1VQDA

Gene v protein mutant with val 35 replaced by ile 35 and ile 47 replaced by leu 47 (v35i, i47l)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYIDLGNEYPVLVKLTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
total genus 10
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqdA00
5LMNQ 3GO5A 5IYCG 1CKMA 3GTLH 5IYDH 4IJHA 4IFDG 2HT1A 4AIMA 3PF5A 1AE3A 3DLLA 1SR3A 4LUOA 1R9TH 4HIDA 2LXKA 1P8LA 1QUQB 1Q7YC 1XPRA 2AKWB 4P73A 2R6GA 3RZDH 4DR2Q 1WYDA 1XNQQ 1HZAA 2BA1A 3M4OH 3ZJYC 2XTIA 2JA7G 1WFQA 3UDIA 1FL0A 2JA6G 4DK6C 1CUKA 2JEBI 1VQFA 4DV0Q 3PUWA 4R4OA 4YCWA 1X9NA 1V1QA 1VQEA 1TWFH 3OYYA 4R1JA 3JAMc 4L5TA 5GAHC 1EOVA 1YZ6A 2B3GA 2I5HA 1QVCA 1Q86C 2Z6KA 5C44H 2LXJA 3HKZE 3CCMA 4DR5L 4BY7H 2A19A 4X64L 3I4OA 3FP9A 1XMOL 1IBKQ 5ELNA 4IFDI 1XNRL 1V9PA 4LUVA 1M1KC 1VQPA 1UE5A 1W3SA 2IX0A 1N33L 4DV6L 3VDYA 1M90C 1XTDA 5GAGC 3RN5A 2B29A 1G291 5IWAL 4A3LG 1X3GA 3CMAA 3CC2A 4DV3Q 5IYDG 4QQBX 5JJIA 1SRUA 2R7ZG 4A3BH 3G71A 5C3EG 4B3MQ 3IRBA 4WJ4A 1FJGQ 4AQYQ 1EWIA 2YU9H 1B70B 3ULLA 2Q2TA 2XGTA 5IE8A 5GADC 1WCMH 2MFIA 2VQFQ 4B3TL 4JI3Q 2UXCL 1VQBA 3HOUH 2ZM6L 2NVTH 1HZ9A 2I5MX 3FKIG 3PV0A 3UE1A 3M9BA 4MZ9A 4DV1Q 4HIOA 4IO9A 1G6PA 3DM3A 4ALPA 5JJKA 1YBYA 3HOWH 2R92G 2C35B 3CAMA 4DR3Q 3W1GA 1A0IA 1K83H 1KRSA 2E8GA 1I5FA 3NENA 4GN3B 1Q46A 4JOIC 3J7ZC 3OTOQ 1VQMA 4GNXC 2L15A 3PGZA 1J5EL 1VQKA 3LGJA 4B3TQ 3JC66 2YYZA 4A3GG 3RN2A 1K0RA 3BZKA 4TVAB 1VQ4A 3H3VI 1YITA 1VQIA 2MO1A 4Y7NH 1S72A 3U50C 3ER0A 3G4SA 1EQRA 2RHSB 3AFQA 4LF8L 4BBSH 2AWOA 4DR6Q 1VQGA 4IOCA 3T1YQ 1SE8A 2CWPA 4FDBA 4JV5Q 4JI0Q 3U58A 2NZHA 4DR7L 1H95A 4DV2L 1PH5A 2ASBA 1WI5A 3NELA 3CC7A 3G6EA 1GM5A 4OX9L 4GN5A 4IPHA 2BA0A 3AFPA 1Y1WG 4GKJQ 3K7UC 3T1HL 3MEFA 4YCVA 1U5KA 3AQQA 3L7ZC 4A3CG 1IL2A 3MXNB 5JEAG 2K5HA 3E9IA 1IBLQ 1VQNA 3J81i 5IYBG 1QZHA 1L1OB 1HH2P 3ULPA 1Q82C 1KIXA 3UE0A 4DV2Q 2VZAA 3EIVA 1IBMQ 4B3RQ 3KFUA 3CCVA 1VQ9A 3PUXA 2EXDA 4R4CA 3CQZH 2MO0A 3Q8DA 4NXNL 1CSPA 3SGIA 2ID0A 1X56A 3I4NG 4H02A 2UU9L 4GKJL 5C0XG 4LNQA 2HQLA 3CW2C 4X64Q 1NMFA 1OXTA 3I4NH 4L5RC 4YHHQ 5LMUQ 4GLXA 4LF6Q 4AH6A 4LUZA 3S1QH 5IP9G 5JEAJ 3AYHB 1E3PA 2A8VA 2K52A 2D62A 2YV5A 5IP9H 1VQDA 3FKIH 3RR5A 1PH1A 2NZOA 3H0GH 1MJCA 5M3MG 1YJNA 1EIFA 2F4VL 3OW2A 1X65A 4DPGA 4XTCS 1N8RC 1N32Q 2JA7H 1RL2A 4JBJA 5IP7H 5AJ3L 1XJVA 5BR8Q 1JJ2A 1I94L 3RNUA 3AEVA 1HZCA 1Y1VH 2VQEL 1T9HA 1KRTA 1OTCA 3RLNA 2PI2E 3GTJH 2HHHL 4JYAQ 1OXXK 4JCVE 3A74A 3K81C 4JI7L 1TWCH 2KBNA 4DUZQ 4JI8Q 3STBD 2OQ0A 1UWVA 3CP0A 3J80c 3TEHB 2JA8H 4LF4Q 4GOPC 4NXMQ 4BXXH 2AWNA 1YJWA 2UXDL 1VQ8A 3H15A 4DV0L 3G48A 4NPSA 4A3EH 5AJ3Q 5M3FG 1K8GA 4BY7G 2JE6I 2MQHA 3HFZB 4AYBE 2PQAA 4HIKA 4GNXA 4LFCQ 2N49A 2UUBL 2VL6A 1W2BA 1D7QA 2CCZA 4JBMA 1VCIA 1UE6A 3CCSA 2IY5B 2WB1E 3K7AH 1JB7A 4JI7Q 1AE2A 3HOUG 1WJJA 3U4ZA 4GLVB 4A3IG 1QZGA 1HNXL 3CF5A 3KOJA 4JI6Q 2DGYA 3M85A 4ME3A 4J15A 4R4QA 5C4XH 1YIJA 2R7ZH 1UE1A 5C3EH 5C0XI 4Y52H 4UPAA 3CCRA 4DR1Q 3S1RH 5FLXc 2V1CC 4A3JH 2JK8A 4LFBL 1NMGA 1SLJA 4AQYL 3GTPH 3S17H 2UUBQ 2EQSA 1E1OA 3HOXH 4X65L 2RF4A 3T1HQ 2WP8J 3CMEA 1BVSA 4PMWA 1N36Q 1BKBA 3I56A 2JQOA 4JI1L 4DUYQ 1HNXQ 1XMQQ 2KHIA 3ERSX 5ELOA 2OCEA 2GN5A 3D0FA 3HOZH 2VNUD 4HJ9A 4DV7Q 2BH2A 5M5YH 4OWXB 4IPCA 2OTJA 3F2BA 1ASZA 3CCQA 4IJLA 2B63H 3HOWG 3B6YA 2ALYB 1XPOA 1XPUA 2WFWA 2Q2IA 2NN6I 1CKNB 2Y0SG 1C7YA 4NXNQ 1Z9FA 1NE3A 3S2DH 4C3HH 3KF6A 2WAQG 4P71A 2QA4A 1N34Q 3F1ZA 3RLFA 3JAMi 3K80C 4QGUA 4YHHL 3J81j 3L0OA 2HIVA 5LMUL 4UP8A 4LF6L 4GKKQ 2I5LX 4C3JH 2UXBL 2WB1G 1OXUA 4A3FH 4DR2L 4LFAQ 1XNQL 4A3DG 2ZTCA 3F8TA 5C4JH 4DR6L 4K0KQ 5IY0A 4JI5L 5E7NA 1VQHA 4EQ5A 4DV5Q 4JV5L 2UUAQ 2RHQB 3S2HH 1I6HH 2D0PA 5FJ8H 1N32L 5GQOA 2JA8G 1IXRA 2H5XA 1SN8A 1Y1WH 2OTLA 4A3MG 1PVOA 3F2CA 1MIUA 3EN2A 3KF8B 5LMNW 1YJ9A 1N34L 1KQSA 4LF7Q 1PYSB 2NN6G 4HJ8A 1XMOQ 1IBKL 1K8AC 1YHQA 3HOZG 2KCTA 4LF9Q 1EQQA 1KC8C 1SMXA 2VS1A 3NBHB 3KJOA 1B7YB 1LUZA 4PG3A 1VQCA 1PA6A 3J7A5 4YCUA 5JJLA 1YHAA 1JMCA 4HIMA 4DV6Q 3K8AA 4A3KG 2VY3A 1Q81C 3M4QA 2YTVA 2UUCL 4MNOA 4LF4L 1NTGA 2UUAL 3M7NA 4BA2I 4R4TA 2F52A 1OXVA 1B8AA 2AHOB 2UXDQ 1IBML 4B3RL 1VQAA 4A3GH 3GTMH 1E24A 4A3LH 2RCNA 4JC0A 4XIGS 4B3ML 2UU9Q 4JI2L 4TQUS 1PH3A 2PMZE 3M4PA 1UE7A 2Z6KC 4LF9L 1HR0L 2E5LQ 2IHEA 2ZTEA 2JJQA 1HNZQ 4A75A 4R4IA 3GTQH 3HOYG 4EX5A 3I55A 4JOIA 4PZ6A 1PH4A 1WOCA 3CD6A 1CKOA 5HGQA 3TREA 5GROA 3CPWA 4WJ3M 1X54A 1HZBA 4DR3L 3TS0A 5C0XJ 4DR1L 1N9WA 2PI2A 4UY8C 1X55A 1PH8A 4JI2Q 4HJAA 3W5OA 4DKAC 4KHPQ 2VQEQ 4BY1H 2BH8A 1PV4A 3CCLA 3KLWA 1O7IA 3K0XA 4X65Q 1GD7A 2HHHQ 4JYAL 1L2FA 2E5LL 2F3IA 1U0LA 4DUZL 2IHFA 4JI8L 3A5UA 4OONA 1XMQL 1N33Q 3S15H 4X62Q 3PCOB 4YWKA 4YY3L 1FVIA 1EYGA 1KHIA 2VUMG 5K36G 5M3FH 5IWAQ 3CCEA 3KDFB 3BU2A 5IYCH 2FXQA 4DV3L 2ZJRA 3E9HA 4GNXB 1PH2A 4DR7Q 2KHJA 4POFA 1SFOH 1X3EA 1L1OC 5J3BA 3CC4A 4JI4Q 4OX9Q 3H0GG 2R7DA 1Q1EA 4X6AH 1OXSC 1HNWQ 4JG2A 1VQLA 2K5VA 4UP7A 1TWGH 4A4IA 1K9MC 3UDFA 4C3IH 3PIPA 2N3SA 4GS3A 2IX1A 4O0AA 3GTOH 2DUDA 4LWCA 1Y1VG 4X62L 4DV4Q 1E22A 4LFAL 1Q1BA 1C0AA 3GD7A 2HIXA 3TQYA 3CPFA 1IZ6A 2CKZB 3HOVH 1DGSA 4KLKA 3NEMA 1S3OA 1VQ7A 1EIYB 4LFBQ 1A62A 3GTKH 3U4VA 2LSSA 4RMFA 4APVA 4DNIA 3OTOL 2I0QA 2ZJQA 5LMNL 2K50A 4KI0A 2YTYA 1SROA 1NJIC 4A3EG 2JA5H 4A93H 4LF7L 1A63A 1X3FA 3S24A 4DR4Q 3PIOA 4BXXG 1NY4A 5FLMG 1PYBA 4JI1Q 4DUYL 3F2DA 4QL5A 4QJFA 1X6OA 5FLMH 4POGA 2Y0SE 4DV7L 3W1BA 1BBWA 4HJ7A 1K73C 1QVGA 1MJEA 5H1SE 4A3FG 3KDFA 1L1OA 1PH7A 3EBEA 4DK3C 2F4VQ 2Q2HA 4OO1I 4JI0L 3KJPA 5M5WH 4O2DA 3CCJA 1HR0W 3BJUA 3L2PA 5C4XG 2JA9A 2D0OA 4IPGA 1EFWA 4P72A 4LF5L 5IP7G 4DR5Q 2CFMA 5EAYA 1PHJA 4DR4L 5DLQE 1E7ZA 1HR0Q 1HJPA 1XNRQ 4GKKL 1JJGA 1BBUA 1JE5A 1HNZL 1IBLL 4A76A 1V43A 3I4MG 1G51A 4NB3A 4K0KL 4JI5Q 2JA6H 4NXML 4A3MH 2Z0SA 4A3KH 1TWHH 2N8NA 4GLAC 4LW1A 3WWVA 1S40A 3RZOH 4BBSG 2QGQA 2KCMA 4PZ7A 1CSQA 4AYBG 1YHBA 3HKSA 1L0WA 4LF5Q 1E1TA 1IYJB 1FJGL 4KHPL 1NBWA 5IT9c 4A3BG 2VQFL 2B63G 3E0EA 2ZM6Q 4PZ8A 4IPDA 3M3YH 1MKHA 3S1NH 2YTXA 2OQKA 4GOPB 2E2HH 4IOAA 3PO2H 4YWMA 1LTLA 4BBRG 4L5SA 1Q8KA 1VS0A 4A3CH 2MNAA 3S1MH 3PO2G 5M5XH 4JBKA 1AH9A 2QEXA 4X66Q 2NVQH 2NVXH 1TWAH 2K5NA 5BR8L 4A3DH 3RLOA 3PUVA 1I50H 1I3QH 1YEZA 3CXCA 3S16H 1KL9A 1Z47A 4A3JG 1VQOA 3ULJA 1HNWL 4IFDJ 2R7FA 3I4MH 3UDGA 3HOYH 3KYHC 2ATWA 1JJCB 1PH6A 1LYLA 1EUJA 1YNXA 3PUZA 3J81c 4B3SL 3H3VH 2JEAI 2R92H 2OWOA 4UP9A 4DV4L 3A5ZB 2CQOA 2VUMH 3T1YL 2WAQE 4X66L 5C44G 3S14H 3TS2A 2N78A 4OWWB 1CKNA 2KENA 4YWLA 1VQ5A 2ZTDA 4BA1I 1VQJA 4RG1A 4LFCL 3I2ZA 1RIPA 4JI3L 1J6QA 2R93H 4C2MH 4OO1G 3J80i 3PO3H 2K75A 2NVYH 3STBC 2UXCQ 4QY7A 3KF6B 4A3IH 2E2JH 2GVAA 1K3RA 1YVCA 3PO3G 2VW9A 4DV1L 4MTNA 2A1AA 5M3MH 4GOPA 1FGUA 1D8LA 3PF4A 2AMCB 4B3SQ 1PFSA 2UXBQ 4JI6L 2K14A 4GN4B 4YY3Q 3D31A 2ZJPA 4P75A 4HJ5A 4OXPA 1KXLA 4DV5L 1C9OA 3FHWA 5IYBH 3GDEA 2Q2UA 1WCMG 4QIWE 3UDXA 3CCUA 3GTGH 4JI4L 3HOXG 1ASYA 2CWAA 1GVPA 5FJ8G 4JBWA 1J5EQ 3BZCA 4L5QA 1GO3E 4OWTB 1UEBA 1KD1C 5GAEC 1VQ6A 1JT8A 1YI2A 1N36L 2JA5G 3TRZA 2IT1A 3ICEA 1Y14B 1QUQA 3HKZG 4DAMA 4DAYB 2E2IH 2K4KA 3PUYA 2PNHA 4P74A 4LF8Q 3HOVG 1PH9A 1KAWA 1QVFA 3PSIA 2UUCQ 2GVBA 1LM0A 2EIFA 1Q12A 1A8VA 3A0JA 4KHZA 4BY1G 2ES2A 2R93G 1P16A 1TXYA 3I7FA 5HY6A 1I94Q 2PQAB 4BBRH 1GKHA 4A93G
chains in the Genus database with same CATH superfamily
5LMNQ 1CA6A 3U9SA 2EYLA 5J22A 1LTID 1V1PB 1CFMA 2LXKA 1Q7YC 1PLFA 4DR2Q 1WYDA 3H3VC 2JA7G 2JA6G 2JEBI 1G2SA 2F0VA 1X9NA 1V1QA 1DJRD 1TWFH 4R1JA 1ESRA 1QVCA 1TVXA 2A19A 3T16A 3I4OA 1IBKQ 4IFDI 4KJNA 3NTIA 3VYSA 2IX0A 4C3JB 3GTJB 5IWAL 1PRTC 1RCVD 4DV3Q 5IYDG 3GTPB 4F7XA 5L37A 4HEDA 4A3BH 1EY8A 1FJGQ 1B70B 2MFIA 5ELBA 1U4RA 3IAYA 1EQVA 3FKIG 5F2DA 4MZ9A 4WORA 3SDZA 1G6PA 4ALPA 1YBYA 4XYQA 2C35B 4DR3Q 2B39A 4JOIC 4IUVA 4ME5A 3MFYA 4GNXC 5BN5A 1WTQA 2YYZA 3RN2A 2F0UA 3H3VI 1YITA 1VQIA 3G6JB 1S72A 1CI3M 1FNVA 2NWGA 1VF7A 4BBSH 2AWOA 1ET9A 1PFBA 4FDBA 4JV5Q 5FO9B 5A2QL 2NZHA 1PH5A 2ASBA 4GN5A 1WTWA 3NUCA 3AFPA 1BF4A 3K7UC 3U9OA 1JE4A 4XT3B 2O2LD 3P20A 2CQAA 1IHZA 3ULPA 3BVGA 1U4PA 1O78A 2VZAA 3EIVA 1HQRD 3CCVA 2EJGC 2EXDA 4A3KB 2MO0A 4NXNL 1CSPA 2QCPX 2RSOA 5CYUA 4ZKBB 1NMFA 4YHHQ 5LMUQ 4LF6Q 1I4XA 1STEA 1O7YA 5FOBB 2F0EA 2R92B 1E3PA 4C3IB 2K52A 1SEBD 5IP9H 1VQDA 3NK9A 3H0GH 2C9OA 5IGCA 5M3MG 1EIFA 2PZWA 4I7ZC 5HGTA 1DOMA 1N32Q 4XTCS 4BS9A 1RL2A 5BR8Q 3L9AX 2PQEA 5KYLA 1DONA 1BXTA 4K5WA 1D5ZC 1T9HA 1KRTA 1OTCA 3S15B 1O7LA 4JI7L 5CV9A 3VA7A 4DAPA 5AFWA 2JA8H 4LF4Q 2NVYB 2WKCA 1IW7D 1DM0B 3G48A 4A3EH 1S5FD 2PQAA 4HIKA 3LNNA 1W2BA 3HOWB 3CCSA 2WB1E 1BCPD 3K7AH 1JB7A 1I4QA 2EYMA 1AE2A 2A6EC 3U4ZA 1D1KA 1HNXL 2HCIA 4FF1A 4NKLA 4JI6Q 2EOTA 5C4XH 4M8AA 1EYDA 4KJOA 1I4HA 2AUKA 2EYJA 4UPAA 1H9SB 3CCRA 2JK8A 2BE5D 2RQXA 1SLJA 3S17H 2QEJC 1LACA 2WP8J 1BVSA 1N36Q 3I56A 3FPPA 1LTAD 2JQOA 2MHVA 3HOZH 2OCEA 3VYUA 4F87A 1K8MA 1U4MA 3NXWA 2JA5B 2ALYB 2WFWA 3EA6A 1CKNB 1SJHD 2KQ3A 3KF6A 2WKDA 4KK7A 3RLFA 5M9OA 3K80C 1JB3A 3L0OA 3Q22A 5LL6S 1TS5A 4DR2L 3F8TA 2ZXPA 1F2LA 5DAUA 2E2JB 5E7NA 4DV5Q 4JV5L 2RHQB 1I6HH 2D0PA 5FJ8H 5GQOA 2H5XA 2XRSD 1D5XC 3OOCA 3SE0A 5DEHA 3KF8B 4C3IG 1EYCA 3PIP3 3K6OA 1PYSB 4LF7Q 4HJ8A 1YNND 1IBKL 5M5YB 1KC8C 3I72A 2JA6B 3NBHB 1LUZA 5JPMC 1VQCA 3J7A5 3RZDB 1KNEA 4DV6Q 1BQQT 2EDGA 4BA2I 1OXVA 5I2YA 2AHOB 1GHKA 2JXMB 1AW7A 5ELCA 2K7VA 3CU7A 4JI2L 4TQUS 3SK5A 2PMZE 3M4PA 1ET6A 4K2KA 4PMCA 3QOLA 3G7LA 1JWUD 3HG9A 2B2TC 1UEAB 3GV6A 3CD6A 1Y8PB 3CPWA 4WJ3M 3HZXA 2NZ1D 2MPMA 4DR1L 2KHSA 1PH8A 4JI2Q 4KHPQ 1JICA 1GD7A 3K5OA 4O1NA 2DNEA 2F3IA 4XYOA 5D3DA 2L9HA 1XMQL 1N33Q 4FF3A 5FO7B 3Q6SA 1QCBD 3CCEA 3VA5A 4EVOA 3D4WA 2FXQA 2QW7A 2F0GA 5HURA 3PO3B 1PH2A 4DR7Q 4G7HC 4JI4Q 1L1OC 2R7DA 2A69D 3MA2B 4H13C 2K5VA 2A6ED 4U68A 1E2ZA 1PZJD 2CH4W 3FKIB 4QB4A 3R3OA 1TWGH 4A4IA 4CJ1B 4S3SA 4FYDA 4RGMA 2F0NA 3GTOH 1Y1VG 2VB2X 1B3QA 5ISRA 5JJZA 2HIXA 2EE1A 5ELEA 1IZ6A 3HOVH 3GTLB 3NEMA 4XDXA 4EGVA 1VQ7A 1G6ZA 3TSSA 1JQYD 3U4VA 2LSSA 4APVA 3OTOL 3QOJA 1B1ZA 5LMNL 4KI0A 4A3JB 4DF7A 2YTYA 1SROA 4A3EG 2JA5H 1A63A 4HSPA 1WD1A 4QL5A 1SJED 3NBIA 3X3MA 4N8FA 4A3FG 2EY6A 3KDFA 1L1OA 3MC0B 2F4VQ 2EYOA 4JI0L 4OO1I 1PTOC 1EWCA 3BJUA 1QNKA 2JA9A 1JOQA 3I4LA 3AU7A 2K04A 3CRKC 5EAYA 1WTOA 3ONAB 1E7ZA 1LLRD 5FKAC 1HJPA 4GKKL 1JJGA 3HP3A 4A93B 3DWAA 3M4YA 3TN2A 2Z0SA 4FNFA 4BY1B 3ZYYX 3A55A 1SSOA 4LW1A 1S40A 4BBSG 1JCKB 2KOLA 4PZ7A 1STGA 4LF5Q 1IYJB 5IT9c 5IT9L 3HKZB 3C3LA 4A3BG 2V4DA 2D5DA 4I65A 2YTXA 4GOPB 1G91A 1R9TB 4L5SA 1Q8KA 2MNAA 2F0WA 5M5XH 4JBKA 1GUTA 2G5DA 4X66Q 2NVXH 3S16B 3CRLC 4A3DH 1I3QB 3MZ5A 3RLOA 4XQNA 1LT4D 1YEZA 1E2WA 1DOLA 1DXMA 1Z47A 1RTOA 1STAA 1SMYD 1HNWL 2IL8A 4ZQ3A 2ATWA 4L8JA 2KVMA 1VMCA 3PUZA 4UP9A 4J6HA 4DV4L 2E75C 2F4IA 1W6KA 4UDUC 4X66L 5JOBA 1VQ5A 1FD7D 1HFNA 4ABNA 1RODA 1JWSD 2ZTDA 4BA1I 2JA7B 1VQJA 4RG1A 4LFCL 3OPOA 3I2ZA 2R93H 3VR2A 1NNXA 5KEEA 4A3IH 4RGTA 2GA4B 3PO3G 2A1AA 3PF4A 2MP1A 1FGUA 3I3CA 2AMCB 2PYKA 2K14A 4YY3Q 3LWEA 3PQIA 2Z1CA 3Q0AA 1QB5D 4HJ5A 4OXPA 3P75A 5C6AA 1SYBA 2Q2UA 3N52A 3GTGH 1C48A 2JSOA 4JI4L 1GVPA 5FJ8G 1J5EQ 4RKBA 4L5QA 3BZCA 1TQOA 1GO3E 2VXWA 2RBMA 4KKTA 3I73A 4NP5A 3LWUA 2K28A 1KD1C 5GAEC 2SEBD 1D6EC 5C5MA 1Y14B 4DAYB 2E2IH 1D5MC 5DM73 1QVFA 4JW0A 2UUCQ 1LM0A 3FVQA 2EIFA 4OGQC 3A0JA 2A69C 3IFDA 1TXYA 2RCFA 1TWHB 2PQAB 4BBRH 1GKHA 3M7GA 3R93A 5IYDH 2F0FA 5EKIA 3VR4A 3PF5A 1A3VA 2E2DC 3R2TA 1Q90A 4HIDA 2PO4A 5T1GA 2AKWB 4P73A 2R6GA 3SXHA 4DK0A 5E1FA 3RZDH 2K33A 1FR3A 1YNJD 3A54A 3ZJYC 2JP1A 3VR5A 4A3IB 1WFQA 3UDIA 1FL0A 1GUOA 2SDFA 4DK6C 4DV0Q 1VQFA 1T5XD 4R4OA 5BN4A 5GAHC 3K5LA 1YZ6A 2B3GA 2EVBA 2Z6KA 3HKZE 4BWGB 2F0QA 4MN3A 3MAQA 2F0DA 5ELNA 1M1KC 4LUVA 1CM9A 1VQPA 1ML0D 1UE5A 1F2MA 3A56A 3VDYA 1XTDA 1G291 4J8QA 3IRBA 4OL7A 4AQYQ 3ULLA 5IE8A 1WCMH 4B3TL 2UXCL 3I91A 1HZ9A 2I5MX 3M9BA 4DV1Q 1L0XB 3KLSX 4HIOA 4IO9A 2A73B 3P1HA 3PMFA 3K7AB 4X3UA 2Q8RE 3W1GA 2A6HD 1A0IA 1K83H 3NENA 3J7ZC 1I5FA 2MJ8A 3OTOQ 2VUMB 2L15A 4B3TQ 2XVSA 3JC66 4FVMA 2FMCA 1K0RA 2BCOA 2AQ2B 1VQ4A 2MO1A 2KEEA 2PCFB 3U50C 4B9XA 4RHRA 1HXYD 4DR6Q 4IOCA 3WDNA 2EYFA 2KCCA 3OW7A 4CDDC 4DV2L 4X3TA 4OX9L 1SXTA 4V190 4GKJQ 1Y1WG 3MEFA 4YCVA 1U5KA 3L7ZC 4FO2A 3MXNB 2K5HA 3E9IA 1VQNA 4DN4M 5I4DA 3J7AV 1WTXA 2XSCA 1L1OB 1HH2P 1PTOF 3C1EA 4KN7C 1IL8A 4IZ8A 2HQEA 3PUXA 4R4CA 4J1MA 3C1FA 3SGIA 4GKJL 2UU9L 5C0XG 1XYIA 1OXTA 5K36H 4GLXA 2B2UC 4AH6A 1XTCD 4F8MA 2A8VA 3NWTA 1K28A 2G9HD 2KJXA 3FKIH 2B2WA 3RR5A 2NZOA 3S9WA 1PH1A 4DXGA 2HDLA 1SNQA 5IP7H 5AJ3L 1JJ2A 2PPBC 3RNUA 3AEVA 1I6HB 4DNTB 1I4GA 3DHQA 1Y1VH 5C3EB 2R7ZB 3J7YW 1ZXTA 1OXXK 4JCVE 1K3BC 1XWEA 1TWCH 2KBNA 2WAQB 4QIWB 4DUZQ 2OQ0A 4R8NA 2E2HB 1EY6A 3S1NB 3TEHB 4BXXH 1YJWA 2UXDL 2HDMA 4DV0L 4NPSA 4DAVA 2JE6I 5FLXL 1TWAB 1J8IA 4DNRB 4LFCQ 2UUBL 2X6GA 1VCIA 2SOBA 2Z4IA 2NBFA 2QILA 4JI7Q 3HOUG 4GLVB 4K5VA 4OELB 3M85A 1I6VC 1ZYRC 3SEBA 1UE1A 5C3EH 1SYDA 3T53B 1LTGD 5FLXc 1NMGA 4AQYL 3EJIA 1M8AA 1E1OA 2F0JA 3HOXH 2RDFA 2RF4A 2B2VC 1IKLA 3T4AC 3J81L 2M9VA 1HNXQ 3ERSX 5ELOA 2GN5A 3D0FA 5FO8B 1S4ZA 4BY7B 4C1NK 3FRPB 3MVVA 3LX0A 1BBXC 5J39A 1XPOA 3Q23A 2B8GA 2NN6I 1I50B 3K5NA 1Z9FA 5CORA 1X32A 5J1ZA 3A8IE 4OIKA 3F1ZA 4K6DA 5E4XA 4JPBW 3JAMi 4GKKQ 4UP8A 1PFMA 3JAME 4C3JH 1OXUA 3MWYW 4A3DG 2ZTCA 5C4JH 4DR6L 1AEXA 4C2MB 4KKSA 1ICWA 2G9DA 4KD4A 1SN8A 2N55A 4A3MG 1SYFA 3H6MA 1MIUA 1ILQA 2HCCA 3EN2A 5KIXA 2B2TA 3HOZG 1YHQA 3IL8A 2EY1A 2MGSA 1SMXA 4OEMB 3KJOA 4UHVA 4F88A 4IQZA 4PG3A 2L0CA 2I07B 1O7ZA 2YTVA 5EJWA 3M7NA 2F52A 1B8AA 1IBML 2L55A 1VQAA 4B3RL 1WTVA 3GTMH 1E24A 4A3GH 4A3LH 2RCNA 4FF2A 4JC0A 2UU9Q 1PH3A 1UE7A 2O4XA 2Z6KC 1SE4A 2H1EA 3GV3A 4JK1C 3GP7A 1SNMA 1HR0L 4KY5A 1HNZQ 2ENBA 2L5TA 1VDZA 4QCLA 3I55A 2OXPA 5GROA 4CGYB 1HZBA 1EY0A 4DR3L 3OWFA 2QKIC 4UY8C 3W5OA 3NSWA 4DKAC 1O7IA 1TR5A 3K0XA 2RA4A 2FJ2A 1B44D 2B8FA 4CKBA 4DUZL 3A5UA 1F2YA 4HMIA 3A7AB 3PCOB 4WFN3 4YY3L 1FVIA 4X62Q 3AMUA 4RAUC 3BU2A 1QNUA 2R61A 5EQ0A 4C56C 4GNXB 3DWPA 1X3EA 3NWSA 3H0GG 1EWHA 1Q8IA 1OXSC 4CDCC 4TRDA 4Z9CB 1VQLA 4UP7A 2QDLA 2PZUA 3UDFA 4C3IH 3PIPA 2N3SA 2C5CA 2IX1A 3X3NA 4X62L 4H7BA 4LFAL 1CHQD 1C0AA 1I4PA 1QE6A 3TP5A 2EYHA 3TQYA 2CKZB 3SK8A 3GQBA 4KLKA 1EIYB 1MSHA 1A62A 5DNFA 4ZKCB 5IGFA 4TSSA 1G8ZD 1SDFA 1TKWB 4QUCA 4C3HG 1X3FA 2RVLA 4DR4Q 4QJFA 1K73C 3W1BA 1MJEA 5TSSA 1EY4A 3EVQA 4DK3C 1PH7A 2Q2HA 3BDLA 3VR6A 3L2PA 5C4XG 1EIGA 2B63B 2Q8IB 1EFWA 4P72A 2XIWA 2VB3X 1PHJA 4DR4L 1RHPA 5JPNC 5KRUA 1GHJA 1JE5A 2BDNA 1IBLL 1CT1D 2PNRC 1E2VA 1OO9B 4JI5Q 2CVRA 3I4MB 4A3MH 1Z6HA 2R93B 4TKOB 4FF4A 3I90A 3WWVA 1YHBA 3FDTA 4KHPL 1CTMA 2ZM6Q 4PZ8A 4IPDA 1MKHA 3S1NH 1U9RA 2OQKA 1STBA 1K8OA 2F0OA 3PO2G 1PXUA 2NVQH 3S2DB 5LHY1 1I3QH 3H91A 3ERQA 4C3JG 3BYTB 3TMEA 2R7FA 2OT2A 5EBCA 3V96A 3UDGA 3KYHC 1EZ8A 1PH6A 4B3SL 2F0PA 5G3LF 2VUMH 1ZYRD 1SYCA 3S14H 2WAQE 5C44G 1PRTF 1CKNA 5D65A 3NP8A 3KBXA 1RIPA 1J6QA 1IYVA 4C2MH 4OO1G 2BE5C 3J80i 2K75A 3K59A 2NVYH 1HUMA 3WOEA 5IODA 3DXJC 1K3RA 3FEWX 2VW9A 4MTNA 5M3MH 3DEPA 4B3SQ 1FYCA 4JVZA 5IGEA 2ZJPA 4IALA 4ULLA 1KXLA 4DV5L 1C9OA 5IYBH 3GDEA 2OEOA 4OHJA 3MTSA 3HOXG 1ASYA 2CWAA 3BDCA 4DA2A 3C2PA 2K6AA 1KAAA 1UEBA 2CH4A 3TRZA 2IT1A 2XWBB 3ICEA 1QUQA 5D14A 2K4KA 2PNHA 4LF8Q 1KDBA 3HOVG 3MXUA 3P7JA 1Q12A 1ENFA 1EY7A 4KHZA 2Z8LA 1WCMB 3BDOA 3I7FA 2X69A 2H4OA 4AYBG 3JAML 3GO5A 4KD3A 3GTLH 1HRJA 1EU4A 1O80A 4AIMA 2HT1A 2O5JC 3T13A 4P2CB 1AE3A 1ESFA 1SR3A 1JORA 1QUQB 3RMHA 4L63B 1XNQQ 3M4OH 3A8JE 3SVMA 3HOUB 4QMGA 1M4VA 5LL6X 3CC4A 4YCWA 1VQEA 3JAMc 4Y7NH 4L5TA 3J81E 1EOVA 2I5HA 5A2QE 5C44H 4BY7H 4X64L 1EFID 3FP9A 1XMOL 5D3IB 2NYZD 5JVG3 1MSGA 4K8JA 1BR9A 3KBGA 4K6LA 1N33L 3K5MA 1IW7C 1M90C 5GAGC 3RN5A 1HCZA 4A3LG 1E0BA 1H9RA 4QQBX 5JJIA 3GTKB 3G71A 1QG7A 2A74C 2FHTA 2OF1A 3NPPA 2A68D 4LK1C 4BBRB 2Q2TA 1JOKA 4JI3Q 2VQFQ 1T5EA 2ZM6L 2NVTH 3UE1A 1CZWA 1WTRA 5FLXE 3DM3A 3M3YB 5JJKA 2WINB 3KUPA 3CAMA 4IUUA 3CQZB 4GN3B 1K9MC 2E8GA 2JN4A 1Q46A 1VQMA 1VQKA 3LGJA 4Q5VA 4A3GG 4X3KA 3D6CA 1VMPA 1PTOH 3BZKA 4Q0FA 2LS01 3ER0A 3G4SA 3AFQA 2L4NA 2SNSA 5BN3A 1VQGA 2F03A 4FXKC 3E5SA 3T1YQ 2CWPA 1SNCA 4JI0Q 3U58A 3J7AF 1EEID 3NELA 3CC7A 3E0JA 3G6EA 1Y1WB 4ZAIA 1QILA 4EQOA 2XNAC 3T1HL 3AQQA 2RDGA 2IWHA 4A3CG 1IL2A 5JEAG 3EFXD 3MEHA 3J81i 5IYBG 1RKNA 3CKIB 3QR8A 1Q82C 3UE0A 4C1NI 4DV2Q 1IBMQ 4B3RQ 3R8BA 4A3GB 1VQ9A 2CW0C 3Q8DA 4IN3A 2HQLA 3CW2C 5M5XB 3I4NH 4L5RC 2K1BA 4HTHA 5IP9G 3GTQB 3AYHB 3RUZA 2PW7A 2BOSA 2D62A 2YV5A 1CQFA 5IT9E 2ZXRA 1I4RA 1N8RC 4G7ZC 2YU9B 2F0IA 4JBJA 1I94L 1Q3LA 3W3AA 1JR0D 4B08A 1HZCA 4A3DB 2WB1B 3RLNA 1HQMC 3K0YA 2HHHL 1EOTA 1V1OA 3STBD 1WVLA 4U673 1NSNS 4NXMQ 2K32A 3QJYA 1PYWD 3H15A 5AJ3Q 5M3FG 2NN6H 4NW2A 4GNXA 1TWFB 3R2IA 1DZ1A 2N49A 2VL6A 1D7QA 3SHLA 1EYAA 2IY5B 1A3TA 2D2CC 2X6LA 1SMYC 3KK7A 5E4WC 1CK1A 1WJJA 4A3IG 2PW5A 1QZGA 3CF5A 2D9UA 3KOJA 4KY7A 4ME3A 4R4QA 1YIJA 2FMMA 1SYEA 4Y52H 4DR1Q 3S1RH 2V1CC 4A3JH 1F9QA 1LT6D 4MIUA 2QDBA 2UUBQ 1BCPF 1F9PA 4V0BA 4X65L 4E6IA 3HRZC 4PMWA 1QOHA 4I7AA 1STHA 5KNBA 2VNUD 4HJ9A 4DV7Q 1L0YB 4OWXB 4IPCA 1C4QA 2A68C 3F2BA 3V05A 3CCQA 2B63H 3DM1A 1Y8NB 5KNCA 1XPUA 2Q2IA 1SFOB 4NXNQ 1EU3A 1C7YA 1J9OA 1NE3A 4RWSC 4C3HH 3S2DH 2QA4A 2M2LA 1AZQA 4HSVA 3OWEB 1STNA 5DM63 2E74C 2J0TD 4QGUA 5I2XA 2HIVA 4YHHL 3J81j 5LMUL 4LF6L 1S5CD 2UXBL 4XT1B 2WB1G 4A3FH 1XNQL 3E3XA 4N8X1 2Y0SB 1TWGB 3TBIB 3MFGA 4JI5L 1VQHA 2L12A 3CHBD 4EQ5A 2UUAQ 1N32L 1IXRA 2RSNA 1Y1WH 3TP6A 2OTLA 2R3ZA 3F2CA 2DY7A 5LMNW 1YJ9A 3TP7A 1KQSA 2NN6G 1SNPA 1XMOQ 1K8AC 2KCTA 4LF9Q 1EQQA 2E2IB 2VS1A 1B7YB 4YCUA 1YHAA 1JMCA 3K8AA 1RDPD 2VY3A 3M4QA 4LF4L 1PVOA 1B50A 2UUAL 4RCNA 4R4TA 2UXDQ 1SNOA 3GTGB 5EGTA 4ODGA 3A8KE 3QG1A 1LTBD 1Y69U 1PZKD 2IHEA 2B2UA 2ZTEA 4DFAA 2I46A 3K58A 1X3PA 3MXGA 3HOYG 1ENCA 4JOIA 1PH4A 1CKOA 2EPBA 5E3FA 1HUNA 5EKLA 4A3BB 2EYPA 5C4HA 4HJAA 4LMQD 4KN4C 2BH8A 2NUCA 1PV4A 3CCLA 4H0LC 1LV9A 1RD9D 4CDFC 2HHHQ 2PMZB 2IJ0A 1U0LA 2IHFA 4JI8L 1TWCB 4OONA 3E6ZX 4YWKA 1EYGA 4ZUIA 1IKMA 5K36G 5M3FH 5IWAQ 2J4XA 4ZYSA 5IYCH 5I6WA 2ZJRA 1K83B 3E9HA 4POFA 5G3LD 3ND9A 1SFOH 3GTMB 4B9WA 5J3BA 4OX9Q 4X6AH 1D1IA 5M5WB 1AN8A 1YNJC 4PQXA 4RCOA 5CV6A 4A3FB 1WTPA 1E22A 3I4NB 1WTHA 1Q1BA 4NDXA 1SE2A 5KYIA 4C3HB 1S3OA 4LFBQ 2EJFC 4X3SA 4DNIA 2I0QA 5CGKA 3S1RB 1NJIC 4A93H 4LF7L 2LFNA 3S24A 3PIOA 5FLMG 1PYBA 4G7OC 5EBDA 1X6OA 5FLMH 1DD2A 2Y0SE 4DV7L 1BBWA 5H1SE 4DU9A 1TS3A 3EBEA 3KJPA 4O2DA 2A5HA 4HMJA 2B2YC 3QWNA 4IPGA 4DR5Q 5JEAH 2CFMA 1R4QB 1HR0Q 2KUMA 1XNRQ 1BBUA 1HNZL 4O42A 4A76A 3I4MG 4NB3A 4AYBB 5CV4A 1KTKA 4A3KH 2ZXOA 1TWHH 2N8NA 1EY5A 3RZOH 2QGQA 2KCMA 1CSQA 1KDAA 2M00A 1L0WA 2ZT9C 1E1TA 1NBWA 3J80E 2VQFL 3E0EA 1CQVA 3M3YH 4LAAA 5CV7A 4YWMA 4A3CH 3TZUA 1VS0A 3S1MH 1AH9A 1AZPA 1TWAH 3PUVA 1I50H 1VQOA 4CBVA 5I6YA 4IFDJ 1BDOA 3I4MH 2Z6BA 4ZRZA 3KF8A 3HOYH 1F77A 1YNXA 2K5QA 3H3VH 2R92H 2RKSA 2OWOA 5IGDA 3T1YL 3TS2A 4OWWB 2KENA 5NUCA 5ELFA 2XRQD 2EY5A 1BCPC 1PTOD 4ZUJA 5CV8A 3PO3H 4A3MB 3DWQA 4QY7A 2UXCQ 2E2JH 2GVAA 1YVCA 5FK9C 4DV1L 5CR3A 4GOPA 1D8LA 1PFSA 2NVTB 4JI6L 3SR1A 1TT2A 1S5DD 1B9NA 1PFNA 3F2UA 4QIWE 5A35A 3CCUA 3QO2A 4IURA 3S1MB 1U4LA 3BVMA 3BS1A 1KLGD 1JWMD 2KEDA 5KGUA 1VQ6A 1V8QA 2QF7A 1YI2A 2JA5G 1XX8A 3OIPA 4ZK9B 2LMCB 3NHHA 4DAMA 5C3XA 1PH9A 3HOYB 3PSIA 1NR4A 1UUPA 1SBBB 5K5PA 4BY1G 2ES2A 2R93G 3RZOB 2DNCA 5HY6A 3T51B 2HUGA 1I94Q 3I70A 4A93G 3HEJA 2E76C 5IYCG 1CKMA 4MTKA 4IJHA 4IUQA 1B9MA 2K01A 2WACA 4IFDG 2KA7A 1GUSA 3QB3A 1GUWA 3DLLA 1LO5D 4LUOA 3MXPA 1R9TH 1P8LA 4DAYA 1XPRA 1QJOA 5CBAE 4RHSA 1HZAA 2BA1A 1II3A 2XTIA 1CZGA 2K03A 5CC4A 1RF2D 1CUKA 3SK6A 3PUWA 5C44B 3HOWG 3OYYA 1Q86C 2LXJA 3CCMA 4DR5L 4RFBA 1QWYA 3VYRA 3J80L 3IFTA 4ID6A 1XNRL 3HS0C 2KECA 1V9PA 4OO1H 1W3SA 4KKUA 1NR2A 1SAPA 4DV6L 1MI2A 5IGBA 2B29A 1X3GA 3CMAA 3CC2A 1SRUA 3FMCA 4CJ2C 2R7ZG 1MHWC 1AFPA 5C3EG 4B3MQ 4WJ4A 2YU9H 1EWIA 2XGTA 5GADC 2IPKD 1VQBA 2Z9HA 3HOUH 4RGOS 3PV0A 3FPUB 2F3WA 5IGGA 5M3MB 3EQLC 1STYA 1PRTB 5EKKA 3HOWH 3IKJA 2BDOA 5C4ZA 2R92G 3D6WA 4WRDA 3L3OC 1HA6A 4H44C 2N88A 1KRSA 1C8CA 2ZJQA 1KLUD 2LY7A 3PGZA 1J5EL 2PZTA 4TVAB 3MHBA 4IFDH 3OMGA 3GTOB 1EQRA 2RHSB 1ZEQX 1CA5A 2F1MA 4K14A 4LF8L 1HA5A 2DN8A 1SE8A 2WIIB 4DR7L 1H95A 1R4PB 1WI5A 1GM5A 4IPHA 5EPKA 2BA0A 1ONLA 1UNSA 1TU2B 5C4JB 5M3FB 2B2VA 3H09A 1IBLQ 3NBHA 1WD0A 3KLSA 1QZHA 4RA8A 4YIJA 1KIXA 1Y8OB 3KFUA 3CQZH 1PRTD 1YNNC 1X56A 2ID0A 2SNMA 4H02A 3I4NG 2L1BA 4LNQA 4EQNA 4X64Q 2ICIA 1EY9A 3D3RA 4LUZA 3BZDB 3D4DA 3OHXC 5JEAJ 3S1QH 3NQIA 4XQJA 4UAIA 1CHPD 1MJCA 1YJNA 2F4VL 4CKCA 1H9MA 4K5XA 3OW2A 1X65A 4DPGA 4FP5D 3PIO3 1BNZA 3NE5B 2JA7H 1XJVA 2AQ3B 5T1IA 4WJWA 4HCEA 4PV1C 2VQEL 2P5ZX 2PI2E 5CBEE 3GTJH 1TY2A 4JYAQ 3A74A 5C5LA 3K81C 1A2UA 1DOKA 4JI8Q 1A15A 1BUVT 1GUNA 1GOZA 1UWVA 3CP0A 3J80c 1NAPA 3O13A 1NUCA 1LT3D 3D4RA 4GOPC 2AWNA 3C46A 1SYGA 1VQ8A 4BY7G 1K8GA 1ICFB 2F0HA 4RGNA 2CHBD 2MQHA 3HFZB 4AYBE 1H9SA 2CCZA 4JBMA 1HHVA 1UE6A 4KMUC 1ENAA 2KCNA 1PMRA 2AUJD 4MHEA 3S1QB 1MBYA 2DGYA 1LTRD 4J15A 2R7ZH 2F0KA 3BG3A 5C0XI 3ND8A 3NQTA 1TY0A 4XQQA 5I9PA 4LFBL 4R9WA 3GTPH 5CMDA 2EQSA 3URYA 5I9OA 3T1HQ 3CMEA 1BKBA 1EIHA 4JI1L 1XXGA 4DUYQ 1XMQQ 3HOZB 2KHIA 2BH2A 5M5YH 2OTJA 1HTLD 1ASZA 4IJLA 3B6YA 1G2TA 1B2TA 4N9PA 4DXFA 2Y0SG 3N6RA 4GZYC 1KDCA 3DEOA 2IW3A 2WAQG 4P71A 2EJMA 3BVZA 1N34Q 5EPJA 2K05A 2F0MA 4G4KA 1GXDC 2I5LX 4G57A 5CV5A 4LFAQ 1Z7TA 5IY0A 1A3UA 4K0KQ 1B4OA 1GJXA 1KABA 4DGZA 1AP0A 1DCZA 3S2HH 1BCPB 2EXZA 1HFGA 2JA8G 1LT5D 4Y7NB 2ICEC 1N34L 1UAPA 5IOCA 1W6JA 3UI2A 3NTKA 5KNDA 3H94A 2F0SA 1PA6A 2XN9C 1H9JA 5JJLA 3EROA 1D2BA 4HIMA 4A3KG 2UUCL 1Q81C 4MNOA 1NTGA 1JOOA 1NCVA 1S5ED 1ZKOA 4XIGS 4B3ML 4IUPA 3OSOA 1KNAA 3Q24A 4EQPA 4LF9L 4OIJA 2AQ1B 4CDEC 1EZ6A 2E5LQ 2JJQA 4A75A 4R4IA 1MD2D 3GTQH 4EX5A 3NTHA 4PZ6A 1WOCA 1SE3A 4L6TB 5HGQA 3A7LA 4N9TA 3TREA 1X54A 3TS0A 5C0XJ 2Q8TA 3D8GA 1N9WA 2DJGC 2PI2A 1X55A 4HN7A 4KTAA 1EEFD 2F3VA 4PNYA 5ELDA 2VQEQ 4BY1H 1FGBD 4BBSB 1A2TA 3KLWA 3S2HB 4X65Q 1TS4A 4JYAL 1L2FA 2E5LL 1FNUA 4KHVA 4ZLTF 4FXGC 3S15H 2VUMG 1KHIA 3KDFB 2NTSA 4DV3L 2L11A 2KHJA 5C3WA 2NVQB 1EQTA 1Q1EA 2NB0A 4RKLA 1HNWQ 4JG2A 3I8ZA 5JVH3 2LKVA 3K57A 2Z4HA 4GS3A 4O0AA 2DUDA 4LWCA 1LTTD 4DV4Q 3T56B 5COYA 1LTSD 1FNWA 3GD7A 1TIID 3CPFA 2FINB 3BYYB 3RD4A 1DGSA 1VF5C 1PDQA 3GTKH 4M1UB 4QUFA 4RMFA 3TDQA 2K50A 2F0TA 2CW0D 2TMPA 4KV6A 4BXXG 1NY4A 1LABA 5C0XH 4JI1Q 4DUYL 1JC7A 5EPLA 3F2DA 3PO2B 4POGA 4HJ7A 1QVGA 1Y1VB 1V1PA 1K0SA 4PMBA 4XXEA 1TS2A 5M5WH 3CCJA 1HR0W 1MGSA 3QIAA 2D0OA 3MXNA 3HGBA 4LF5L 5IP7G 4FXDA 4K8IA 3M4OB 1HTPA 5DLQE 1SNDA 1V43A 1BOSA 1RJTA 1G51A 4QF4A 2TSSA 1PTOB 4K0KL 2JA6H 4IUNA 4NXML 2DJFC 2EZVA 4R8IA 3OIQA 3S17B 1A6XA 4GLAC 1FJGL 3HKSA 2K5DA 2B63G 5C4XB 3WOFA 2K5WA 2HD3A 4DK1A 5IIFA 4CKEA 2DY8A 4IOAA 2E2HH 3PO2H 1LTLA 4BBRG 1X3QA 1S5BD 2FFKB 2QEXA 4IUTA 2K5NA 5BR8L 3CXCA 1B53A 4A3EB 3S16H 2NVXB 1KL9A 4KY6A 4A3JG 3AB9A 1F9RA 3ULJA 1BO0A 2JYOA 1JJCB 1LYLA 1H9KA 1EUJA 3J81c 2JEAI 3A5ZB 2CQOA 4RH6A 2N78A 3V2TA 4YWLA 4CJ0B 4HCSA 2F0LA 2O5IC 4LJZC 2B2WC 4HR7B 3VYTA 1ILPA 4JI3L 3H0GB 3STBC 4CHTB 3KF6B 2JA8B 4NMZA 3TP8A 2WV6D 3OMCA 2UXBQ 3W2DA 4GN4B 3D31A 1GUGA 4P75A 2A6HC 3SK4A 2NTTA 3TZDA 5JAVA 3FHWA 1HPCA 1WCMG 3UDXA 1EL0A 1PZID 4ILWA 4JBWA 4ZCKA 3VR3A 1F2ZA 3HOVB 4OWTB 2XWJB 2IX3A 3S14B 3DUZA 1RTNA 3DMUA 1JT8A 1N36L 2RDHA 4K2LA 3HKZG 1B3AA 3PUYA 1IYUA 2EY2A 4P74A 1F9SA 3KLRA 1KAWA 1DYQA 2B2YA 2GVBA 3HOXB 1A8VA 2MUYA 4HAEA 1P16A 2J7ZA 3ITPA
chains in the Genus database with same CATH topology
5LMNQ 3GO5A 5IYCG 1CKMA 3GTLH 5IYDH 4IJHA 4IFDG 2HT1A 4AIMA 3PF5A 1AE3A 3DLLA 1SR3A 4LUOA 1R9TH 4HIDA 2LXKA 1P8LA 1QUQB 1Q7YC 1XPRA 2AKWB 4P73A 2R6GA 3RZDH 4DR2Q 1WYDA 1XNQQ 1HZAA 2BA1A 3M4OH 3ZJYC 2XTIA 2JA7G 1WFQA 3UDIA 1FL0A 2JA6G 4DK6C 1CUKA 2JEBI 1VQFA 4DV0Q 3PUWA 4R4OA 4YCWA 1X9NA 1V1QA 1VQEA 1TWFH 3OYYA 4R1JA 3JAMc 4L5TA 5GAHC 1EOVA 1YZ6A 2B3GA 2I5HA 1QVCA 1Q86C 2Z6KA 5C44H 2LXJA 3HKZE 3CCMA 4DR5L 4BY7H 2A19A 4X64L 3I4OA 3FP9A 1XMOL 1IBKQ 5ELNA 4IFDI 1XNRL 1V9PA 4LUVA 1M1KC 1VQPA 1UE5A 1W3SA 2IX0A 1N33L 4DV6L 3VDYA 1M90C 1XTDA 5GAGC 3RN5A 2B29A 1G291 5IWAL 4A3LG 1X3GA 3CMAA 3CC2A 4DV3Q 5IYDG 4QQBX 5JJIA 1SRUA 2R7ZG 4A3BH 3G71A 5C3EG 4B3MQ 3IRBA 4WJ4A 1FJGQ 4AQYQ 1EWIA 2YU9H 1B70B 3ULLA 2Q2TA 2XGTA 5IE8A 5GADC 1WCMH 2MFIA 2VQFQ 4B3TL 4JI3Q 2UXCL 1VQBA 3HOUH 2ZM6L 2NVTH 1HZ9A 2I5MX 3FKIG 3PV0A 3UE1A 3M9BA 4MZ9A 4DV1Q 4HIOA 4IO9A 1G6PA 3DM3A 4ALPA 5JJKA 1YBYA 3HOWH 2R92G 2C35B 3CAMA 4DR3Q 3W1GA 1A0IA 1K83H 1KRSA 2E8GA 1I5FA 3NENA 4GN3B 1Q46A 4JOIC 3J7ZC 3OTOQ 1VQMA 4GNXC 2L15A 3PGZA 1J5EL 1VQKA 3LGJA 4B3TQ 3JC66 2YYZA 4A3GG 3RN2A 1K0RA 3BZKA 4TVAB 1VQ4A 3H3VI 1YITA 1VQIA 2MO1A 4Y7NH 1S72A 3U50C 3ER0A 3G4SA 1EQRA 2RHSB 3AFQA 4LF8L 4BBSH 2AWOA 4DR6Q 1VQGA 4IOCA 3T1YQ 1SE8A 2CWPA 4FDBA 4JV5Q 4JI0Q 3U58A 2NZHA 4DR7L 1H95A 4DV2L 1PH5A 2ASBA 1WI5A 3NELA 3CC7A 3G6EA 1GM5A 4OX9L 4GN5A 4IPHA 2BA0A 3AFPA 1Y1WG 4GKJQ 3K7UC 3T1HL 3MEFA 4YCVA 1U5KA 3AQQA 3L7ZC 4A3CG 1IL2A 3MXNB 5JEAG 2K5HA 3E9IA 1IBLQ 1VQNA 3J81i 5IYBG 1QZHA 1L1OB 1HH2P 3ULPA 1Q82C 1KIXA 3UE0A 4DV2Q 2VZAA 3EIVA 1IBMQ 4B3RQ 3KFUA 3CCVA 1VQ9A 3PUXA 2EXDA 4R4CA 3CQZH 2MO0A 3Q8DA 4NXNL 1CSPA 3SGIA 2ID0A 1X56A 3I4NG 4H02A 2UU9L 4GKJL 5C0XG 4LNQA 2HQLA 3CW2C 4X64Q 1NMFA 1OXTA 3I4NH 4L5RC 4YHHQ 5LMUQ 4GLXA 4LF6Q 4AH6A 4LUZA 3S1QH 5IP9G 5JEAJ 3AYHB 1E3PA 2A8VA 2K52A 2D62A 2YV5A 5IP9H 1VQDA 3FKIH 3RR5A 1PH1A 2NZOA 3H0GH 1MJCA 5M3MG 1YJNA 1EIFA 2F4VL 3OW2A 1X65A 4DPGA 4XTCS 1N8RC 1N32Q 2JA7H 1RL2A 4JBJA 5IP7H 5AJ3L 1XJVA 5BR8Q 1JJ2A 1I94L 3RNUA 3AEVA 1HZCA 1Y1VH 2VQEL 1T9HA 1KRTA 1OTCA 3RLNA 2PI2E 3GTJH 2HHHL 4JYAQ 1OXXK 4JCVE 3A74A 3K81C 4JI7L 1TWCH 2KBNA 4DUZQ 4JI8Q 3STBD 2OQ0A 1UWVA 3CP0A 3J80c 3TEHB 2JA8H 4LF4Q 4GOPC 4NXMQ 4BXXH 2AWNA 1YJWA 2UXDL 1VQ8A 3H15A 4DV0L 3G48A 4NPSA 4A3EH 5AJ3Q 5M3FG 1K8GA 4BY7G 2JE6I 2MQHA 3HFZB 4AYBE 2PQAA 4HIKA 4GNXA 4LFCQ 2N49A 2UUBL 2VL6A 1W2BA 1D7QA 2CCZA 4JBMA 1VCIA 1UE6A 3CCSA 2IY5B 2WB1E 3K7AH 1JB7A 4JI7Q 1AE2A 3HOUG 1WJJA 3U4ZA 4GLVB 4A3IG 1QZGA 1HNXL 3CF5A 3KOJA 4JI6Q 2DGYA 3M85A 4ME3A 4J15A 4R4QA 5C4XH 1YIJA 2R7ZH 1UE1A 5C3EH 5C0XI 4Y52H 4UPAA 3CCRA 4DR1Q 3S1RH 5FLXc 2V1CC 4A3JH 2JK8A 4LFBL 1NMGA 1SLJA 4AQYL 3GTPH 3S17H 2UUBQ 2EQSA 1E1OA 3HOXH 4X65L 2RF4A 3T1HQ 2WP8J 3CMEA 1BVSA 4PMWA 1N36Q 1BKBA 3I56A 2JQOA 4JI1L 4DUYQ 1HNXQ 1XMQQ 2KHIA 3ERSX 5ELOA 2OCEA 2GN5A 3D0FA 3HOZH 2VNUD 4HJ9A 4DV7Q 2BH2A 5M5YH 4OWXB 4IPCA 2OTJA 3F2BA 1ASZA 3CCQA 4IJLA 2B63H 3HOWG 3B6YA 2ALYB 1XPOA 1XPUA 2WFWA 2Q2IA 2NN6I 1CKNB 2Y0SG 1C7YA 4NXNQ 1Z9FA 1NE3A 3S2DH 4C3HH 3KF6A 2WAQG 4P71A 2QA4A 1N34Q 3F1ZA 3RLFA 3JAMi 3K80C 4QGUA 4YHHL 3J81j 3L0OA 2HIVA 5LMUL 4UP8A 4LF6L 4GKKQ 2I5LX 4C3JH 2UXBL 2WB1G 1OXUA 4A3FH 4DR2L 4LFAQ 1XNQL 4A3DG 2ZTCA 3F8TA 5C4JH 4DR6L 4K0KQ 5IY0A 4JI5L 5E7NA 1VQHA 4EQ5A 4DV5Q 4JV5L 2UUAQ 2RHQB 3S2HH 1I6HH 2D0PA 5FJ8H 1N32L 5GQOA 2JA8G 1IXRA 2H5XA 1SN8A 1Y1WH 2OTLA 4A3MG 1PVOA 3F2CA 1MIUA 3EN2A 3KF8B 5LMNW 1YJ9A 1N34L 1KQSA 4LF7Q 1PYSB 2NN6G 4HJ8A 1XMOQ 1IBKL 1K8AC 1YHQA 3HOZG 2KCTA 4LF9Q 1EQQA 1KC8C 1SMXA 2VS1A 3NBHB 3KJOA 1B7YB 1LUZA 4PG3A 1VQCA 1PA6A 3J7A5 4YCUA 5JJLA 1YHAA 1JMCA 4HIMA 4DV6Q 3K8AA 4A3KG 2VY3A 1Q81C 3M4QA 2YTVA 2UUCL 4MNOA 4LF4L 1NTGA 2UUAL 3M7NA 4BA2I 4R4TA 2F52A 1OXVA 1B8AA 2AHOB 2UXDQ 1IBML 4B3RL 1VQAA 4A3GH 3GTMH 1E24A 4A3LH 2RCNA 4JC0A 4XIGS 4B3ML 2UU9Q 4JI2L 4TQUS 1PH3A 2PMZE 3M4PA 1UE7A 2Z6KC 4LF9L 1HR0L 2E5LQ 2IHEA 2ZTEA 2JJQA 1HNZQ 4A75A 4R4IA 3GTQH 3HOYG 4EX5A 3I55A 4JOIA 4PZ6A 1PH4A 1WOCA 3CD6A 1CKOA 5HGQA 3TREA 5GROA 3CPWA 4WJ3M 1X54A 1HZBA 4DR3L 3TS0A 5C0XJ 4DR1L 1N9WA 2PI2A 4UY8C 1X55A 1PH8A 4JI2Q 4HJAA 3W5OA 4DKAC 4KHPQ 2VQEQ 4BY1H 2BH8A 1PV4A 3CCLA 3KLWA 1O7IA 3K0XA 4X65Q 1GD7A 2HHHQ 4JYAL 1L2FA 2E5LL 2F3IA 1U0LA 4DUZL 2IHFA 4JI8L 3A5UA 4OONA 1XMQL 1N33Q 3S15H 4X62Q 3PCOB 4YWKA 4YY3L 1FVIA 1EYGA 1KHIA 2VUMG 5K36G 5M3FH 5IWAQ 3CCEA 3KDFB 3BU2A 5IYCH 2FXQA 4DV3L 2ZJRA 3E9HA 4GNXB 1PH2A 4DR7Q 2KHJA 4POFA 1SFOH 1X3EA 1L1OC 5J3BA 3CC4A 4JI4Q 4OX9Q 3H0GG 2R7DA 1Q1EA 4X6AH 1OXSC 1HNWQ 4JG2A 1VQLA 2K5VA 4UP7A 1TWGH 4A4IA 1K9MC 3UDFA 4C3IH 3PIPA 2N3SA 4GS3A 2IX1A 4O0AA 3GTOH 2DUDA 4LWCA 1Y1VG 4X62L 4DV4Q 1E22A 4LFAL 1Q1BA 1C0AA 3GD7A 2HIXA 3TQYA 3CPFA 1IZ6A 2CKZB 3HOVH 1DGSA 4KLKA 3NEMA 1S3OA 1VQ7A 1EIYB 4LFBQ 1A62A 3GTKH 3U4VA 2LSSA 4RMFA 4APVA 4DNIA 3OTOL 2I0QA 2ZJQA 5LMNL 2K50A 4KI0A 2YTYA 1SROA 1NJIC 4A3EG 2JA5H 4A93H 4LF7L 1A63A 1X3FA 3S24A 4DR4Q 3PIOA 4BXXG 1NY4A 5FLMG 1PYBA 4JI1Q 4DUYL 3F2DA 4QL5A 4QJFA 1X6OA 5FLMH 4POGA 2Y0SE 4DV7L 3W1BA 1BBWA 4HJ7A 1K73C 1QVGA 1MJEA 5H1SE 4A3FG 3KDFA 1L1OA 1PH7A 3EBEA 4DK3C 2F4VQ 2Q2HA 4OO1I 4JI0L 3KJPA 5M5WH 4O2DA 3CCJA 1HR0W 3BJUA 3L2PA 5C4XG 2JA9A 2D0OA 4IPGA 1EFWA 4P72A 4LF5L 5IP7G 4DR5Q 2CFMA 5EAYA 1PHJA 4DR4L 5DLQE 1E7ZA 1HR0Q 1HJPA 1XNRQ 4GKKL 1JJGA 1BBUA 1JE5A 1HNZL 1IBLL 4A76A 1V43A 3I4MG 1G51A 4NB3A 4K0KL 4JI5Q 2JA6H 4NXML 4A3MH 2Z0SA 4A3KH 1TWHH 2N8NA 4GLAC 4LW1A 3WWVA 1S40A 3RZOH 4BBSG 2QGQA 2KCMA 4PZ7A 1CSQA 4AYBG 1YHBA 3HKSA 1L0WA 4LF5Q 1E1TA 1IYJB 1FJGL 4KHPL 1NBWA 5IT9c 4A3BG 2VQFL 2B63G 3E0EA 2ZM6Q 4PZ8A 4IPDA 3M3YH 1MKHA 3S1NH 2YTXA 2OQKA 4GOPB 2E2HH 4IOAA 3PO2H 4YWMA 1LTLA 4BBRG 4L5SA 1Q8KA 1VS0A 4A3CH 2MNAA 3S1MH 3PO2G 5M5XH 4JBKA 1AH9A 2QEXA 4X66Q 2NVQH 2NVXH 1TWAH 2K5NA 5BR8L 4A3DH 3RLOA 3PUVA 1I50H 1I3QH 1YEZA 3CXCA 3S16H 1KL9A 1Z47A 4A3JG 1VQOA 3ULJA 1HNWL 4IFDJ 2R7FA 3I4MH 3UDGA 3HOYH 3KYHC 2ATWA 1JJCB 1PH6A 1LYLA 1EUJA 1YNXA 3PUZA 3J81c 4B3SL 3H3VH 2JEAI 2R92H 2OWOA 4UP9A 4DV4L 3A5ZB 2CQOA 2VUMH 3T1YL 2WAQE 4X66L 5C44G 3S14H 3TS2A 2N78A 4OWWB 1CKNA 2KENA 4YWLA 1VQ5A 2ZTDA 4BA1I 1VQJA 4RG1A 4LFCL 3I2ZA 1RIPA 4JI3L 1J6QA 2R93H 4C2MH 4OO1G 3J80i 3PO3H 2K75A 2NVYH 3STBC 2UXCQ 4QY7A 3KF6B 4A3IH 2E2JH 2GVAA 1K3RA 1YVCA 3PO3G 2VW9A 4DV1L 4MTNA 2A1AA 5M3MH 4GOPA 1FGUA 1D8LA 3PF4A 2AMCB 4B3SQ 1PFSA 2UXBQ 4JI6L 2K14A 4GN4B 4YY3Q 3D31A 2ZJPA 4P75A 4HJ5A 4OXPA 1KXLA 4DV5L 1C9OA 3FHWA 5IYBH 3GDEA 2Q2UA 1WCMG 4QIWE 3UDXA 3CCUA 3GTGH 4JI4L 3HOXG 1ASYA 2CWAA 1GVPA 5FJ8G 4JBWA 1J5EQ 3BZCA 4L5QA 1GO3E 4OWTB 1UEBA 1KD1C 5GAEC 1VQ6A 1JT8A 1YI2A 1N36L 2JA5G 3TRZA 2IT1A 3ICEA 1Y14B 1QUQA 3HKZG 4DAMA 4DAYB 2E2IH 2K4KA 3PUYA 2PNHA 4P74A 4LF8Q 3HOVG 1PH9A 1KAWA 1QVFA 3PSIA 2UUCQ 2GVBA 1LM0A 2EIFA 1Q12A 1A8VA 3A0JA 4KHZA 4BY1G 2ES2A 2R93G 1P16A 1TXYA 3I7FA 5HY6A 1I94Q 2PQAB 4BBRH 1GKHA 4A93G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN Q;  3GO5 A;  5IYC G;  1CKM A;  3GTL H;  5IYD H;  4IJH A;  4IFD G;  2HT1 A;  4AIM A;  3PF5 A;  1AE3 A;  3DLL A;  1SR3 A;  4LUO A;  1R9T H;  4HID A;  2LXK A;  1P8L A;  1QUQ B;  1Q7Y C;  1XPR A;  2AKW B;  4P73 A;  2R6G A;  3RZD H;  4DR2 Q;  1WYD A;  1XNQ Q;  1HZA A;  2BA1 A;  3M4O H;  3ZJY C;  2XTI A;  2JA7 G;  1WFQ A;  3UDI A;  1FL0 A;  2JA6 G;  4DK6 C;  1CUK A;  2JEB I;  1VQF A;  4DV0 Q;  3PUW A;  4R4O A;  4YCW A;  1X9N A;  1V1Q A;  1VQE A;  1TWF H;  3OYY A;  4R1J A;  3JAM c;  4L5T A;  5GAH C;  1EOV A;  1YZ6 A;  2B3G A;  2I5H A;  1QVC A;  1Q86 C;  2Z6K A;  5C44 H;  2LXJ A;  3HKZ E;  3CCM A;  4DR5 L;  4BY7 H;  2A19 A;  4X64 L;  3I4O A;  3FP9 A;  1XMO L;  1IBK Q;  5ELN A;  4IFD I;  1XNR L;  1V9P A;  4LUV A;  1M1K C;  1VQP A;  1UE5 A;  1W3S A;  2IX0 A;  1N33 L;  4DV6 L;  3VDY A;  1M90 C;  1XTD A;  5GAG C;  3RN5 A;  2B29 A;  1G29 1;  5IWA L;  4A3L G;  1X3G A;  3CMA A;  3CC2 A;  4DV3 Q;  5IYD G;  4QQB X;  5JJI A;  1SRU A;  2R7Z G;  4A3B H;  3G71 A;  5C3E G;  4B3M Q;  3IRB A;  4WJ4 A;  1FJG Q;  4AQY Q;  1EWI A;  2YU9 H;  1B70 B;  3ULL A;  2Q2T A;  2XGT A;  5IE8 A;  5GAD C;  1WCM H;  2MFI A;  2VQF Q;  4B3T L;  4JI3 Q;  2UXC L;  1VQB A;  3HOU H;  2ZM6 L;  2NVT H;  1HZ9 A;  2I5M X;  3FKI G;  3PV0 A;  3UE1 A;  3M9B A;  4MZ9 A;  4DV1 Q;  4HIO A;  4IO9 A;  1G6P A;  3DM3 A;  4ALP A;  5JJK A;  1YBY A;  3HOW H;  2R92 G;  2C35 B;  3CAM A;  4DR3 Q;  3W1G A;  1A0I A;  1K83 H;  1KRS A;  2E8G A;  1I5F A;  3NEN A;  4GN3 B;  1Q46 A;  4JOI C;  3J7Z C;  3OTO Q;  1VQM A;  4GNX C;  2L15 A;  3PGZ A;  1J5E L;  1VQK A;  3LGJ A;  4B3T Q;  3JC6 6;  2YYZ A;  4A3G G;  3RN2 A;  1K0R A;  3BZK A;  4TVA B;  1VQ4 A;  3H3V I;  1YIT A;  1VQI A;  2MO1 A;  4Y7N H;  1S72 A;  3U50 C;  3ER0 A;  3G4S A;  1EQR A;  2RHS B;  3AFQ A;  4LF8 L;  4BBS H;  2AWO A;  4DR6 Q;  1VQG A;  4IOC A;  3T1Y Q;  1SE8 A;  2CWP A;  4FDB A;  4JV5 Q;  4JI0 Q;  3U58 A;  2NZH A;  4DR7 L;  1H95 A;  4DV2 L;  1PH5 A;  2ASB A;  1WI5 A;  3NEL A;  3CC7 A;  3G6E A;  1GM5 A;  4OX9 L;  4GN5 A;  4IPH A;  2BA0 A;  3AFP A;  1Y1W G;  4GKJ Q;  3K7U C;  3T1H L;  3MEF A;  4YCV A;  1U5K A;  3AQQ A;  3L7Z C;  4A3C G;  1IL2 A;  3MXN B;  5JEA G;  2K5H A;  3E9I A;  1IBL Q;  1VQN A;  3J81 i;  5IYB G;  1QZH A;  1L1O B;  1HH2 P;  3ULP A;  1Q82 C;  1KIX A;  3UE0 A;  4DV2 Q;  2VZA A;  3EIV A;  1IBM Q;  4B3R Q;  3KFU A;  3CCV A;  1VQ9 A;  3PUX A;  2EXD A;  4R4C A;  3CQZ H;  2MO0 A;  3Q8D A;  4NXN L;  1CSP A;  3SGI A;  2ID0 A;  1X56 A;  3I4N G;  4H02 A;  2UU9 L;  4GKJ L;  5C0X G;  4LNQ A;  2HQL A;  3CW2 C;  4X64 Q;  1NMF A;  1OXT A;  3I4N H;  4L5R C;  4YHH Q;  5LMU Q;  4GLX A;  4LF6 Q;  4AH6 A;  4LUZ A;  3S1Q H;  5IP9 G;  5JEA J;  3AYH B;  1E3P A;  2A8V A;  2K52 A;  2D62 A;  2YV5 A;  5IP9 H;  1VQD A;  3FKI H;  3RR5 A;  1PH1 A;  2NZO A;  3H0G H;  1MJC A;  5M3M G;  1YJN A;  1EIF A;  2F4V L;  3OW2 A;  1X65 A;  4DPG A;  4XTC S;  1N8R C;  1N32 Q;  2JA7 H;  1RL2 A;  4JBJ A;  5IP7 H;  5AJ3 L;  1XJV A;  5BR8 Q;  1JJ2 A;  1I94 L;  3RNU A;  3AEV A;  1HZC A;  1Y1V H;  2VQE L;  1T9H A;  1KRT A;  1OTC A;  3RLN A;  2PI2 E;  3GTJ H;  2HHH L;  4JYA Q;  1OXX K;  4JCV E;  3A74 A;  3K81 C;  4JI7 L;  1TWC H;  2KBN A;  4DUZ Q;  4JI8 Q;  3STB D;  2OQ0 A;  1UWV A;  3CP0 A;  3J80 c;  3TEH B;  2JA8 H;  4LF4 Q;  4GOP C;  4NXM Q;  4BXX H;  2AWN A;  1YJW A;  2UXD L;  1VQ8 A;  3H15 A;  4DV0 L;  3G48 A;  4NPS A;  4A3E H;  5AJ3 Q;  5M3F G;  1K8G A;  4BY7 G;  2JE6 I;  2MQH A;  3HFZ B;  4AYB E;  2PQA A;  4HIK A;  4GNX A;  4LFC Q;  2N49 A;  2UUB L;  2VL6 A;  1W2B A;  1D7Q A;  2CCZ A;  4JBM A;  1VCI A;  1UE6 A;  3CCS A;  2IY5 B;  2WB1 E;  3K7A H;  1JB7 A;  4JI7 Q;  1AE2 A;  3HOU G;  1WJJ A;  3U4Z A;  4GLV B;  4A3I G;  1QZG A;  1HNX L;  3CF5 A;  3KOJ A;  4JI6 Q;  2DGY A;  3M85 A;  4ME3 A;  4J15 A;  4R4Q A;  5C4X H;  1YIJ A;  2R7Z H;  1UE1 A;  5C3E H;  5C0X I;  4Y52 H;  4UPA A;  3CCR A;  4DR1 Q;  3S1R H;  5FLX c;  2V1C C;  4A3J H;  2JK8 A;  4LFB L;  1NMG A;  1SLJ A;  4AQY L;  3GTP H;  3S17 H;  2UUB Q;  2EQS A;  1E1O A;  3HOX H;  4X65 L;  2RF4 A;  3T1H Q;  2WP8 J;  3CME A;  1BVS A;  4PMW A;  1N36 Q;  1BKB A;  3I56 A;  2JQO A;  4JI1 L;  4DUY Q;  1HNX Q;  1XMQ Q;  2KHI A;  3ERS X;  5ELO A;  2OCE A;  2GN5 A;  3D0F A;  3HOZ H;  2VNU D;  4HJ9 A;  4DV7 Q;  2BH2 A;  5M5Y H;  4OWX B;  4IPC A;  2OTJ A;  3F2B A;  1ASZ A;  3CCQ A;  4IJL A;  2B63 H;  3HOW G;  3B6Y A;  2ALY B;  1XPO A;  1XPU A;  2WFW A;  2Q2I A;  2NN6 I;  1CKN B;  2Y0S G;  1C7Y A;  4NXN Q;  1Z9F A;  1NE3 A;  3S2D H;  4C3H H;  3KF6 A;  2WAQ G;  4P71 A;  2QA4 A;  1N34 Q;  3F1Z A;  3RLF A;  3JAM i;  3K80 C;  4QGU A;  4YHH L;  3J81 j;  3L0O A;  2HIV A;  5LMU L;  4UP8 A;  4LF6 L;  4GKK Q;  2I5L X;  4C3J H;  2UXB L;  2WB1 G;  1OXU A;  4A3F H;  4DR2 L;  4LFA Q;  1XNQ L;  4A3D G;  2ZTC A;  3F8T A;  5C4J H;  4DR6 L;  4K0K Q;  5IY0 A;  4JI5 L;  5E7N A;  1VQH A;  4EQ5 A;  4DV5 Q;  4JV5 L;  2UUA Q;  2RHQ B;  3S2H H;  1I6H H;  2D0P A;  5FJ8 H;  1N32 L;  5GQO A;  2JA8 G;  1IXR A;  2H5X A;  1SN8 A;  1Y1W H;  2OTL A;  4A3M G;  1PVO A;  3F2C A;  1MIU A;  3EN2 A;  3KF8 B;  5LMN W;  1YJ9 A;  1N34 L;  1KQS A;  4LF7 Q;  1PYS B;  2NN6 G;  4HJ8 A;  1XMO Q;  1IBK L;  1K8A C;  1YHQ A;  3HOZ G;  2KCT A;  4LF9 Q;  1EQQ A;  1KC8 C;  1SMX A;  2VS1 A;  3NBH B;  3KJO A;  1B7Y B;  1LUZ A;  4PG3 A;  1VQC A;  1PA6 A;  3J7A 5;  4YCU A;  5JJL A;  1YHA A;  1JMC A;  4HIM A;  4DV6 Q;  3K8A A;  4A3K G;  2VY3 A;  1Q81 C;  3M4Q A;  2YTV A;  2UUC L;  4MNO A;  4LF4 L;  1NTG A;  2UUA L;  3M7N A;  4BA2 I;  4R4T A;  2F52 A;  1OXV A;  1B8A A;  2AHO B;  2UXD Q;  1IBM L;  4B3R L;  1VQA A;  4A3G H;  3GTM H;  1E24 A;  4A3L H;  2RCN A;  4JC0 A;  4XIG S;  4B3M L;  2UU9 Q;  4JI2 L;  4TQU S;  1PH3 A;  2PMZ E;  3M4P A;  1UE7 A;  2Z6K C;  4LF9 L;  1HR0 L;  2E5L Q;  2IHE A;  2ZTE A;  2JJQ A;  1HNZ Q;  4A75 A;  4R4I A;  3GTQ H;  3HOY G;  4EX5 A;  3I55 A;  4JOI A;  4PZ6 A;  1PH4 A;  1WOC A;  3CD6 A;  1CKO A;  5HGQ A;  3TRE A;  5GRO A;  3CPW A;  4WJ3 M;  1X54 A;  1HZB A;  4DR3 L;  3TS0 A;  5C0X J;  4DR1 L;  1N9W A;  2PI2 A;  4UY8 C;  1X55 A;  1PH8 A;  4JI2 Q;  4HJA A;  3W5O A;  4DKA C;  4KHP Q;  2VQE Q;  4BY1 H;  2BH8 A;  1PV4 A;  3CCL A;  3KLW A;  1O7I A;  3K0X A;  4X65 Q;  1GD7 A;  2HHH Q;  4JYA L;  1L2F A;  2E5L L;  2F3I A;  1U0L A;  4DUZ L;  2IHF A;  4JI8 L;  3A5U A;  4OON A;  1XMQ L;  1N33 Q;  3S15 H;  4X62 Q;  3PCO B;  4YWK A;  4YY3 L;  1FVI A;  1EYG A;  1KHI A;  2VUM G;  5K36 G;  5M3F H;  5IWA Q;  3CCE A;  3KDF B;  3BU2 A;  5IYC H;  2FXQ A;  4DV3 L;  2ZJR A;  3E9H A;  4GNX B;  1PH2 A;  4DR7 Q;  2KHJ A;  4POF A;  1SFO H;  1X3E A;  1L1O C;  5J3B A;  3CC4 A;  4JI4 Q;  4OX9 Q;  3H0G G;  2R7D A;  1Q1E A;  4X6A H;  1OXS C;  1HNW Q;  4JG2 A;  1VQL A;  2K5V A;  4UP7 A;  1TWG H;  4A4I A;  1K9M C;  3UDF A;  4C3I H;  3PIP A;  2N3S A;  4GS3 A;  2IX1 A;  4O0A A;  3GTO H;  2DUD A;  4LWC A;  1Y1V G;  4X62 L;  4DV4 Q;  1E22 A;  4LFA L;  1Q1B A;  1C0A A;  3GD7 A;  2HIX A;  3TQY A;  3CPF A;  1IZ6 A;  2CKZ B;  3HOV H;  1DGS A;  4KLK A;  3NEM A;  1S3O A;  1VQ7 A;  1EIY B;  4LFB Q;  1A62 A;  3GTK H;  3U4V A;  2LSS A;  4RMF A;  4APV A;  4DNI A;  3OTO L;  2I0Q A;  2ZJQ A;  5LMN L;  2K50 A;  4KI0 A;  2YTY A;  1SRO A;  1NJI C;  4A3E G;  2JA5 H;  4A93 H;  4LF7 L;  1A63 A;  1X3F A;  3S24 A;  4DR4 Q;  3PIO A;  4BXX G;  1NY4 A;  5FLM G;  1PYB A;  4JI1 Q;  4DUY L;  3F2D A;  4QL5 A;  4QJF A;  1X6O A;  5FLM H;  4POG A;  2Y0S E;  4DV7 L;  3W1B A;  1BBW A;  4HJ7 A;  1K73 C;  1QVG A;  1MJE A;  5H1S E;  4A3F G;  3KDF A;  1L1O A;  1PH7 A;  3EBE A;  4DK3 C;  2F4V Q;  2Q2H A;  4OO1 I;  4JI0 L;  3KJP A;  5M5W H;  4O2D A;  3CCJ A;  1HR0 W;  3BJU A;  3L2P A;  5C4X G;  2JA9 A;  2D0O A;  4IPG A;  1EFW A;  4P72 A;  4LF5 L;  5IP7 G;  4DR5 Q;  2CFM A;  5EAY A;  1PHJ A;  4DR4 L;  5DLQ E;  1E7Z A;  1HR0 Q;  1HJP A;  1XNR Q;  4GKK L;  1JJG A;  1BBU A;  1JE5 A;  1HNZ L;  1IBL L;  4A76 A;  1V43 A;  3I4M G;  1G51 A;  4NB3 A;  4K0K L;  4JI5 Q;  2JA6 H;  4NXM L;  4A3M H;  2Z0S A;  4A3K H;  1TWH H;  2N8N A;  4GLA C;  4LW1 A;  3WWV A;  1S40 A;  3RZO H;  4BBS G;  2QGQ A;  2KCM A;  4PZ7 A;  1CSQ A;  4AYB G;  1YHB A;  3HKS A;  1L0W A;  4LF5 Q;  1E1T A;  1IYJ B;  1FJG L;  4KHP L;  1NBW A;  5IT9 c;  4A3B G;  2VQF L;  2B63 G;  3E0E A;  2ZM6 Q;  4PZ8 A;  4IPD A;  3M3Y H;  1MKH A;  3S1N H;  2YTX A;  2OQK A;  4GOP B;  2E2H H;  4IOA A;  3PO2 H;  4YWM A;  1LTL A;  4BBR G;  4L5S A;  1Q8K A;  1VS0 A;  4A3C H;  2MNA A;  3S1M H;  3PO2 G;  5M5X H;  4JBK A;  1AH9 A;  2QEX A;  4X66 Q;  2NVQ H;  2NVX H;  1TWA H;  2K5N A;  5BR8 L;  4A3D H;  3RLO A;  3PUV A;  1I50 H;  1I3Q H;  1YEZ A;  3CXC A;  3S16 H;  1KL9 A;  1Z47 A;  4A3J G;  1VQO A;  3ULJ A;  1HNW L;  4IFD J;  2R7F A;  3I4M H;  3UDG A;  3HOY H;  3KYH C;  2ATW A;  1JJC B;  1PH6 A;  1LYL A;  1EUJ A;  1YNX A;  3PUZ A;  3J81 c;  4B3S L;  3H3V H;  2JEA I;  2R92 H;  2OWO A;  4UP9 A;  4DV4 L;  3A5Z B;  2CQO A;  2VUM H;  3T1Y L;  2WAQ E;  4X66 L;  5C44 G;  3S14 H;  3TS2 A;  2N78 A;  4OWW B;  1CKN A;  2KEN A;  4YWL A;  1VQ5 A;  2ZTD A;  4BA1 I;  1VQJ A;  4RG1 A;  4LFC L;  3I2Z A;  1RIP A;  4JI3 L;  1J6Q A;  2R93 H;  4C2M H;  4OO1 G;  3J80 i;  3PO3 H;  2K75 A;  2NVY H;  3STB C;  2UXC Q;  4QY7 A;  3KF6 B;  4A3I H;  2E2J H;  2GVA A;  1K3R A;  1YVC A;  3PO3 G;  2VW9 A;  4DV1 L;  4MTN A;  2A1A A;  5M3M H;  4GOP A;  1FGU A;  1D8L A;  3PF4 A;  2AMC B;  4B3S Q;  1PFS A;  2UXB Q;  4JI6 L;  2K14 A;  4GN4 B;  4YY3 Q;  3D31 A;  2ZJP A;  4P75 A;  4HJ5 A;  4OXP A;  1KXL A;  4DV5 L;  1C9O A;  3FHW A;  5IYB H;  3GDE A;  2Q2U A;  1WCM G;  4QIW E;  3UDX A;  3CCU A;  3GTG H;  4JI4 L;  3HOX G;  1ASY A;  2CWA A;  1GVP A;  5FJ8 G;  4JBW A;  1J5E Q;  3BZC A;  4L5Q A;  1GO3 E;  4OWT B;  1UEB A;  1KD1 C;  5GAE C;  1VQ6 A;  1JT8 A;  1YI2 A;  1N36 L;  2JA5 G;  3TRZ A;  2IT1 A;  3ICE A;  1Y14 B;  1QUQ A;  3HKZ G;  4DAM A;  4DAY B;  2E2I H;  2K4K A;  3PUY A;  2PNH A;  4P74 A;  4LF8 Q;  3HOV G;  1PH9 A;  1KAW A;  1QVF A;  3PSI A;  2UUC Q;  2GVB A;  1LM0 A;  2EIF A;  1Q12 A;  1A8V A;  3A0J A;  4KHZ A;  4BY1 G;  2ES2 A;  2R93 G;  1P16 A;  1TXY A;  3I7F A;  5HY6 A;  1I94 Q;  2PQA B;  4BBR H;  1GKH A;  4A93 G; 
#chains in the Genus database with same CATH topology
 5LMN Q;  1CA6 A;  3U9S A;  2EYL A;  5J22 A;  1LTI D;  1V1P B;  1CFM A;  2LXK A;  1Q7Y C;  1PLF A;  4DR2 Q;  1WYD A;  3H3V C;  2JA7 G;  2JA6 G;  2JEB I;  1G2S A;  2F0V A;  1X9N A;  1V1Q A;  1DJR D;  1TWF H;  4R1J A;  1ESR A;  1QVC A;  1TVX A;  2A19 A;  3T16 A;  3I4O A;  1IBK Q;  4IFD I;  4KJN A;  3NTI A;  3VYS A;  2IX0 A;  4C3J B;  3GTJ B;  5IWA L;  1PRT C;  1RCV D;  4DV3 Q;  5IYD G;  3GTP B;  4F7X A;  5L37 A;  4HED A;  4A3B H;  1EY8 A;  1FJG Q;  1B70 B;  2MFI A;  5ELB A;  1U4R A;  3IAY A;  1EQV A;  3FKI G;  5F2D A;  4MZ9 A;  4WOR A;  3SDZ A;  1G6P A;  4ALP A;  1YBY A;  4XYQ A;  2C35 B;  4DR3 Q;  2B39 A;  4JOI C;  4IUV A;  4ME5 A;  3MFY A;  4GNX C;  5BN5 A;  1WTQ A;  2YYZ A;  3RN2 A;  2F0U A;  3H3V I;  1YIT A;  1VQI A;  3G6J B;  1S72 A;  1CI3 M;  1FNV A;  2NWG A;  1VF7 A;  4BBS H;  2AWO A;  1ET9 A;  1PFB A;  4FDB A;  4JV5 Q;  5FO9 B;  5A2Q L;  2NZH A;  1PH5 A;  2ASB A;  4GN5 A;  1WTW A;  3NUC A;  3AFP A;  1BF4 A;  3K7U C;  3U9O A;  1JE4 A;  4XT3 B;  2O2L D;  3P20 A;  2CQA A;  1IHZ A;  3ULP A;  3BVG A;  1U4P A;  1O78 A;  2VZA A;  3EIV A;  1HQR D;  3CCV A;  2EJG C;  2EXD A;  4A3K B;  2MO0 A;  4NXN L;  1CSP A;  2QCP X;  2RSO A;  5CYU A;  4ZKB B;  1NMF A;  4YHH Q;  5LMU Q;  4LF6 Q;  1I4X A;  1STE A;  1O7Y A;  5FOB B;  2F0E A;  2R92 B;  1E3P A;  4C3I B;  2K52 A;  1SEB D;  5IP9 H;  1VQD A;  3NK9 A;  3H0G H;  2C9O A;  5IGC A;  5M3M G;  1EIF A;  2PZW A;  4I7Z C;  5HGT A;  1DOM A;  1N32 Q;  4XTC S;  4BS9 A;  1RL2 A;  5BR8 Q;  3L9A X;  2PQE A;  5KYL A;  1DON A;  1BXT A;  4K5W A;  1D5Z C;  1T9H A;  1KRT A;  1OTC A;  3S15 B;  1O7L A;  4JI7 L;  5CV9 A;  3VA7 A;  4DAP A;  5AFW A;  2JA8 H;  4LF4 Q;  2NVY B;  2WKC A;  1IW7 D;  1DM0 B;  3G48 A;  4A3E H;  1S5F D;  2PQA A;  4HIK A;  3LNN A;  1W2B A;  3HOW B;  3CCS A;  2WB1 E;  1BCP D;  3K7A H;  1JB7 A;  1I4Q A;  2EYM A;  1AE2 A;  2A6E C;  3U4Z A;  1D1K A;  1HNX L;  2HCI A;  4FF1 A;  4NKL A;  4JI6 Q;  2EOT A;  5C4X H;  4M8A A;  1EYD A;  4KJO A;  1I4H A;  2AUK A;  2EYJ A;  4UPA A;  1H9S B;  3CCR A;  2JK8 A;  2BE5 D;  2RQX A;  1SLJ A;  3S17 H;  2QEJ C;  1LAC A;  2WP8 J;  1BVS A;  1N36 Q;  3I56 A;  3FPP A;  1LTA D;  2JQO A;  2MHV A;  3HOZ H;  2OCE A;  3VYU A;  4F87 A;  1K8M A;  1U4M A;  3NXW A;  2JA5 B;  2ALY B;  2WFW A;  3EA6 A;  1CKN B;  1SJH D;  2KQ3 A;  3KF6 A;  2WKD A;  4KK7 A;  3RLF A;  5M9O A;  3K80 C;  1JB3 A;  3L0O A;  3Q22 A;  5LL6 S;  1TS5 A;  4DR2 L;  3F8T A;  2ZXP A;  1F2L A;  5DAU A;  2E2J B;  5E7N A;  4DV5 Q;  4JV5 L;  2RHQ B;  1I6H H;  2D0P A;  5FJ8 H;  5GQO A;  2H5X A;  2XRS D;  1D5X C;  3OOC A;  3SE0 A;  5DEH A;  3KF8 B;  4C3I G;  1EYC A;  3PIP 3;  3K6O A;  1PYS B;  4LF7 Q;  4HJ8 A;  1YNN D;  1IBK L;  5M5Y B;  1KC8 C;  3I72 A;  2JA6 B;  3NBH B;  1LUZ A;  5JPM C;  1VQC A;  3J7A 5;  3RZD B;  1KNE A;  4DV6 Q;  1BQQ T;  2EDG A;  4BA2 I;  1OXV A;  5I2Y A;  2AHO B;  1GHK A;  2JXM B;  1AW7 A;  5ELC A;  2K7V A;  3CU7 A;  4JI2 L;  4TQU S;  3SK5 A;  2PMZ E;  3M4P A;  1ET6 A;  4K2K A;  4PMC A;  3QOL A;  3G7L A;  1JWU D;  3HG9 A;  2B2T C;  1UEA B;  3GV6 A;  3CD6 A;  1Y8P B;  3CPW A;  4WJ3 M;  3HZX A;  2NZ1 D;  2MPM A;  4DR1 L;  2KHS A;  1PH8 A;  4JI2 Q;  4KHP Q;  1JIC A;  1GD7 A;  3K5O A;  4O1N A;  2DNE A;  2F3I A;  4XYO A;  5D3D A;  2L9H A;  1XMQ L;  1N33 Q;  4FF3 A;  5FO7 B;  3Q6S A;  1QCB D;  3CCE A;  3VA5 A;  4EVO A;  3D4W A;  2FXQ A;  2QW7 A;  2F0G A;  5HUR A;  3PO3 B;  1PH2 A;  4DR7 Q;  4G7H C;  4JI4 Q;  1L1O C;  2R7D A;  2A69 D;  3MA2 B;  4H13 C;  2K5V A;  2A6E D;  4U68 A;  1E2Z A;  1PZJ D;  2CH4 W;  3FKI B;  4QB4 A;  3R3O A;  1TWG H;  4A4I A;  4CJ1 B;  4S3S A;  4FYD A;  4RGM A;  2F0N A;  3GTO H;  1Y1V G;  2VB2 X;  1B3Q A;  5ISR A;  5JJZ A;  2HIX A;  2EE1 A;  5ELE A;  1IZ6 A;  3HOV H;  3GTL B;  3NEM A;  4XDX A;  4EGV A;  1VQ7 A;  1G6Z A;  3TSS A;  1JQY D;  3U4V A;  2LSS A;  4APV A;  3OTO L;  3QOJ A;  1B1Z A;  5LMN L;  4KI0 A;  4A3J B;  4DF7 A;  2YTY A;  1SRO A;  4A3E G;  2JA5 H;  1A63 A;  4HSP A;  1WD1 A;  4QL5 A;  1SJE D;  3NBI A;  3X3M A;  4N8F A;  4A3F G;  2EY6 A;  3KDF A;  1L1O A;  3MC0 B;  2F4V Q;  2EYO A;  4JI0 L;  4OO1 I;  1PTO C;  1EWC A;  3BJU A;  1QNK A;  2JA9 A;  1JOQ A;  3I4L A;  3AU7 A;  2K04 A;  3CRK C;  5EAY A;  1WTO A;  3ONA B;  1E7Z A;  1LLR D;  5FKA C;  1HJP A;  4GKK L;  1JJG A;  3HP3 A;  4A93 B;  3DWA A;  3M4Y A;  3TN2 A;  2Z0S A;  4FNF A;  4BY1 B;  3ZYY X;  3A55 A;  1SSO A;  4LW1 A;  1S40 A;  4BBS G;  1JCK B;  2KOL A;  4PZ7 A;  1STG A;  4LF5 Q;  1IYJ B;  5IT9 c;  5IT9 L;  3HKZ B;  3C3L A;  4A3B G;  2V4D A;  2D5D A;  4I65 A;  2YTX A;  4GOP B;  1G91 A;  1R9T B;  4L5S A;  1Q8K A;  2MNA A;  2F0W A;  5M5X H;  4JBK A;  1GUT A;  2G5D A;  4X66 Q;  2NVX H;  3S16 B;  3CRL C;  4A3D H;  1I3Q B;  3MZ5 A;  3RLO A;  4XQN A;  1LT4 D;  1YEZ A;  1E2W A;  1DOL A;  1DXM A;  1Z47 A;  1RTO A;  1STA A;  1SMY D;  1HNW L;  2IL8 A;  4ZQ3 A;  2ATW A;  4L8J A;  2KVM A;  1VMC A;  3PUZ A;  4UP9 A;  4J6H A;  4DV4 L;  2E75 C;  2F4I A;  1W6K A;  4UDU C;  4X66 L;  5JOB A;  1VQ5 A;  1FD7 D;  1HFN A;  4ABN A;  1ROD A;  1JWS D;  2ZTD A;  4BA1 I;  2JA7 B;  1VQJ A;  4RG1 A;  4LFC L;  3OPO A;  3I2Z A;  2R93 H;  3VR2 A;  1NNX A;  5KEE A;  4A3I H;  4RGT A;  2GA4 B;  3PO3 G;  2A1A A;  3PF4 A;  2MP1 A;  1FGU A;  3I3C A;  2AMC B;  2PYK A;  2K14 A;  4YY3 Q;  3LWE A;  3PQI A;  2Z1C A;  3Q0A A;  1QB5 D;  4HJ5 A;  4OXP A;  3P75 A;  5C6A A;  1SYB A;  2Q2U A;  3N52 A;  3GTG H;  1C48 A;  2JSO A;  4JI4 L;  1GVP A;  5FJ8 G;  1J5E Q;  4RKB A;  4L5Q A;  3BZC A;  1TQO A;  1GO3 E;  2VXW A;  2RBM A;  4KKT A;  3I73 A;  4NP5 A;  3LWU A;  2K28 A;  1KD1 C;  5GAE C;  2SEB D;  1D6E C;  5C5M A;  1Y14 B;  4DAY B;  2E2I H;  1D5M C;  5DM7 3;  1QVF A;  4JW0 A;  2UUC Q;  1LM0 A;  3FVQ A;  2EIF A;  4OGQ C;  3A0J A;  2A69 C;  3IFD A;  1TXY A;  2RCF A;  1TWH B;  2PQA B;  4BBR H;  1GKH A;  3M7G A;  3R93 A;  5IYD H;  2F0F A;  5EKI A;  3VR4 A;  3PF5 A;  1A3V A;  2E2D C;  3R2T A;  1Q90 A;  4HID A;  2PO4 A;  5T1G A;  2AKW B;  4P73 A;  2R6G A;  3SXH A;  4DK0 A;  5E1F A;  3RZD H;  2K33 A;  1FR3 A;  1YNJ D;  3A54 A;  3ZJY C;  2JP1 A;  3VR5 A;  4A3I B;  1WFQ A;  3UDI A;  1FL0 A;  1GUO A;  2SDF A;  4DK6 C;  4DV0 Q;  1VQF A;  1T5X D;  4R4O A;  5BN4 A;  5GAH C;  3K5L A;  1YZ6 A;  2B3G A;  2EVB A;  2Z6K A;  3HKZ E;  4BWG B;  2F0Q A;  4MN3 A;  3MAQ A;  2F0D A;  5ELN A;  1M1K C;  4LUV A;  1CM9 A;  1VQP A;  1ML0 D;  1UE5 A;  1F2M A;  3A56 A;  3VDY A;  1XTD A;  1G29 1;  4J8Q A;  3IRB A;  4OL7 A;  4AQY Q;  3ULL A;  5IE8 A;  1WCM H;  4B3T L;  2UXC L;  3I91 A;  1HZ9 A;  2I5M X;  3M9B A;  4DV1 Q;  1L0X B;  3KLS X;  4HIO A;  4IO9 A;  2A73 B;  3P1H A;  3PMF A;  3K7A B;  4X3U A;  2Q8R E;  3W1G A;  2A6H D;  1A0I A;  1K83 H;  3NEN A;  3J7Z C;  1I5F A;  2MJ8 A;  3OTO Q;  2VUM B;  2L15 A;  4B3T Q;  2XVS A;  3JC6 6;  4FVM A;  2FMC A;  1K0R A;  2BCO A;  2AQ2 B;  1VQ4 A;  2MO1 A;  2KEE A;  2PCF B;  3U50 C;  4B9X A;  4RHR A;  1HXY D;  4DR6 Q;  4IOC A;  3WDN A;  2EYF A;  2KCC A;  3OW7 A;  4CDD C;  4DV2 L;  4X3T A;  4OX9 L;  1SXT A;  4V19 0;  4GKJ Q;  1Y1W G;  3MEF A;  4YCV A;  1U5K A;  3L7Z C;  4FO2 A;  3MXN B;  2K5H A;  3E9I A;  1VQN A;  4DN4 M;  5I4D A;  3J7A V;  1WTX A;  2XSC A;  1L1O B;  1HH2 P;  1PTO F;  3C1E A;  4KN7 C;  1IL8 A;  4IZ8 A;  2HQE A;  3PUX A;  4R4C A;  4J1M A;  3C1F A;  3SGI A;  4GKJ L;  2UU9 L;  5C0X G;  1XYI A;  1OXT A;  5K36 H;  4GLX A;  2B2U C;  4AH6 A;  1XTC D;  4F8M A;  2A8V A;  3NWT A;  1K28 A;  2G9H D;  2KJX A;  3FKI H;  2B2W A;  3RR5 A;  2NZO A;  3S9W A;  1PH1 A;  4DXG A;  2HDL A;  1SNQ A;  5IP7 H;  5AJ3 L;  1JJ2 A;  2PPB C;  3RNU A;  3AEV A;  1I6H B;  4DNT B;  1I4G A;  3DHQ A;  1Y1V H;  5C3E B;  2R7Z B;  3J7Y W;  1ZXT A;  1OXX K;  4JCV E;  1K3B C;  1XWE A;  1TWC H;  2KBN A;  2WAQ B;  4QIW B;  4DUZ Q;  2OQ0 A;  4R8N A;  2E2H B;  1EY6 A;  3S1N B;  3TEH B;  4BXX H;  1YJW A;  2UXD L;  2HDM A;  4DV0 L;  4NPS A;  4DAV A;  2JE6 I;  5FLX L;  1TWA B;  1J8I A;  4DNR B;  4LFC Q;  2UUB L;  2X6G A;  1VCI A;  2SOB A;  2Z4I A;  2NBF A;  2QIL A;  4JI7 Q;  3HOU G;  4GLV B;  4K5V A;  4OEL B;  3M85 A;  1I6V C;  1ZYR C;  3SEB A;  1UE1 A;  5C3E H;  1SYD A;  3T53 B;  1LTG D;  5FLX c;  1NMG A;  4AQY L;  3EJI A;  1M8A A;  1E1O A;  2F0J A;  3HOX H;  2RDF A;  2RF4 A;  2B2V C;  1IKL A;  3T4A C;  3J81 L;  2M9V A;  1HNX Q;  3ERS X;  5ELO A;  2GN5 A;  3D0F A;  5FO8 B;  1S4Z A;  4BY7 B;  4C1N K;  3FRP B;  3MVV A;  3LX0 A;  1BBX C;  5J39 A;  1XPO A;  3Q23 A;  2B8G A;  2NN6 I;  1I50 B;  3K5N A;  1Z9F A;  5COR A;  1X32 A;  5J1Z A;  3A8I E;  4OIK A;  3F1Z A;  4K6D A;  5E4X A;  4JPB W;  3JAM i;  4GKK Q;  4UP8 A;  1PFM A;  3JAM E;  4C3J H;  1OXU A;  3MWY W;  4A3D G;  2ZTC A;  5C4J H;  4DR6 L;  1AEX A;  4C2M B;  4KKS A;  1ICW A;  2G9D A;  4KD4 A;  1SN8 A;  2N55 A;  4A3M G;  1SYF A;  3H6M A;  1MIU A;  1ILQ A;  2HCC A;  3EN2 A;  5KIX A;  2B2T A;  3HOZ G;  1YHQ A;  3IL8 A;  2EY1 A;  2MGS A;  1SMX A;  4OEM B;  3KJO A;  4UHV A;  4F88 A;  4IQZ A;  4PG3 A;  2L0C A;  2I07 B;  1O7Z A;  2YTV A;  5EJW A;  3M7N A;  2F52 A;  1B8A A;  1IBM L;  2L55 A;  1VQA A;  4B3R L;  1WTV A;  3GTM H;  1E24 A;  4A3G H;  4A3L H;  2RCN A;  4FF2 A;  4JC0 A;  2UU9 Q;  1PH3 A;  1UE7 A;  2O4X A;  2Z6K C;  1SE4 A;  2H1E A;  3GV3 A;  4JK1 C;  3GP7 A;  1SNM A;  1HR0 L;  4KY5 A;  1HNZ Q;  2ENB A;  2L5T A;  1VDZ A;  4QCL A;  3I55 A;  2OXP A;  5GRO A;  4CGY B;  1HZB A;  1EY0 A;  4DR3 L;  3OWF A;  2QKI C;  4UY8 C;  3W5O A;  3NSW A;  4DKA C;  1O7I A;  1TR5 A;  3K0X A;  2RA4 A;  2FJ2 A;  1B44 D;  2B8F A;  4CKB A;  4DUZ L;  3A5U A;  1F2Y A;  4HMI A;  3A7A B;  3PCO B;  4WFN 3;  4YY3 L;  1FVI A;  4X62 Q;  3AMU A;  4RAU C;  3BU2 A;  1QNU A;  2R61 A;  5EQ0 A;  4C56 C;  4GNX B;  3DWP A;  1X3E A;  3NWS A;  3H0G G;  1EWH A;  1Q8I A;  1OXS C;  4CDC C;  4TRD A;  4Z9C B;  1VQL A;  4UP7 A;  2QDL A;  2PZU A;  3UDF A;  4C3I H;  3PIP A;  2N3S A;  2C5C A;  2IX1 A;  3X3N A;  4X62 L;  4H7B A;  4LFA L;  1CHQ D;  1C0A A;  1I4P A;  1QE6 A;  3TP5 A;  2EYH A;  3TQY A;  2CKZ B;  3SK8 A;  3GQB A;  4KLK A;  1EIY B;  1MSH A;  1A62 A;  5DNF A;  4ZKC B;  5IGF A;  4TSS A;  1G8Z D;  1SDF A;  1TKW B;  4QUC A;  4C3H G;  1X3F A;  2RVL A;  4DR4 Q;  4QJF A;  1K73 C;  3W1B A;  1MJE A;  5TSS A;  1EY4 A;  3EVQ A;  4DK3 C;  1PH7 A;  2Q2H A;  3BDL A;  3VR6 A;  3L2P A;  5C4X G;  1EIG A;  2B63 B;  2Q8I B;  1EFW A;  4P72 A;  2XIW A;  2VB3 X;  1PHJ A;  4DR4 L;  1RHP A;  5JPN C;  5KRU A;  1GHJ A;  1JE5 A;  2BDN A;  1IBL L;  1CT1 D;  2PNR C;  1E2V A;  1OO9 B;  4JI5 Q;  2CVR A;  3I4M B;  4A3M H;  1Z6H A;  2R93 B;  4TKO B;  4FF4 A;  3I90 A;  3WWV A;  1YHB A;  3FDT A;  4KHP L;  1CTM A;  2ZM6 Q;  4PZ8 A;  4IPD A;  1MKH A;  3S1N H;  1U9R A;  2OQK A;  1STB A;  1K8O A;  2F0O A;  3PO2 G;  1PXU A;  2NVQ H;  3S2D B;  5LHY 1;  1I3Q H;  3H91 A;  3ERQ A;  4C3J G;  3BYT B;  3TME A;  2R7F A;  2OT2 A;  5EBC A;  3V96 A;  3UDG A;  3KYH C;  1EZ8 A;  1PH6 A;  4B3S L;  2F0P A;  5G3L F;  2VUM H;  1ZYR D;  1SYC A;  3S14 H;  2WAQ E;  5C44 G;  1PRT F;  1CKN A;  5D65 A;  3NP8 A;  3KBX A;  1RIP A;  1J6Q A;  1IYV A;  4C2M H;  4OO1 G;  2BE5 C;  3J80 i;  2K75 A;  3K59 A;  2NVY H;  1HUM A;  3WOE A;  5IOD A;  3DXJ C;  1K3R A;  3FEW X;  2VW9 A;  4MTN A;  5M3M H;  3DEP A;  4B3S Q;  1FYC A;  4JVZ A;  5IGE A;  2ZJP A;  4IAL A;  4ULL A;  1KXL A;  4DV5 L;  1C9O A;  5IYB H;  3GDE A;  2OEO A;  4OHJ A;  3MTS A;  3HOX G;  1ASY A;  2CWA A;  3BDC A;  4DA2 A;  3C2P A;  2K6A A;  1KAA A;  1UEB A;  2CH4 A;  3TRZ A;  2IT1 A;  2XWB B;  3ICE A;  1QUQ A;  5D14 A;  2K4K A;  2PNH A;  4LF8 Q;  1KDB A;  3HOV G;  3MXU A;  3P7J A;  1Q12 A;  1ENF A;  1EY7 A;  4KHZ A;  2Z8L A;  1WCM B;  3BDO A;  3I7F A;  2X69 A;  2H4O A;  4AYB G;  3JAM L;  3GO5 A;  4KD3 A;  3GTL H;  1HRJ A;  1EU4 A;  1O80 A;  4AIM A;  2HT1 A;  2O5J C;  3T13 A;  4P2C B;  1AE3 A;  1ESF A;  1SR3 A;  1JOR A;  1QUQ B;  3RMH A;  4L63 B;  1XNQ Q;  3M4O H;  3A8J E;  3SVM A;  3HOU B;  4QMG A;  1M4V A;  5LL6 X;  3CC4 A;  4YCW A;  1VQE A;  3JAM c;  4Y7N H;  4L5T A;  3J81 E;  1EOV A;  2I5H A;  5A2Q E;  5C44 H;  4BY7 H;  4X64 L;  1EFI D;  3FP9 A;  1XMO L;  5D3I B;  2NYZ D;  5JVG 3;  1MSG A;  4K8J A;  1BR9 A;  3KBG A;  4K6L A;  1N33 L;  3K5M A;  1IW7 C;  1M90 C;  5GAG C;  3RN5 A;  1HCZ A;  4A3L G;  1E0B A;  1H9R A;  4QQB X;  5JJI A;  3GTK B;  3G71 A;  1QG7 A;  2A74 C;  2FHT A;  2OF1 A;  3NPP A;  2A68 D;  4LK1 C;  4BBR B;  2Q2T A;  1JOK A;  4JI3 Q;  2VQF Q;  1T5E A;  2ZM6 L;  2NVT H;  3UE1 A;  1CZW A;  1WTR A;  5FLX E;  3DM3 A;  3M3Y B;  5JJK A;  2WIN B;  3KUP A;  3CAM A;  4IUU A;  3CQZ B;  4GN3 B;  1K9M C;  2E8G A;  2JN4 A;  1Q46 A;  1VQM A;  1VQK A;  3LGJ A;  4Q5V A;  4A3G G;  4X3K A;  3D6C A;  1VMP A;  1PTO H;  3BZK A;  4Q0F A;  2LS0 1;  3ER0 A;  3G4S A;  3AFQ A;  2L4N A;  2SNS A;  5BN3 A;  1VQG A;  2F03 A;  4FXK C;  3E5S A;  3T1Y Q;  2CWP A;  1SNC A;  4JI0 Q;  3U58 A;  3J7A F;  1EEI D;  3NEL A;  3CC7 A;  3E0J A;  3G6E A;  1Y1W B;  4ZAI A;  1QIL A;  4EQO A;  2XNA C;  3T1H L;  3AQQ A;  2RDG A;  2IWH A;  4A3C G;  1IL2 A;  5JEA G;  3EFX D;  3MEH A;  3J81 i;  5IYB G;  1RKN A;  3CKI B;  3QR8 A;  1Q82 C;  3UE0 A;  4C1N I;  4DV2 Q;  1IBM Q;  4B3R Q;  3R8B A;  4A3G B;  1VQ9 A;  2CW0 C;  3Q8D A;  4IN3 A;  2HQL A;  3CW2 C;  5M5X B;  3I4N H;  4L5R C;  2K1B A;  4HTH A;  5IP9 G;  3GTQ B;  3AYH B;  3RUZ A;  2PW7 A;  2BOS A;  2D62 A;  2YV5 A;  1CQF A;  5IT9 E;  2ZXR A;  1I4R A;  1N8R C;  4G7Z C;  2YU9 B;  2F0I A;  4JBJ A;  1I94 L;  1Q3L A;  3W3A A;  1JR0 D;  4B08 A;  1HZC A;  4A3D B;  2WB1 B;  3RLN A;  1HQM C;  3K0Y A;  2HHH L;  1EOT A;  1V1O A;  3STB D;  1WVL A;  4U67 3;  1NSN S;  4NXM Q;  2K32 A;  3QJY A;  1PYW D;  3H15 A;  5AJ3 Q;  5M3F G;  2NN6 H;  4NW2 A;  4GNX A;  1TWF B;  3R2I A;  1DZ1 A;  2N49 A;  2VL6 A;  1D7Q A;  3SHL A;  1EYA A;  2IY5 B;  1A3T A;  2D2C C;  2X6L A;  1SMY C;  3KK7 A;  5E4W C;  1CK1 A;  1WJJ A;  4A3I G;  2PW5 A;  1QZG A;  3CF5 A;  2D9U A;  3KOJ A;  4KY7 A;  4ME3 A;  4R4Q A;  1YIJ A;  2FMM A;  1SYE A;  4Y52 H;  4DR1 Q;  3S1R H;  2V1C C;  4A3J H;  1F9Q A;  1LT6 D;  4MIU A;  2QDB A;  2UUB Q;  1BCP F;  1F9P A;  4V0B A;  4X65 L;  4E6I A;  3HRZ C;  4PMW A;  1QOH A;  4I7A A;  1STH A;  5KNB A;  2VNU D;  4HJ9 A;  4DV7 Q;  1L0Y B;  4OWX B;  4IPC A;  1C4Q A;  2A68 C;  3F2B A;  3V05 A;  3CCQ A;  2B63 H;  3DM1 A;  1Y8N B;  5KNC A;  1XPU A;  2Q2I A;  1SFO B;  4NXN Q;  1EU3 A;  1C7Y A;  1J9O A;  1NE3 A;  4RWS C;  4C3H H;  3S2D H;  2QA4 A;  2M2L A;  1AZQ A;  4HSV A;  3OWE B;  1STN A;  5DM6 3;  2E74 C;  2J0T D;  4QGU A;  5I2X A;  2HIV A;  4YHH L;  3J81 j;  5LMU L;  4LF6 L;  1S5C D;  2UXB L;  4XT1 B;  2WB1 G;  4A3F H;  1XNQ L;  3E3X A;  4N8X 1;  2Y0S B;  1TWG B;  3TBI B;  3MFG A;  4JI5 L;  1VQH A;  2L12 A;  3CHB D;  4EQ5 A;  2UUA Q;  1N32 L;  1IXR A;  2RSN A;  1Y1W H;  3TP6 A;  2OTL A;  2R3Z A;  3F2C A;  2DY7 A;  5LMN W;  1YJ9 A;  3TP7 A;  1KQS A;  2NN6 G;  1SNP A;  1XMO Q;  1K8A C;  2KCT A;  4LF9 Q;  1EQQ A;  2E2I B;  2VS1 A;  1B7Y B;  4YCU A;  1YHA A;  1JMC A;  3K8A A;  1RDP D;  2VY3 A;  3M4Q A;  4LF4 L;  1PVO A;  1B50 A;  2UUA L;  4RCN A;  4R4T A;  2UXD Q;  1SNO A;  3GTG B;  5EGT A;  4ODG A;  3A8K E;  3QG1 A;  1LTB D;  1Y69 U;  1PZK D;  2IHE A;  2B2U A;  2ZTE A;  4DFA A;  2I46 A;  3K58 A;  1X3P A;  3MXG A;  3HOY G;  1ENC A;  4JOI A;  1PH4 A;  1CKO A;  2EPB A;  5E3F A;  1HUN A;  5EKL A;  4A3B B;  2EYP A;  5C4H A;  4HJA A;  4LMQ D;  4KN4 C;  2BH8 A;  2NUC A;  1PV4 A;  3CCL A;  4H0L C;  1LV9 A;  1RD9 D;  4CDF C;  2HHH Q;  2PMZ B;  2IJ0 A;  1U0L A;  2IHF A;  4JI8 L;  1TWC B;  4OON A;  3E6Z X;  4YWK A;  1EYG A;  4ZUI A;  1IKM A;  5K36 G;  5M3F H;  5IWA Q;  2J4X A;  4ZYS A;  5IYC H;  5I6W A;  2ZJR A;  1K83 B;  3E9H A;  4POF A;  5G3L D;  3ND9 A;  1SFO H;  3GTM B;  4B9W A;  5J3B A;  4OX9 Q;  4X6A H;  1D1I A;  5M5W B;  1AN8 A;  1YNJ C;  4PQX A;  4RCO A;  5CV6 A;  4A3F B;  1WTP A;  1E22 A;  3I4N B;  1WTH A;  1Q1B A;  4NDX A;  1SE2 A;  5KYI A;  4C3H B;  1S3O A;  4LFB Q;  2EJF C;  4X3S A;  4DNI A;  2I0Q A;  5CGK A;  3S1R B;  1NJI C;  4A93 H;  4LF7 L;  2LFN A;  3S24 A;  3PIO A;  5FLM G;  1PYB A;  4G7O C;  5EBD A;  1X6O A;  5FLM H;  1DD2 A;  2Y0S E;  4DV7 L;  1BBW A;  5H1S E;  4DU9 A;  1TS3 A;  3EBE A;  3KJP A;  4O2D A;  2A5H A;  4HMJ A;  2B2Y C;  3QWN A;  4IPG A;  4DR5 Q;  5JEA H;  2CFM A;  1R4Q B;  1HR0 Q;  2KUM A;  1XNR Q;  1BBU A;  1HNZ L;  4O42 A;  4A76 A;  3I4M G;  4NB3 A;  4AYB B;  5CV4 A;  1KTK A;  4A3K H;  2ZXO A;  1TWH H;  2N8N A;  1EY5 A;  3RZO H;  2QGQ A;  2KCM A;  1CSQ A;  1KDA A;  2M00 A;  1L0W A;  2ZT9 C;  1E1T A;  1NBW A;  3J80 E;  2VQF L;  3E0E A;  1CQV A;  3M3Y H;  4LAA A;  5CV7 A;  4YWM A;  4A3C H;  3TZU A;  1VS0 A;  3S1M H;  1AH9 A;  1AZP A;  1TWA H;  3PUV A;  1I50 H;  1VQO A;  4CBV A;  5I6Y A;  4IFD J;  1BDO A;  3I4M H;  2Z6B A;  4ZRZ A;  3KF8 A;  3HOY H;  1F77 A;  1YNX A;  2K5Q A;  3H3V H;  2R92 H;  2RKS A;  2OWO A;  5IGD A;  3T1Y L;  3TS2 A;  4OWW B;  2KEN A;  5NUC A;  5ELF A;  2XRQ D;  2EY5 A;  1BCP C;  1PTO D;  4ZUJ A;  5CV8 A;  3PO3 H;  4A3M B;  3DWQ A;  4QY7 A;  2UXC Q;  2E2J H;  2GVA A;  1YVC A;  5FK9 C;  4DV1 L;  5CR3 A;  4GOP A;  1D8L A;  1PFS A;  2NVT B;  4JI6 L;  3SR1 A;  1TT2 A;  1S5D D;  1B9N A;  1PFN A;  3F2U A;  4QIW E;  5A35 A;  3CCU A;  3QO2 A;  4IUR A;  3S1M B;  1U4L A;  3BVM A;  3BS1 A;  1KLG D;  1JWM D;  2KED A;  5KGU A;  1VQ6 A;  1V8Q A;  2QF7 A;  1YI2 A;  2JA5 G;  1XX8 A;  3OIP A;  4ZK9 B;  2LMC B;  3NHH A;  4DAM A;  5C3X A;  1PH9 A;  3HOY B;  3PSI A;  1NR4 A;  1UUP A;  1SBB B;  5K5P A;  4BY1 G;  2ES2 A;  2R93 G;  3RZO B;  2DNC A;  5HY6 A;  3T51 B;  2HUG A;  1I94 Q;  3I70 A;  4A93 G;  3HEJ A;  2E76 C;  5IYC G;  1CKM A;  4MTK A;  4IJH A;  4IUQ A;  1B9M A;  2K01 A;  2WAC A;  4IFD G;  2KA7 A;  1GUS A;  3QB3 A;  1GUW A;  3DLL A;  1LO5 D;  4LUO A;  3MXP A;  1R9T H;  1P8L A;  4DAY A;  1XPR A;  1QJO A;  5CBA E;  4RHS A;  1HZA A;  2BA1 A;  1II3 A;  2XTI A;  1CZG A;  2K03 A;  5CC4 A;  1RF2 D;  1CUK A;  3SK6 A;  3PUW A;  5C44 B;  3HOW G;  3OYY A;  1Q86 C;  2LXJ A;  3CCM A;  4DR5 L;  4RFB A;  1QWY A;  3VYR A;  3J80 L;  3IFT A;  4ID6 A;  1XNR L;  3HS0 C;  2KEC A;  1V9P A;  4OO1 H;  1W3S A;  4KKU A;  1NR2 A;  1SAP A;  4DV6 L;  1MI2 A;  5IGB A;  2B29 A;  1X3G A;  3CMA A;  3CC2 A;  1SRU A;  3FMC A;  4CJ2 C;  2R7Z G;  1MHW C;  1AFP A;  5C3E G;  4B3M Q;  4WJ4 A;  2YU9 H;  1EWI A;  2XGT A;  5GAD C;  2IPK D;  1VQB A;  2Z9H A;  3HOU H;  4RGO S;  3PV0 A;  3FPU B;  2F3W A;  5IGG A;  5M3M B;  3EQL C;  1STY A;  1PRT B;  5EKK A;  3HOW H;  3IKJ A;  2BDO A;  5C4Z A;  2R92 G;  3D6W A;  4WRD A;  3L3O C;  1HA6 A;  4H44 C;  2N88 A;  1KRS A;  1C8C A;  2ZJQ A;  1KLU D;  2LY7 A;  3PGZ A;  1J5E L;  2PZT A;  4TVA B;  3MHB A;  4IFD H;  3OMG A;  3GTO B;  1EQR A;  2RHS B;  1ZEQ X;  1CA5 A;  2F1M A;  4K14 A;  4LF8 L;  1HA5 A;  2DN8 A;  1SE8 A;  2WII B;  4DR7 L;  1H95 A;  1R4P B;  1WI5 A;  1GM5 A;  4IPH A;  5EPK A;  2BA0 A;  1ONL A;  1UNS A;  1TU2 B;  5C4J B;  5M3F B;  2B2V A;  3H09 A;  1IBL Q;  3NBH A;  1WD0 A;  3KLS A;  1QZH A;  4RA8 A;  4YIJ A;  1KIX A;  1Y8O B;  3KFU A;  3CQZ H;  1PRT D;  1YNN C;  1X56 A;  2ID0 A;  2SNM A;  4H02 A;  3I4N G;  2L1B A;  4LNQ A;  4EQN A;  4X64 Q;  2ICI A;  1EY9 A;  3D3R A;  4LUZ A;  3BZD B;  3D4D A;  3OHX C;  5JEA J;  3S1Q H;  3NQI A;  4XQJ A;  4UAI A;  1CHP D;  1MJC A;  1YJN A;  2F4V L;  4CKC A;  1H9M A;  4K5X A;  3OW2 A;  1X65 A;  4DPG A;  4FP5 D;  3PIO 3;  1BNZ A;  3NE5 B;  2JA7 H;  1XJV A;  2AQ3 B;  5T1I A;  4WJW A;  4HCE A;  4PV1 C;  2VQE L;  2P5Z X;  2PI2 E;  5CBE E;  3GTJ H;  1TY2 A;  4JYA Q;  3A74 A;  5C5L A;  3K81 C;  1A2U A;  1DOK A;  4JI8 Q;  1A15 A;  1BUV T;  1GUN A;  1GOZ A;  1UWV A;  3CP0 A;  3J80 c;  1NAP A;  3O13 A;  1NUC A;  1LT3 D;  3D4R A;  4GOP C;  2AWN A;  3C46 A;  1SYG A;  1VQ8 A;  4BY7 G;  1K8G A;  1ICF B;  2F0H A;  4RGN A;  2CHB D;  2MQH A;  3HFZ B;  4AYB E;  1H9S A;  2CCZ A;  4JBM A;  1HHV A;  1UE6 A;  4KMU C;  1ENA A;  2KCN A;  1PMR A;  2AUJ D;  4MHE A;  3S1Q B;  1MBY A;  2DGY A;  1LTR D;  4J15 A;  2R7Z H;  2F0K A;  3BG3 A;  5C0X I;  3ND8 A;  3NQT A;  1TY0 A;  4XQQ A;  5I9P A;  4LFB L;  4R9W A;  3GTP H;  5CMD A;  2EQS A;  3URY A;  5I9O A;  3T1H Q;  3CME A;  1BKB A;  1EIH A;  4JI1 L;  1XXG A;  4DUY Q;  1XMQ Q;  3HOZ B;  2KHI A;  2BH2 A;  5M5Y H;  2OTJ A;  1HTL D;  1ASZ A;  4IJL A;  3B6Y A;  1G2T A;  1B2T A;  4N9P A;  4DXF A;  2Y0S G;  3N6R A;  4GZY C;  1KDC A;  3DEO A;  2IW3 A;  2WAQ G;  4P71 A;  2EJM A;  3BVZ A;  1N34 Q;  5EPJ A;  2K05 A;  2F0M A;  4G4K A;  1GXD C;  2I5L X;  4G57 A;  5CV5 A;  4LFA Q;  1Z7T A;  5IY0 A;  1A3U A;  4K0K Q;  1B4O A;  1GJX A;  1KAB A;  4DGZ A;  1AP0 A;  1DCZ A;  3S2H H;  1BCP B;  2EXZ A;  1HFG A;  2JA8 G;  1LT5 D;  4Y7N B;  2ICE C;  1N34 L;  1UAP A;  5IOC A;  1W6J A;  3UI2 A;  3NTK A;  5KND A;  3H94 A;  2F0S A;  1PA6 A;  2XN9 C;  1H9J A;  5JJL A;  3ERO A;  1D2B A;  4HIM A;  4A3K G;  2UUC L;  1Q81 C;  4MNO A;  1NTG A;  1JOO A;  1NCV A;  1S5E D;  1ZKO A;  4XIG S;  4B3M L;  4IUP A;  3OSO A;  1KNA A;  3Q24 A;  4EQP A;  4LF9 L;  4OIJ A;  2AQ1 B;  4CDE C;  1EZ6 A;  2E5L Q;  2JJQ A;  4A75 A;  4R4I A;  1MD2 D;  3GTQ H;  4EX5 A;  3NTH A;  4PZ6 A;  1WOC A;  1SE3 A;  4L6T B;  5HGQ A;  3A7L A;  4N9T A;  3TRE A;  1X54 A;  3TS0 A;  5C0X J;  2Q8T A;  3D8G A;  1N9W A;  2DJG C;  2PI2 A;  1X55 A;  4HN7 A;  4KTA A;  1EEF D;  2F3V A;  4PNY A;  5ELD A;  2VQE Q;  4BY1 H;  1FGB D;  4BBS B;  1A2T A;  3KLW A;  3S2H B;  4X65 Q;  1TS4 A;  4JYA L;  1L2F A;  2E5L L;  1FNU A;  4KHV A;  4ZLT F;  4FXG C;  3S15 H;  2VUM G;  1KHI A;  3KDF B;  2NTS A;  4DV3 L;  2L11 A;  2KHJ A;  5C3W A;  2NVQ B;  1EQT A;  1Q1E A;  2NB0 A;  4RKL A;  1HNW Q;  4JG2 A;  3I8Z A;  5JVH 3;  2LKV A;  3K57 A;  2Z4H A;  4GS3 A;  4O0A A;  2DUD A;  4LWC A;  1LTT D;  4DV4 Q;  3T56 B;  5COY A;  1LTS D;  1FNW A;  3GD7 A;  1TII D;  3CPF A;  2FIN B;  3BYY B;  3RD4 A;  1DGS A;  1VF5 C;  1PDQ A;  3GTK H;  4M1U B;  4QUF A;  4RMF A;  3TDQ A;  2K50 A;  2F0T A;  2CW0 D;  2TMP A;  4KV6 A;  4BXX G;  1NY4 A;  1LAB A;  5C0X H;  4JI1 Q;  4DUY L;  1JC7 A;  5EPL A;  3F2D A;  3PO2 B;  4POG A;  4HJ7 A;  1QVG A;  1Y1V B;  1V1P A;  1K0S A;  4PMB A;  4XXE A;  1TS2 A;  5M5W H;  3CCJ A;  1HR0 W;  1MGS A;  3QIA A;  2D0O A;  3MXN A;  3HGB A;  4LF5 L;  5IP7 G;  4FXD A;  4K8I A;  3M4O B;  1HTP A;  5DLQ E;  1SND A;  1V43 A;  1BOS A;  1RJT A;  1G51 A;  4QF4 A;  2TSS A;  1PTO B;  4K0K L;  2JA6 H;  4IUN A;  4NXM L;  2DJF C;  2EZV A;  4R8I A;  3OIQ A;  3S17 B;  1A6X A;  4GLA C;  1FJG L;  3HKS A;  2K5D A;  2B63 G;  5C4X B;  3WOF A;  2K5W A;  2HD3 A;  4DK1 A;  5IIF A;  4CKE A;  2DY8 A;  4IOA A;  2E2H H;  3PO2 H;  1LTL A;  4BBR G;  1X3Q A;  1S5B D;  2FFK B;  2QEX A;  4IUT A;  2K5N A;  5BR8 L;  3CXC A;  1B53 A;  4A3E B;  3S16 H;  2NVX B;  1KL9 A;  4KY6 A;  4A3J G;  3AB9 A;  1F9R A;  3ULJ A;  1BO0 A;  2JYO A;  1JJC B;  1LYL A;  1H9K A;  1EUJ A;  3J81 c;  2JEA I;  3A5Z B;  2CQO A;  4RH6 A;  2N78 A;  3V2T A;  4YWL A;  4CJ0 B;  4HCS A;  2F0L A;  2O5I C;  4LJZ C;  2B2W C;  4HR7 B;  3VYT A;  1ILP A;  4JI3 L;  3H0G B;  3STB C;  4CHT B;  3KF6 B;  2JA8 B;  4NMZ A;  3TP8 A;  2WV6 D;  3OMC A;  2UXB Q;  3W2D A;  4GN4 B;  3D31 A;  1GUG A;  4P75 A;  2A6H C;  3SK4 A;  2NTT A;  3TZD A;  5JAV A;  3FHW A;  1HPC A;  1WCM G;  3UDX A;  1EL0 A;  1PZI D;  4ILW A;  4JBW A;  4ZCK A;  3VR3 A;  1F2Z A;  3HOV B;  4OWT B;  2XWJ B;  2IX3 A;  3S14 B;  3DUZ A;  1RTN A;  3DMU A;  1JT8 A;  1N36 L;  2RDH A;  4K2L A;  3HKZ G;  1B3A A;  3PUY A;  1IYU A;  2EY2 A;  4P74 A;  1F9S A;  3KLR A;  1KAW A;  1DYQ A;  2B2Y A;  2GVB A;  3HOX B;  1A8V A;  2MUY A;  4HAE A;  1P16 A;  2J7Z A;  3ITP A; 
#chains in the Genus database with same CATH homology
 5LMN Q;  3GO5 A;  5IYC G;  1CKM A;  3GTL H;  5IYD H;  4IJH A;  4IFD G;  2HT1 A;  4AIM A;  3PF5 A;  1AE3 A;  3DLL A;  1SR3 A;  4LUO A;  1R9T H;  4HID A;  2LXK A;  1P8L A;  1QUQ B;  1Q7Y C;  1XPR A;  2AKW B;  4P73 A;  2R6G A;  3RZD H;  4DR2 Q;  1WYD A;  1XNQ Q;  1HZA A;  2BA1 A;  3M4O H;  3ZJY C;  2XTI A;  2JA7 G;  1WFQ A;  3UDI A;  1FL0 A;  2JA6 G;  4DK6 C;  1CUK A;  2JEB I;  1VQF A;  4DV0 Q;  3PUW A;  4R4O A;  4YCW A;  1X9N A;  1V1Q A;  1VQE A;  1TWF H;  3OYY A;  4R1J A;  3JAM c;  4L5T A;  5GAH C;  1EOV A;  1YZ6 A;  2B3G A;  2I5H A;  1QVC A;  1Q86 C;  2Z6K A;  5C44 H;  2LXJ A;  3HKZ E;  3CCM A;  4DR5 L;  4BY7 H;  2A19 A;  4X64 L;  3I4O A;  3FP9 A;  1XMO L;  1IBK Q;  5ELN A;  4IFD I;  1XNR L;  1V9P A;  4LUV A;  1M1K C;  1VQP A;  1UE5 A;  1W3S A;  2IX0 A;  1N33 L;  4DV6 L;  3VDY A;  1M90 C;  1XTD A;  5GAG C;  3RN5 A;  2B29 A;  1G29 1;  5IWA L;  4A3L G;  1X3G A;  3CMA A;  3CC2 A;  4DV3 Q;  5IYD G;  4QQB X;  5JJI A;  1SRU A;  2R7Z G;  4A3B H;  3G71 A;  5C3E G;  4B3M Q;  3IRB A;  4WJ4 A;  1FJG Q;  4AQY Q;  1EWI A;  2YU9 H;  1B70 B;  3ULL A;  2Q2T A;  2XGT A;  5IE8 A;  5GAD C;  1WCM H;  2MFI A;  2VQF Q;  4B3T L;  4JI3 Q;  2UXC L;  1VQB A;  3HOU H;  2ZM6 L;  2NVT H;  1HZ9 A;  2I5M X;  3FKI G;  3PV0 A;  3UE1 A;  3M9B A;  4MZ9 A;  4DV1 Q;  4HIO A;  4IO9 A;  1G6P A;  3DM3 A;  4ALP A;  5JJK A;  1YBY A;  3HOW H;  2R92 G;  2C35 B;  3CAM A;  4DR3 Q;  3W1G A;  1A0I A;  1K83 H;  1KRS A;  2E8G A;  1I5F A;  3NEN A;  4GN3 B;  1Q46 A;  4JOI C;  3J7Z C;  3OTO Q;  1VQM A;  4GNX C;  2L15 A;  3PGZ A;  1J5E L;  1VQK A;  3LGJ A;  4B3T Q;  3JC6 6;  2YYZ A;  4A3G G;  3RN2 A;  1K0R A;  3BZK A;  4TVA B;  1VQ4 A;  3H3V I;  1YIT A;  1VQI A;  2MO1 A;  4Y7N H;  1S72 A;  3U50 C;  3ER0 A;  3G4S A;  1EQR A;  2RHS B;  3AFQ A;  4LF8 L;  4BBS H;  2AWO A;  4DR6 Q;  1VQG A;  4IOC A;  3T1Y Q;  1SE8 A;  2CWP A;  4FDB A;  4JV5 Q;  4JI0 Q;  3U58 A;  2NZH A;  4DR7 L;  1H95 A;  4DV2 L;  1PH5 A;  2ASB A;  1WI5 A;  3NEL A;  3CC7 A;  3G6E A;  1GM5 A;  4OX9 L;  4GN5 A;  4IPH A;  2BA0 A;  3AFP A;  1Y1W G;  4GKJ Q;  3K7U C;  3T1H L;  3MEF A;  4YCV A;  1U5K A;  3AQQ A;  3L7Z C;  4A3C G;  1IL2 A;  3MXN B;  5JEA G;  2K5H A;  3E9I A;  1IBL Q;  1VQN A;  3J81 i;  5IYB G;  1QZH A;  1L1O B;  1HH2 P;  3ULP A;  1Q82 C;  1KIX A;  3UE0 A;  4DV2 Q;  2VZA A;  3EIV A;  1IBM Q;  4B3R Q;  3KFU A;  3CCV A;  1VQ9 A;  3PUX A;  2EXD A;  4R4C A;  3CQZ H;  2MO0 A;  3Q8D A;  4NXN L;  1CSP A;  3SGI A;  2ID0 A;  1X56 A;  3I4N G;  4H02 A;  2UU9 L;  4GKJ L;  5C0X G;  4LNQ A;  2HQL A;  3CW2 C;  4X64 Q;  1NMF A;  1OXT A;  3I4N H;  4L5R C;  4YHH Q;  5LMU Q;  4GLX A;  4LF6 Q;  4AH6 A;  4LUZ A;  3S1Q H;  5IP9 G;  5JEA J;  3AYH B;  1E3P A;  2A8V A;  2K52 A;  2D62 A;  2YV5 A;  5IP9 H;  1VQD A;  3FKI H;  3RR5 A;  1PH1 A;  2NZO A;  3H0G H;  1MJC A;  5M3M G;  1YJN A;  1EIF A;  2F4V L;  3OW2 A;  1X65 A;  4DPG A;  4XTC S;  1N8R C;  1N32 Q;  2JA7 H;  1RL2 A;  4JBJ A;  5IP7 H;  5AJ3 L;  1XJV A;  5BR8 Q;  1JJ2 A;  1I94 L;  3RNU A;  3AEV A;  1HZC A;  1Y1V H;  2VQE L;  1T9H A;  1KRT A;  1OTC A;  3RLN A;  2PI2 E;  3GTJ H;  2HHH L;  4JYA Q;  1OXX K;  4JCV E;  3A74 A;  3K81 C;  4JI7 L;  1TWC H;  2KBN A;  4DUZ Q;  4JI8 Q;  3STB D;  2OQ0 A;  1UWV A;  3CP0 A;  3J80 c;  3TEH B;  2JA8 H;  4LF4 Q;  4GOP C;  4NXM Q;  4BXX H;  2AWN A;  1YJW A;  2UXD L;  1VQ8 A;  3H15 A;  4DV0 L;  3G48 A;  4NPS A;  4A3E H;  5AJ3 Q;  5M3F G;  1K8G A;  4BY7 G;  2JE6 I;  2MQH A;  3HFZ B;  4AYB E;  2PQA A;  4HIK A;  4GNX A;  4LFC Q;  2N49 A;  2UUB L;  2VL6 A;  1W2B A;  1D7Q A;  2CCZ A;  4JBM A;  1VCI A;  1UE6 A;  3CCS A;  2IY5 B;  2WB1 E;  3K7A H;  1JB7 A;  4JI7 Q;  1AE2 A;  3HOU G;  1WJJ A;  3U4Z A;  4GLV B;  4A3I G;  1QZG A;  1HNX L;  3CF5 A;  3KOJ A;  4JI6 Q;  2DGY A;  3M85 A;  4ME3 A;  4J15 A;  4R4Q A;  5C4X H;  1YIJ A;  2R7Z H;  1UE1 A;  5C3E H;  5C0X I;  4Y52 H;  4UPA A;  3CCR A;  4DR1 Q;  3S1R H;  5FLX c;  2V1C C;  4A3J H;  2JK8 A;  4LFB L;  1NMG A;  1SLJ A;  4AQY L;  3GTP H;  3S17 H;  2UUB Q;  2EQS A;  1E1O A;  3HOX H;  4X65 L;  2RF4 A;  3T1H Q;  2WP8 J;  3CME A;  1BVS A;  4PMW A;  1N36 Q;  1BKB A;  3I56 A;  2JQO A;  4JI1 L;  4DUY Q;  1HNX Q;  1XMQ Q;  2KHI A;  3ERS X;  5ELO A;  2OCE A;  2GN5 A;  3D0F A;  3HOZ H;  2VNU D;  4HJ9 A;  4DV7 Q;  2BH2 A;  5M5Y H;  4OWX B;  4IPC A;  2OTJ A;  3F2B A;  1ASZ A;  3CCQ A;  4IJL A;  2B63 H;  3HOW G;  3B6Y A;  2ALY B;  1XPO A;  1XPU A;  2WFW A;  2Q2I A;  2NN6 I;  1CKN B;  2Y0S G;  1C7Y A;  4NXN Q;  1Z9F A;  1NE3 A;  3S2D H;  4C3H H;  3KF6 A;  2WAQ G;  4P71 A;  2QA4 A;  1N34 Q;  3F1Z A;  3RLF A;  3JAM i;  3K80 C;  4QGU A;  4YHH L;  3J81 j;  3L0O A;  2HIV A;  5LMU L;  4UP8 A;  4LF6 L;  4GKK Q;  2I5L X;  4C3J H;  2UXB L;  2WB1 G;  1OXU A;  4A3F H;  4DR2 L;  4LFA Q;  1XNQ L;  4A3D G;  2ZTC A;  3F8T A;  5C4J H;  4DR6 L;  4K0K Q;  5IY0 A;  4JI5 L;  5E7N A;  1VQH A;  4EQ5 A;  4DV5 Q;  4JV5 L;  2UUA Q;  2RHQ B;  3S2H H;  1I6H H;  2D0P A;  5FJ8 H;  1N32 L;  5GQO A;  2JA8 G;  1IXR A;  2H5X A;  1SN8 A;  1Y1W H;  2OTL A;  4A3M G;  1PVO A;  3F2C A;  1MIU A;  3EN2 A;  3KF8 B;  5LMN W;  1YJ9 A;  1N34 L;  1KQS A;  4LF7 Q;  1PYS B;  2NN6 G;  4HJ8 A;  1XMO Q;  1IBK L;  1K8A C;  1YHQ A;  3HOZ G;  2KCT A;  4LF9 Q;  1EQQ A;  1KC8 C;  1SMX A;  2VS1 A;  3NBH B;  3KJO A;  1B7Y B;  1LUZ A;  4PG3 A;  1VQC A;  1PA6 A;  3J7A 5;  4YCU A;  5JJL A;  1YHA A;  1JMC A;  4HIM A;  4DV6 Q;  3K8A A;  4A3K G;  2VY3 A;  1Q81 C;  3M4Q A;  2YTV A;  2UUC L;  4MNO A;  4LF4 L;  1NTG A;  2UUA L;  3M7N A;  4BA2 I;  4R4T A;  2F52 A;  1OXV A;  1B8A A;  2AHO B;  2UXD Q;  1IBM L;  4B3R L;  1VQA A;  4A3G H;  3GTM H;  1E24 A;  4A3L H;  2RCN A;  4JC0 A;  4XIG S;  4B3M L;  2UU9 Q;  4JI2 L;  4TQU S;  1PH3 A;  2PMZ E;  3M4P A;  1UE7 A;  2Z6K C;  4LF9 L;  1HR0 L;  2E5L Q;  2IHE A;  2ZTE A;  2JJQ A;  1HNZ Q;  4A75 A;  4R4I A;  3GTQ H;  3HOY G;  4EX5 A;  3I55 A;  4JOI A;  4PZ6 A;  1PH4 A;  1WOC A;  3CD6 A;  1CKO A;  5HGQ A;  3TRE A;  5GRO A;  3CPW A;  4WJ3 M;  1X54 A;  1HZB A;  4DR3 L;  3TS0 A;  5C0X J;  4DR1 L;  1N9W A;  2PI2 A;  4UY8 C;  1X55 A;  1PH8 A;  4JI2 Q;  4HJA A;  3W5O A;  4DKA C;  4KHP Q;  2VQE Q;  4BY1 H;  2BH8 A;  1PV4 A;  3CCL A;  3KLW A;  1O7I A;  3K0X A;  4X65 Q;  1GD7 A;  2HHH Q;  4JYA L;  1L2F A;  2E5L L;  2F3I A;  1U0L A;  4DUZ L;  2IHF A;  4JI8 L;  3A5U A;  4OON A;  1XMQ L;  1N33 Q;  3S15 H;  4X62 Q;  3PCO B;  4YWK A;  4YY3 L;  1FVI A;  1EYG A;  1KHI A;  2VUM G;  5K36 G;  5M3F H;  5IWA Q;  3CCE A;  3KDF B;  3BU2 A;  5IYC H;  2FXQ A;  4DV3 L;  2ZJR A;  3E9H A;  4GNX B;  1PH2 A;  4DR7 Q;  2KHJ A;  4POF A;  1SFO H;  1X3E A;  1L1O C;  5J3B A;  3CC4 A;  4JI4 Q;  4OX9 Q;  3H0G G;  2R7D A;  1Q1E A;  4X6A H;  1OXS C;  1HNW Q;  4JG2 A;  1VQL A;  2K5V A;  4UP7 A;  1TWG H;  4A4I A;  1K9M C;  3UDF A;  4C3I H;  3PIP A;  2N3S A;  4GS3 A;  2IX1 A;  4O0A A;  3GTO H;  2DUD A;  4LWC A;  1Y1V G;  4X62 L;  4DV4 Q;  1E22 A;  4LFA L;  1Q1B A;  1C0A A;  3GD7 A;  2HIX A;  3TQY A;  3CPF A;  1IZ6 A;  2CKZ B;  3HOV H;  1DGS A;  4KLK A;  3NEM A;  1S3O A;  1VQ7 A;  1EIY B;  4LFB Q;  1A62 A;  3GTK H;  3U4V A;  2LSS A;  4RMF A;  4APV A;  4DNI A;  3OTO L;  2I0Q A;  2ZJQ A;  5LMN L;  2K50 A;  4KI0 A;  2YTY A;  1SRO A;  1NJI C;  4A3E G;  2JA5 H;  4A93 H;  4LF7 L;  1A63 A;  1X3F A;  3S24 A;  4DR4 Q;  3PIO A;  4BXX G;  1NY4 A;  5FLM G;  1PYB A;  4JI1 Q;  4DUY L;  3F2D A;  4QL5 A;  4QJF A;  1X6O A;  5FLM H;  4POG A;  2Y0S E;  4DV7 L;  3W1B A;  1BBW A;  4HJ7 A;  1K73 C;  1QVG A;  1MJE A;  5H1S E;  4A3F G;  3KDF A;  1L1O A;  1PH7 A;  3EBE A;  4DK3 C;  2F4V Q;  2Q2H A;  4OO1 I;  4JI0 L;  3KJP A;  5M5W H;  4O2D A;  3CCJ A;  1HR0 W;  3BJU A;  3L2P A;  5C4X G;  2JA9 A;  2D0O A;  4IPG A;  1EFW A;  4P72 A;  4LF5 L;  5IP7 G;  4DR5 Q;  2CFM A;  5EAY A;  1PHJ A;  4DR4 L;  5DLQ E;  1E7Z A;  1HR0 Q;  1HJP A;  1XNR Q;  4GKK L;  1JJG A;  1BBU A;  1JE5 A;  1HNZ L;  1IBL L;  4A76 A;  1V43 A;  3I4M G;  1G51 A;  4NB3 A;  4K0K L;  4JI5 Q;  2JA6 H;  4NXM L;  4A3M H;  2Z0S A;  4A3K H;  1TWH H;  2N8N A;  4GLA C;  4LW1 A;  3WWV A;  1S40 A;  3RZO H;  4BBS G;  2QGQ A;  2KCM A;  4PZ7 A;  1CSQ A;  4AYB G;  1YHB A;  3HKS A;  1L0W A;  4LF5 Q;  1E1T A;  1IYJ B;  1FJG L;  4KHP L;  1NBW A;  5IT9 c;  4A3B G;  2VQF L;  2B63 G;  3E0E A;  2ZM6 Q;  4PZ8 A;  4IPD A;  3M3Y H;  1MKH A;  3S1N H;  2YTX A;  2OQK A;  4GOP B;  2E2H H;  4IOA A;  3PO2 H;  4YWM A;  1LTL A;  4BBR G;  4L5S A;  1Q8K A;  1VS0 A;  4A3C H;  2MNA A;  3S1M H;  3PO2 G;  5M5X H;  4JBK A;  1AH9 A;  2QEX A;  4X66 Q;  2NVQ H;  2NVX H;  1TWA H;  2K5N A;  5BR8 L;  4A3D H;  3RLO A;  3PUV A;  1I50 H;  1I3Q H;  1YEZ A;  3CXC A;  3S16 H;  1KL9 A;  1Z47 A;  4A3J G;  1VQO A;  3ULJ A;  1HNW L;  4IFD J;  2R7F A;  3I4M H;  3UDG A;  3HOY H;  3KYH C;  2ATW A;  1JJC B;  1PH6 A;  1LYL A;  1EUJ A;  1YNX A;  3PUZ A;  3J81 c;  4B3S L;  3H3V H;  2JEA I;  2R92 H;  2OWO A;  4UP9 A;  4DV4 L;  3A5Z B;  2CQO A;  2VUM H;  3T1Y L;  2WAQ E;  4X66 L;  5C44 G;  3S14 H;  3TS2 A;  2N78 A;  4OWW B;  1CKN A;  2KEN A;  4YWL A;  1VQ5 A;  2ZTD A;  4BA1 I;  1VQJ A;  4RG1 A;  4LFC L;  3I2Z A;  1RIP A;  4JI3 L;  1J6Q A;  2R93 H;  4C2M H;  4OO1 G;  3J80 i;  3PO3 H;  2K75 A;  2NVY H;  3STB C;  2UXC Q;  4QY7 A;  3KF6 B;  4A3I H;  2E2J H;  2GVA A;  1K3R A;  1YVC A;  3PO3 G;  2VW9 A;  4DV1 L;  4MTN A;  2A1A A;  5M3M H;  4GOP A;  1FGU A;  1D8L A;  3PF4 A;  2AMC B;  4B3S Q;  1PFS A;  2UXB Q;  4JI6 L;  2K14 A;  4GN4 B;  4YY3 Q;  3D31 A;  2ZJP A;  4P75 A;  4HJ5 A;  4OXP A;  1KXL A;  4DV5 L;  1C9O A;  3FHW A;  5IYB H;  3GDE A;  2Q2U A;  1WCM G;  4QIW E;  3UDX A;  3CCU A;  3GTG H;  4JI4 L;  3HOX G;  1ASY A;  2CWA A;  1GVP A;  5FJ8 G;  4JBW A;  1J5E Q;  3BZC A;  4L5Q A;  1GO3 E;  4OWT B;  1UEB A;  1KD1 C;  5GAE C;  1VQ6 A;  1JT8 A;  1YI2 A;  1N36 L;  2JA5 G;  3TRZ A;  2IT1 A;  3ICE A;  1Y14 B;  1QUQ A;  3HKZ G;  4DAM A;  4DAY B;  2E2I H;  2K4K A;  3PUY A;  2PNH A;  4P74 A;  4LF8 Q;  3HOV G;  1PH9 A;  1KAW A;  1QVF A;  3PSI A;  2UUC Q;  2GVB A;  1LM0 A;  2EIF A;  1Q12 A;  1A8V A;  3A0J A;  4KHZ A;  4BY1 G;  2ES2 A;  2R93 G;  1P16 A;  1TXY A;  3I7F A;  5HY6 A;  1I94 Q;  2PQA B;  4BBR H;  1GKH A;  4A93 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...