4 A;  3PUX A;  4X6A H;  5T1I A;  1OO9 B;  1T5X D;  5AJ3 Q;  5GRO A;  1GHK A;  4X3K A;  1S72 A;  1UEB A;  2VB3 X;  4LJZ C;  3OWF A;  3NEN A;  4CJ1 B;  1QWY A;  4DV6 Q;  1ENA A;  4C3J B;  2J7Z A;  2LFN A;  3H6M A;  3K5L A;  4A3D G;  1CUK A;  1DOL A;  4MTK A;  2D0O A;  3HKZ G;  3E9H A;  2R3Z A;  1HUM A;  4JI1 Q;  1BCP D;  4P72 A;  3DXJ C;  1VS0 A;  5IGC A;  3D8G A;  2YTV A;  1Y1V H;  3CHB D;  1VQJ A;  5JJZ A;  1UE7 A;  3J7A 5;  3FDT A;  3U4Z A;  3L2P A;  4JYA L;  1UEA B;  2H4O A;  2G9H D;  3NPP A;  3VR2 A;  3H91 A;  3NQI A;  4YY3 L;  4R4I A;  1C4Q A;  2ATW A;  3CD6 A;  5AJ3 L;  4DF7 A;  4H02 A;  4LF6 Q;  4L5S A;  4DV3 Q;  1LTR D;  3GTG H;  1VQG A;  1SXT A;  3FKI G;  3CC2 A;  1F9R A;  5K36 H;  2DJF C;  2F0K A;  4X3U A;  2QEX A;  4DV6 L;  3B6Y A;  1PH5 A;  1B2T A;  1JQY D;  5C3E B;  3IRB A;  5C0X G;  2Q2T A;  3NXW A;  3K7A B;  4JI1 L;  1F2Z A;  4OHJ A;  2GA4 B;  1TWH B;  1JWM D;  4F7X A;  1OXS C;  2HHH Q;  3KFU A;  4JI3 Q;  2EY6 A;  4N9T A;  3W2D A;  3TZD A;  3NWT A;  3S16 H;  2C5C A;  5M5W H;  1VQ6 A;  2EY1 A;  3VYS A;  1EU3 A;  2R92 H;  3DUZ A;  2B29 A;  1VQA A;  4QIW B;  4LF6 L;  3HOV B;  4DV3 L;  1QOH A;  5FO8 B;  4CJ0 B;  3RLN A;  4PQX A;  2K5Q A;  2PO4 A;  3MAQ A;  2OTL A;  3MVV A;  2NWG A;  1UAP A;  2IHF A;  1I50 B;  4C1N K;  4KHP Q;  3T13 A;  5JJI A;  2RSN A;  4IUT A;  3L3O C;  1GJX A;  5CV7 A;  3SK5 A;  1VQ9 A;  1VQL A;  2E2H B;  5IP9 H;  4AIM A;  3F2C A;  2Q8I B;  5FLM G;  2JA8 B;  1PH8 A;  1NE3 A;  1B53 A;  2B2Y C;  4JBK A;  3S14 H;  3GTP B;  3SXH A;  2CWA A;  1XNQ Q;  5EKK A;  1B8A A;  5FJ8 G;  2HHH L;  2SOB A;  4JI3 L;  1R9T H;  4M1U B;  1EY5 A;  1JOR A;  1PYS B;  2KED A;  1YNX A;  1GO3 E;  1J5E Q;  3BVZ A;  1GM5 A;  3HGB A;  1HZB A;  4O2D A;  5LL6 S;  4OEL B;  4UY8 C;  2EYL A;  1STE A;  3P20 A;  4JI7 Q;  4NPS A;  2L9H A;  1NJI C;  3VDY A;  4L63 B;  4DXF A;  2IWH A;  5CMD A;  4KHP L;  1VQD A;  5CR3 A;  3MEF A;  3H0G H;  4ZCK A;  1I6V C;  1S5F D;  3GTM H;  3QG1 A;  1XYI A;  1LT5 D;  5JVH 3;  1A0I A;  3GTJ B;  3CPW A;  1XNQ L;  3ERS X;  5JEA J;  3A8I E;  3ITP A;  3Q23 A;  1H9M A;  4IOC A;  2QW7 A;  4YCV A;  4QGU A;  3C1E A;  3E0E A;  1JWS D;  2ZTD A;  1CSP A;  3A5Z B;  1J6Q A;  2D9U A;  1J5E L;  3K58 A;  4BY7 B;  1CA6 A;  4GS3 A;  5ELO A;  1WCM H;  1WOC A;  4R8N A;  4A4I A;  4ZLT F;  3BZD B;  3RN2 A;  1WYD A;  4WJ3 M;  3DEO A;  4A3E G;  1WFQ A;  4JI7 L;  4FYD A;  1N33 Q;  3TSS A;  4R1J A;  4UDU C;  1SYD A;  1H95 A;  1KDC A;  5IGE A;  2C35 B;  3EVQ A;  5COY A;  5C3X A;  1KAA A;  3RD4 A;  3PQI A;  3FRP B;  1Y1W B;  1NSN S;  1GVP A;  3M7G A;  3M9B A;  2NZ1 D;  1SRO A;  5DM7 3;  3G4S A;  5M9O A;  1XTC D;  4KHZ A;  1HFN A;  1WD0 A;  3HOZ G;  3S24 A;  2ENB A;  1CKO A;  1GXD C;  4A3D H;  1EYC A;  1CQF A;  3D31 A;  3NUC A;  4BBR H;  1YZ6 A;  4I7Z C;  3J80 L;  3MXG A;  4N8X 1;  3J80 E;  4CHT B;  1N33 L;  2E2J H;  1L0W A;  2VUM G;  5EPL A;  4HSP A;  1ET6 A;  3J7A F;  2C9O A;  2BH2 A;  1K3R A;  1Y8P B;  2HUG A;  2PI2 E;  1A2T A;  4RWS C;  2O5J C;  2DJG C;  3C3L A;  2A6E D;  3ND8 A;  1FL0 A;  2ID0 A;  2JA7 G;  2XSC A;  4JI6 Q;  3HZX A;  3ERQ A;  2F0I A;  1CKM A;  2K6A A;  3A7L A;  1IZ6 A;  1LTL A;  2VUM B;  1D7Q A;  4BXX G;  3STB D;  5IY0 A;  1S3O A;  1N32 Q;  4A3B B;  3FP9 A;  2WP8 J;  1X3Q A;  3ONA B;  3F2B A;  1WTR A;  1X3E A;  1TU2 B;  4R4O A;  4NDX A;  5E4W C;  3BZC A;  4JI0 Q;  2IX3 A;  1MI2 A;  1U4M A;  4JI2 Q;  1E1O A;  1NR2 A;  3GO5 A;  3Q0A A;  3KOJ A;  5E7N A;  2JA6 G;  1JT8 A;  1E2W A;  5H1S E;  1HA5 A;  3TZU A;  4DAV A;  1JOO A;  4HIK A;  3I56 A;  5IGB A;  4NW2 A;  3QO2 A;  3H15 A;  3GDE A;  1MJC A;  1P8L A;  2B63 G;  1LT4 D;  1SND A;  3S15 B;  5ELD A;  5HUR A;  2E76 C;  5EJW A;  3K59 A;  2H1E A;  3CCM A;  3G7L A;  1TVX A;  1RTO A;  2O4X A;  4OO1 H;  4JI0 L;  5JEA G;  5IIF A;  4IUV A;  5KYI A;  5DNF A;  4RGO S;  1JE4 A;  2K1B A;  5C5M A;  4JCV E;  5EAY A;  3CPF A;  1PFN A;  4DV0 L;  1I4P A;  2WIN B;  2KCT A;  3NEM A;  1F9S A;  4OL7 A;  3LGJ A;  5KND A;  4JI4 L;  1KTK A;  4PMB A;  1G51 A;  3KK7 A;  3M4O B;  5IP7 G;  2CFM A;  4IUR A;  3DM1 A;  3QB3 A;  2NVY B;  1HR0 Q;  3UDF A;  2B2U A;  3QOL A;  2JYO A;  2RF4 A;  3LWU A;  5I9P A;  1OXU A;  2D2C C;  3I72 A;  1G2S A;  1STB A;  1QIL A;  2EYF A;  3CCE A;  1Q82 C;  4KJN A;  2N49 A;  2B2T A;  2A68 D;  2DY7 A;  2HQL A;  1HFG A;  3OOC A;  3FHW A;  3STB C;  1QVC A;  4X65 Q;  3TEH B;  5C4X G;  1NMF A;  2KA7 A;  2F3I A;  2HD3 A;  2K7V A;  3TRZ A;  4NKL A;  3BS1 A;  1L1O C;  2PQA A;  3IKJ A;  4DK6 C;  2LS0 1;  2HT1 A;  4QJF A;  4G7H C;  1SMY D;  1H9K A;  5J39 A;  1PFS A;  4EX5 A;  4JG2 A;  3CCU A;  1KNA A;  5AFW A;  4C3I B;  4A93 G;  1KL9 A;  3Q22 A;  3M4Q A;  4DK1 A;  1HR0 L;  1ESF A;  4KKT A;  4ZRZ A;  3VR5 A;  5FLX L;  4A3E H;  3GTL B;  3K5N A;  1IL2 A;  1ILP A;  3KYH C;  5FLX E;  2R7F A;  4HTH A;  1NAP A;  1K28 A;  2ZJQ A;  1W6J A;  1C8C A;  2QKI C;  5KEE A;  4XTC S;  3E0J A;  2RQX A;  4X65 L;  4KY7 A;  4IN3 A;  1WTQ A;  4A93 B;  3OSO A;  2TMP A;  2JA5 H;  2L15 A;  1BQQ T;  5D65 A;  1LAC A;  3PV0 A;  1C9O A;  1UWV A;  3MHB A;  5GAG C;  4OX9 Q;  2G9D A;  1M90 C;  2OF1 A;  4H0L C;  1JOK A;  4AQY Q;  1SNO A;  3SK6 A;  4KD3 A;  1XMQ Q;  2EYM A;  3CRK C;  4MTN A;  5CV5 A;  1ESR A;  4JI5 Q;  2R61 A;  3CCJ A;  4FVM A;  1QJO A;  4J6H A;  3T4A C;  2QIL A;  1GOZ A;  2MQH A;  3M7N A;  2ZT9 C;  3I2Z A;  4K5V A;  1SN8 A;  2A68 C;  5M3M B;  3A0J A;  1K8O A;  5C4Z A;  1CKN A;  1XX8 A;  4HJ9 A;  4F87 A;  4ZAI A;  4TKO B;  4OX9 L;  2EE1 A;  1I6H B;  3ULL A;  4AQY L;  4CKB A;  3PUV A;  1U0L A;  1XMQ L;  2KEN A;  3ULP A;  4J8Q A;  4IPG A;  4A75 A;  3GTK H;  4RGM A;  3BZK A;  4ABN A;  2ZJR A;  1X9N A;  2Q2I A;  4P74 A;  1PFM A;  2B2V A;  5L37 A;  1AFP A;  2SEB D;  3NTI A;  1Y69 U;  3A56 A;  2UXD Q;  4ULL A;  1GUW A;  3A54 A;  3Q24 A;  4HJ8 A;  1YI2 A;  4PG3 A;  4RGT A;  2CH4 A;  4OEM B;  4L8J A;  4EQP A;  1SNM A;  5I6Y A;  1IW7 D;  3F2D A;  4KV6 A;  1V1Q A;  1X3P A;  4K6L A;  1VQM A;  5ELC A;  1VQN A;  2L11 A;  1PTO B;  1K0S A;  2XRQ D;  5GAD C;  4CDC C;  2K05 A;  1H9R A;  2R93 G;  1JB7 A;  2ZTE A;  1EIY B;  2GVA A;  2WB1 B;  5LMU Q;  1SYB A;  4A3J G;  4R9W A;  2E2I B;  2OQK A;  4RKL A;  5JEA H;  1A63 A;  4HJ7 A;  4GLX A;  3IAY A;  2UXD L;  1O7Y A;  1NUC A;  1TWC B;  3HP3 A;  2K33 A;  3GTG B;  2F0H A;  5HY6 A;  1PH1 A;  1RF2 D;  3PMF A;  1MSH A;  5IOC A;  1YVC A;  3S9W A;  1LTT D;  2A6H C;  3UI2 A;  2UUB Q;  3K5O A;  1FNW A;  3U4V A;  2IX0 A;  2PQA B;  4GNX A;  3J81 L;  1D5X C;  2ALY B;  1I4H A;  2KCM A;  1JC7 A;  3J81 E;  1Q1E A;  3GTQ B;  2BE5 C;  1S5E D;  1TWG B;  1KXL A;  4DR4 Q;  4B3M Q;  4KN7 C;  1HNZ L;  1EU4 A;  4X64 Q;  3K57 A;  1TWA H;  5LMU L;  4LNQ A;  4K8J A;  1EIF A;  2UU9 Q;  4QIW E;  3CQZ H;  2GVB A;  1XNR Q;  4LFA Q;  3K81 C;  5C4X H;  2BA1 A;  3VA7 A;  1KHI A;  2ZJP A;  5GAE C;  1PH3 A;  1TWF B;  3I4N G;  3KF8 A;  4WFN 3;  1XMO Q;  4Y7N B;  4K6D A;  1M4V A;  3S1M H;  4RA8 A;  2AUJ D;  2UUB L;  2NVX B;  5I6W A;  1PH7 A;  1ONL A;  2RBM A;  1HRJ A;  1VQK A;  1ILQ A;  1PDQ A;  2EJG C;  1VQ7 A;  2LSS A;  2P5Z X;  1S4Z A;  4BWG B;  3EQL C;  3J80 c;  2HDM A;  1FJG Q;  3S14 B;  5M3F B;  3I4N B;  5J3B A;  1R4Q B;  4LUZ A;  1WD1 A;  4LMQ D;  1E3P A;  1EWH A;  1TR5 A;  2IW3 A;  4DNI A;  3O13 A;  4XQN A;  4X64 L;  2AKW B;  1KQS A;  1AW7 A;  4FP5 D;  4GLV B;  2Z0S A;  4XQJ A;  2UU9 L;  1ZKO A;  4OO1 I;  3P75 A;  4LFA L;  4JI8 Q;  3GQB A;  4POF A;  2F0S A;  3K0X A;  4CDE C;  1UUP A;  2RDF A;  1Y8N B;  2B2W C;  1LYL A;  1XMO L;  1SYG A;  2XWB B;  4B3T Q;  2NN6 H;  3PO2 H;  3UDX A;  2WV6 D;  3S1R B;  1CKN B;  3K5M A;  3NP8 A;  4C3J G;  4BA2 I;  4JOI A;  3KF6 A;  2CW0 D;  1AN8 A;  4H13 C;  1SYF A;  4J15 A;  4GN5 A;  5ELF A;  2MGS A;  2EZV A;  1P16 A;  1FJG L;  1S5B D;  2K03 A;  3D4W A;  3MEH A;  1SSO A;  5F2D A;  2HQE A;  1CTM A;  1D5Z C;  1R4P B;  1F9Q A;  5EPK A;  2F4V L;  2ZXP A;  1YJW A;  3M85 A;  1WJJ A;  1DJR D;  1O80 A;  3OWE B;  4JI8 L;  1CSQ A;  2FMM A;  4LF4 L;  2QDL A;  4A3K G;  4P2C B;  3BYT B;  1PYW D;  4OGQ C;  1KIX A;  3G48 A;  4B3T L;  5IWA Q;  5JOB A;  5IE8 A;  1H9J A;  2V4D A;  1PTO F;  2EYP A;  1I3Q H;  1VQ8 A;  3RLO A;  3RZO B;  1UNS A;  3A74 A;  2YU9 B;  4C1N I;  3T1H Q;  2PMZ B;  4IFD H;  1G2T A;  2VS1 A;  3SVM A;  1A62 A;  5C3E G;  2RKS A;  4G4K A;  3S17 B;  4A3K B;  4F88 A;  2MUY A;  1MIU A;  4JV5 Q;  1Q3L A;  2F0U A;  4FXD A;  3MXN B;  3UE0 A;  1SJE D;  1WI5 A;  2M9V A;  4QUF A;  3TDQ A;  3TME A;  4V0B A;  2CHB D;  1D6E C;  1F9P A;  4N9P A;  4MNO A;  4Q0F A;  3HOX B;  3KLS A;  1UE6 A;  3HOV G;  4WJW A;  3SEB A;  1STA A;  1B1Z A;  4KK7 A;  4U68 A;  5IWA L;  4GOP B;  4GNX B;  4A3F B;  4JBM A;  5CV8 A;  1LTI D;  3GV3 A;  3D4R A;  2IL8 A;  3T1H L;  4B3S Q;  3HOW G;  1AE3 A;  2DNE A;  3SK4 A;  1Z47 A;  4A3G H;  1TXY A;  2UUC Q;  4A3J H;  2JA8 G;  3EFX D;  3KJP A;  3I90 A;  3I8Z A;  4IJH A;  1W2B A;  5J22 A;  4Q5V A;  4JV5 L;  3UE1 A;  2Q2H A;  4V19 0;  2JQO A;  2AMC B;  2F4I A;  2MNA A;  2VXW A;  2XRS D;  4L5Q A;  5C5L A;  4DXG A;  1AZQ A;  2G5D A;  2O2L D;  1GHJ A;  4ZUJ A;  3HOW B;  1PV4 A;  1N34 Q;  3I4M H;  2VNU D;  2RHQ B;  2K75 A;  3K8A A;  3KF8 B;  3QWN A;  1K3B C;  1U4R A;  1KDB A;  3PO3 B;  3DWA A;  3CXC A;  3RNU A;  1A3V A;  4HAE A;  1QVG A;  4QQB X;  4O1N A;  5FLX c;  1B70 B;  1L0Y B;  2UXC L;  3FPP A;  2AWN A;  3RMH A;  1HZC A;  1BCP C;  1V1P A;  4B3S L;  2XGT A;  1E2V A;  2UUC L;  1GUG A;  3V2T A;  3E5S A;  1FGB D;  4ZKB B;  2WAC A;  1Z7T A;  1L2F A;  1MSG A;  2OQ0 A;  4M8A A;  1LTS D;  1PTO D;  1IKL A;  1VQO A;  1VMP A;  2F03 A;  2K5H A;  3S1Q H;  3S2H H;  1VQH A;  2SNM A;  4QY7 A;  3BJU A;  3R93 A;  4JW0 A;  1ASZ A;  4BY7 G;  1N34 L;  2MHV A;  4XYO A;  1HZ9 A;  1UE5 A;  2WAQ G;  1VQP A;  4ME3 A;  2NVT B;  5NUC A;  2NYZ D;  3KF6 B;  2SDF A;  4A3I H;  2EOT A;  4LWC A;  3AU7 A;  1PZJ D;  5EKI A;  4C2M B;  2L55 A;  4OON A;  2EVB A;  5LMN W;  2NTT A;  3T16 A;  3W1G A;  2VZA A;  5C4J H;  3ND9 A;  4DR1 Q;  3RUZ A;  3GTO B;  2WAQ B;  3M3Y H;  2R7Z G;  1Y1W G;  1A3U A;  4JPB W;  1YNJ D;  1G6P A;  2J0T D;  2NUC A;  5IGF A;  4ALP A;  2JA9 A;  4YCW A;  4UP9 A;  4DR5 Q;  1B9M A;  4B9X A;  4GN4 B;  2BH8 A;  3PIO A;  2XN9 C;  3RZD B;  4C3J H;  2A1A A;  3W5O A;  3D6W A;  4PNY A;  1BBX C;  3GP7 A;  1SDF A;  3ZJY C;  1QVF A;  2R7D A;  5ELN A;  2JJQ A;  5E4X A;  2R7Z B;  4HIM A;  3TP7 A;  1ET9 A;  1HXY D;  1LO5 D;  1HJP A;  3KLW A;  3MA2 B;  5G3L F;  4TVA B;  1EWC A;  1DZ1 A;  3FEW X;  4C3H B;  4LFB L;  1PH9 A;  1OXX K;  1JJG A;  1G8Z D;  3S1N B;  3U9O A;  2Z4I A;  3PF5 A;  1EY8 A;  3X3M A;  4DR1 L;  3GD7 A;  1B3A A;  5D3I B;  4XDX A;  2EYO A;  1RIP A;  2B2Y A;  4PV1 C;  1EOV A;  2PNH A;  4DR5 L;  4OIK A;  2K5V A;  3BDC A;  3OMG A;  3K0Y A;  1HR0 W;  5EQ0 A;  3WWV A;  2F0E A;  4C56 C;  2NZH A;  2F52 A;  4A3B G;  1F2Y A;  1GUN A;  5C3E H;  3PUW A;  1IBM Q;  4FXG C;  3K7A H;  2B2U C;  2K04 A;  2UXB L;  1KD1 C;  1VDZ A;  1TWH H;  3JAM L;  3FKI H;  2NB0 A;  4ME5 A;  2F3W A;  3JAM E;  3C2P A;  3GV6 A;  4KHV A;  4HED A;  1ENC A;  4OWW B;  1FNU A;  3KBX A;  2PPB C;  4DU9 A;  3J81 c;  1PMR A;  3HOU G;  5C0X H;  4B3R Q;  3T53 B;  4X3S A;  1FYC A;  1PRT B;  3DHQ A;  3CME A;  4K8I A;  2NN6 I;  1Q1B A;  3UDI A;  1YHB A;  5LMN Q;  4DV7 Q;  2A69 D;  4CKE A;  1I50 H;  2DGY A;  4DV0 Q;  1SFO B;  2NVQ B;  2K5N A;  1YIT A;  2QEJ C;  4JI4 Q;  3MWY W;  1DM0 B;  2VW9 A;  1EWI A;  2JA8 H;  3CCL A;  1HA6 A;  1IBM L;  4LW1 A;  3CC7 A;  3GTP H;  3HOU B;  1V1P B;  1AEX A;  2MO1 A;  1ZYR D;  1SYC A;  2KQ3 A;  2E75 C;  1J9O A;  2FHT A;  4EVO A;  3QJY A;  3K80 C;  2DNC A;  5IYC G;  2JP1 A;  2M2L A;  2I5L X;  1V43 A;  2XWJ B;  4A3M G;  3F1Z A;  1JB3 A;  1HPC A;  4DR6 Q;  1QZG A;  4A3C G;  5LHY 1;  5FLM H;  2Q8R E;  2EJF C;  4FO2 A;  3RN5 A;  1GUO A;  3FVQ A;  3I73 A;  3L9A X;  3I7F A;  4B3R L;  3ZYY X;  3GTK B;  4H44 C;  5G3L D;  1BKB A;  5FJ8 H;  1WVL A;  4AYB B;  4ZKC B;  5LMN L;  4DV7 L;  2VQE Q;  5C3W A;  5IYD G;  3PUY A;  2L4N A;  4IFD I;  4MZ9 A;  2EDG A;  4DAP A;  4RCO A;  4A3M B;  2AWO A;  4R4Q A;  4P71 A;  1RDP D;  3UDG A;  2K01 A;  4L6T B;  1VQI A;  3GTJ H;  4F8M A;  4HID A;  2I07 B;  4LF7 Q;  3HOY B;  2E8G A;  2A6E C;  1QG7 A;  2RVL A;  5GQO A;  2F0T A;  3CCR A;  2ZTC A;  2WB1 E;  4QF4 A;  5CV9 A;  4DR6 L;  2D5D A;  2AQ2 B;  4C3I G;  4RGN A;  4FF2 A;  1E24 A;  3QR8 A;  3A7A B;  5C44 G;  3AFP A;  1EIG A;  1EFW A;  5M5X H;  2VQE L;  1I5F A;  3E9I A;  3PIP A;  4IO9 A;  1X3G A;  1LLR D;  4U67 3;  5JJK A;  1DOK A;  1VQB A;  4RCN A;  4DV1 Q;  3IFT A;  4RKB A;  2HIV A;  4LF7 L;  1MKH A;  1S5C D;  3JC6 6;  4K14 A;  1EFI D;  5FOB B;  5C44 B;  1T9H A;  4KY5 A;  4HR7 B;  1K8G A;  1X32 A;  1STY A;  4O42 A;  1V9P A;  2NZO A;  3S2D H;  3VYU A;  3OPO A;  2IPK D;  1TWA B;  3ULJ A;  1Q8I A;  2M00 A;  5CV4 A;  1JE5 A;  1JCK B;  3SHL A;  3CQZ B;  4BY1 B;  1O7Z A;  1N8R C;  1QCB D;  4CDD C;  4BBS G;  1FNV A;  1CZW A;  2ES2 A;  4XIG S;  3K6O A;  5BR8 Q;  4LF5 Q;  1A8V A;  1IYJ B;  3HOZ H;  4R4C A;  3D3R A;  4OWX B;  4DV1 L;  3A55 A;  1OXT A;  2KCN A;  4ILW A;  4ZUI A;  5M3M G;  4IZ8 A;  4HN7 A;  1EQQ A;  2Z6K C;  3SR1 A;  2YTY A;  5IT9 L;  2ZXO A;  4QL5 A;  2A73 B;  2L5T A;  5IT9 E;  1MD2 D;  4FF4 A;  4BBS B;  3H94 A;  1KRT A;  5I2Y A;  2VUM H;  4NXN L;  4DR2 Q;  2N78 A;  5BN5 A;  1PRT F;  2MP1 A;  2Z9H A;  5I4D A;  4A3B H;  3R2T A; 
#chains in the Genus database with same CATH homology
 1R9T H;  4JI3 L;  1EQR A;  1YHA A;  2LXJ A;  2Z0S A;  1PYS B;  4GLV B;  2UU9 L;  4OO1 I;  2JA7 H;  1YNX A;  1GO3 E;  4LFA L;  4JI8 Q;  4R4T A;  2ASB A;  4POF A;  1J5E Q;  3K0X A;  2CQO A;  5BR8 L;  4LF5 L;  1GM5 A;  1BBW A;  1XTD A;  3EBE A;  3RLF A;  2QA4 A;  4BXX H;  1LYL A;  1XMO L;  1HZB A;  4O2D A;  4B3T Q;  3PO2 H;  4UY8 C;  3I4M H;  3UDX A;  3AFQ A;  3HOY G;  1CKN B;  3A5U A;  3CCV A;  3PF4 A;  4JI7 Q;  4NPS A;  4BA2 I;  1NJI C;  2YTX A;  4JOI A;  3CCQ A;  3VDY A;  3KF6 A;  4KHP L;  4J15 A;  1VQD A;  3I55 A;  1K73 C;  4JI6 L;  1NY4 A;  1Q7Y C;  4O0A A;  1PH2 A;  4GN5 A;  3MEF A;  2KHI A;  2VQF L;  1L1O A;  2K14 A;  1NMG A;  2MFI A;  3H0G H;  4DKA C;  2CCZ A;  2JA6 H;  4DR2 L;  1P16 A;  1FJG L;  3GTM H;  5HGQ A;  1OXV A;  1N32 L;  1A0I A;  1Y1V G;  3NEL A;  2NVT H;  1GKH A;  1BBU A;  3CPW A;  2WB1 G;  1XNQ L;  4IFD J;  3ERS X;  5JEA J;  3L0O A;  2Y0S G;  4IOC A;  4NXM L;  4YCV A;  1YJN A;  1HNW Q;  4QGU A;  1AE2 A;  3E0E A;  2F4V L;  4JI2 L;  1E22 A;  2B63 H;  3KJO A;  3M85 A;  1YJW A;  1WJJ A;  4K0K Q;  4EQ5 A;  2ZTD A;  4LFC Q;  1CSP A;  3A5Z B;  1J6Q A;  4JI8 L;  4C2M H;  3U50 C;  1J5E L;  1PYB A;  1CSQ A;  3D0F A;  4LF4 L;  4A3K G;  4GS3 A;  1ASY A;  4BY7 H;  5ELO A;  1WCM H;  2K4K A;  1WOC A;  2Y0S E;  4JBJ A;  4A4I A;  1KIX A;  5JJL A;  3Q8D A;  3AQQ A;  3GTO H;  1HNZ Q;  2IX1 A;  2PMZ E;  1FVI A;  3G48 A;  5IWA Q;  1WYD A;  3RN2 A;  5IE8 A;  4B3T L;  4WJ3 M;  4A3E G;  1VQ8 A;  1I3Q H;  1WFQ A;  3AYH B;  1D8L A;  1NBW A;  3RLO A;  4JI7 L;  3M4O H;  3A74 A;  1SR3 A;  4DPG A;  2I0Q A;  3T1H Q;  4POG A;  2NVY H;  1N33 Q;  1BVS A;  4P75 A;  4NXM Q;  2VS1 A;  4R1J A;  1H95 A;  1A62 A;  5C3E G;  2C35 B;  3RZD H;  1IBK Q;  5IYD H;  5IYB G;  3I4O A;  2KHJ A;  1MIU A;  4PMW A;  4DK3 C;  4JV5 Q;  2IY5 B;  3M9B A;  1GVP A;  2R7Z H;  1Y1W H;  2WFW A;  2K52 A;  1SRO A;  3MXN B;  3UE0 A;  3G4S A;  4BY1 G;  4GOP A;  1VCI A;  1WI5 A;  1HNW L;  5IP7 H;  4YHH Q;  4KHZ A;  1NTG A;  3PCO B;  4K0K L;  4TQU S;  4MNO A;  4LFC L;  4C3H H;  1JMC A;  1Q12 A;  3HOZ G;  1SMX A;  4NXN Q;  1UE6 A;  3S1N H;  3HOV G;  3S24 A;  1CKO A;  3EN2 A;  4A3D H;  1KRS A;  1I94 Q;  3F8T A;  1Z9F A;  3D31 A;  2HIX A;  5IWA L;  4GOP B;  4GNX B;  3CP0 A;  4KLK A;  4JBM A;  4BBR H;  1YZ6 A;  2D0P A;  4IPC A;  4HJA A;  2OTJ A;  1HH2 P;  5C0X I;  3HOW G;  3T1H L;  4B3S Q;  4RMF A;  1AE3 A;  2A19 A;  4P73 A;  5IP9 G;  1N33 L;  2E2J H;  1L0W A;  1Z47 A;  2VUM G;  4A3G H;  1TXY A;  2UUC Q;  3EIV A;  3CCS A;  4A3J H;  2K50 A;  1IBK L;  5M3F G;  2JA8 G;  3KJP A;  1SLJ A;  3TQY A;  1OTC A;  4HIO A;  2BH2 A;  3TS2 A;  1K3R A;  2A8V A;  2PI2 E;  4IJH A;  1W2B A;  4L5R C;  4DR7 L;  4JV5 L;  3UE1 A;  2Q2H A;  2JQO A;  4AH6 A;  1FL0 A;  2AMC B;  1K83 H;  2ID0 A;  2MNA A;  4YWM A;  2JA7 G;  1X6O A;  4L5Q A;  1PH6 A;  1MJE A;  1C7Y A;  1IBL L;  4A93 H;  4YHH L;  4JI6 Q;  1CKM A;  1PV4 A;  3BU2 A;  1N34 Q;  1IZ6 A;  1LTL A;  1U5K A;  2EXD A;  2K75 A;  2RHQ B;  3K8A A;  3KF8 B;  4DV2 L;  1D7Q A;  4BXX G;  3STB D;  5IY0 A;  4GLA C;  1X65 A;  1S3O A;  2NN6 G;  3PO2 G;  3FP9 A;  2WP8 J;  3CXC A;  3CF5 A;  3RNU A;  1QVG A;  1I94 L;  4QQB X;  2RCN A;  2VL6 A;  1Q46 A;  3CW2 C;  3F2B A;  1X3E A;  5FLX c;  4R4O A;  4GOP C;  4GNX C;  1B70 B;  3BZC A;  2UXC L;  2MO0 A;  2AWN A;  4JI0 Q;  1DGS A;  1HZC A;  2F4V Q;  4JI2 Q;  4B3S L;  1E1O A;  1LUZ A;  2XGT A;  3GO5 A;  3J7Z C;  3H0G G;  3KOJ A;  5E7N A;  1RL2 A;  2JA6 G;  2UUC L;  1JT8 A;  4OWT B;  3T1Y Q;  5H1S E;  3NBH B;  1M1K C;  4LF4 Q;  3TRE A;  1SFO H;  2NVQ H;  4HIK A;  3JAM c;  4A76 A;  1B7Y B;  1L2F A;  3I56 A;  2OQ0 A;  3H15 A;  3GDE A;  5JJK A;  1MJC A;  2EQS A;  1P8L A;  4OXP A;  5GAH C;  2B63 G;  3HOU H;  1VQO A;  4LF9 Q;  4FDB A;  3S2H H;  2K5H A;  3S1Q H;  1FGU A;  1VQH A;  2I5M X;  5M3M H;  4QY7 A;  3BJU A;  3OYY A;  4WJ4 A;  1ASZ A;  4BY7 G;  1N34 L;  3S15 H;  1HZ9 A;  3SGI A;  1UE5 A;  2WAQ G;  1VQP A;  4ME3 A;  3J81 i;  1W3S A;  3CCM A;  4DV4 Q;  2H5X A;  3PGZ A;  3KF6 B;  4IFD G;  4A3I H;  4JI0 L;  3HFZ B;  4BA1 I;  4LWC A;  5JEA G;  1L1O B;  2WAQ E;  4JI5 L;  4OON A;  4JCV E;  5EAY A;  3CPF A;  5LMN W;  3T1Y L;  3W1B A;  3W1G A;  4DV0 L;  1XPO A;  2VZA A;  5DLQ E;  5IYC H;  5C4J H;  2KCT A;  4DR1 Q;  3NEM A;  2JEA I;  3LGJ A;  1YJ9 A;  2R7Z G;  3M3Y H;  1Y1W G;  4JI4 L;  1XPR A;  1G51 A;  4DV5 Q;  4A3M H;  1XJV A;  1X3F A;  1G6P A;  5K36 G;  4LUV A;  5IP7 G;  1N36 L;  2CFM A;  4ALP A;  2JA9 A;  4A3L G;  4YCW A;  4UP9 A;  4A3C H;  4DR5 Q;  1HR0 Q;  3UDF A;  4LF9 L;  2RF4 A;  4GN4 B;  1OXU A;  1X55 A;  1KQS A;  2AHO B;  2BH8 A;  3PIO A;  3HOY H;  4C3J H;  3HOX G;  2A1A A;  3KDF A;  1PVO A;  3W5O A;  4GKK Q;  3CCE A;  3ZJY C;  1Q82 C;  1QVF A;  2R7D A;  2N49 A;  5ELN A;  4DR7 Q;  2JJQ A;  4BBR G;  1O7I A;  4DV4 L;  4HIM A;  2HQL A;  4A3F G;  3OTO Q;  3FHW A;  3STB C;  1HJP A;  4JOI C;  4DR3 Q;  1QVC A;  2V1C C;  3KLW A;  3TEH B;  4X65 Q;  1IBL Q;  4TVA B;  5C4X G;  1LM0 A;  2EIF A;  1NMF A;  2N8N A;  2F3I A;  4A3G G;  3TRZ A;  4PZ7 A;  3HKZ E;  1L1O C;  4LFB L;  2R92 G;  2PQA A;  1OXX K;  1PH9 A;  1JJG A;  2Z6K A;  4DV2 Q;  2E2I H;  4DK6 C;  3PF5 A;  2JK8 A;  2HT1 A;  3PSI A;  4QJF A;  4DR1 L;  3GD7 A;  3K7U C;  4IPD A;  1TWC H;  1X54 A;  1PFS A;  4UP8 A;  1Q86 C;  4DV5 L;  2YV5 A;  4EX5 A;  4JG2 A;  1RIP A;  3CMA A;  3CCU A;  1AH9 A;  1Q81 C;  4A93 G;  2UXC Q;  3OW2 A;  1KL9 A;  1EOV A;  2PNH A;  4C3I H;  3M4Q A;  4LUO A;  4DR5 L;  1HR0 L;  2R93 H;  2K5V A;  3I4M G;  1S40 A;  1K9M C;  4A3E H;  2E5L Q;  1HR0 W;  1IL2 A;  5C44 H;  3GTL H;  3KYH C;  1YHQ A;  1YBY A;  3WWV A;  2KBN A;  2R7F A;  4UP7 A;  3PO3 G;  5C0X J;  4GKK L;  2NZH A;  2F52 A;  4A3B G;  4HJ5 A;  4LF8 Q;  1YEZ A;  2ZJQ A;  3AEV A;  5C3E H;  1X56 A;  3PUW A;  3GTQ H;  5IYB H;  1IBM Q;  1TWG H;  3OTO L;  2YYZ A;  3K7A H;  4XTC S;  2UXB L;  4DR3 L;  4X65 L;  4X66 Q;  1QUQ A;  1KD1 C;  1TWH H;  3H3V I;  3FKI H;  4Y52 H;  4UPA A;  2JA5 H;  2L15 A;  4BY1 H;  3PV0 A;  1N9W A;  4X62 Q;  1C9O A;  3DM3 A;  1UWV A;  4OWW B;  1QZH A;  1G29 1;  5GAG C;  4OX9 Q;  3L7Z C;  1M90 C;  3J81 c;  1SE8 A;  1TWF H;  3ER0 A;  3HOU G;  4AQY Q;  4Y7N H;  2Q2U A;  4B3R Q;  1XMQ Q;  4MTN A;  4JC0 A;  1Y14 B;  3CME A;  5LMN Q;  2NN6 I;  1Q1B A;  3UDI A;  1YHB A;  4DV7 Q;  2NVX H;  4JI5 Q;  2ZM6 Q;  2E5L L;  4DUZ Q;  1I50 H;  2RHS B;  1XPU A;  2DGY A;  4NB3 A;  3CCJ A;  4DV0 Q;  1PH4 A;  2K5N A;  1YIT A;  4IPH A;  4BBS H;  1EYG A;  4LF8 L;  4PZ8 A;  1GD7 A;  4PZ6 A;  4JI4 Q;  2MQH A;  4OO1 G;  2VW9 A;  3M7N A;  1EWI A;  4B3M L;  5M3F H;  4A3I G;  3CCL A;  1IBM L;  2JA8 H;  3I2Z A;  4LW1 A;  3I4N H;  2IT1 A;  3CC7 A;  1N36 Q;  3GTP H;  3ICE A;  1KC8 C;  2MO1 A;  4X66 L;  1SN8 A;  3M4P A;  3CC4 A;  1EUJ A;  3HKS A;  1SRU A;  3A0J A;  3CAM A;  4JBW A;  1CKN A;  3K80 C;  1VQ5 A;  5IYC G;  1XNR L;  1WCM G;  1N32 Q;  2JE6 I;  4X62 L;  4HJ9 A;  2I5L X;  1V43 A;  2OCE A;  1YIJ A;  4A3M G;  3F1Z A;  4IOA A;  4OX9 L;  4DR6 Q;  1QZG A;  2CKZ B;  5IT9 c;  4AYB E;  4DUY Q;  4A3C G;  1I6H H;  3ULL A;  5FLM H;  3G71 A;  4AQY L;  3RN5 A;  4B3R L;  3PUV A;  1U0L A;  3PUZ A;  3I7F A;  1XMQ L;  2KEN A;  3ULP A;  1BKB A;  1VQF A;  4IPG A;  5FJ8 H;  4A75 A;  3GTK H;  3BZK A;  5LMN L;  4DV7 L;  2ZJR A;  3S1R H;  1X9N A;  4JYA Q;  2QGQ A;  4LFB Q;  4DAY B;  2Q2I A;  5IYD G;  5M5Y H;  3PUY A;  2ZM6 L;  2VQE Q;  4P74 A;  4DUZ L;  1PHJ A;  4BBS G;  4YCU A;  4YY3 Q;  2UXD Q;  2OWO A;  3J80 i;  4IFD I;  4MZ9 A;  4HJ8 A;  3TS0 A;  3PUX A;  4X6A H;  2CWP A;  4GN3 B;  5AJ3 Q;  1YI2 A;  4PG3 A;  2AWO A;  4R4Q A;  5GRO A;  4GKJ Q;  4P71 A;  1UE1 A;  3UDG A;  1IXR A;  1S72 A;  1UEB A;  3F2D A;  2IHE A;  2XTI A;  4YWL A;  1VQI A;  3GTJ H;  4HID A;  4LF7 Q;  1V1Q A;  3NEN A;  4DR4 L;  2E8G A;  1VQM A;  4DV6 Q;  1VQN A;  5GQO A;  2VNU D;  4A3D G;  5GAD C;  1CUK A;  3CCR A;  2D0O A;  2ZTC A;  3HKZ G;  3E9H A;  2LXK A;  2UUA Q;  1JJC B;  3JAM i;  2WB1 E;  4YWK A;  2BA0 A;  4DR6 L;  4JI1 Q;  4DUY L;  2R93 G;  2UXB Q;  1E24 A;  2ZTE A;  1JB7 A;  4P72 A;  1EIY B;  1VS0 A;  2GVA A;  2YTV A;  1Y1V H;  1VQJ A;  5LMU Q;  1UE7 A;  3AFP A;  5C44 G;  1EFW A;  3J7A 5;  3U4Z A;  3L2P A;  4A3J G;  3KDF B;  4JYA L;  3RR5 A;  5M5X H;  2VQE L;  2YU9 H;  2OQK A;  1E1T A;  1I5F A;  3RZO H;  3E9I A;  2GN5 A;  3PIP A;  4HJ7 A;  1A63 A;  4IO9 A;  4YY3 L;  4IJL A;  4R4I A;  4GLX A;  1X3G A;  2R6G A;  2UXD L;  2VY3 A;  2ATW A;  2I5H A;  3CD6 A;  5AJ3 L;  1VQ4 A;  4H02 A;  4LF6 Q;  1PH1 A;  1VQB A;  5HY6 A;  4L5S A;  4GKJ L;  4DV3 Q;  3S17 H;  4A3K H;  3GTG H;  1YVC A;  4DV1 Q;  1VQG A;  3FKI G;  2HIV A;  2UUB Q;  4LF7 L;  1MKH A;  2JEB I;  2JA5 G;  3CC2 A;  2N3S A;  3U4V A;  2IX0 A;  2PQA B;  3JC6 6;  4GNX A;  4DAM A;  1K0R A;  2ALY B;  2QEX A;  4DV6 L;  3B6Y A;  4A3L H;  1T9H A;  2KCM A;  1PH5 A;  1HNX Q;  1Q1E A;  2UUA L;  1K8G A;  2FXQ A;  1V9P A;  2NZO A;  3IRB A;  5C0X G;  3HOX H;  3S2D H;  1KXL A;  2Q2T A;  4B3M Q;  4DR4 Q;  4JI1 L;  2B3G A;  1HNZ L;  2HHH Q;  3KFU A;  1OXS C;  3ULJ A;  4X64 Q;  1TWA H;  4APV A;  5LMU L;  1JE5 A;  4A3F H;  4JI3 Q;  1JJ2 A;  4LNQ A;  1E7Z A;  3J81 j;  1EIF A;  1VQC A;  2UU9 Q;  4QIW E;  3CQZ H;  1N8R C;  2GVB A;  1XNR Q;  3G6E A;  4LFA Q;  2DUD A;  2PI2 A;  3K81 C;  5C4X H;  3S16 H;  2BA1 A;  5M5W H;  2ES2 A;  1KHI A;  4XIG S;  2ZJP A;  5GAE C;  1VQ6 A;  1KAW A;  5BR8 Q;  1PH3 A;  4LF5 Q;  2R92 H;  2B29 A;  1A8V A;  1IYJ B;  1VQA A;  3I4N G;  4KI0 A;  4LF6 L;  3HOZ H;  4R4C A;  1XMO Q;  1QUQ B;  4DV3 L;  4OWX B;  3DLL A;  4DV1 L;  1K8A C;  3HOV H;  3RLN A;  1OXT A;  3S1M H;  1VQE A;  1HZA A;  2UUB L;  5M3M G;  2OTL A;  1EQQ A;  2Z6K C;  3U58 A;  2YTY A;  2IHF A;  4QL5 A;  1PH7 A;  4KHP Q;  5JJI A;  1VQK A;  1VQ9 A;  1VQL A;  1VQ7 A;  2LSS A;  3HOW H;  1HNX L;  2E2H H;  1KRT A;  5IP9 H;  4AIM A;  2VQF Q;  2VUM H;  4NXN L;  3F2C A;  4L5T A;  4RG1 A;  3J80 c;  5FLM G;  4DR2 Q;  2N78 A;  1PH8 A;  1NE3 A;  1FJG Q;  4JBK A;  3PO3 H;  3S14 H;  3H3V H;  1PA6 A;  2D62 A;  1Q8K A;  4A3B H;  2CWA A;  5J3B A;  1XNQ Q;  4LUZ A;  1B8A A;  5FJ8 G;  1C0A A;  1E3P A;  2HHH L;  4DNI A;  4X64 L;  2AKW B;  4AYB G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...