1VQDA

Gene v protein mutant with val 35 replaced by ile 35 and ile 47 replaced by leu 47 (v35i, i47l)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYIDLGNEYPVLVKLTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
total genus 10
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqdA00
2AMCB 3S1RH 1IBMQ 5DLQE 4DNIA 4HJAA 1HZAA 4JI1Q 1Y1WG 4HJ9A 4BY1G 3ULJA 1MJEA 5IT9c 1C7YA 4WJ3M 2WAQE 4DR7Q 4DR6Q 1SMXA 2LXJA 1J5EQ 3HOWH 2YTXA 3CCLA 2K5VA 4LFCL 4A3EH 1PHJA 4X62Q 4HIMA 2R92H 3JAMc 2BH2A 3JC66 4A3FG 5JEAJ 3CW2C 4YCVA 1HR0W 1MKHA 2JA6G 4PG3A 3PUXA 4JI3Q 2A1AA 1PA6A 2UUAL 5ELOA 3A5ZB 3CCQA 1VQMA 2BA1A 1VQIA 2D62A 4A3MH 1IZ6A 3HOYG 1RL2A 3BZKA 4YY3L 3OW2A 1PH2A 2K75A 4DAMA 3J7A5 4LUVA 4YHHQ 4DR3L 4R4TA 3TEHB 1KQSA 1Y1WH 1V43A 5JJIA 3S1QH 2A19A 4DR3Q 1FL0A 4UP9A 4A3GH 4LFBL 3ULLA 1N33Q 2XGTA 1CKNA 2UXBL 1VQ5A 1KD1C 4POFA 4A3FH 4HIOA 4DR4Q 1AE3A 5FLMH 1S72A 3CPWA 1X3GA 2ES2A 4R1JA 1Q81C 1O7IA 3ERSX 4JV5L 2JA8H 3GTOH 2CCZA 4DR5Q 4X62L 1XMOQ 3CXCA 2E8GA 1HNWL 2LSSA 1K3RA 4RMFA 5C4XH 1GD7A 4A3IH 1NY4A 2RHQB 4LW1A 3FKIG 5IYBG 5GAHC 3G71A 2VQEL 4GOPC 3I4MH 2PI2E 3F8TA 3I56A 1UE7A 3HFZB 5M5WH 3T1YQ 1YJWA 1FJGL 2R7ZG 3PUYA 1VQEA 3M9BA 2I5HA 2I0QA 2UUBQ 4KHPL 4PZ7A 3NENA 1L0WA 1JJ2A 2NZOA 3NEMA 1Y1VG 1HNZQ 4LF6L 4BY7G 2KBNA 4DR1Q 2YTYA 4ALPA 4O0AA 1IL2A 4DK6C 5LMUL 4A4IA 2NVQH 4A3BG 2A8VA 4DR1L 1A0IA 4OO1G 2CWPA 2D0OA 4GKJQ 3A74A 3PIOA 4L5QA 1YIJA 4IPGA 3S14H 1YJNA 5GQOA 3KF6A 1VQJA 4JI3L 4A3CH 2VUMG 3FP9A 2ZTCA 4A93H 3PF4A 1PH8A 4TVAB 1WYDA 4DUZQ 2VNUD 1PH6A 3E0EA 2VY3A 2VUMH 5GADC 1BVSA 4IPHA 2JE6I 1VQCA 2R6GA 1PH3A 3PV0A 3GTGH 1KXLA 1EOVA 1SFOH 2UXDQ 2R7FA 4GLAC 2QGQA 4LFAQ 1PYSB 1A62A 2H5XA 1A8VA 3J80i 3UE0A 1QVGA 2R93H 4A3KH 1WCMH 1N33L 1D7QA 4P72A 1I50H 5C3EG 5C0XJ 2E2HH 2PMZE 2PQAB 1XTDA 3CC2A 5LMUQ 3GTPH 2JA5H 1JT8A 1FGUA 1JB7A 3HKZG 4O2DA 1S40A 4JI5Q 4GN4B 4JG2A 1Q1EA 3EIVA 1E24A 3U4VA 3J81i 3M3YH 3L2PA 3F2DA 1CKNB 3CC7A 4MZ9A 4DR2Q 3K7UC 1I94L 2CWAA 2IX0A 2WB1E 4LF8Q 2NN6I 4GS3A 1N34Q 3G48A 3KDFB 1E1TA 1N36Q 1EFWA 3PCOB 2LXKA 1YNXA 1GVPA 5M3FG 3PO2G 1WCMG 1EQRA 3GTKH 3CCMA 1NMGA 1VQPA 1N36L 1IYJB 2IX1A 2OQKA 4JI8L 4EQ5A 1VQ4A 2XTIA 3AFPA 4C3HH 4B3SL 1PYBA 4LF9L 4A75A 4JCVE 3AEVA 4BA1I 3GTJH 1VQHA 4DV6L 2E5LQ 4NXNL 4GOPA 2VW9A 1IXRA 1Q12A 1Y14B 1IBKL 4JOIC 1TWCH 3BZCA 3CD6A 3TS0A 2JJQA 2B29A 1SE8A 1VQ8A 4IJLA 3MXNB 2AHOB 4A3DG 3KJPA 3NBHB 5IP7G 2JA7H 4FDBA 3F2CA 2OWOA 5IWAQ 2YV5A 1EYGA 1HZ9A 2E2JH 4RG1A 4YHHL 3I4NH 5IP9H 3CCUA 4IPDA 3TQYA 1LUZA 1UE6A 2EXDA 4EX5A 1KIXA 4BA2I 4IOAA 1E3PA 3PO3H 1N32Q 4GKKL 2ZTDA 2OTLA 4R4CA 3F2BA 4BY1H 4LF6Q 2EQSA 5IP9G 1YJ9A 5C3EH 3RLFA 4B3TL 4B3RL 2BH8A 2UXCQ 1BBWA 4JBWA 3T1HL 4B3MQ 1D8LA 4JI0Q 2Q2HA 3PUZA 1Q8KA 1EIYB 1KHIA 1I6HH 1J5EL 3A0JA 1IBLQ 4DR6L 4BXXG 1K9MC 2Y0SG 4NXNQ 3KOJA 1AH9A 1HNWQ 3CMEA 1OXUA 3IRBA 1YBYA 1XMQQ 4LUZA 1Q7YC 3GD7A 1GKHA 1Q1BA 4R4QA 2UU9Q 3HOXG 3RN5A 1LTLA 2KCMA 4DR2L 4R4IA 5C44H 2OQ0A 2K52A 1SR3A 4OWTB 1V1QA 5M3MH 4JI7L 2WFWA 3TREA 4A3JG 2RF4A 2MO1A 4OONA 3H3VI 4YWKA 4LFAL 2UUBL 4BBRG 1VQGA 2R7ZH 3M4PA 4H02A 3CCSA 4DV5Q 3PF5A 2AWOA 1PH9A 1MIUA 3AYHB 1YVCA 3K80C 3UDFA 1HNZL 3PUWA 1OXVA 1VQBA 1NJIC 4A76A 1IBKQ 4PZ8A 1XNQL 3STBD 3S15H 5K36G 1G291 4AYBG 5LMNW 4A3BH 4NB3A 4JBMA 2PQAA 3FKIH 3GO5A 1U5KA 4QJFA 1HNXQ 1AE2A 1KL9A 2OCEA 3UDIA 4X6AH 4LF4Q 2Q2UA 4GN5A 5AJ3Q 2GVAA 1XMOL 1SROA 4LF7Q 1XPUA 5HGQA 2FXQA 1N8RC 1N34L 2ZJQA 3F1ZA 1SN8A 3UDGA 1Z47A 1CKOA 4DV4L 4AQYQ 1OTCA 3M85A 3KF8B 5HY6A 1YHBA 1TXYA 4BBSH 2HHHL 3T1HQ 3M4QA 4JI6L 2JEAI 2UXCL 3OTOQ 4LFBQ 1SRUA 2D0PA 4KLKA 3D0FA 3K0XA 4DPGA 2F3IA 2YYZA 1LM0A 1VQOA 4AIMA 5FJ8H 3H15A 2KENA 1XMQL 1VQ6A 3EBEA 3HOZG 2N3SA 4UP8A 4XIGS 4DR5L 4OX9Q 2NVYH 2YU9H 5FLMG 3KDFA 3CCRA 1HZCA 1X3EA 2ZJRA 5JEAG 1UE1A 4HJ7A 4OWWB 4P71A 4L5TA 3RNUA 4KHPQ 1ASYA 1NTGA 3K7AH 1ASZA 4A3GG 4UPAA 3PUVA 5C0XG 5IYCG 1WFQA 3KJOA 5LMNL 3S2DH 4DR7L 2VQFL 1X6OA 4DV5L 1KRSA 1VS0A 2CFMA 1XPRA 4YWLA 4A3CG 1L1OC 4K0KQ 3UDXA 1K83H 4GKJL 2ZTEA 4K0KL 3HOXH 2HIVA 1YHAA 2CQOA 5J3BA 4GOPB 1PV4A 3K8AA 2IY5B 2ALYB 3KLWA 2L15A 5GAEC 2UU9L 3EN2A 3RLNA 3CMAA 4LWCA 1CSPA 4DKAC 4A3LG 1PH1A 1E1OA 2GVBA 2RCNA 1X54A 1UEBA 3W1BA 4A3DH 3S2HH 4DV4Q 2Z0SA 4BBSG 2K4KA 2F4VL 1QZGA 3KF6B 1XJVA 2VZAA 1C9OA 1PFSA 2F4VQ 3PO2H 4JI0L 4IPCA 5M5YH 5M3FH 2WP8J 2EIFA 5H1SE 4A3JH 1BBUA 1E7ZA 2JEBI 1EIFA 3W5OA 2GN5A 3ICEA 1T9HA 2MQHA 1DGSA 1K0RA 5EAYA 1W2BA 1OXXK 4AH6A 3JAMi 2WB1G 5JJLA 1KC8C 1VQLA 1QVCA 4POGA 4IFDI 4OO1I 1B7YB 4C3IH 1Q86C 5IWAL 5GROA 1HZBA 1EQQA 1XNRL 2BA0A 3I7FA 4X65Q 2ZJPA 1R9TH 2IT1A 4APVA 1PH7A 4ME3A 2K14A 3ULPA 3PIPA 2KCTA 4A3KG 2HHHQ 4JI6Q 4HJ5A 4HJ8A 5IY0A 2PNHA 3KYHC 1A63A 4A3EG 1M1KC 3I2ZA 4DV7L 2I5LX 2HT1A 1Q82C 1TWAH 4DV1L 3FHWA 1M90C 5IP7H 4DAYB 1BKBA 4LFCQ 2AKWB 1FVIA 4YCWA 1GO3E 4DV1Q 1IBLL 4J15A 4QQBX 3U4ZA 1HNXL 2WAQG 2OTJA 4JI2Q 1WJJA 3CC4A 4NXMQ 4P73A 4JYAQ 1I94Q 2QEXA 3M7NA 2MFIA 1CSQA 3PGZA 4JI4Q 1PH4A 3HKZE 1TWHH 4L5RC 1KAWA 4PZ6A 3GTLH 1OXTA 4A93G 3E9HA 2NN6G 4C2MH 2HIXA 2DUDA 1XNRQ 1G51A 3I4MG 3H0GH 1UE5A 3S24A 1HR0L 1WOCA 2VQFQ 4AQYL 1K73C 4JI7Q 2ATWA 1Q46A 2Y0SE 3H0GG 1LYLA 1OXSC 1Y1VH 2JA9A 3TS2A 4BY7H 5C0XI 2K50A 3BJUA 3BU2A 4XTCS 4YWMA 3W1GA 1JE5A 2ID0A 1TWGH 1N9WA 3CP0A 5BR8Q 1UWVA 3PSIA 4UY8C 3OYYA 3I4NG 1VQFA 3HOYH 4DV3Q 2B63G 3GDEA 1HH2P 3U50C 4IFDJ 1HJPA 4MTNA 3SGIA 1VQNA 5C4JH 1P8LA 1L1OB 4X65L 4R4OA 4L5SA 4OX9L 1QZHA 1N32L 3L0OA 1X3FA 3I4OA 4LUOA 2NVXH 3CAMA 1YZ6A 4JC0A 3G6EA 1V9PA 4A3MG 2UUCQ 3RZOH 4B3RQ 4WJ4A 2Q2IA 3CCJA 3CCVA 4YCUA 4DK3C 3PO3G 1J6QA 2UXBQ 3HKSA 4P74A 3J80c 1E22A 1B70B 1NBWA 2K5HA 4X66L 3CCEA 4HIKA 5E7NA 3GTQH 2E5LL 4DV0Q 4A3IG 5C4XG 4KHZA 4X64L 1YI2A 4JI2L 3S17H 4NXML 1KRTA 2VQEQ 1C0AA 4IOCA 4YY3Q 2JA5G 2JK8A 5GAGC 5M3MG 4IO9A 1I3QH 1YEZA 5AJ3L 4DUZL 2UUAQ 2JQOA 3DM3A 4DV2Q 2ASBA 4DUYQ 2F52A 2RHSB 2KHJA 3L7ZC 1HR0Q 1JMCA 2E2IH 4LNQA 4IFDG 5C44G 1IBML 1NE3A 5M5XH 4P75A 4LF5L 4GNXC 4B3TQ 5FJ8G 3OTOL 4BXXH 1XNQQ 1I5FA 3K81C 3J7ZC 1X56A 3HOUH 3HOVH 2DGYA 1RIPA 1Z9FA 2I5MX 1TWFH 2B63H 4JYAL 5ELNA 3STBC 5FLXc 2VL6A 1WI5A 4GLVB 4DV3L 3HOVG 1JJCB 3CQZH 4LF7L 1B8AA 3T1YL 3MEFA 2N78A 4QGUA 5IE8A 2MO0A 2Z6KA 3NELA 4GLXA 2IHEA 3RN2A 1X9NA 3DLLA 3S16H 2C35B 3E9IA 4Y7NH 4DV2L 4HIDA 4GNXB 1VQ9A 3D31A 1FJGQ 3TRZA 1P16A 3WWVA 3LGJA 2HQLA 1VQDA 2PI2A 4OXPA 4JI8Q 4B3SQ 1VCIA 4JI1L 3HOWG 3J81j 3H3VH 1EWIA 4UP7A 4QL5A 4BBRH 1QUQB 2CKZB 2Z6KC 1GM5A 5BR8L 4B3ML 2N8NA 1VQKA 3S1NH 3M4OH 3ER0A 4X66Q 1L2FA 1VQAA 3AFQA 4JBKA 4A3LH 1S3OA 4JI4L 3A5UA 1QUQA 3B6YA 4NPSA 3RLOA 3U58A 1YHQA 1QVFA 5JJKA 2ZM6L 1U0LA 1XPOA 3I55A 2JA6H 2NVTH 1NMFA 4Y52H 2UUCL 4QY7A 2B3GA 2JA8G 3RR5A 4LF4L 2N49A 5IYCH 3ZJYC 4GNXA 2R7DA 2Q2TA 1VQ7A 4JOIA 2V1CC 3AQQA 4DUYL 5IYBH 1H95A 3G4SA 4PMWA 5IYDH 4LF9Q 1K8GA 4LF5Q 1CKMA 1K8AC 4GN3B 3HOUG 2NZHA 4DV6Q 3CF5A 3GTMH 2UXDL 4MNOA 4JBJA 4AYBE 1G6PA 2IHFA 3VDYA 1YITA 4DV7Q 4IJHA 1PH5A 3HOZH 3RZDH 4X64Q 2MNAA 4DR4L 2R93G 1X55A 3J81c 4DV0L 3KFUA 1MJCA 1W3SA 1EUJA 4JV5Q 1PVOA 2YTVA 2R92G 4JI5L 3UE1A 4LF8L 3CPFA 2AWNA 4TQUS 2ZM6Q 2QA4A 1JJGA 4C3JH 2JA7G 1L1OA 2KHIA 2VS1A 3S1MH 4GKKQ 4QIWE 3Q8DA 1X65A 2K5NA 4OWXB 5IYDG 5LMNQ 1SLJA 1CUKA 4KI0A
chains in the Genus database with same CATH superfamily
3VYSA 2WAQE 4DR7Q 2XRSD 4N9PA 1PTOC 2K5VA 4XXEA 4A3EH 1PHJA 1D1KA 4X62Q 2BH2A 5EPKA 3JC66 2H4OA 5JEAJ 4YCVA 4PG3A 4KY5A 2A1AA 2UUAL 5ELOA 2A74C 1FNVA 4K2LA 3MC0B 3HOYG 3OW2A 2K75A 3M4YA 1Q90A 1T5XD 4LUVA 1Y1WH 4OL7A 3W3AA 5C3WA 4DR3Q 1FL0A 3EQLC 1CKNA 2UXBL 1D2BA 4POFA 1YNND 3J7AF 5FLMH 3Q22A 1X3GA 2EY5A 4MTKA 2DY7A 2EYPA 4IQZA 4X62L 4DR5Q 5DM63 1HNWL 4A3IH 4KHVA 4X3KA 1QE6A 3I4MH 2VQEL 4Z9CB 3F8TA 3S1QH 3I56A 1LTRD 3J7AV 3PUYA 4KHPL 4PZ7A 1PYWD 1L0WA 1JJ2A 3NEMA 5FO8B 1Y1VG 4BY7G 5COYA 4O0AA 4DK6C 5LMUL 4A4IA 2A8VA 1DXMA 2KCCA 4A3EB 2D0OA 1K83B 5GQOA 4H13C 3KF6A 2VUMG 3FP9A 5CYUA 2ZTCA 1PH8A 4TVAB 3QB3A 4R8NA 1HTPA 5ELCA 3NHHA 2VY3A 3J7YW 1BNZA 1MBYA 1PH3A 2HD3A 5EPLA 1SFOH 4GLAC 2QGQA 2H5XA 1A62A 3EVQA 1HXYD 1WCMH 1D7QA 4KKTA 1QNKA 2C5CA 4WFN3 1ONLA 3GTPH 2WIIB 1FGUA 1AZQA 3H09A 3J80E 3GTMB 4O2DA 4F88A 1WTQA 1F2LA 2VB2X 3NXWA 4GN4B 2NTTA 4JG2A 1E24A 2XSCA 1KNAA 1S5FD 1ZKOA 2CWAA 2B2YA 4GS3A 4C3HG 3KDFB 2HDLA 5D3DA 4V0BA 2E74C 5CC4A 4FF1A 1VQPA 1F9RA 2IX1A 4B3SL 4YIJA 3R3OA 4ZCKA 1A3UA 1Y14B 4JOIC 4ILWA 3CD6A 4ZKBB 3TS0A 1R4QB 3SK5A 4A3DG 3NBHB 3R8BA 3OHXC 3OMGA 1JICA 1HZ9A 4RG1A 1BOSA 3MXPA 4IPDA 1LUZA 2QEJC 3PO3H 1TIID 4CDCC 4LF6Q 1YJ9A 5C3EH 3RLFA 4B3TL 3D6CA 2B2VC 1D8LA 5IT9L 3QWNA 1JR0D 3HOVB 3HOUB 3URYA 5BN5A 3KOJA 1AH9A 1HNWQ 4DU9A 1G6ZA 1B53A 1SBBB 2B39A 4CDEC 1EYAA 1Q1BA 4DXFA 3GQBA 1E2VA 4DR2L 3C3LA 2K52A 5M5WB 5M3MH 3X3NA 2J0TD 5IGCA 2VB3X 4XQNA 4JI7L 3TREA 2MO1A 2NB0A 4KTAA 2IJ0A 4OGQC 1H9SA 3GTOB 2JA8B 4DV5Q 1PH9A 1TWCB 4XQQA 4K5WA 3UDFA 1OXVA 1IBKQ 4A76A 2BDOA 5K36G 1G291 4NB3A 4ULLA 3O13A 3FKIH 2AUKA 5I2XA 5I6WA 3UDIA 2ZXOA 1DONA 4LF4Q 4GN5A 5AJ3Q 4KD3A 2KECA 3N52A 5HGQA 3JAME 1ENCA 1N8RC 3UDGA 1Z47A 2I46A 2R3ZA 4H44C 1PFBA 1TXYA 3HEJA 2EYFA 1AN8A 1KDBA 3D0FA 2PNRC 4DNTB 3R2TA 1VQOA 2Y0SB 3H15A 3EBEA 4DR5L 1HHVA 2NVYH 2YU9H 5FLMG 1O7ZA 3H0GB 4UAIA 2X6LA 4P71A 3KLRA 4RGTA 4L5TA 3RNUA 1ASYA 4RGOS 1ASZA 4U68A 1WFQA 5FKAC 4DR7L 2L55A 3MZ5A 4KMUC 2VQFL 1KRSA 4H7BA 4Q5VA 1L1OC 4A3CG 3Q6SA 1K83H 2ZTEA 3T4AC 3HOXH 1WTHA 1YHAA 5J3BA 1TWAB 5CBEE 1PV4A 3K8AA 2ALYB 1ML0D 4HSPA 5M5XB 2UU9L 1BR9A 1LTSD 1WTOA 1GUWA 1E1OA 2VXWA 1SMYD 2Z0SA 3I4LA 1QZGA 1WTRA 3GV6A 3KF6B 3L3OC 1HPCA 1M8AA 3L9AX 1F2ZA 4IPCA 5M5YH 3DEPA 1BBUA 2JEBI 2Z1CA 2JP1A 1R4PB 5NUCA 1T9HA 2MQHA 3OPOA 3VYUA 1W2BA 1TS2A 5G3LD 1ET6A 1VQLA 1GHKA 1B7YB 1E2ZA 4C3IH 5GROA 4G4KA 1RHPA 3S9WA 2K05A 5M3MB 3H94A 2K14A 2K32A 1RCVD 4K6LA 1WD0A 2B2VA 3PQIA 2EY6A 1I4PA 1FVIA 4PNYA 4DV1Q 2OTJA 3U4ZA 4JI2Q 4NXMQ 2EY2A 1S4ZA 4JI4Q 4PZ6A 4QMGA 3PO3B 2RBMA 1EQVA 1XNRQ 3H0GH 1UE5A 1DOMA 1UAPA 2LFNA 1GUSA 1K73C 5DAUA 1EFID 2Y0SE 3H0GG 1LYLA 1ZYRC 2JA9A 2KUMA 2IW3A 4ZUIA 3BVZA 3FPPA 4BBSB 3HOYH 3U50C 2NN6H 1HJPA 4MTNA 5C4JH 1F9SA 1FD7D 4L5SA 4XYQA 5J22A 1N32L 3I4OA 3NWTA 3RZOH 3J81L 2F3VA 3CCVA 2QW7A 1J6QA 2UXBQ 3J80c 1E22A 1NBWA 4X66L 3CCEA 3GTQH 3NTKA 1WTVA 1CZGA 1WCMB 2F0FA 3IFDA 3ITPA 4DV0Q 3OOCA 4A3IG 3S17H 4L6TB 1KRTA 2R7ZB 2EJGC 5EBCA 4IOCA 2JA5G 2JK8A 2UUAQ 1Y1WB 1SYGA 4F8MA 2L12A 2F52A 1TWHB 2RHSB 2KHJA 2OT2A 3CQZB 2D5DA 4GNXC 4B3TQ 4BXXH 1F77A 1XNQQ 2EZVA 3HOUH 2F0MA 3HOVH 2MP1A 1I6HB 4EQPA 1W6JA 2I5MX 2O2LD 3STBC 2VL6A 1F2YA 3HOVG 2G9DA 1STYA 5I6YA 3S2DB 3T1YL 1SMYC 1HFNA 5CV7A 2SOBA 4GLXA 2IHEA 1L0YB 2AQ3B 5EKIA 3SE0A 3D31A 1VQ9A 3C2PA 3WWVA 4P2CB 5JPNC 1LTAD 2F0JA 4OXPA 4B3SQ 1VCIA 2WKCA 3QG1A 3H3VH 1EWIA 4QL5A 4BBRH 1S5BD 1QUQB 2Z6KC 1PXUA 3DWAA 3S1NH 4RKLA 4X66Q 1L2FA 1VQAA 5KYLA 3MWYW 4FXDA 4N9TA 5A2QL 3A5UA 1QUQA 2HQEA 4NPSA 1QVFA 4JVZA 1XPOA 2NZ1D 2RDHA 2JA6H 2NVTH 3IL8A 4QY7A 2JA8G 5IYCH 4GNXA 3TBIB 4OELB 2Q2TA 2WKDA 1UNSA 3E3XA 4KN4C 2DNEA 3G4SA 1K8GA 3K5OA 1CKMA 1K8AC 2NZHA 3GTMH 1SSOA 1PRTF 4DV7Q 2NUCA 1XX8A 1EY9A 4DK0A 3RZDH 3C1EA 4NDXA 4DV0L 1X32A 5FLXL 5I9PA 4JV5Q 3K57A 1IW7C 3M7GA 3UE1A 1D5MC 2AWNA 2K7VA 1O78A 4GKKQ 3S1MH 1U4RA 4OWXB 1QWYA 2VUMB 5LMNQ 3GTJH 1CUKA 4RAUC 3E0JA 1MJEA 1LTBD 3ULJA 4WJ3M 1C7YA 4ZAIA 2EOTA 2MPMA 1TWFB 3HOWH 2YTXA 3NBHA 4DXGA 2R92H 1PZJD 2V4DA 3MXGA 4ZYSA 1MKHA 1RF2D 3PUXA 2B2TA 4MN3A 4CGYB 3DWPA 4JPBW 1IKLA 4BWGB 3BZKA 1PH2A 3HG9A 1HA5A 3TEHB 1KQSA 1V43A 1DZ1A 5JJIA 5ELDA 2NYZD 3V96A 4A3GH 3T53B 3ULLA 1N33Q 2XGTA 2JA7B 3LNNA 1TS5A 5I4DA 4A3FH 3RD4A 4HIOA 3LWEA 1J8IA 2AQ2B 3CPWA 2ES2A 1Q81C 3ERSX 4JV5L 1JORA 4HAEA 2CCZA 4CJ0B 2K1BA 3CXCA 3KLSX 1EY5A 5C4XH 2O5JC 1EL0A 2QKIC 1K8OA 5IYBG 5GAHC 3G71A 2F0TA 1XTCD 3NPPA 4CKCA 1FJGL 2Z4HA 2KVMA 1VQEA 4CJ1B 4A3DB 5F2DA 5CV6A 2UUBQ 3NENA 4XDXA 2L5TA 2Z4IA 4NW2A 1DCZA 1A3VA 2EYMA 3DM1A 1STBA 4DR1L 4OO1G 5E1FA 2F0WA 3OMCA 3A74A 1G2SA 2KCNA 4L5QA 3PIOA 1YIJA 4C56C 4IALA 1VQJA 4MHEA 1QCBD 2N55A 4RHSA 4A3CH 2QDBA 4A93H 1SE2A 1WYDA 4DFAA 4DUZQ 3H6MA 2VNUD 4EVOA 3E0EA 2VUMH 1BVSA 3I4NB 2JE6I 3NE5B 3D4WA 3CRKC 1QVGA 1TY0A 1PTOH 1KLGD 1Y8NB 4A3KH 2L4NA 1I50H 5C3EG 2PMZE 2PQAB 1XTDA 3CC2A 3MAQA 2JA5H 3HOZB 1JB7A 4RKBA 1Q3LA 4JI5Q 4OEMB 1QB5D 2L11A 3P75A 1CKNB 1DOKA 3NK9A 2WB1E 1N34Q 3G48A 1JC7A 1SE3A 2HDMA 3VYRA 1QILA 2A68D 1EQRA 1D6EC 4IUVA 1NMGA 5C6AA 1N36L 2OQKA 4JI8L 4LF9L 4C3HH 3IFTA 1PYBA 1FNUA 2K28A 4NXNL 1IXRA 4ZK9B 1ET9A 2B29A 1VQ8A 3PMFA 2AHOB 3NTIA 3NWSA 3KJPA 4RA8A 3SR1A 1VMPA 5IWAQ 1EYGA 1LTTD 2E2JH 1B44D 1WTWA 3MXUA 4IOAA 4BA2I 4Y7NB 4QUFA 5CV9A 3GTLB 1N32Q 4FO2A 2OTLA 3T16A 2EQSA 4JK1C 2UXCQ 2J7ZA 3A8IE 4JBWA 1C8CA 4B3MQ 5DEHA 4JI0Q 1EYCA 2Q2HA 1JWUD 3F2UA 1I6HH 2CW0C 4BXXG 5G3LF 1D1IA 1PTOD 5L37A 3QOLA 4FYDA 2RVLA 2ZT9C 3IRBA 1B9MA 1YBYA 1Q7YC 3GD7A 4LJZC 3RN5A 1LTLA 2F0EA 3TZUA 1H9MA 2OQ0A 3WOEA 2LKVA 1EY6A 1SR3A 4OWTB 1SYDA 3KF8A 2E76C 1SNQA 1F2MA 1VF5C 4KJNA 4LMQD 1GOZA 2RF4A 4UHVA 4YWKA 1CA5A 2HUGA 3NUCA 2R7ZH 3K5NA 1HUMA 4OO1I 1HNZL 5IGGA 1VQBA 1NJIC 3S15H 4WJWA 4F7XA 5LMNW 4A3BH 2ZXRA 4A3GB 5IGFA 3GO5A 4QJFA 1AE2A 2DJGC 1EYDA 2Q8RE 4X6AH 4LF7Q 1S5ED 1SN8A 1OTCA 4AQYQ 3KF8B 2SEBD 5ELEA 3T1HQ 2FHTA 4RCNA 2JEAI 4XYOA 3OTOQ 3VR6A 5C0XH 4KY6A 2IX3A 3K0XA 1EZ8A 3S1NB 2P5ZX 1I50B 1VQ6A 2N3SA 3KDFA 3GTJB 2FMMA 2ZJRA 1W6KA 3VYTA 1SYFA 4UPAA 1TQOA 2EVBA 5CR3A 3S2DH 2EDGA 3KJOA 4ZUJA 3QO2A 1X6OA 1XPRA 3UDXA 1HQMC 2CQOA 2IY5B 1CA6A 2RDFA 2L15A 5GAEC 5D14A 3EN2A 1BCPF 1VMCA 3S2HH 4DV4Q 4BBSG 2K4KA 1ENAA 3FMCA 2F4VL 5C5MA 1JWMD 4X3TA 1XJVA 4HMIA 3EJIA 3IAYA 4JI0L 4G57A 2F0OA 5BN4A 5M3FH 5DM73 1BCPD 2XVSA 3A7LA 1EIFA 1LTGD 4NMZA 2PMZB 3W5OA 3GTQB 3ICEA 4R8IA 2CVRA 5LL6X 1PFNA 3JAMi 1KC8C 3SK8A 1ZXTA 1TU2B 4QF4A 1SYBA 5IWAL 1HZBA 2NBFA 4H0LC 4J1MA 3I7FA 4X65Q 1PH7A 2IT1A 3I73A 4BS9A 1E2WA 3PIPA 2KCTA 3ULPA 2K04A 4KY7A 4HJ8A 2EPBA 4DK1A 2PNHA 3TN2A 2I5LX 3EROA 4PMCA 2RDGA 1TWAH 1HUNA 4YCWA 1IBLL 4J15A 4QQBX 1LLRD 4CKBA 3CC4A 1UUPA 4PV1C 4JYAQ 1I94Q 2QEXA 5JVG3 2MFIA 3Q0AA 3M7NA 3PGZA 1U4LA 1TWHH 2NTSA 2G9HD 3I72A 3GTLH 1OXTA 1V1PA 4TKOB 3ND9A 1BBXC 1ILQA 1Z6HA 3A56A 2DUDA 1I3QB 2SNSA 1G51A 3I4MG 2R61A 3QJYA 4JI7Q 1GUTA 1BXTA 3OWEB 1XYIA 3A7AB 3OSOA 1HTLD 1OXSC 2BE5C 3TS2A 3RZDB 5C0XI 2K50A 5ISRA 3W1GA 2K33A 5BR8Q 1UWVA 1ZYRD 5JPMC 4UY8C 2MJ8A 3I4NG 2NVQB 1DYQA 4DV3Q 1HH2P 3KBGA 5EKKA 1AFPA 1VQNA 1Q8IA 4OX9L 1QZHA 3D3RA 4LUOA 3L0OA 5LHY1 2NVXH 3G6EA 1R9TB 4JC0A 3CU7A 2UUCQ 3WOFA 5KEEA 5JOBA 2Q2IA 3CCJA 1KTKA 4TSSA 3S15B 1MGSA 2JA5B 1STGA 1OO9B 2M00A 1FR3A 5I2YA 4A3JB 5C4XG 4KHZA 4X64L 2F03A 4JI2L 5KIXA 1C0AA 3MA2B 5M3MG 4G7OC 3D4DA 4DUZL 2JQOA 3DUZA 3DM3A 3PIP3 2F0LA 1HR0Q 1LTID 4IFDG 5BN3A 5C44G 1TY2A 1NE3A 4E6IA 5FJ8G 3OTOL 1NNXA 4Q0FA 1I5FA 2PQEA 1X56A 1RIPA 5KNDA 3U9OA 2BDNA 1Z9FA 1PFMA 3DMUA 3CQZH 1STAA 4LF7L 1B8AA 2N78A 3VR2A 2EYHA 3ZYYX 3DLLA 2C35B 3E9IA 2M2LA 4GNXB 2E2JB 3S1MB 4OO1H 3LGJA 1GUGA 4HCEA 3S17B 2PI2A 3J81j 1Y69U 3I70A 2F0PA 4CDDC 2CKZB 4B3ML 5BR8L 3ER0A 3AFQA 4A3LH 5M5YB 2F0SA 3B6YA 3U58A 5K36H 1U0LA 2UUCL 3RZOB 2B2UC 2EXZA 5C4ZA 1RDPD 3BYYB 1VQ7A 3AQQA 4DUYL 5IGDA 3BS1A 5IYDH 4LF5Q 3W2DA 3CF5A 3EA6A 4MNOA 2F4IA 4AYBE 3BVGA 3VDYA 2AUJD 3R2IA 4IUQA 2MNAA 3JAML 2XNAC 2CHBD 2XWJB 2A6HC 2EY1A 3CPFA 1JJGA 1NCVA 1EQTA 1L1OA 2B8FA 3BDLA 4QIWE 3Q8DA 1Y8OB 4F87A 1X65A 1JOQA 3BZDB 1NAPA 5EJWA 4EQNA 1SAPA 2AMCB 1IBMQ 1HZAA 4JI1Q 4HJ9A 1I6VC 2EYLA 3MTSA 3CCLA 4LFCL 2EE1A 4HIMA 4G7ZC 4XT3B 2B2UA 1HR0W 1V1OA 1LABA 1NSNS 2A68C 4HR7B 5AFWA 4JI3Q 3AMUA 3A5ZB 2DJFC 1VQMA 1VQIA 1IZ6A 2BCOA 1RL2A 4YY3L 4X3UA 4DAMA 1SNCA 3J7A5 4YHHQ 2EJFC 4DR3L 1LT5D 2N88A 1CM9A 4LFBL 2K6AA 5KGUA 3FRPB 2QDLA 4DR4Q 2WB1B 1NUCA 1STHA 2GA4B 1MD2D 1CQFA 4C1NK 2JA8H 3GTOH 1B4OA 1XMOQ 2E8GA 4RMFA 1NY4A 2RHQB 4GOPC 1MHWC 4FXGC 3PO2G 1H9RA 5M5WH 3T1YQ 1YJWA 2R7ZG 2F3WA 2XIWA 4I65A 1K28A 2TSSA 4KK7A 2NWGA 1EIGA 4HEDA 4LF6L 2KBNA 4DR1Q 2YTYA 4ALPA 3HZXA 4UDUC 1IL2A 3HOYB 1SJHD 5KNBA 4A3BG 1A0IA 1HRJA 3HOWB 4GKJQ 3S14H 2O5IC 1YJNA 2MUYA 1KDAA 1SNOA 4JI3L 2IL8A 4RH6A 1D5ZC 4DA2A 2XN9C 3A54A 1HCZA 5GADC 4C3JB 4IPHA 1VQCA 3PV0A 1TR5A 1KXLA 1EOVA 1ICFB 3E6ZX 2NVYB 4S3SA 2YU9B 2UXDQ 3UE0A 4LFAQ 1A8VA 3J80i 1IL8A 2DNCA 1U4PA 5C5LA 1EU3A 4P72A 1BCPB 5C0XJ 1N33L 3T51B 2C9OA 2F0VA 1JQYD 2RSNA 1JT8A 1X3PA 1GJXA 3QOJA 4N8X1 1Q1EA 3M3YH 4OHJA 4CBVA 2QF7A 3F2DA 4IUTA 1XWEA 1JWSD 2IX0A 1I4RA 4K8IA 3AU7A 2PZUA 5K5PA 3PCOB 2LXKA 5J1ZA 5M3FG 3I4MB 1WCMG 3GTKH 4C3IB 1G2TA 1IYJB 2A6ED 4EQ5A 1VQ4A 3ONAB 1VF7A 1S5CD 4A75A 3AEVA 2BE5D 2K03A 1VQHA 5CV4A 1KLUD 3TP5A 2A5HA 2Q8TA 4DV6L 2E5LQ 2VW9A 2TMPA 1TWCH 1EY0A 1PTOF 1A15A 1SE8A 4IJLA 3BDOA 3MXNB 5IP7G 1SFOB 4FDBA 4KKSA 2YV5A 1SDFA 3TQYA 3S16B 4EX5A 3TDQA 4FVMA 4GKKL 2ZTDA 1WTPA 5IT9E 2PCFB 3VR4A 2SDFA 3FPUB 4B3RL 1BBWA 3OIPA 2L9HA 4FP5D 1EIYB 1KHIA 5EBDA 3SDZA 3A0JA 1IBLQ 4DR6L 3AB9A 1K9MC 1GHJA 3DWQA 4NXNQ 3CMEA 4I7ZC 4K2KA 2B2WA 1XMQQ 1GKHA 3TZDA 4R4QA 3FDTA 2X69A 5C3EB 2UU9Q 2DN8A 3HOXG 2KCMA 4R4IA 1V1QA 5FK9C 4A3IB 3H91A 3H3VI 3SK4A 4LFAL 3P20A 1VQGA 3TMEA 4J8QA 3SHLA 2EYJA 3CCSA 3PF5A 2AWOA 1MIUA 3AYHB 1XNQL 3PUWA 3HP3A 4PZ8A 4I7AA 2AQ1B 1BCPC 5HGTA 1O7LA 1CT1D 2A69D 4AYBG 5CBAE 1U5KA 1HNXQ 3G7LA 1KL9A 2OCEA 1GUNA 3D6WA 1XMOL 2GVAA 1N34L 3F1ZA 4DV4L 3M85A 1DJRD 3MXNA 1YHBA 5C4HA 4BBSH 2F0UA 2HHHL 3M4QA 4JI6L 3KUPA 2K5DA 4LFBQ 1H9JA 2PPBC 3FKIB 1SRUA 4WRDA 4KLKA 4DPGA 3D4RA 3A8KE 2F3IA 3I90A 1LM0A 5FJ8H 5JEAH 3A55A 4DAVA 1H9KA 2WACA 1XMQL 1JOOA 2D9UA 1HZCA 1UE1A 1DM0B 1NTGA 1B3AA 4FNFA 1LT6D 5C0XG 3DXJC 4DV5L 1S5DD 3V05A 1VS0A 1A2UA 1IYUA 4YWLA 4KN7C 4B08A 4K0KQ 3S14B 3X3MA 2FJ2A 1ILPA 1F9QA 2PZWA 1FNWA 4CJ2C 4DGZA 3E5SA 1XXGA 3RLNA 1D5XC 3NQIA 5KNCA 4LWCA 3CMAA 2EJMA 3HS0C 4G7HC 4A3LG 1KAAA 2RCNA 1NR4A 5E4WC 1IKMA 1U9RA 1C9OA 1PFSA 5ELBA 2F4VQ 5IGEA 2XRQD 4DNRB 4KD4A 5H1SE 1F9PA 1E7ZA 4A3JH 1RTOA 1DGSA 2B2YC 1OXXK 3CRLC 3KLSA 4XT1B 4V190 2WB1G 2DY8A 1QG7A 1QVCA 4IFDI 3GTKB 4XQJA 1EQQA 1XNRL 3SK6A 1R9TH 4ME3A 4A3KG 1PZKD 4CDFC 1RD9D 5IY0A 3KYHC 1A6XA 3FEWX 1M1KC 4M1UB 3I2ZA 4DV7L 2CQAA 1Q82C 2CW0D 4DV1L 3FHWA 3G6JB 5IP7H 1BKBA 1JE4A 4AYBB 2WAQG 2MHVA 4RGMA 4P73A 1MI2A 2A73B 1CSQA 1PH4A 3J80L 2Z6BA 3K0YA 4A93G 5KRUA 2HIXA 3S24A 3TSSA 1HR0L 1WOCA 4AQYL 4FF4A 4K6DA 4R9WA 5FLXE 1Q46A 5C3XA 2Z9HA 5J39A 1ZEQX 3BU2A 4YWMA 1J5EQ 1B1ZA 1JE5A 2ID0A 3OYYA 3OW7A 3GDEA 4IFDJ 3P1HA 3SGIA 1TT2A 1X3FA 2PW5A 1YZ6A 4A3MG 1V9PA 4N8FA 2PO4A 3R93A 5KYIA 3PO3G 4KKUA 2CH4W 3HKSA 4P74A 1B9NA 1EY8A 1CTMA 3K59A 5E7NA 3K6OA 2B2WC 2VQEQ 4YY3Q 2K5WA 5GAGC 3EFXD 1RODA 2JN4A 4IO9A 1KABA 1G8ZD 1I3QH 1YEZA 3QR8A 5AJ3L 1WD1A 4DV2Q 2KOLA 5IGBA 3U9SA 3L7ZC 1JMCA 4LNQA 1ESFA 1U4MA 1IBML 4LF5L 2ZXPA 2DGYA 4QIWB 2J4XA 5EQ0A 4QCLA 2PYKA 5JVH3 1WTXA 2B63H 4JYAL 3NSWA 5ELNA 3V2TA 2RSOA 5FLXc 4IUPA 1WI5A 4DV3L 1JJCB 3IKJA 4C1NI 1SJED 3MEFA 2LY7A 3BYTB 2EYOA 5IE8A 2MO0A 5CORA 3NELA 3RN2A 4QB4A 1X9NA 3S16H 3S1QB 4RGNA 4DV2L 4Y7NH 4HIDA 1FJGQ 1P16A 2HQLA 1A2TA 2RKSA 4IURA 4JI1L 1CI3M 3VA5A 5A2QE 4PMBA 1PZID 4UP7A 3T13A 1GM5A 1VQKA 1EEID 4RHRA 4ZKCB 4JBKA 3T56B 5M3FB 1TS4A 1YHQA 4C3HB 5JJKA 4DAPA 3MFYA 3I55A 2KEEA 1NMFA 3RR5A 4LF4L 1SNMA 4RFBA 4JOIA 4B9XA 1M4VA 1PDQA 1QNUA 1H95A 1GXDC 4PMWA 1V1PB 4LF9Q 3K5LA 4HSVA 4DV6Q 1SXTA 2UXDL 1II3A 4JBJA 2IHFA 2OF1A 1YITA 1TWGB 2R93G 3HOZH 3D8GA 5TSSA 1X55A 3J81c 3KFUA 2E2HB 1W3SA 3HKZB 1PVOA 2R92G 4JI5L 4ZQ3A 1RJTA 4KV6A 2ZM6Q 1KNEA 2QA4A 4C3JH 4WORA 2JA7G 2VS1A 3LX0A 1TS3A 2K5NA 5IYDG 1SLJA 4DF7A 4KI0A 3S1RH 1EWCA 5DLQE 4DNIA 3ERQA 4HJAA 1Y1WG 4BY1G 3TP6A 5IT9c 4L63B 4DR6Q 1SMXA 2FFKB 2LXJA 2F0KA 3MFGA 2O4XA 1WVLA 3JAMc 4A3FG 3CW2C 2JA6G 1NR2A 2KEDA 1EZ6A 1PA6A 3CCQA 2JXMB 1ENFA 2BA1A 2D62A 4A3MH 1AW7A 1SNPA 3NTHA 2RCFA 4R4TA 2ENBA 5EPJA 3CKIB 2A19A 4UP9A 3SXHA 1VQ5A 1KD1C 3M4OB 1SEBD 2IPKD 5D3IB 1AE3A 1S72A 4R1JA 1O7IA 4OIKA 1L0XB 2LSSA 1K3RA 1I4GA 1GD7A 5IODA 3FVQA 4LW1A 3FKIG 2PI2E 1UE7A 3HFZB 5C44B 3M9BA 4RWSC 3TP8A 2I5HA 2I0QA 3KK7A 2NZOA 1HNZQ 1QJOA 3CHBD 1Y8PB 2NVQH 5A35A 2CWPA 3RMHA 1SYCA 1Y1VB 4BY7B 4IPGA 3PIO3 4A3KB 1PLFA 3PF4A 2E2IB 4B9WA 1AZPA 2F0QA 1PH6A 1HQRD 3C46A 2R6GA 3MEHA 3GTGH 5FO9B 1EY4A 1MSHA 2R7FA 1PYSB 3I3CA 2R93H 2E2HH 5LMUQ 4U673 3NQTA 3Q24A 3HKZG 1S40A 3EIVA 3U4VA 3J81i 1G91A 2OEOA 3L2PA 3VA7A 3CC7A 4MZ9A 4DR2Q 3K7UC 1I94L 2NVXB 1I4QA 4NP5A 4LF8Q 1A3TA 2FINB 2NN6I 4K8JA 1E1TA 1N36Q 1EFWA 1GVPA 1YNXA 4LAAA 4EQOA 3CCMA 4OIJA 2XTIA 3AFPA 3I8ZA 3K58A 4JCVE 4BA1I 1IW7D 4A3BB 4GOPA 1Q12A 1IBKL 3BZCA 4IN3A 4A3FB 2JJQA 2JSOA 2JA7H 2F1MA 3F2CA 2OWOA 1JCKB 5JJZA 3PO2B 4M8AA 1SYEA 4YHHL 3I4NH 5IP9H 3CCUA 1UE6A 2EXDA 1KIXA 1C4QA 1E3PA 4R4CA 3F2BA 4BY1H 2JYOA 4A3MB 5JAVA 5CMDA 5IP9G 2ICIA 2BH8A 3T1HL 4J6HA 1SNDA 3PUZA 1Q8KA 2B63B 2A69C 3LWUA 1J5EL 2Y0SG 1K3BC 1OXUA 4LUZA 1LV9A 5D65A 5E4XA 4EGVA 5C44H 3NP8A 3K7AB 3MHBA 4K5VA 5T1IA 2WFWA 2RQXA 4A3JG 5C4XB 1QOHA 3GV3A 4OONA 2UUBL 4BBRG 4DAYA 3M4PA 4H02A 4KJOA 1STEA 1B50A 1YVCA 3K80C 1C48A 2F0HA 1JOKA 3STBD 3HRZC 4GZYC 4JBMA 2PQAA 1MSGA 1K8MA 4IZ8A 2Q2UA 1DD2A 1XPUA 1AEXA 1SROA 2FXQA 2ZJQA 3S2HB 1CKOA 3I91A 1O80A 5HY6A 2RA4A 5HURA 4K5XA 1BUVT 2FMCA 1B3QA 2UXCL 1JB3A 4ME5A 1CHPD 2D0PA 4TRDA 2YYZA 4AIMA 1PTOB 2L0CA 2KENA 3HOZG 2R93B 3GP7A 4UP8A 1BQQT 4XIGS 3NBIA 4OX9Q 1EIHA 3VR3A 1ICWA 3CCRA 1X3EA 2A6EC 3QIAA 5JEAG 1LT3D 4HJ7A 4OWWB 2B8GA 4C2MB 4KHPQ 3K7AH 2A6HD 4A3GG 3PUVA 5IYCG 5LMNL 5I9OA 4A93B 2CFMA 2WV6D 4RCOA 2KA7A 2Z8LA 4ID6A 1FYCA 3BG3A 4GKJL 2LMCB 2KJXA 4K0KL 2HIVA 2F0NA 4GOPB 3KLWA 2K01A 1CHQD 1K0SA 1V8QA 3K5MA 1CSPA 2HCCA 4DKAC 1PH1A 2GVBA 4BY1B 4ZLTF 1X54A 1CK1A 1UEBA 3W1BA 4A3DH 4C3IG 2NVTB 1ESRA 3SVMA 2F0DA 2VZAA 1EY7A 3PO2H 5IIFA 4CKEA 2HCIA 2WP8J 4LK1C 2EIFA 3P7JA 4HN7A 2GN5A 2SNMA 5EAYA 1K0RA 1I4HA 5T1GA 4AH6A 2ICEC 5JJLA 1STNA 4POGA 1IYVA 1YNJC 1Q86C 2BA0A 1EEFD 2ZJPA 1X3QA 4APVA 1FGBD 4X3SA 2PZTA 1LACA 2HHHQ 4JI6Q 4HJ5A 5C4JB 4C3JG 4FF3A 1A63A 4IUNA 4A3EG 2F0IA 2HT1A 3ND8A 4DN4M 1M90C 2CH4A 4DAYB 4LFCQ 1H9SB 2AKWB 3DEOA 4MIUA 1GO3E 3VR5A 1HNXL 1WJJA 4QUCA 4O42A 1KDCA 3HKZE 4O1NA 5M9OA 3S1RB 4L5RC 1KAWA 5CV8A 1BDOA 3E9HA 2NN6G 2QILA 4ODGA 4C2MH 1YNJD 4HMJA 3UI2A 1LT4D 2L1BA 2E2DC 2VQFQ 1EU4A 5EKLA 1TVXA 3MVVA 5FO7B 2ATWA 1PRTD 4PQXA 4ZRZA 1E0BA 2LS01 1IHZA 1Y1VH 2G5DA 4BY7H 1BO0A 3BJUA 4XTCS 2K5QA 5DNFA 1TWGH 1N9WA 2B2TC 3CP0A 3PSIA 3Q23A 1VQFA 1O7YA 2B63G 1Z7TA 3HGBA 1P8LA 1L1OB 2KHSA 4R4OA 4X65L 4K14A 3CAMA 3WDNA 2JA6B 4B3RQ 2MGSA 1CQVA 4WJ4A 2X6GA 5ELFA 4YCUA 4DK3C 1I4XA 1SE4A 4HTHA 1B70B 3SEBA 5EGTA 1B2TA 2K5HA 4HIKA 1J9OA 4BBRB 5CGKA 1EOTA 2QCPX 2E5LL 2WAQB 1YI2A 3TP7A 4NXML 3N6RA 2BOSA 2ASBA 4DUYQ 5LL6S 3RUZA 1GUOA 2E2IH 5M5XH 3J81E 4P75A 3KBXA 2H1EA 3K81C 3J7ZC 2R92B 1TWFH 1EWHA 2M9VA 2E75C 4GLVB 1YNNC 2WINB 1UEAB 1PRTC 4HCSA 4QGUA 2Z6KA 4IFDH 3A8JE 1TKWB 5FOBB 1T5EA 4FXKC 5IOCA 3TRZA 2Q8IB 1RTNA 4ABNA 1VQDA 1DOLA 1PRTB 4JI8Q 3HOWG 1VDZA 3DHQA 2N8NA 3OWFA 3M4OH 4IUUA 1S3OA 4JI4L 5E3FA 4L8JA 3RLOA 2PW7A 3OIQA 2ZM6L 4Y52H 1BF4A 2B3GA 2KQ3A 2N49A 1AP0A 3ZJYC 2R7DA 2V1CC 5IYBH 2D2CC 4CHTB 1CZWA 3HOUG 4NKLA 4GN3B 3M3YB 3C1FA 2OXPA 4FF2A 3HOXB 1HA6A 1G6PA 4JW0A 1PMRA 3H3VC 4IJHA 1PH5A 4X64Q 2IWHA 4DR4L 2XWBB 3GTPB 1RKNA 1LO5D 2I07B 1MJCA 1EUJA 2YTVA 3BDCA 4LF8L 4TQUS 3GTGB 3BVMA 1CFMA 2F0GA 2KHIA 1HFGA 5CV5A
chains in the Genus database with same CATH topology
2AMCB 3S1RH 1IBMQ 5DLQE 4DNIA 4HJAA 1HZAA 4JI1Q 1Y1WG 4HJ9A 4BY1G 3ULJA 1MJEA 5IT9c 1C7YA 4WJ3M 2WAQE 4DR7Q 4DR6Q 1SMXA 2LXJA 1J5EQ 3HOWH 2YTXA 3CCLA 2K5VA 4LFCL 4A3EH 1PHJA 4X62Q 4HIMA 2R92H 3JAMc 2BH2A 3JC66 4A3FG 5JEAJ 3CW2C 4YCVA 1HR0W 1MKHA 2JA6G 4PG3A 3PUXA 4JI3Q 2A1AA 1PA6A 2UUAL 5ELOA 3A5ZB 3CCQA 1VQMA 2BA1A 1VQIA 2D62A 4A3MH 1IZ6A 3HOYG 1RL2A 3BZKA 4YY3L 3OW2A 1PH2A 2K75A 4DAMA 3J7A5 4LUVA 4YHHQ 4DR3L 4R4TA 3TEHB 1KQSA 1Y1WH 1V43A 5JJIA 3S1QH 2A19A 4DR3Q 1FL0A 4UP9A 4A3GH 4LFBL 3ULLA 1N33Q 2XGTA 1CKNA 2UXBL 1VQ5A 1KD1C 4POFA 4A3FH 4HIOA 4DR4Q 1AE3A 5FLMH 1S72A 3CPWA 1X3GA 2ES2A 4R1JA 1Q81C 1O7IA 3ERSX 4JV5L 2JA8H 3GTOH 2CCZA 4DR5Q 4X62L 1XMOQ 3CXCA 2E8GA 1HNWL 2LSSA 1K3RA 4RMFA 5C4XH 1GD7A 4A3IH 1NY4A 2RHQB 4LW1A 3FKIG 5IYBG 5GAHC 3G71A 2VQEL 4GOPC 3I4MH 2PI2E 3F8TA 3I56A 1UE7A 3HFZB 5M5WH 3T1YQ 1YJWA 1FJGL 2R7ZG 3PUYA 1VQEA 3M9BA 2I5HA 2I0QA 2UUBQ 4KHPL 4PZ7A 3NENA 1L0WA 1JJ2A 2NZOA 3NEMA 1Y1VG 1HNZQ 4LF6L 4BY7G 2KBNA 4DR1Q 2YTYA 4ALPA 4O0AA 1IL2A 4DK6C 5LMUL 4A4IA 2NVQH 4A3BG 2A8VA 4DR1L 1A0IA 4OO1G 2CWPA 2D0OA 4GKJQ 3A74A 3PIOA 4L5QA 1YIJA 4IPGA 3S14H 1YJNA 5GQOA 3KF6A 1VQJA 4JI3L 4A3CH 2VUMG 3FP9A 2ZTCA 4A93H 3PF4A 1PH8A 4TVAB 1WYDA 4DUZQ 2VNUD 1PH6A 3E0EA 2VY3A 2VUMH 5GADC 1BVSA 4IPHA 2JE6I 1VQCA 2R6GA 1PH3A 3PV0A 3GTGH 1KXLA 1EOVA 1SFOH 2UXDQ 2R7FA 4GLAC 2QGQA 4LFAQ 1PYSB 1A62A 2H5XA 1A8VA 3J80i 3UE0A 1QVGA 2R93H 4A3KH 1WCMH 1N33L 1D7QA 4P72A 1I50H 5C3EG 5C0XJ 2E2HH 2PMZE 2PQAB 1XTDA 3CC2A 5LMUQ 3GTPH 2JA5H 1JT8A 1FGUA 1JB7A 3HKZG 4O2DA 1S40A 4JI5Q 4GN4B 4JG2A 1Q1EA 3EIVA 1E24A 3U4VA 3J81i 3M3YH 3L2PA 3F2DA 1CKNB 3CC7A 4MZ9A 4DR2Q 3K7UC 1I94L 2CWAA 2IX0A 2WB1E 4LF8Q 2NN6I 4GS3A 1N34Q 3G48A 3KDFB 1E1TA 1N36Q 1EFWA 3PCOB 2LXKA 1YNXA 1GVPA 5M3FG 3PO2G 1WCMG 1EQRA 3GTKH 3CCMA 1NMGA 1VQPA 1N36L 1IYJB 2IX1A 2OQKA 4JI8L 4EQ5A 1VQ4A 2XTIA 3AFPA 4C3HH 4B3SL 1PYBA 4LF9L 4A75A 4JCVE 3AEVA 4BA1I 3GTJH 1VQHA 4DV6L 2E5LQ 4NXNL 4GOPA 2VW9A 1IXRA 1Q12A 1Y14B 1IBKL 4JOIC 1TWCH 3BZCA 3CD6A 3TS0A 2JJQA 2B29A 1SE8A 1VQ8A 4IJLA 3MXNB 2AHOB 4A3DG 3KJPA 3NBHB 5IP7G 2JA7H 4FDBA 3F2CA 2OWOA 5IWAQ 2YV5A 1EYGA 1HZ9A 2E2JH 4RG1A 4YHHL 3I4NH 5IP9H 3CCUA 4IPDA 3TQYA 1LUZA 1UE6A 2EXDA 4EX5A 1KIXA 4BA2I 4IOAA 1E3PA 3PO3H 1N32Q 4GKKL 2ZTDA 2OTLA 4R4CA 3F2BA 4BY1H 4LF6Q 2EQSA 5IP9G 1YJ9A 5C3EH 3RLFA 4B3TL 4B3RL 2BH8A 2UXCQ 1BBWA 4JBWA 3T1HL 4B3MQ 1D8LA 4JI0Q 2Q2HA 3PUZA 1Q8KA 1EIYB 1KHIA 1I6HH 1J5EL 3A0JA 1IBLQ 4DR6L 4BXXG 1K9MC 2Y0SG 4NXNQ 3KOJA 1AH9A 1HNWQ 3CMEA 1OXUA 3IRBA 1YBYA 1XMQQ 4LUZA 1Q7YC 3GD7A 1GKHA 1Q1BA 4R4QA 2UU9Q 3HOXG 3RN5A 1LTLA 2KCMA 4DR2L 4R4IA 5C44H 2OQ0A 2K52A 1SR3A 4OWTB 1V1QA 5M3MH 4JI7L 2WFWA 3TREA 4A3JG 2RF4A 2MO1A 4OONA 3H3VI 4YWKA 4LFAL 2UUBL 4BBRG 1VQGA 2R7ZH 3M4PA 4H02A 3CCSA 4DV5Q 3PF5A 2AWOA 1PH9A 1MIUA 3AYHB 1YVCA 3K80C 3UDFA 1HNZL 3PUWA 1OXVA 1VQBA 1NJIC 4A76A 1IBKQ 4PZ8A 1XNQL 3STBD 3S15H 5K36G 1G291 4AYBG 5LMNW 4A3BH 4NB3A 4JBMA 2PQAA 3FKIH 3GO5A 1U5KA 4QJFA 1HNXQ 1AE2A 1KL9A 2OCEA 3UDIA 4X6AH 4LF4Q 2Q2UA 4GN5A 5AJ3Q 2GVAA 1XMOL 1SROA 4LF7Q 1XPUA 5HGQA 2FXQA 1N8RC 1N34L 2ZJQA 3F1ZA 1SN8A 3UDGA 1Z47A 1CKOA 4DV4L 4AQYQ 1OTCA 3M85A 3KF8B 5HY6A 1YHBA 1TXYA 4BBSH 2HHHL 3T1HQ 3M4QA 4JI6L 2JEAI 2UXCL 3OTOQ 4LFBQ 1SRUA 2D0PA 4KLKA 3D0FA 3K0XA 4DPGA 2F3IA 2YYZA 1LM0A 1VQOA 4AIMA 5FJ8H 3H15A 2KENA 1XMQL 1VQ6A 3EBEA 3HOZG 2N3SA 4UP8A 4XIGS 4DR5L 4OX9Q 2NVYH 2YU9H 5FLMG 3KDFA 3CCRA 1HZCA 1X3EA 2ZJRA 5JEAG 1UE1A 4HJ7A 4OWWB 4P71A 4L5TA 3RNUA 4KHPQ 1ASYA 1NTGA 3K7AH 1ASZA 4A3GG 4UPAA 3PUVA 5C0XG 5IYCG 1WFQA 3KJOA 5LMNL 3S2DH 4DR7L 2VQFL 1X6OA 4DV5L 1KRSA 1VS0A 2CFMA 1XPRA 4YWLA 4A3CG 1L1OC 4K0KQ 3UDXA 1K83H 4GKJL 2ZTEA 4K0KL 3HOXH 2HIVA 1YHAA 2CQOA 5J3BA 4GOPB 1PV4A 3K8AA 2IY5B 2ALYB 3KLWA 2L15A 5GAEC 2UU9L 3EN2A 3RLNA 3CMAA 4LWCA 1CSPA 4DKAC 4A3LG 1PH1A 1E1OA 2GVBA 2RCNA 1X54A 1UEBA 3W1BA 4A3DH 3S2HH 4DV4Q 2Z0SA 4BBSG 2K4KA 2F4VL 1QZGA 3KF6B 1XJVA 2VZAA 1C9OA 1PFSA 2F4VQ 3PO2H 4JI0L 4IPCA 5M5YH 5M3FH 2WP8J 2EIFA 5H1SE 4A3JH 1BBUA 1E7ZA 2JEBI 1EIFA 3W5OA 2GN5A 3ICEA 1T9HA 2MQHA 1DGSA 1K0RA 5EAYA 1W2BA 1OXXK 4AH6A 3JAMi 2WB1G 5JJLA 1KC8C 1VQLA 1QVCA 4POGA 4IFDI 4OO1I 1B7YB 4C3IH 1Q86C 5IWAL 5GROA 1HZBA 1EQQA 1XNRL 2BA0A 3I7FA 4X65Q 2ZJPA 1R9TH 2IT1A 4APVA 1PH7A 4ME3A 2K14A 3ULPA 3PIPA 2KCTA 4A3KG 2HHHQ 4JI6Q 4HJ5A 4HJ8A 5IY0A 2PNHA 3KYHC 1A63A 4A3EG 1M1KC 3I2ZA 4DV7L 2I5LX 2HT1A 1Q82C 1TWAH 4DV1L 3FHWA 1M90C 5IP7H 4DAYB 1BKBA 4LFCQ 2AKWB 1FVIA 4YCWA 1GO3E 4DV1Q 1IBLL 4J15A 4QQBX 3U4ZA 1HNXL 2WAQG 2OTJA 4JI2Q 1WJJA 3CC4A 4NXMQ 4P73A 4JYAQ 1I94Q 2QEXA 3M7NA 2MFIA 1CSQA 3PGZA 4JI4Q 1PH4A 3HKZE 1TWHH 4L5RC 1KAWA 4PZ6A 3GTLH 1OXTA 4A93G 3E9HA 2NN6G 4C2MH 2HIXA 2DUDA 1XNRQ 1G51A 3I4MG 3H0GH 1UE5A 3S24A 1HR0L 1WOCA 2VQFQ 4AQYL 1K73C 4JI7Q 2ATWA 1Q46A 2Y0SE 3H0GG 1LYLA 1OXSC 1Y1VH 2JA9A 3TS2A 4BY7H 5C0XI 2K50A 3BJUA 3BU2A 4XTCS 4YWMA 3W1GA 1JE5A 2ID0A 1TWGH 1N9WA 3CP0A 5BR8Q 1UWVA 3PSIA 4UY8C 3OYYA 3I4NG 1VQFA 3HOYH 4DV3Q 2B63G 3GDEA 1HH2P 3U50C 4IFDJ 1HJPA 4MTNA 3SGIA 1VQNA 5C4JH 1P8LA 1L1OB 4X65L 4R4OA 4L5SA 4OX9L 1QZHA 1N32L 3L0OA 1X3FA 3I4OA 4LUOA 2NVXH 3CAMA 1YZ6A 4JC0A 3G6EA 1V9PA 4A3MG 2UUCQ 3RZOH 4B3RQ 4WJ4A 2Q2IA 3CCJA 3CCVA 4YCUA 4DK3C 3PO3G 1J6QA 2UXBQ 3HKSA 4P74A 3J80c 1E22A 1B70B 1NBWA 2K5HA 4X66L 3CCEA 4HIKA 5E7NA 3GTQH 2E5LL 4DV0Q 4A3IG 5C4XG 4KHZA 4X64L 1YI2A 4JI2L 3S17H 4NXML 1KRTA 2VQEQ 1C0AA 4IOCA 4YY3Q 2JA5G 2JK8A 5GAGC 5M3MG 4IO9A 1I3QH 1YEZA 5AJ3L 4DUZL 2UUAQ 2JQOA 3DM3A 4DV2Q 2ASBA 4DUYQ 2F52A 2RHSB 2KHJA 3L7ZC 1HR0Q 1JMCA 2E2IH 4LNQA 4IFDG 5C44G 1IBML 1NE3A 5M5XH 4P75A 4LF5L 4GNXC 4B3TQ 5FJ8G 3OTOL 4BXXH 1XNQQ 1I5FA 3K81C 3J7ZC 1X56A 3HOUH 3HOVH 2DGYA 1RIPA 1Z9FA 2I5MX 1TWFH 2B63H 4JYAL 5ELNA 3STBC 5FLXc 2VL6A 1WI5A 4GLVB 4DV3L 3HOVG 1JJCB 3CQZH 4LF7L 1B8AA 3T1YL 3MEFA 2N78A 4QGUA 5IE8A 2MO0A 2Z6KA 3NELA 4GLXA 2IHEA 3RN2A 1X9NA 3DLLA 3S16H 2C35B 3E9IA 4Y7NH 4DV2L 4HIDA 4GNXB 1VQ9A 3D31A 1FJGQ 3TRZA 1P16A 3WWVA 3LGJA 2HQLA 1VQDA 2PI2A 4OXPA 4JI8Q 4B3SQ 1VCIA 4JI1L 3HOWG 3J81j 3H3VH 1EWIA 4UP7A 4QL5A 4BBRH 1QUQB 2CKZB 2Z6KC 1GM5A 5BR8L 4B3ML 2N8NA 1VQKA 3S1NH 3M4OH 3ER0A 4X66Q 1L2FA 1VQAA 3AFQA 4JBKA 4A3LH 1S3OA 4JI4L 3A5UA 1QUQA 3B6YA 4NPSA 3RLOA 3U58A 1YHQA 1QVFA 5JJKA 2ZM6L 1U0LA 1XPOA 3I55A 2JA6H 2NVTH 1NMFA 4Y52H 2UUCL 4QY7A 2B3GA 2JA8G 3RR5A 4LF4L 2N49A 5IYCH 3ZJYC 4GNXA 2R7DA 2Q2TA 1VQ7A 4JOIA 2V1CC 3AQQA 4DUYL 5IYBH 1H95A 3G4SA 4PMWA 5IYDH 4LF9Q 1K8GA 4LF5Q 1CKMA 1K8AC 4GN3B 3HOUG 2NZHA 4DV6Q 3CF5A 3GTMH 2UXDL 4MNOA 4JBJA 4AYBE 1G6PA 2IHFA 3VDYA 1YITA 4DV7Q 4IJHA 1PH5A 3HOZH 3RZDH 4X64Q 2MNAA 4DR4L 2R93G 1X55A 3J81c 4DV0L 3KFUA 1MJCA 1W3SA 1EUJA 4JV5Q 1PVOA 2YTVA 2R92G 4JI5L 3UE1A 4LF8L 3CPFA 2AWNA 4TQUS 2ZM6Q 2QA4A 1JJGA 4C3JH 2JA7G 1L1OA 2KHIA 2VS1A 3S1MH 4GKKQ 4QIWE 3Q8DA 1X65A 2K5NA 4OWXB 5IYDG 5LMNQ 1SLJA 1CUKA 4KI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AMC B;  3S1R H;  1IBM Q;  5DLQ E;  4DNI A;  4HJA A;  1HZA A;  4JI1 Q;  1Y1W G;  4HJ9 A;  4BY1 G;  3ULJ A;  1MJE A;  5IT9 c;  1C7Y A;  4WJ3 M;  2WAQ E;  4DR7 Q;  4DR6 Q;  1SMX A;  2LXJ A;  1J5E Q;  3HOW H;  2YTX A;  3CCL A;  2K5V A;  4LFC L;  4A3E H;  1PHJ A;  4X62 Q;  4HIM A;  2R92 H;  3JAM c;  2BH2 A;  3JC6 6;  4A3F G;  5JEA J;  3CW2 C;  4YCV A;  1HR0 W;  1MKH A;  2JA6 G;  4PG3 A;  3PUX A;  4JI3 Q;  2A1A A;  1PA6 A;  2UUA L;  5ELO A;  3A5Z B;  3CCQ A;  1VQM A;  2BA1 A;  1VQI A;  2D62 A;  4A3M H;  1IZ6 A;  3HOY G;  1RL2 A;  3BZK A;  4YY3 L;  3OW2 A;  1PH2 A;  2K75 A;  4DAM A;  3J7A 5;  4LUV A;  4YHH Q;  4DR3 L;  4R4T A;  3TEH B;  1KQS A;  1Y1W H;  1V43 A;  5JJI A;  3S1Q H;  2A19 A;  4DR3 Q;  1FL0 A;  4UP9 A;  4A3G H;  4LFB L;  3ULL A;  1N33 Q;  2XGT A;  1CKN A;  2UXB L;  1VQ5 A;  1KD1 C;  4POF A;  4A3F H;  4HIO A;  4DR4 Q;  1AE3 A;  5FLM H;  1S72 A;  3CPW A;  1X3G A;  2ES2 A;  4R1J A;  1Q81 C;  1O7I A;  3ERS X;  4JV5 L;  2JA8 H;  3GTO H;  2CCZ A;  4DR5 Q;  4X62 L;  1XMO Q;  3CXC A;  2E8G A;  1HNW L;  2LSS A;  1K3R A;  4RMF A;  5C4X H;  1GD7 A;  4A3I H;  1NY4 A;  2RHQ B;  4LW1 A;  3FKI G;  5IYB G;  5GAH C;  3G71 A;  2VQE L;  4GOP C;  3I4M H;  2PI2 E;  3F8T A;  3I56 A;  1UE7 A;  3HFZ B;  5M5W H;  3T1Y Q;  1YJW A;  1FJG L;  2R7Z G;  3PUY A;  1VQE A;  3M9B A;  2I5H A;  2I0Q A;  2UUB Q;  4KHP L;  4PZ7 A;  3NEN A;  1L0W A;  1JJ2 A;  2NZO A;  3NEM A;  1Y1V G;  1HNZ Q;  4LF6 L;  4BY7 G;  2KBN A;  4DR1 Q;  2YTY A;  4ALP A;  4O0A A;  1IL2 A;  4DK6 C;  5LMU L;  4A4I A;  2NVQ H;  4A3B G;  2A8V A;  4DR1 L;  1A0I A;  4OO1 G;  2CWP A;  2D0O A;  4GKJ Q;  3A74 A;  3PIO A;  4L5Q A;  1YIJ A;  4IPG A;  3S14 H;  1YJN A;  5GQO A;  3KF6 A;  1VQJ A;  4JI3 L;  4A3C H;  2VUM G;  3FP9 A;  2ZTC A;  4A93 H;  3PF4 A;  1PH8 A;  4TVA B;  1WYD A;  4DUZ Q;  2VNU D;  1PH6 A;  3E0E A;  2VY3 A;  2VUM H;  5GAD C;  1BVS A;  4IPH A;  2JE6 I;  1VQC A;  2R6G A;  1PH3 A;  3PV0 A;  3GTG H;  1KXL A;  1EOV A;  1SFO H;  2UXD Q;  2R7F A;  4GLA C;  2QGQ A;  4LFA Q;  1PYS B;  1A62 A;  2H5X A;  1A8V A;  3J80 i;  3UE0 A;  1QVG A;  2R93 H;  4A3K H;  1WCM H;  1N33 L;  1D7Q A;  4P72 A;  1I50 H;  5C3E G;  5C0X J;  2E2H H;  2PMZ E;  2PQA B;  1XTD A;  3CC2 A;  5LMU Q;  3GTP H;  2JA5 H;  1JT8 A;  1FGU A;  1JB7 A;  3HKZ G;  4O2D A;  1S40 A;  4JI5 Q;  4GN4 B;  4JG2 A;  1Q1E A;  3EIV A;  1E24 A;  3U4V A;  3J81 i;  3M3Y H;  3L2P A;  3F2D A;  1CKN B;  3CC7 A;  4MZ9 A;  4DR2 Q;  3K7U C;  1I94 L;  2CWA A;  2IX0 A;  2WB1 E;  4LF8 Q;  2NN6 I;  4GS3 A;  1N34 Q;  3G48 A;  3KDF B;  1E1T A;  1N36 Q;  1EFW A;  3PCO B;  2LXK A;  1YNX A;  1GVP A;  5M3F G;  3PO2 G;  1WCM G;  1EQR A;  3GTK H;  3CCM A;  1NMG A;  1VQP A;  1N36 L;  1IYJ B;  2IX1 A;  2OQK A;  4JI8 L;  4EQ5 A;  1VQ4 A;  2XTI A;  3AFP A;  4C3H H;  4B3S L;  1PYB A;  4LF9 L;  4A75 A;  4JCV E;  3AEV A;  4BA1 I;  3GTJ H;  1VQH A;  4DV6 L;  2E5L Q;  4NXN L;  4GOP A;  2VW9 A;  1IXR A;  1Q12 A;  1Y14 B;  1IBK L;  4JOI C;  1TWC H;  3BZC A;  3CD6 A;  3TS0 A;  2JJQ A;  2B29 A;  1SE8 A;  1VQ8 A;  4IJL A;  3MXN B;  2AHO B;  4A3D G;  3KJP A;  3NBH B;  5IP7 G;  2JA7 H;  4FDB A;  3F2C A;  2OWO A;  5IWA Q;  2YV5 A;  1EYG A;  1HZ9 A;  2E2J H;  4RG1 A;  4YHH L;  3I4N H;  5IP9 H;  3CCU A;  4IPD A;  3TQY A;  1LUZ A;  1UE6 A;  2EXD A;  4EX5 A;  1KIX A;  4BA2 I;  4IOA A;  1E3P A;  3PO3 H;  1N32 Q;  4GKK L;  2ZTD A;  2OTL A;  4R4C A;  3F2B A;  4BY1 H;  4LF6 Q;  2EQS A;  5IP9 G;  1YJ9 A;  5C3E H;  3RLF A;  4B3T L;  4B3R L;  2BH8 A;  2UXC Q;  1BBW A;  4JBW A;  3T1H L;  4B3M Q;  1D8L A;  4JI0 Q;  2Q2H A;  3PUZ A;  1Q8K A;  1EIY B;  1KHI A;  1I6H H;  1J5E L;  3A0J A;  1IBL Q;  4DR6 L;  4BXX G;  1K9M C;  2Y0S G;  4NXN Q;  3KOJ A;  1AH9 A;  1HNW Q;  3CME A;  1OXU A;  3IRB A;  1YBY A;  1XMQ Q;  4LUZ A;  1Q7Y C;  3GD7 A;  1GKH A;  1Q1B A;  4R4Q A;  2UU9 Q;  3HOX G;  3RN5 A;  1LTL A;  2KCM A;  4DR2 L;  4R4I A;  5C44 H;  2OQ0 A;  2K52 A;  1SR3 A;  4OWT B;  1V1Q A;  5M3M H;  4JI7 L;  2WFW A;  3TRE A;  4A3J G;  2RF4 A;  2MO1 A;  4OON A;  3H3V I;  4YWK A;  4LFA L;  2UUB L;  4BBR G;  1VQG A;  2R7Z H;  3M4P A;  4H02 A;  3CCS A;  4DV5 Q;  3PF5 A;  2AWO A;  1PH9 A;  1MIU A;  3AYH B;  1YVC A;  3K80 C;  3UDF A;  1HNZ L;  3PUW A;  1OXV A;  1VQB A;  1NJI C;  4A76 A;  1IBK Q;  4PZ8 A;  1XNQ L;  3STB D;  3S15 H;  5K36 G;  1G29 1;  4AYB G;  5LMN W;  4A3B H;  4NB3 A;  4JBM A;  2PQA A;  3FKI H;  3GO5 A;  1U5K A;  4QJF A;  1HNX Q;  1AE2 A;  1KL9 A;  2OCE A;  3UDI A;  4X6A H;  4LF4 Q;  2Q2U A;  4GN5 A;  5AJ3 Q;  2GVA A;  1XMO L;  1SRO A;  4LF7 Q;  1XPU A;  5HGQ A;  2FXQ A;  1N8R C;  1N34 L;  2ZJQ A;  3F1Z A;  1SN8 A;  3UDG A;  1Z47 A;  1CKO A;  4DV4 L;  4AQY Q;  1OTC A;  3M85 A;  3KF8 B;  5HY6 A;  1YHB A;  1TXY A;  4BBS H;  2HHH L;  3T1H Q;  3M4Q A;  4JI6 L;  2JEA I;  2UXC L;  3OTO Q;  4LFB Q;  1SRU A;  2D0P A;  4KLK A;  3D0F A;  3K0X A;  4DPG A;  2F3I A;  2YYZ A;  1LM0 A;  1VQO A;  4AIM A;  5FJ8 H;  3H15 A;  2KEN A;  1XMQ L;  1VQ6 A;  3EBE A;  3HOZ G;  2N3S A;  4UP8 A;  4XIG S;  4DR5 L;  4OX9 Q;  2NVY H;  2YU9 H;  5FLM G;  3KDF A;  3CCR A;  1HZC A;  1X3E A;  2ZJR A;  5JEA G;  1UE1 A;  4HJ7 A;  4OWW B;  4P71 A;  4L5T A;  3RNU A;  4KHP Q;  1ASY A;  1NTG A;  3K7A H;  1ASZ A;  4A3G G;  4UPA A;  3PUV A;  5C0X G;  5IYC G;  1WFQ A;  3KJO A;  5LMN L;  3S2D H;  4DR7 L;  2VQF L;  1X6O A;  4DV5 L;  1KRS A;  1VS0 A;  2CFM A;  1XPR A;  4YWL A;  4A3C G;  1L1O C;  4K0K Q;  3UDX A;  1K83 H;  4GKJ L;  2ZTE A;  4K0K L;  3HOX H;  2HIV A;  1YHA A;  2CQO A;  5J3B A;  4GOP B;  1PV4 A;  3K8A A;  2IY5 B;  2ALY B;  3KLW A;  2L15 A;  5GAE C;  2UU9 L;  3EN2 A;  3RLN A;  3CMA A;  4LWC A;  1CSP A;  4DKA C;  4A3L G;  1PH1 A;  1E1O A;  2GVB A;  2RCN A;  1X54 A;  1UEB A;  3W1B A;  4A3D H;  3S2H H;  4DV4 Q;  2Z0S A;  4BBS G;  2K4K A;  2F4V L;  1QZG A;  3KF6 B;  1XJV A;  2VZA A;  1C9O A;  1PFS A;  2F4V Q;  3PO2 H;  4JI0 L;  4IPC A;  5M5Y H;  5M3F H;  2WP8 J;  2EIF A;  5H1S E;  4A3J H;  1BBU A;  1E7Z A;  2JEB I;  1EIF A;  3W5O A;  2GN5 A;  3ICE A;  1T9H A;  2MQH A;  1DGS A;  1K0R A;  5EAY A;  1W2B A;  1OXX K;  4AH6 A;  3JAM i;  2WB1 G;  5JJL A;  1KC8 C;  1VQL A;  1QVC A;  4POG A;  4IFD I;  4OO1 I;  1B7Y B;  4C3I H;  1Q86 C;  5IWA L;  5GRO A;  1HZB A;  1EQQ A;  1XNR L;  2BA0 A;  3I7F A;  4X65 Q;  2ZJP A;  1R9T H;  2IT1 A;  4APV A;  1PH7 A;  4ME3 A;  2K14 A;  3ULP A;  3PIP A;  2KCT A;  4A3K G;  2HHH Q;  4JI6 Q;  4HJ5 A;  4HJ8 A;  5IY0 A;  2PNH A;  3KYH C;  1A63 A;  4A3E G;  1M1K C;  3I2Z A;  4DV7 L;  2I5L X;  2HT1 A;  1Q82 C;  1TWA H;  4DV1 L;  3FHW A;  1M90 C;  5IP7 H;  4DAY B;  1BKB A;  4LFC Q;  2AKW B;  1FVI A;  4YCW A;  1GO3 E;  4DV1 Q;  1IBL L;  4J15 A;  4QQB X;  3U4Z A;  1HNX L;  2WAQ G;  2OTJ A;  4JI2 Q;  1WJJ A;  3CC4 A;  4NXM Q;  4P73 A;  4JYA Q;  1I94 Q;  2QEX A;  3M7N A;  2MFI A;  1CSQ A;  3PGZ A;  4JI4 Q;  1PH4 A;  3HKZ E;  1TWH H;  4L5R C;  1KAW A;  4PZ6 A;  3GTL H;  1OXT A;  4A93 G;  3E9H A;  2NN6 G;  4C2M H;  2HIX A;  2DUD A;  1XNR Q;  1G51 A;  3I4M G;  3H0G H;  1UE5 A;  3S24 A;  1HR0 L;  1WOC A;  2VQF Q;  4AQY L;  1K73 C;  4JI7 Q;  2ATW A;  1Q46 A;  2Y0S E;  3H0G G;  1LYL A;  1OXS C;  1Y1V H;  2JA9 A;  3TS2 A;  4BY7 H;  5C0X I;  2K50 A;  3BJU A;  3BU2 A;  4XTC S;  4YWM A;  3W1G A;  1JE5 A;  2ID0 A;  1TWG H;  1N9W A;  3CP0 A;  5BR8 Q;  1UWV A;  3PSI A;  4UY8 C;  3OYY A;  3I4N G;  1VQF A;  3HOY H;  4DV3 Q;  2B63 G;  3GDE A;  1HH2 P;  3U50 C;  4IFD J;  1HJP A;  4MTN A;  3SGI A;  1VQN A;  5C4J H;  1P8L A;  1L1O B;  4X65 L;  4R4O A;  4L5S A;  4OX9 L;  1QZH A;  1N32 L;  3L0O A;  1X3F A;  3I4O A;  4LUO A;  2NVX H;  3CAM A;  1YZ6 A;  4JC0 A;  3G6E A;  1V9P A;  4A3M G;  2UUC Q;  3RZO H;  4B3R Q;  4WJ4 A;  2Q2I A;  3CCJ A;  3CCV A;  4YCU A;  4DK3 C;  3PO3 G;  1J6Q A;  2UXB Q;  3HKS A;  4P74 A;  3J80 c;  1E22 A;  1B70 B;  1NBW A;  2K5H A;  4X66 L;  3CCE A;  4HIK A;  5E7N A;  3GTQ H;  2E5L L;  4DV0 Q;  4A3I G;  5C4X G;  4KHZ A;  4X64 L;  1YI2 A;  4JI2 L;  3S17 H;  4NXM L;  1KRT A;  2VQE Q;  1C0A A;  4IOC A;  4YY3 Q;  2JA5 G;  2JK8 A;  5GAG C;  5M3M G;  4IO9 A;  1I3Q H;  1YEZ A;  5AJ3 L;  4DUZ L;  2UUA Q;  2JQO A;  3DM3 A;  4DV2 Q;  2ASB A;  4DUY Q;  2F52 A;  2RHS B;  2KHJ A;  3L7Z C;  1HR0 Q;  1JMC A;  2E2I H;  4LNQ A;  4IFD G;  5C44 G;  1IBM L;  1NE3 A;  5M5X H;  4P75 A;  4LF5 L;  4GNX C;  4B3T Q;  5FJ8 G;  3OTO L;  4BXX H;  1XNQ Q;  1I5F A;  3K81 C;  3J7Z C;  1X56 A;  3HOU H;  3HOV H;  2DGY A;  1RIP A;  1Z9F A;  2I5M X;  1TWF H;  2B63 H;  4JYA L;  5ELN A;  3STB C;  5FLX c;  2VL6 A;  1WI5 A;  4GLV B;  4DV3 L;  3HOV G;  1JJC B;  3CQZ H;  4LF7 L;  1B8A A;  3T1Y L;  3MEF A;  2N78 A;  4QGU A;  5IE8 A;  2MO0 A;  2Z6K A;  3NEL A;  4GLX A;  2IHE A;  3RN2 A;  1X9N A;  3DLL A;  3S16 H;  2C35 B;  3E9I A;  4Y7N H;  4DV2 L;  4HID A;  4GNX B;  1VQ9 A;  3D31 A;  1FJG Q;  3TRZ A;  1P16 A;  3WWV A;  3LGJ A;  2HQL A;  1VQD A;  2PI2 A;  4OXP A;  4JI8 Q;  4B3S Q;  1VCI A;  4JI1 L;  3HOW G;  3J81 j;  3H3V H;  1EWI A;  4UP7 A;  4QL5 A;  4BBR H;  1QUQ B;  2CKZ B;  2Z6K C;  1GM5 A;  5BR8 L;  4B3M L;  2N8N A;  1VQK A;  3S1N H;  3M4O H;  3ER0 A;  4X66 Q;  1L2F A;  1VQA A;  3AFQ A;  4JBK A;  4A3L H;  1S3O A;  4JI4 L;  3A5U A;  1QUQ A;  3B6Y A;  4NPS A;  3RLO A;  3U58 A;  1YHQ A;  1QVF A;  5JJK A;  2ZM6 L;  1U0L A;  1XPO A;  3I55 A;  2JA6 H;  2NVT H;  1NMF A;  4Y52 H;  2UUC L;  4QY7 A;  2B3G A;  2JA8 G;  3RR5 A;  4LF4 L;  2N49 A;  5IYC H;  3ZJY C;  4GNX A;  2R7D A;  2Q2T A;  1VQ7 A;  4JOI A;  2V1C C;  3AQQ A;  4DUY L;  5IYB H;  1H95 A;  3G4S A;  4PMW A;  5IYD H;  4LF9 Q;  1K8G A;  4LF5 Q;  1CKM A;  1K8A C;  4GN3 B;  3HOU G;  2NZH A;  4DV6 Q;  3CF5 A;  3GTM H;  2UXD L;  4MNO A;  4JBJ A;  4AYB E;  1G6P A;  2IHF A;  3VDY A;  1YIT A;  4DV7 Q;  4IJH A;  1PH5 A;  3HOZ H;  3RZD H;  4X64 Q;  2MNA A;  4DR4 L;  2R93 G;  1X55 A;  3J81 c;  4DV0 L;  3KFU A;  1MJC A;  1W3S A;  1EUJ A;  4JV5 Q;  1PVO A;  2YTV A;  2R92 G;  4JI5 L;  3UE1 A;  4LF8 L;  3CPF A;  2AWN A;  4TQU S;  2ZM6 Q;  2QA4 A;  1JJG A;  4C3J H;  2JA7 G;  1L1O A;  2KHI A;  2VS1 A;  3S1M H;  4GKK Q;  4QIW E;  3Q8D A;  1X65 A;  2K5N A;  4OWX B;  5IYD G;  5LMN Q;  1SLJ A;  1CUK A;  4KI0 A; 
#chains in the Genus database with same CATH topology
 3VYS A;  2WAQ E;  4DR7 Q;  2XRS D;  4N9P A;  1PTO C;  2K5V A;  4XXE A;  4A3E H;  1PHJ A;  1D1K A;  4X62 Q;  2BH2 A;  5EPK A;  3JC6 6;  2H4O A;  5JEA J;  4YCV A;  4PG3 A;  4KY5 A;  2A1A A;  2UUA L;  5ELO A;  2A74 C;  1FNV A;  4K2L A;  3MC0 B;  3HOY G;  3OW2 A;  2K75 A;  3M4Y A;  1Q90 A;  1T5X D;  4LUV A;  1Y1W H;  4OL7 A;  3W3A A;  5C3W A;  4DR3 Q;  1FL0 A;  3EQL C;  1CKN A;  2UXB L;  1D2B A;  4POF A;  1YNN D;  3J7A F;  5FLM H;  3Q22 A;  1X3G A;  2EY5 A;  4MTK A;  2DY7 A;  2EYP A;  4IQZ A;  4X62 L;  4DR5 Q;  5DM6 3;  1HNW L;  4A3I H;  4KHV A;  4X3K A;  1QE6 A;  3I4M H;  2VQE L;  4Z9C B;  3F8T A;  3S1Q H;  3I56 A;  1LTR D;  3J7A V;  3PUY A;  4KHP L;  4PZ7 A;  1PYW D;  1L0W A;  1JJ2 A;  3NEM A;  5FO8 B;  1Y1V G;  4BY7 G;  5COY A;  4O0A A;  4DK6 C;  5LMU L;  4A4I A;  2A8V A;  1DXM A;  2KCC A;  4A3E B;  2D0O A;  1K83 B;  5GQO A;  4H13 C;  3KF6 A;  2VUM G;  3FP9 A;  5CYU A;  2ZTC A;  1PH8 A;  4TVA B;  3QB3 A;  4R8N A;  1HTP A;  5ELC A;  3NHH A;  2VY3 A;  3J7Y W;  1BNZ A;  1MBY A;  1PH3 A;  2HD3 A;  5EPL A;  1SFO H;  4GLA C;  2QGQ A;  2H5X A;  1A62 A;  3EVQ A;  1HXY D;  1WCM H;  1D7Q A;  4KKT A;  1QNK A;  2C5C A;  4WFN 3;  1ONL A;  3GTP H;  2WII B;  1FGU A;  1AZQ A;  3H09 A;  3J80 E;  3GTM B;  4O2D A;  4F88 A;  1WTQ A;  1F2L A;  2VB2 X;  3NXW A;  4GN4 B;  2NTT A;  4JG2 A;  1E24 A;  2XSC A;  1KNA A;  1S5F D;  1ZKO A;  2CWA A;  2B2Y A;  4GS3 A;  4C3H G;  3KDF B;  2HDL A;  5D3D A;  4V0B A;  2E74 C;  5CC4 A;  4FF1 A;  1VQP A;  1F9R A;  2IX1 A;  4B3S L;  4YIJ A;  3R3O A;  4ZCK A;  1A3U A;  1Y14 B;  4JOI C;  4ILW A;  3CD6 A;  4ZKB B;  3TS0 A;  1R4Q B;  3SK5 A;  4A3D G;  3NBH B;  3R8B A;  3OHX C;  3OMG A;  1JIC A;  1HZ9 A;  4RG1 A;  1BOS A;  3MXP A;  4IPD A;  1LUZ A;  2QEJ C;  3PO3 H;  1TII D;  4CDC C;  4LF6 Q;  1YJ9 A;  5C3E H;  3RLF A;  4B3T L;  3D6C A;  2B2V C;  1D8L A;  5IT9 L;  3QWN A;  1JR0 D;  3HOV B;  3HOU B;  3URY A;  5BN5 A;  3KOJ A;  1AH9 A;  1HNW Q;  4DU9 A;  1G6Z A;  1B53 A;  1SBB B;  2B39 A;  4CDE C;  1EYA A;  1Q1B A;  4DXF A;  3GQB A;  1E2V A;  4DR2 L;  3C3L A;  2K52 A;  5M5W B;  5M3M H;  3X3N A;  2J0T D;  5IGC A;  2VB3 X;  4XQN A;  4JI7 L;  3TRE A;  2MO1 A;  2NB0 A;  4KTA A;  2IJ0 A;  4OGQ C;  1H9S A;  3GTO B;  2JA8 B;  4DV5 Q;  1PH9 A;  1TWC B;  4XQQ A;  4K5W A;  3UDF A;  1OXV A;  1IBK Q;  4A76 A;  2BDO A;  5K36 G;  1G29 1;  4NB3 A;  4ULL A;  3O13 A;  3FKI H;  2AUK A;  5I2X A;  5I6W A;  3UDI A;  2ZXO A;  1DON A;  4LF4 Q;  4GN5 A;  5AJ3 Q;  4KD3 A;  2KEC A;  3N52 A;  5HGQ A;  3JAM E;  1ENC A;  1N8R C;  3UDG A;  1Z47 A;  2I46 A;  2R3Z A;  4H44 C;  1PFB A;  1TXY A;  3HEJ A;  2EYF A;  1AN8 A;  1KDB A;  3D0F A;  2PNR C;  4DNT B;  3R2T A;  1VQO A;  2Y0S B;  3H15 A;  3EBE A;  4DR5 L;  1HHV A;  2NVY H;  2YU9 H;  5FLM G;  1O7Z A;  3H0G B;  4UAI A;  2X6L A;  4P71 A;  3KLR A;  4RGT A;  4L5T A;  3RNU A;  1ASY A;  4RGO S;  1ASZ A;  4U68 A;  1WFQ A;  5FKA C;  4DR7 L;  2L55 A;  3MZ5 A;  4KMU C;  2VQF L;  1KRS A;  4H7B A;  4Q5V A;  1L1O C;  4A3C G;  3Q6S A;  1K83 H;  2ZTE A;  3T4A C;  3HOX H;  1WTH A;  1YHA A;  5J3B A;  1TWA B;  5CBE E;  1PV4 A;  3K8A A;  2ALY B;  1ML0 D;  4HSP A;  5M5X B;  2UU9 L;  1BR9 A;  1LTS D;  1WTO A;  1GUW A;  1E1O A;  2VXW A;  1SMY D;  2Z0S A;  3I4L A;  1QZG A;  1WTR A;  3GV6 A;  3KF6 B;  3L3O C;  1HPC A;  1M8A A;  3L9A X;  1F2Z A;  4IPC A;  5M5Y H;  3DEP A;  1BBU A;  2JEB I;  2Z1C A;  2JP1 A;  1R4P B;  5NUC A;  1T9H A;  2MQH A;  3OPO A;  3VYU A;  1W2B A;  1TS2 A;  5G3L D;  1ET6 A;  1VQL A;  1GHK A;  1B7Y B;  1E2Z A;  4C3I H;  5GRO A;  4G4K A;  1RHP A;  3S9W A;  2K05 A;  5M3M B;  3H94 A;  2K14 A;  2K32 A;  1RCV D;  4K6L A;  1WD0 A;  2B2V A;  3PQI A;  2EY6 A;  1I4P A;  1FVI A;  4PNY A;  4DV1 Q;  2OTJ A;  3U4Z A;  4JI2 Q;  4NXM Q;  2EY2 A;  1S4Z A;  4JI4 Q;  4PZ6 A;  4QMG A;  3PO3 B;  2RBM A;  1EQV A;  1XNR Q;  3H0G H;  1UE5 A;  1DOM A;  1UAP A;  2LFN A;  1GUS A;  1K73 C;  5DAU A;  1EFI D;  2Y0S E;  3H0G G;  1LYL A;  1ZYR C;  2JA9 A;  2KUM A;  2IW3 A;  4ZUI A;  3BVZ A;  3FPP A;  4BBS B;  3HOY H;  3U50 C;  2NN6 H;  1HJP A;  4MTN A;  5C4J H;  1F9S A;  1FD7 D;  4L5S A;  4XYQ A;  5J22 A;  1N32 L;  3I4O A;  3NWT A;  3RZO H;  3J81 L;  2F3V A;  3CCV A;  2QW7 A;  1J6Q A;  2UXB Q;  3J80 c;  1E22 A;  1NBW A;  4X66 L;  3CCE A;  3GTQ H;  3NTK A;  1WTV A;  1CZG A;  1WCM B;  2F0F A;  3IFD A;  3ITP A;  4DV0 Q;  3OOC A;  4A3I G;  3S17 H;  4L6T B;  1KRT A;  2R7Z B;  2EJG C;  5EBC A;  4IOC A;  2JA5 G;  2JK8 A;  2UUA Q;  1Y1W B;  1SYG A;  4F8M A;  2L12 A;  2F52 A;  1TWH B;  2RHS B;  2KHJ A;  2OT2 A;  3CQZ B;  2D5D A;  4GNX C;  4B3T Q;  4BXX H;  1F77 A;  1XNQ Q;  2EZV A;  3HOU H;  2F0M A;  3HOV H;  2MP1 A;  1I6H B;  4EQP A;  1W6J A;  2I5M X;  2O2L D;  3STB C;  2VL6 A;  1F2Y A;  3HOV G;  2G9D A;  1STY A;  5I6Y A;  3S2D B;  3T1Y L;  1SMY C;  1HFN A;  5CV7 A;  2SOB A;  4GLX A;  2IHE A;  1L0Y B;  2AQ3 B;  5EKI A;  3SE0 A;  3D31 A;  1VQ9 A;  3C2P A;  3WWV A;  4P2C B;  5JPN C;  1LTA D;  2F0J A;  4OXP A;  4B3S Q;  1VCI A;  2WKC A;  3QG1 A;  3H3V H;  1EWI A;  4QL5 A;  4BBR H;  1S5B D;  1QUQ B;  2Z6K C;  1PXU A;  3DWA A;  3S1N H;  4RKL A;  4X66 Q;  1L2F A;  1VQA A;  5KYL A;  3MWY W;  4FXD A;  4N9T A;  5A2Q L;  3A5U A;  1QUQ A;  2HQE A;  4NPS A;  1QVF A;  4JVZ A;  1XPO A;  2NZ1 D;  2RDH A;  2JA6 H;  2NVT H;  3IL8 A;  4QY7 A;  2JA8 G;  5IYC H;  4GNX A;  3TBI B;  4OEL B;  2Q2T A;  2WKD A;  1UNS A;  3E3X A;  4KN4 C;  2DNE A;  3G4S A;  1K8G A;  3K5O A;  1CKM A;  1K8A C;  2NZH A;  3GTM H;  1SSO A;  1PRT F;  4DV7 Q;  2NUC A;  1XX8 A;  1EY9 A;  4DK0 A;  3RZD H;  3C1E A;  4NDX A;  4DV0 L;  1X32 A;  5FLX L;  5I9P A;  4JV5 Q;  3K57 A;  1IW7 C;  3M7G A;  3UE1 A;  1D5M C;  2AWN A;  2K7V A;  1O78 A;  4GKK Q;  3S1M H;  1U4R A;  4OWX B;  1QWY A;  2VUM B;  5LMN Q;  3GTJ H;  1CUK A;  4RAU C;  3E0J A;  1MJE A;  1LTB D;  3ULJ A;  4WJ3 M;  1C7Y A;  4ZAI A;  2EOT A;  2MPM A;  1TWF B;  3HOW H;  2YTX A;  3NBH A;  4DXG A;  2R92 H;  1PZJ D;  2V4D A;  3MXG A;  4ZYS A;  1MKH A;  1RF2 D;  3PUX A;  2B2T A;  4MN3 A;  4CGY B;  3DWP A;  4JPB W;  1IKL A;  4BWG B;  3BZK A;  1PH2 A;  3HG9 A;  1HA5 A;  3TEH B;  1KQS A;  1V43 A;  1DZ1 A;  5JJI A;  5ELD A;  2NYZ D;  3V96 A;  4A3G H;  3T53 B;  3ULL A;  1N33 Q;  2XGT A;  2JA7 B;  3LNN A;  1TS5 A;  5I4D A;  4A3F H;  3RD4 A;  4HIO A;  3LWE A;  1J8I A;  2AQ2 B;  3CPW A;  2ES2 A;  1Q81 C;  3ERS X;  4JV5 L;  1JOR A;  4HAE A;  2CCZ A;  4CJ0 B;  2K1B A;  3CXC A;  3KLS X;  1EY5 A;  5C4X H;  2O5J C;  1EL0 A;  2QKI C;  1K8O A;  5IYB G;  5GAH C;  3G71 A;  2F0T A;  1XTC D;  3NPP A;  4CKC A;  1FJG L;  2Z4H A;  2KVM A;  1VQE A;  4CJ1 B;  4A3D B;  5F2D A;  5CV6 A;  2UUB Q;  3NEN A;  4XDX A;  2L5T A;  2Z4I A;  4NW2 A;  1DCZ A;  1A3V A;  2EYM A;  3DM1 A;  1STB A;  4DR1 L;  4OO1 G;  5E1F A;  2F0W A;  3OMC A;  3A74 A;  1G2S A;  2KCN A;  4L5Q A;  3PIO A;  1YIJ A;  4C56 C;  4IAL A;  1VQJ A;  4MHE A;  1QCB D;  2N55 A;  4RHS A;  4A3C H;  2QDB A;  4A93 H;  1SE2 A;  1WYD A;  4DFA A;  4DUZ Q;  3H6M A;  2VNU D;  4EVO A;  3E0E A;  2VUM H;  1BVS A;  3I4N B;  2JE6 I;  3NE5 B;  3D4W A;  3CRK C;  1QVG A;  1TY0 A;  1PTO H;  1KLG D;  1Y8N B;  4A3K H;  2L4N A;  1I50 H;  5C3E G;  2PMZ E;  2PQA B;  1XTD A;  3CC2 A;  3MAQ A;  2JA5 H;  3HOZ B;  1JB7 A;  4RKB A;  1Q3L A;  4JI5 Q;  4OEM B;  1QB5 D;  2L11 A;  3P75 A;  1CKN B;  1DOK A;  3NK9 A;  2WB1 E;  1N34 Q;  3G48 A;  1JC7 A;  1SE3 A;  2HDM A;  3VYR A;  1QIL A;  2A68 D;  1EQR A;  1D6E C;  4IUV A;  1NMG A;  5C6A A;  1N36 L;  2OQK A;  4JI8 L;  4LF9 L;  4C3H H;  3IFT A;  1PYB A;  1FNU A;  2K28 A;  4NXN L;  1IXR A;  4ZK9 B;  1ET9 A;  2B29 A;  1VQ8 A;  3PMF A;  2AHO B;  3NTI A;  3NWS A;  3KJP A;  4RA8 A;  3SR1 A;  1VMP A;  5IWA Q;  1EYG A;  1LTT D;  2E2J H;  1B44 D;  1WTW A;  3MXU A;  4IOA A;  4BA2 I;  4Y7N B;  4QUF A;  5CV9 A;  3GTL B;  1N32 Q;  4FO2 A;  2OTL A;  3T16 A;  2EQS A;  4JK1 C;  2UXC Q;  2J7Z A;  3A8I E;  4JBW A;  1C8C A;  4B3M Q;  5DEH A;  4JI0 Q;  1EYC A;  2Q2H A;  1JWU D;  3F2U A;  1I6H H;  2CW0 C;  4BXX G;  5G3L F;  1D1I A;  1PTO D;  5L37 A;  3QOL A;  4FYD A;  2RVL A;  2ZT9 C;  3IRB A;  1B9M A;  1YBY A;  1Q7Y C;  3GD7 A;  4LJZ C;  3RN5 A;  1LTL A;  2F0E A;  3TZU A;  1H9M A;  2OQ0 A;  3WOE A;  2LKV A;  1EY6 A;  1SR3 A;  4OWT B;  1SYD A;  3KF8 A;  2E76 C;  1SNQ A;  1F2M A;  1VF5 C;  4KJN A;  4LMQ D;  1GOZ A;  2RF4 A;  4UHV A;  4YWK A;  1CA5 A;  2HUG A;  3NUC A;  2R7Z H;  3K5N A;  1HUM A;  4OO1 I;  1HNZ L;  5IGG A;  1VQB A;  1NJI C;  3S15 H;  4WJW A;  4F7X A;  5LMN W;  4A3B H;  2ZXR A;  4A3G B;  5IGF A;  3GO5 A;  4QJF A;  1AE2 A;  2DJG C;  1EYD A;  2Q8R E;  4X6A H;  4LF7 Q;  1S5E D;  1SN8 A;  1OTC A;  4AQY Q;  3KF8 B;  2SEB D;  5ELE A;  3T1H Q;  2FHT A;  4RCN A;  2JEA I;  4XYO A;  3OTO Q;  3VR6 A;  5C0X H;  4KY6 A;  2IX3 A;  3K0X A;  1EZ8 A;  3S1N B;  2P5Z X;  1I50 B;  1VQ6 A;  2N3S A;  3KDF A;  3GTJ B;  2FMM A;  2ZJR A;  1W6K A;  3VYT A;  1SYF A;  4UPA A;  1TQO A;  2EVB A;  5CR3 A;  3S2D H;  2EDG A;  3KJO A;  4ZUJ A;  3QO2 A;  1X6O A;  1XPR A;  3UDX A;  1HQM C;  2CQO A;  2IY5 B;  1CA6 A;  2RDF A;  2L15 A;  5GAE C;  5D14 A;  3EN2 A;  1BCP F;  1VMC A;  3S2H H;  4DV4 Q;  4BBS G;  2K4K A;  1ENA A;  3FMC A;  2F4V L;  5C5M A;  1JWM D;  4X3T A;  1XJV A;  4HMI A;  3EJI A;  3IAY A;  4JI0 L;  4G57 A;  2F0O A;  5BN4 A;  5M3F H;  5DM7 3;  1BCP D;  2XVS A;  3A7L A;  1EIF A;  1LTG D;  4NMZ A;  2PMZ B;  3W5O A;  3GTQ B;  3ICE A;  4R8I A;  2CVR A;  5LL6 X;  1PFN A;  3JAM i;  1KC8 C;  3SK8 A;  1ZXT A;  1TU2 B;  4QF4 A;  1SYB A;  5IWA L;  1HZB A;  2NBF A;  4H0L C;  4J1M A;  3I7F A;  4X65 Q;  1PH7 A;  2IT1 A;  3I73 A;  4BS9 A;  1E2W A;  3PIP A;  2KCT A;  3ULP A;  2K04 A;  4KY7 A;  4HJ8 A;  2EPB A;  4DK1 A;  2PNH A;  3TN2 A;  2I5L X;  3ERO A;  4PMC A;  2RDG A;  1TWA H;  1HUN A;  4YCW A;  1IBL L;  4J15 A;  4QQB X;  1LLR D;  4CKB A;  3CC4 A;  1UUP A;  4PV1 C;  4JYA Q;  1I94 Q;  2QEX A;  5JVG 3;  2MFI A;  3Q0A A;  3M7N A;  3PGZ A;  1U4L A;  1TWH H;  2NTS A;  2G9H D;  3I72 A;  3GTL H;  1OXT A;  1V1P A;  4TKO B;  3ND9 A;  1BBX C;  1ILQ A;  1Z6H A;  3A56 A;  2DUD A;  1I3Q B;  2SNS A;  1G51 A;  3I4M G;  2R61 A;  3QJY A;  4JI7 Q;  1GUT A;  1BXT A;  3OWE B;  1XYI A;  3A7A B;  3OSO A;  1HTL D;  1OXS C;  2BE5 C;  3TS2 A;  3RZD B;  5C0X I;  2K50 A;  5ISR A;  3W1G A;  2K33 A;  5BR8 Q;  1UWV A;  1ZYR D;  5JPM C;  4UY8 C;  2MJ8 A;  3I4N G;  2NVQ B;  1DYQ A;  4DV3 Q;  1HH2 P;  3KBG A;  5EKK A;  1AFP A;  1VQN A;  1Q8I A;  4OX9 L;  1QZH A;  3D3R A;  4LUO A;  3L0O A;  5LHY 1;  2NVX H;  3G6E A;  1R9T B;  4JC0 A;  3CU7 A;  2UUC Q;  3WOF A;  5KEE A;  5JOB A;  2Q2I A;  3CCJ A;  1KTK A;  4TSS A;  3S15 B;  1MGS A;  2JA5 B;  1STG A;  1OO9 B;  2M00 A;  1FR3 A;  5I2Y A;  4A3J B;  5C4X G;  4KHZ A;  4X64 L;  2F03 A;  4JI2 L;  5KIX A;  1C0A A;  3MA2 B;  5M3M G;  4G7O C;  3D4D A;  4DUZ L;  2JQO A;  3DUZ A;  3DM3 A;  3PIP 3;  2F0L A;  1HR0 Q;  1LTI D;  4IFD G;  5BN3 A;  5C44 G;  1TY2 A;  1NE3 A;  4E6I A;  5FJ8 G;  3OTO L;  1NNX A;  4Q0F A;  1I5F A;  2PQE A;  1X56 A;  1RIP A;  5KND A;  3U9O A;  2BDN A;  1Z9F A;  1PFM A;  3DMU A;  3CQZ H;  1STA A;  4LF7 L;  1B8A A;  2N78 A;  3VR2 A;  2EYH A;  3ZYY X;  3DLL A;  2C35 B;  3E9I A;  2M2L A;  4GNX B;  2E2J B;  3S1M B;  4OO1 H;  3LGJ A;  1GUG A;  4HCE A;  3S17 B;  2PI2 A;  3J81 j;  1Y69 U;  3I70 A;  2F0P A;  4CDD C;  2CKZ B;  4B3M L;  5BR8 L;  3ER0 A;  3AFQ A;  4A3L H;  5M5Y B;  2F0S A;  3B6Y A;  3U58 A;  5K36 H;  1U0L A;  2UUC L;  3RZO B;  2B2U C;  2EXZ A;  5C4Z A;  1RDP D;  3BYY B;  1VQ7 A;  3AQQ A;  4DUY L;  5IGD A;  3BS1 A;  5IYD H;  4LF5 Q;  3W2D A;  3CF5 A;  3EA6 A;  4MNO A;  2F4I A;  4AYB E;  3BVG A;  3VDY A;  2AUJ D;  3R2I A;  4IUQ A;  2MNA A;  3JAM L;  2XNA C;  2CHB D;  2XWJ B;  2A6H C;  2EY1 A;  3CPF A;  1JJG A;  1NCV A;  1EQT A;  1L1O A;  2B8F A;  3BDL A;  4QIW E;  3Q8D A;  1Y8O B;  4F87 A;  1X65 A;  1JOQ A;  3BZD B;  1NAP A;  5EJW A;  4EQN A;  1SAP A;  2AMC B;  1IBM Q;  1HZA A;  4JI1 Q;  4HJ9 A;  1I6V C;  2EYL A;  3MTS A;  3CCL A;  4LFC L;  2EE1 A;  4HIM A;  4G7Z C;  4XT3 B;  2B2U A;  1HR0 W;  1V1O A;  1LAB A;  1NSN S;  2A68 C;  4HR7 B;  5AFW A;  4JI3 Q;  3AMU A;  3A5Z B;  2DJF C;  1VQM A;  1VQI A;  1IZ6 A;  2BCO A;  1RL2 A;  4YY3 L;  4X3U A;  4DAM A;  1SNC A;  3J7A 5;  4YHH Q;  2EJF C;  4DR3 L;  1LT5 D;  2N88 A;  1CM9 A;  4LFB L;  2K6A A;  5KGU A;  3FRP B;  2QDL A;  4DR4 Q;  2WB1 B;  1NUC A;  1STH A;  2GA4 B;  1MD2 D;  1CQF A;  4C1N K;  2JA8 H;  3GTO H;  1B4O A;  1XMO Q;  2E8G A;  4RMF A;  1NY4 A;  2RHQ B;  4GOP C;  1MHW C;  4FXG C;  3PO2 G;  1H9R A;  5M5W H;  3T1Y Q;  1YJW A;  2R7Z G;  2F3W A;  2XIW A;  4I65 A;  1K28 A;  2TSS A;  4KK7 A;  2NWG A;  1EIG A;  4HED A;  4LF6 L;  2KBN A;  4DR1 Q;  2YTY A;  4ALP A;  3HZX A;  4UDU C;  1IL2 A;  3HOY B;  1SJH D;  5KNB A;  4A3B G;  1A0I A;  1HRJ A;  3HOW B;  4GKJ Q;  3S14 H;  2O5I C;  1YJN A;  2MUY A;  1KDA A;  1SNO A;  4JI3 L;  2IL8 A;  4RH6 A;  1D5Z C;  4DA2 A;  2XN9 C;  3A54 A;  1HCZ A;  5GAD C;  4C3J B;  4IPH A;  1VQC A;  3PV0 A;  1TR5 A;  1KXL A;  1EOV A;  1ICF B;  3E6Z X;  2NVY B;  4S3S A;  2YU9 B;  2UXD Q;  3UE0 A;  4LFA Q;  1A8V A;  3J80 i;  1IL8 A;  2DNC A;  1U4P A;  5C5L A;  1EU3 A;  4P72 A;  1BCP B;  5C0X J;  1N33 L;  3T51 B;  2C9O A;  2F0V A;  1JQY D;  2RSN A;  1JT8 A;  1X3P A;  1GJX A;  3QOJ A;  4N8X 1;  1Q1E A;  3M3Y H;  4OHJ A;  4CBV A;  2QF7 A;  3F2D A;  4IUT A;  1XWE A;  1JWS D;  2IX0 A;  1I4R A;  4K8I A;  3AU7 A;  2PZU A;  5K5P A;  3PCO B;  2LXK A;  5J1Z A;  5M3F G;  3I4M B;  1WCM G;  3GTK H;  4C3I B;  1G2T A;  1IYJ B;  2A6E D;  4EQ5 A;  1VQ4 A;  3ONA B;  1VF7 A;  1S5C D;  4A75 A;  3AEV A;  2BE5 D;  2K03 A;  1VQH A;  5CV4 A;  1KLU D;  3TP5 A;  2A5H A;  2Q8T A;  4DV6 L;  2E5L Q;  2VW9 A;  2TMP A;  1TWC H;  1EY0 A;  1PTO F;  1A15 A;  1SE8 A;  4IJL A;  3BDO A;  3MXN B;  5IP7 G;  1SFO B;  4FDB A;  4KKS A;  2YV5 A;  1SDF A;  3TQY A;  3S16 B;  4EX5 A;  3TDQ A;  4FVM A;  4GKK L;  2ZTD A;  1WTP A;  5IT9 E;  2PCF B;  3VR4 A;  2SDF A;  3FPU B;  4B3R L;  1BBW A;  3OIP A;  2L9H A;  4FP5 D;  1EIY B;  1KHI A;  5EBD A;  3SDZ A;  3A0J A;  1IBL Q;  4DR6 L;  3AB9 A;  1K9M C;  1GHJ A;  3DWQ A;  4NXN Q;  3CME A;  4I7Z C;  4K2K A;  2B2W A;  1XMQ Q;  1GKH A;  3TZD A;  4R4Q A;  3FDT A;  2X69 A;  5C3E B;  2UU9 Q;  2DN8 A;  3HOX G;  2KCM A;  4R4I A;  1V1Q A;  5FK9 C;  4A3I B;  3H91 A;  3H3V I;  3SK4 A;  4LFA L;  3P20 A;  1VQG A;  3TME A;  4J8Q A;  3SHL A;  2EYJ A;  3CCS A;  3PF5 A;  2AWO A;  1MIU A;  3AYH B;  1XNQ L;  3PUW A;  3HP3 A;  4PZ8 A;  4I7A A;  2AQ1 B;  1BCP C;  5HGT A;  1O7L A;  1CT1 D;  2A69 D;  4AYB G;  5CBA E;  1U5K A;  1HNX Q;  3G7L A;  1KL9 A;  2OCE A;  1GUN A;  3D6W A;  1XMO L;  2GVA A;  1N34 L;  3F1Z A;  4DV4 L;  3M85 A;  1DJR D;  3MXN A;  1YHB A;  5C4H A;  4BBS H;  2F0U A;  2HHH L;  3M4Q A;  4JI6 L;  3KUP A;  2K5D A;  4LFB Q;  1H9J A;  2PPB C;  3FKI B;  1SRU A;  4WRD A;  4KLK A;  4DPG A;  3D4R A;  3A8K E;  2F3I A;  3I90 A;  1LM0 A;  5FJ8 H;  5JEA H;  3A55 A;  4DAV A;  1H9K A;  2WAC A;  1XMQ L;  1JOO A;  2D9U A;  1HZC A;  1UE1 A;  1DM0 B;  1NTG A;  1B3A A;  4FNF A;  1LT6 D;  5C0X G;  3DXJ C;  4DV5 L;  1S5D D;  3V05 A;  1VS0 A;  1A2U A;  1IYU A;  4YWL A;  4KN7 C;  4B08 A;  4K0K Q;  3S14 B;  3X3M A;  2FJ2 A;  1ILP A;  1F9Q A;  2PZW A;  1FNW A;  4CJ2 C;  4DGZ A;  3E5S A;  1XXG A;  3RLN A;  1D5X C;  3NQI A;  5KNC A;  4LWC A;  3CMA A;  2EJM A;  3HS0 C;  4G7H C;  4A3L G;  1KAA A;  2RCN A;  1NR4 A;  5E4W C;  1IKM A;  1U9R A;  1C9O A;  1PFS A;  5ELB A;  2F4V Q;  5IGE A;  2XRQ D;  4DNR B;  4KD4 A;  5H1S E;  1F9P A;  1E7Z A;  4A3J H;  1RTO A;  1DGS A;  2B2Y C;  1OXX K;  3CRL C;  3KLS A;  4XT1 B;  4V19 0;  2WB1 G;  2DY8 A;  1QG7 A;  1QVC A;  4IFD I;  3GTK B;  4XQJ A;  1EQQ A;  1XNR L;  3SK6 A;  1R9T H;  4ME3 A;  4A3K G;  1PZK D;  4CDF C;  1RD9 D;  5IY0 A;  3KYH C;  1A6X A;  3FEW X;  1M1K C;  4M1U B;  3I2Z A;  4DV7 L;  2CQA A;  1Q82 C;  2CW0 D;  4DV1 L;  3FHW A;  3G6J B;  5IP7 H;  1BKB A;  1JE4 A;  4AYB B;  2WAQ G;  2MHV A;  4RGM A;  4P73 A;  1MI2 A;  2A73 B;  1CSQ A;  1PH4 A;  3J80 L;  2Z6B A;  3K0Y A;  4A93 G;  5KRU A;  2HIX A;  3S24 A;  3TSS A;  1HR0 L;  1WOC A;  4AQY L;  4FF4 A;  4K6D A;  4R9W A;  5FLX E;  1Q46 A;  5C3X A;  2Z9H A;  5J39 A;  1ZEQ X;  3BU2 A;  4YWM A;  1J5E Q;  1B1Z A;  1JE5 A;  2ID0 A;  3OYY A;  3OW7 A;  3GDE A;  4IFD J;  3P1H A;  3SGI A;  1TT2 A;  1X3F A;  2PW5 A;  1YZ6 A;  4A3M G;  1V9P A;  4N8F A;  2PO4 A;  3R93 A;  5KYI A;  3PO3 G;  4KKU A;  2CH4 W;  3HKS A;  4P74 A;  1B9N A;  1EY8 A;  1CTM A;  3K59 A;  5E7N A;  3K6O A;  2B2W C;  2VQE Q;  4YY3 Q;  2K5W A;  5GAG C;  3EFX D;  1ROD A;  2JN4 A;  4IO9 A;  1KAB A;  1G8Z D;  1I3Q H;  1YEZ A;  3QR8 A;  5AJ3 L;  1WD1 A;  4DV2 Q;  2KOL A;  5IGB A;  3U9S A;  3L7Z C;  1JMC A;  4LNQ A;  1ESF A;  1U4M A;  1IBM L;  4LF5 L;  2ZXP A;  2DGY A;  4QIW B;  2J4X A;  5EQ0 A;  4QCL A;  2PYK A;  5JVH 3;  1WTX A;  2B63 H;  4JYA L;  3NSW A;  5ELN A;  3V2T A;  2RSO A;  5FLX c;  4IUP A;  1WI5 A;  4DV3 L;  1JJC B;  3IKJ A;  4C1N I;  1SJE D;  3MEF A;  2LY7 A;  3BYT B;  2EYO A;  5IE8 A;  2MO0 A;  5COR A;  3NEL A;  3RN2 A;  4QB4 A;  1X9N A;  3S16 H;  3S1Q B;  4RGN A;  4DV2 L;  4Y7N H;  4HID A;  1FJG Q;  1P16 A;  2HQL A;  1A2T A;  2RKS A;  4IUR A;  4JI1 L;  1CI3 M;  3VA5 A;  5A2Q E;  4PMB A;  1PZI D;  4UP7 A;  3T13 A;  1GM5 A;  1VQK A;  1EEI D;  4RHR A;  4ZKC B;  4JBK A;  3T56 B;  5M3F B;  1TS4 A;  1YHQ A;  4C3H B;  5JJK A;  4DAP A;  3MFY A;  3I55 A;  2KEE A;  1NMF A;  3RR5 A;  4LF4 L;  1SNM A;  4RFB A;  4JOI A;  4B9X A;  1M4V A;  1PDQ A;  1QNU A;  1H95 A;  1GXD C;  4PMW A;  1V1P B;  4LF9 Q;  3K5L A;  4HSV A;  4DV6 Q;  1SXT A;  2UXD L;  1II3 A;  4JBJ A;  2IHF A;  2OF1 A;  1YIT A;  1TWG B;  2R93 G;  3HOZ H;  3D8G A;  5TSS A;  1X55 A;  3J81 c;  3KFU A;  2E2H B;  1W3S A;  3HKZ B;  1PVO A;  2R92 G;  4JI5 L;  4ZQ3 A;  1RJT A;  4KV6 A;  2ZM6 Q;  1KNE A;  2QA4 A;  4C3J H;  4WOR A;  2JA7 G;  2VS1 A;  3LX0 A;  1TS3 A;  2K5N A;  5IYD G;  1SLJ A;  4DF7 A;  4KI0 A;  3S1R H;  1EWC A;  5DLQ E;  4DNI A;  3ERQ A;  4HJA A;  1Y1W G;  4BY1 G;  3TP6 A;  5IT9 c;  4L63 B;  4DR6 Q;  1SMX A;  2FFK B;  2LXJ A;  2F0K A;  3MFG A;  2O4X A;  1WVL A;  3JAM c;  4A3F G;  3CW2 C;  2JA6 G;  1NR2 A;  2KED A;  1EZ6 A;  1PA6 A;  3CCQ A;  2JXM B;  1ENF A;  2BA1 A;  2D62 A;  4A3M H;  1AW7 A;  1SNP A;  3NTH A;  2RCF A;  4R4T A;  2ENB A;  5EPJ A;  3CKI B;  2A19 A;  4UP9 A;  3SXH A;  1VQ5 A;  1KD1 C;  3M4O B;  1SEB D;  2IPK D;  5D3I B;  1AE3 A;  1S72 A;  4R1J A;  1O7I A;  4OIK A;  1L0X B;  2LSS A;  1K3R A;  1I4G A;  1GD7 A;  5IOD A;  3FVQ A;  4LW1 A;  3FKI G;  2PI2 E;  1UE7 A;  3HFZ B;  5C44 B;  3M9B A;  4RWS C;  3TP8 A;  2I5H A;  2I0Q A;  3KK7 A;  2NZO A;  1HNZ Q;  1QJO A;  3CHB D;  1Y8P B;  2NVQ H;  5A35 A;  2CWP A;  3RMH A;  1SYC A;  1Y1V B;  4BY7 B;  4IPG A;  3PIO 3;  4A3K B;  1PLF A;  3PF4 A;  2E2I B;  4B9W A;  1AZP A;  2F0Q A;  1PH6 A;  1HQR D;  3C46 A;  2R6G A;  3MEH A;  3GTG H;  5FO9 B;  1EY4 A;  1MSH A;  2R7F A;  1PYS B;  3I3C A;  2R93 H;  2E2H H;  5LMU Q;  4U67 3;  3NQT A;  3Q24 A;  3HKZ G;  1S40 A;  3EIV A;  3U4V A;  3J81 i;  1G91 A;  2OEO A;  3L2P A;  3VA7 A;  3CC7 A;  4MZ9 A;  4DR2 Q;  3K7U C;  1I94 L;  2NVX B;  1I4Q A;  4NP5 A;  4LF8 Q;  1A3T A;  2FIN B;  2NN6 I;  4K8J A;  1E1T A;  1N36 Q;  1EFW A;  1GVP A;  1YNX A;  4LAA A;  4EQO A;  3CCM A;  4OIJ A;  2XTI A;  3AFP A;  3I8Z A;  3K58 A;  4JCV E;  4BA1 I;  1IW7 D;  4A3B B;  4GOP A;  1Q12 A;  1IBK L;  3BZC A;  4IN3 A;  4A3F B;  2JJQ A;  2JSO A;  2JA7 H;  2F1M A;  3F2C A;  2OWO A;  1JCK B;  5JJZ A;  3PO2 B;  4M8A A;  1SYE A;  4YHH L;  3I4N H;  5IP9 H;  3CCU A;  1UE6 A;  2EXD A;  1KIX A;  1C4Q A;  1E3P A;  4R4C A;  3F2B A;  4BY1 H;  2JYO A;  4A3M B;  5JAV A;  5CMD A;  5IP9 G;  2ICI A;  2BH8 A;  3T1H L;  4J6H A;  1SND A;  3PUZ A;  1Q8K A;  2B63 B;  2A69 C;  3LWU A;  1J5E L;  2Y0S G;  1K3B C;  1OXU A;  4LUZ A;  1LV9 A;  5D65 A;  5E4X A;  4EGV A;  5C44 H;  3NP8 A;  3K7A B;  3MHB A;  4K5V A;  5T1I A;  2WFW A;  2RQX A;  4A3J G;  5C4X B;  1QOH A;  3GV3 A;  4OON A;  2UUB L;  4BBR G;  4DAY A;  3M4P A;  4H02 A;  4KJO A;  1STE A;  1B50 A;  1YVC A;  3K80 C;  1C48 A;  2F0H A;  1JOK A;  3STB D;  3HRZ C;  4GZY C;  4JBM A;  2PQA A;  1MSG A;  1K8M A;  4IZ8 A;  2Q2U A;  1DD2 A;  1XPU A;  1AEX A;  1SRO A;  2FXQ A;  2ZJQ A;  3S2H B;  1CKO A;  3I91 A;  1O80 A;  5HY6 A;  2RA4 A;  5HUR A;  4K5X A;  1BUV T;  2FMC A;  1B3Q A;  2UXC L;  1JB3 A;  4ME5 A;  1CHP D;  2D0P A;  4TRD A;  2YYZ A;  4AIM A;  1PTO B;  2L0C A;  2KEN A;  3HOZ G;  2R93 B;  3GP7 A;  4UP8 A;  1BQQ T;  4XIG S;  3NBI A;  4OX9 Q;  1EIH A;  3VR3 A;  1ICW A;  3CCR A;  1X3E A;  2A6E C;  3QIA A;  5JEA G;  1LT3 D;  4HJ7 A;  4OWW B;  2B8G A;  4C2M B;  4KHP Q;  3K7A H;  2A6H D;  4A3G G;  3PUV A;  5IYC G;  5LMN L;  5I9O A;  4A93 B;  2CFM A;  2WV6 D;  4RCO A;  2KA7 A;  2Z8L A;  4ID6 A;  1FYC A;  3BG3 A;  4GKJ L;  2LMC B;  2KJX A;  4K0K L;  2HIV A;  2F0N A;  4GOP B;  3KLW A;  2K01 A;  1CHQ D;  1K0S A;  1V8Q A;  3K5M A;  1CSP A;  2HCC A;  4DKA C;  1PH1 A;  2GVB A;  4BY1 B;  4ZLT F;  1X54 A;  1CK1 A;  1UEB A;  3W1B A;  4A3D H;  4C3I G;  2NVT B;  1ESR A;  3SVM A;  2F0D A;  2VZA A;  1EY7 A;  3PO2 H;  5IIF A;  4CKE A;  2HCI A;  2WP8 J;  4LK1 C;  2EIF A;  3P7J A;  4HN7 A;  2GN5 A;  2SNM A;  5EAY A;  1K0R A;  1I4H A;  5T1G A;  4AH6 A;  2ICE C;  5JJL A;  1STN A;  4POG A;  1IYV A;  1YNJ C;  1Q86 C;  2BA0 A;  1EEF D;  2ZJP A;  1X3Q A;  4APV A;  1FGB D;  4X3S A;  2PZT A;  1LAC A;  2HHH Q;  4JI6 Q;  4HJ5 A;  5C4J B;  4C3J G;  4FF3 A;  1A63 A;  4IUN A;  4A3E G;  2F0I A;  2HT1 A;  3ND8 A;  4DN4 M;  1M90 C;  2CH4 A;  4DAY B;  4LFC Q;  1H9S B;  2AKW B;  3DEO A;  4MIU A;  1GO3 E;  3VR5 A;  1HNX L;  1WJJ A;  4QUC A;  4O42 A;  1KDC A;  3HKZ E;  4O1N A;  5M9O A;  3S1R B;  4L5R C;  1KAW A;  5CV8 A;  1BDO A;  3E9H A;  2NN6 G;  2QIL A;  4ODG A;  4C2M H;  1YNJ D;  4HMJ A;  3UI2 A;  1LT4 D;  2L1B A;  2E2D C;  2VQF Q;  1EU4 A;  5EKL A;  1TVX A;  3MVV A;  5FO7 B;  2ATW A;  1PRT D;  4PQX A;  4ZRZ A;  1E0B A;  2LS0 1;  1IHZ A;  1Y1V H;  2G5D A;  4BY7 H;  1BO0 A;  3BJU A;  4XTC S;  2K5Q A;  5DNF A;  1TWG H;  1N9W A;  2B2T C;  3CP0 A;  3PSI A;  3Q23 A;  1VQF A;  1O7Y A;  2B63 G;  1Z7T A;  3HGB A;  1P8L A;  1L1O B;  2KHS A;  4R4O A;  4X65 L;  4K14 A;  3CAM A;  3WDN A;  2JA6 B;  4B3R Q;  2MGS A;  1CQV A;  4WJ4 A;  2X6G A;  5ELF A;  4YCU A;  4DK3 C;  1I4X A;  1SE4 A;  4HTH A;  1B70 B;  3SEB A;  5EGT A;  1B2T A;  2K5H A;  4HIK A;  1J9O A;  4BBR B;  5CGK A;  1EOT A;  2QCP X;  2E5L L;  2WAQ B;  1YI2 A;  3TP7 A;  4NXM L;  3N6R A;  2BOS A;  2ASB A;  4DUY Q;  5LL6 S;  3RUZ A;  1GUO A;  2E2I H;  5M5X H;  3J81 E;  4P75 A;  3KBX A;  2H1E A;  3K81 C;  3J7Z C;  2R92 B;  1TWF H;  1EWH A;  2M9V A;  2E75 C;  4GLV B;  1YNN C;  2WIN B;  1UEA B;  1PRT C;  4HCS A;  4QGU A;  2Z6K A;  4IFD H;  3A8J E;  1TKW B;  5FOB B;  1T5E A;  4FXK C;  5IOC A;  3TRZ A;  2Q8I B;  1RTN A;  4ABN A;  1VQD A;  1DOL A;  1PRT B;  4JI8 Q;  3HOW G;  1VDZ A;  3DHQ A;  2N8N A;  3OWF A;  3M4O H;  4IUU A;  1S3O A;  4JI4 L;  5E3F A;  4L8J A;  3RLO A;  2PW7 A;  3OIQ A;  2ZM6 L;  4Y52 H;  1BF4 A;  2B3G A;  2KQ3 A;  2N49 A;  1AP0 A;  3ZJY C;  2R7D A;  2V1C C;  5IYB H;  2D2C C;  4CHT B;  1CZW A;  3HOU G;  4NKL A;  4GN3 B;  3M3Y B;  3C1F A;  2OXP A;  4FF2 A;  3HOX B;  1HA6 A;  1G6P A;  4JW0 A;  1PMR A;  3H3V C;  4IJH A;  1PH5 A;  4X64 Q;  2IWH A;  4DR4 L;  2XWB B;  3GTP B;  1RKN A;  1LO5 D;  2I07 B;  1MJC A;  1EUJ A;  2YTV A;  3BDC A;  4LF8 L;  4TQU S;  3GTG B;  3BVM A;  1CFM A;  2F0G A;  2KHI A;  1HFG A;  5CV5 A; 
#chains in the Genus database with same CATH homology
 2AMC B;  3S1R H;  1IBM Q;  5DLQ E;  4DNI A;  4HJA A;  1HZA A;  4JI1 Q;  1Y1W G;  4HJ9 A;  4BY1 G;  3ULJ A;  1MJE A;  5IT9 c;  1C7Y A;  4WJ3 M;  2WAQ E;  4DR7 Q;  4DR6 Q;  1SMX A;  2LXJ A;  1J5E Q;  3HOW H;  2YTX A;  3CCL A;  2K5V A;  4LFC L;  4A3E H;  1PHJ A;  4X62 Q;  4HIM A;  2R92 H;  3JAM c;  2BH2 A;  3JC6 6;  4A3F G;  5JEA J;  3CW2 C;  4YCV A;  1HR0 W;  1MKH A;  2JA6 G;  4PG3 A;  3PUX A;  4JI3 Q;  2A1A A;  1PA6 A;  2UUA L;  5ELO A;  3A5Z B;  3CCQ A;  1VQM A;  2BA1 A;  1VQI A;  2D62 A;  4A3M H;  1IZ6 A;  3HOY G;  1RL2 A;  3BZK A;  4YY3 L;  3OW2 A;  1PH2 A;  2K75 A;  4DAM A;  3J7A 5;  4LUV A;  4YHH Q;  4DR3 L;  4R4T A;  3TEH B;  1KQS A;  1Y1W H;  1V43 A;  5JJI A;  3S1Q H;  2A19 A;  4DR3 Q;  1FL0 A;  4UP9 A;  4A3G H;  4LFB L;  3ULL A;  1N33 Q;  2XGT A;  1CKN A;  2UXB L;  1VQ5 A;  1KD1 C;  4POF A;  4A3F H;  4HIO A;  4DR4 Q;  1AE3 A;  5FLM H;  1S72 A;  3CPW A;  1X3G A;  2ES2 A;  4R1J A;  1Q81 C;  1O7I A;  3ERS X;  4JV5 L;  2JA8 H;  3GTO H;  2CCZ A;  4DR5 Q;  4X62 L;  1XMO Q;  3CXC A;  2E8G A;  1HNW L;  2LSS A;  1K3R A;  4RMF A;  5C4X H;  1GD7 A;  4A3I H;  1NY4 A;  2RHQ B;  4LW1 A;  3FKI G;  5IYB G;  5GAH C;  3G71 A;  2VQE L;  4GOP C;  3I4M H;  2PI2 E;  3F8T A;  3I56 A;  1UE7 A;  3HFZ B;  5M5W H;  3T1Y Q;  1YJW A;  1FJG L;  2R7Z G;  3PUY A;  1VQE A;  3M9B A;  2I5H A;  2I0Q A;  2UUB Q;  4KHP L;  4PZ7 A;  3NEN A;  1L0W A;  1JJ2 A;  2NZO A;  3NEM A;  1Y1V G;  1HNZ Q;  4LF6 L;  4BY7 G;  2KBN A;  4DR1 Q;  2YTY A;  4ALP A;  4O0A A;  1IL2 A;  4DK6 C;  5LMU L;  4A4I A;  2NVQ H;  4A3B G;  2A8V A;  4DR1 L;  1A0I A;  4OO1 G;  2CWP A;  2D0O A;  4GKJ Q;  3A74 A;  3PIO A;  4L5Q A;  1YIJ A;  4IPG A;  3S14 H;  1YJN A;  5GQO A;  3KF6 A;  1VQJ A;  4JI3 L;  4A3C H;  2VUM G;  3FP9 A;  2ZTC A;  4A93 H;  3PF4 A;  1PH8 A;  4TVA B;  1WYD A;  4DUZ Q;  2VNU D;  1PH6 A;  3E0E A;  2VY3 A;  2VUM H;  5GAD C;  1BVS A;  4IPH A;  2JE6 I;  1VQC A;  2R6G A;  1PH3 A;  3PV0 A;  3GTG H;  1KXL A;  1EOV A;  1SFO H;  2UXD Q;  2R7F A;  4GLA C;  2QGQ A;  4LFA Q;  1PYS B;  1A62 A;  2H5X A;  1A8V A;  3J80 i;  3UE0 A;  1QVG A;  2R93 H;  4A3K H;  1WCM H;  1N33 L;  1D7Q A;  4P72 A;  1I50 H;  5C3E G;  5C0X J;  2E2H H;  2PMZ E;  2PQA B;  1XTD A;  3CC2 A;  5LMU Q;  3GTP H;  2JA5 H;  1JT8 A;  1FGU A;  1JB7 A;  3HKZ G;  4O2D A;  1S40 A;  4JI5 Q;  4GN4 B;  4JG2 A;  1Q1E A;  3EIV A;  1E24 A;  3U4V A;  3J81 i;  3M3Y H;  3L2P A;  3F2D A;  1CKN B;  3CC7 A;  4MZ9 A;  4DR2 Q;  3K7U C;  1I94 L;  2CWA A;  2IX0 A;  2WB1 E;  4LF8 Q;  2NN6 I;  4GS3 A;  1N34 Q;  3G48 A;  3KDF B;  1E1T A;  1N36 Q;  1EFW A;  3PCO B;  2LXK A;  1YNX A;  1GVP A;  5M3F G;  3PO2 G;  1WCM G;  1EQR A;  3GTK H;  3CCM A;  1NMG A;  1VQP A;  1N36 L;  1IYJ B;  2IX1 A;  2OQK A;  4JI8 L;  4EQ5 A;  1VQ4 A;  2XTI A;  3AFP A;  4C3H H;  4B3S L;  1PYB A;  4LF9 L;  4A75 A;  4JCV E;  3AEV A;  4BA1 I;  3GTJ H;  1VQH A;  4DV6 L;  2E5L Q;  4NXN L;  4GOP A;  2VW9 A;  1IXR A;  1Q12 A;  1Y14 B;  1IBK L;  4JOI C;  1TWC H;  3BZC A;  3CD6 A;  3TS0 A;  2JJQ A;  2B29 A;  1SE8 A;  1VQ8 A;  4IJL A;  3MXN B;  2AHO B;  4A3D G;  3KJP A;  3NBH B;  5IP7 G;  2JA7 H;  4FDB A;  3F2C A;  2OWO A;  5IWA Q;  2YV5 A;  1EYG A;  1HZ9 A;  2E2J H;  4RG1 A;  4YHH L;  3I4N H;  5IP9 H;  3CCU A;  4IPD A;  3TQY A;  1LUZ A;  1UE6 A;  2EXD A;  4EX5 A;  1KIX A;  4BA2 I;  4IOA A;  1E3P A;  3PO3 H;  1N32 Q;  4GKK L;  2ZTD A;  2OTL A;  4R4C A;  3F2B A;  4BY1 H;  4LF6 Q;  2EQS A;  5IP9 G;  1YJ9 A;  5C3E H;  3RLF A;  4B3T L;  4B3R L;  2BH8 A;  2UXC Q;  1BBW A;  4JBW A;  3T1H L;  4B3M Q;  1D8L A;  4JI0 Q;  2Q2H A;  3PUZ A;  1Q8K A;  1EIY B;  1KHI A;  1I6H H;  1J5E L;  3A0J A;  1IBL Q;  4DR6 L;  4BXX G;  1K9M C;  2Y0S G;  4NXN Q;  3KOJ A;  1AH9 A;  1HNW Q;  3CME A;  1OXU A;  3IRB A;  1YBY A;  1XMQ Q;  4LUZ A;  1Q7Y C;  3GD7 A;  1GKH A;  1Q1B A;  4R4Q A;  2UU9 Q;  3HOX G;  3RN5 A;  1LTL A;  2KCM A;  4DR2 L;  4R4I A;  5C44 H;  2OQ0 A;  2K52 A;  1SR3 A;  4OWT B;  1V1Q A;  5M3M H;  4JI7 L;  2WFW A;  3TRE A;  4A3J G;  2RF4 A;  2MO1 A;  4OON A;  3H3V I;  4YWK A;  4LFA L;  2UUB L;  4BBR G;  1VQG A;  2R7Z H;  3M4P A;  4H02 A;  3CCS A;  4DV5 Q;  3PF5 A;  2AWO A;  1PH9 A;  1MIU A;  3AYH B;  1YVC A;  3K80 C;  3UDF A;  1HNZ L;  3PUW A;  1OXV A;  1VQB A;  1NJI C;  4A76 A;  1IBK Q;  4PZ8 A;  1XNQ L;  3STB D;  3S15 H;  5K36 G;  1G29 1;  4AYB G;  5LMN W;  4A3B H;  4NB3 A;  4JBM A;  2PQA A;  3FKI H;  3GO5 A;  1U5K A;  4QJF A;  1HNX Q;  1AE2 A;  1KL9 A;  2OCE A;  3UDI A;  4X6A H;  4LF4 Q;  2Q2U A;  4GN5 A;  5AJ3 Q;  2GVA A;  1XMO L;  1SRO A;  4LF7 Q;  1XPU A;  5HGQ A;  2FXQ A;  1N8R C;  1N34 L;  2ZJQ A;  3F1Z A;  1SN8 A;  3UDG A;  1Z47 A;  1CKO A;  4DV4 L;  4AQY Q;  1OTC A;  3M85 A;  3KF8 B;  5HY6 A;  1YHB A;  1TXY A;  4BBS H;  2HHH L;  3T1H Q;  3M4Q A;  4JI6 L;  2JEA I;  2UXC L;  3OTO Q;  4LFB Q;  1SRU A;  2D0P A;  4KLK A;  3D0F A;  3K0X A;  4DPG A;  2F3I A;  2YYZ A;  1LM0 A;  1VQO A;  4AIM A;  5FJ8 H;  3H15 A;  2KEN A;  1XMQ L;  1VQ6 A;  3EBE A;  3HOZ G;  2N3S A;  4UP8 A;  4XIG S;  4DR5 L;  4OX9 Q;  2NVY H;  2YU9 H;  5FLM G;  3KDF A;  3CCR A;  1HZC A;  1X3E A;  2ZJR A;  5JEA G;  1UE1 A;  4HJ7 A;  4OWW B;  4P71 A;  4L5T A;  3RNU A;  4KHP Q;  1ASY A;  1NTG A;  3K7A H;  1ASZ A;  4A3G G;  4UPA A;  3PUV A;  5C0X G;  5IYC G;  1WFQ A;  3KJO A;  5LMN L;  3S2D H;  4DR7 L;  2VQF L;  1X6O A;  4DV5 L;  1KRS A;  1VS0 A;  2CFM A;  1XPR A;  4YWL A;  4A3C G;  1L1O C;  4K0K Q;  3UDX A;  1K83 H;  4GKJ L;  2ZTE A;  4K0K L;  3HOX H;  2HIV A;  1YHA A;  2CQO A;  5J3B A;  4GOP B;  1PV4 A;  3K8A A;  2IY5 B;  2ALY B;  3KLW A;  2L15 A;  5GAE C;  2UU9 L;  3EN2 A;  3RLN A;  3CMA A;  4LWC A;  1CSP A;  4DKA C;  4A3L G;  1PH1 A;  1E1O A;  2GVB A;  2RCN A;  1X54 A;  1UEB A;  3W1B A;  4A3D H;  3S2H H;  4DV4 Q;  2Z0S A;  4BBS G;  2K4K A;  2F4V L;  1QZG A;  3KF6 B;  1XJV A;  2VZA A;  1C9O A;  1PFS A;  2F4V Q;  3PO2 H;  4JI0 L;  4IPC A;  5M5Y H;  5M3F H;  2WP8 J;  2EIF A;  5H1S E;  4A3J H;  1BBU A;  1E7Z A;  2JEB I;  1EIF A;  3W5O A;  2GN5 A;  3ICE A;  1T9H A;  2MQH A;  1DGS A;  1K0R A;  5EAY A;  1W2B A;  1OXX K;  4AH6 A;  3JAM i;  2WB1 G;  5JJL A;  1KC8 C;  1VQL A;  1QVC A;  4POG A;  4IFD I;  4OO1 I;  1B7Y B;  4C3I H;  1Q86 C;  5IWA L;  5GRO A;  1HZB A;  1EQQ A;  1XNR L;  2BA0 A;  3I7F A;  4X65 Q;  2ZJP A;  1R9T H;  2IT1 A;  4APV A;  1PH7 A;  4ME3 A;  2K14 A;  3ULP A;  3PIP A;  2KCT A;  4A3K G;  2HHH Q;  4JI6 Q;  4HJ5 A;  4HJ8 A;  5IY0 A;  2PNH A;  3KYH C;  1A63 A;  4A3E G;  1M1K C;  3I2Z A;  4DV7 L;  2I5L X;  2HT1 A;  1Q82 C;  1TWA H;  4DV1 L;  3FHW A;  1M90 C;  5IP7 H;  4DAY B;  1BKB A;  4LFC Q;  2AKW B;  1FVI A;  4YCW A;  1GO3 E;  4DV1 Q;  1IBL L;  4J15 A;  4QQB X;  3U4Z A;  1HNX L;  2WAQ G;  2OTJ A;  4JI2 Q;  1WJJ A;  3CC4 A;  4NXM Q;  4P73 A;  4JYA Q;  1I94 Q;  2QEX A;  3M7N A;  2MFI A;  1CSQ A;  3PGZ A;  4JI4 Q;  1PH4 A;  3HKZ E;  1TWH H;  4L5R C;  1KAW A;  4PZ6 A;  3GTL H;  1OXT A;  4A93 G;  3E9H A;  2NN6 G;  4C2M H;  2HIX A;  2DUD A;  1XNR Q;  1G51 A;  3I4M G;  3H0G H;  1UE5 A;  3S24 A;  1HR0 L;  1WOC A;  2VQF Q;  4AQY L;  1K73 C;  4JI7 Q;  2ATW A;  1Q46 A;  2Y0S E;  3H0G G;  1LYL A;  1OXS C;  1Y1V H;  2JA9 A;  3TS2 A;  4BY7 H;  5C0X I;  2K50 A;  3BJU A;  3BU2 A;  4XTC S;  4YWM A;  3W1G A;  1JE5 A;  2ID0 A;  1TWG H;  1N9W A;  3CP0 A;  5BR8 Q;  1UWV A;  3PSI A;  4UY8 C;  3OYY A;  3I4N G;  1VQF A;  3HOY H;  4DV3 Q;  2B63 G;  3GDE A;  1HH2 P;  3U50 C;  4IFD J;  1HJP A;  4MTN A;  3SGI A;  1VQN A;  5C4J H;  1P8L A;  1L1O B;  4X65 L;  4R4O A;  4L5S A;  4OX9 L;  1QZH A;  1N32 L;  3L0O A;  1X3F A;  3I4O A;  4LUO A;  2NVX H;  3CAM A;  1YZ6 A;  4JC0 A;  3G6E A;  1V9P A;  4A3M G;  2UUC Q;  3RZO H;  4B3R Q;  4WJ4 A;  2Q2I A;  3CCJ A;  3CCV A;  4YCU A;  4DK3 C;  3PO3 G;  1J6Q A;  2UXB Q;  3HKS A;  4P74 A;  3J80 c;  1E22 A;  1B70 B;  1NBW A;  2K5H A;  4X66 L;  3CCE A;  4HIK A;  5E7N A;  3GTQ H;  2E5L L;  4DV0 Q;  4A3I G;  5C4X G;  4KHZ A;  4X64 L;  1YI2 A;  4JI2 L;  3S17 H;  4NXM L;  1KRT A;  2VQE Q;  1C0A A;  4IOC A;  4YY3 Q;  2JA5 G;  2JK8 A;  5GAG C;  5M3M G;  4IO9 A;  1I3Q H;  1YEZ A;  5AJ3 L;  4DUZ L;  2UUA Q;  2JQO A;  3DM3 A;  4DV2 Q;  2ASB A;  4DUY Q;  2F52 A;  2RHS B;  2KHJ A;  3L7Z C;  1HR0 Q;  1JMC A;  2E2I H;  4LNQ A;  4IFD G;  5C44 G;  1IBM L;  1NE3 A;  5M5X H;  4P75 A;  4LF5 L;  4GNX C;  4B3T Q;  5FJ8 G;  3OTO L;  4BXX H;  1XNQ Q;  1I5F A;  3K81 C;  3J7Z C;  1X56 A;  3HOU H;  3HOV H;  2DGY A;  1RIP A;  1Z9F A;  2I5M X;  1TWF H;  2B63 H;  4JYA L;  5ELN A;  3STB C;  5FLX c;  2VL6 A;  1WI5 A;  4GLV B;  4DV3 L;  3HOV G;  1JJC B;  3CQZ H;  4LF7 L;  1B8A A;  3T1Y L;  3MEF A;  2N78 A;  4QGU A;  5IE8 A;  2MO0 A;  2Z6K A;  3NEL A;  4GLX A;  2IHE A;  3RN2 A;  1X9N A;  3DLL A;  3S16 H;  2C35 B;  3E9I A;  4Y7N H;  4DV2 L;  4HID A;  4GNX B;  1VQ9 A;  3D31 A;  1FJG Q;  3TRZ A;  1P16 A;  3WWV A;  3LGJ A;  2HQL A;  1VQD A;  2PI2 A;  4OXP A;  4JI8 Q;  4B3S Q;  1VCI A;  4JI1 L;  3HOW G;  3J81 j;  3H3V H;  1EWI A;  4UP7 A;  4QL5 A;  4BBR H;  1QUQ B;  2CKZ B;  2Z6K C;  1GM5 A;  5BR8 L;  4B3M L;  2N8N A;  1VQK A;  3S1N H;  3M4O H;  3ER0 A;  4X66 Q;  1L2F A;  1VQA A;  3AFQ A;  4JBK A;  4A3L H;  1S3O A;  4JI4 L;  3A5U A;  1QUQ A;  3B6Y A;  4NPS A;  3RLO A;  3U58 A;  1YHQ A;  1QVF A;  5JJK A;  2ZM6 L;  1U0L A;  1XPO A;  3I55 A;  2JA6 H;  2NVT H;  1NMF A;  4Y52 H;  2UUC L;  4QY7 A;  2B3G A;  2JA8 G;  3RR5 A;  4LF4 L;  2N49 A;  5IYC H;  3ZJY C;  4GNX A;  2R7D A;  2Q2T A;  1VQ7 A;  4JOI A;  2V1C C;  3AQQ A;  4DUY L;  5IYB H;  1H95 A;  3G4S A;  4PMW A;  5IYD H;  4LF9 Q;  1K8G A;  4LF5 Q;  1CKM A;  1K8A C;  4GN3 B;  3HOU G;  2NZH A;  4DV6 Q;  3CF5 A;  3GTM H;  2UXD L;  4MNO A;  4JBJ A;  4AYB E;  1G6P A;  2IHF A;  3VDY A;  1YIT A;  4DV7 Q;  4IJH A;  1PH5 A;  3HOZ H;  3RZD H;  4X64 Q;  2MNA A;  4DR4 L;  2R93 G;  1X55 A;  3J81 c;  4DV0 L;  3KFU A;  1MJC A;  1W3S A;  1EUJ A;  4JV5 Q;  1PVO A;  2YTV A;  2R92 G;  4JI5 L;  3UE1 A;  4LF8 L;  3CPF A;  2AWN A;  4TQU S;  2ZM6 Q;  2QA4 A;  1JJG A;  4C3J H;  2JA7 G;  1L1O A;  2KHI A;  2VS1 A;  3S1M H;  4GKK Q;  4QIW E;  3Q8D A;  1X65 A;  2K5N A;  4OWX B;  5IYD G;  5LMN Q;  1SLJ A;  1CUK A;  4KI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...