1VQDA

Gene v protein mutant with val 35 replaced by ile 35 and ile 47 replaced by leu 47 (v35i, i47l)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYIDLGNEYPVLVKLTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
total genus 10
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqdA00
3GTGH 4O2DA 3HOWG 2I5HA 4JI4L 3D0FA 3PF5A 2FXQA 3FKIG 3GDEA 4JCVE 3ULLA 1FJGQ 3JAMi 3ICEA 4C3IH 4UPAA 5C44H 1FJGL 2ZTDA 4IFDI 3CC2A 5K36G 1M1KC 2JEBI 1VQEA 4JI2L 4GOPC 3I2ZA 1HNXQ 2BA1A 2WB1E 4IPCA 4C3JH 2K14A 4X66Q 5LMNW 4LNQA 1UEBA 3GO5A 1WCMG 1PH9A 1S40A 1UWVA 3PUWA 4BBRH 1PH2A 1K3RA 5FJ8G 2NZHA 4DR2L 4LFCL 4GOPB 1D8LA 1XMQQ 5M3MH 3F2DA 2C35B 3JAMc 2BA0A 4L5QA 3AYHB 1VQNA 4A3MH 4ALPA 1UE7A 1I94L 4DUYQ 1HNZL 4UY8C 4JYAQ 4JI1Q 3L0OA 2VS1A 2ZJPA 4LFAL 2K75A 4JI5Q 3VDYA 1IYJB 3CD6A 1N36L 3GTMH 1X3GA 4AQYQ 2WB1G 1KAWA 1UE1A 2K5VA 3K80C 4A3IH 2EQSA 4A3FH 1YIJA 4DR6Q 1WYDA 5HY6A 1SE8A 1YITA 1XNRL 2ALYB 5GAGC 4DPGA 3PIPA 3S14H 3TRZA 2F4VQ 2CCZA 2NVQH 1X3FA 2XGTA 3F2CA 3TREA 4KLKA 1A63A 4B3TQ 1MJCA 1X56A 3U50C 1NMGA 2ES2A 2R92H 1OXUA 4LWCA 1V9PA 4RMFA 3I4NH 1YJNA 3SGIA 1C9OA 5IWAL 4FDBA 2HQLA 2MNAA 4NXML 4A3BG 4X6AH 2UXCL 3HOXH 4POFA 2VQEQ 4JI7Q 2Q2TA 4UP7A 4Y7NH 3PCOB 1N34Q 3S2DH 1NMFA 2JA6G 4QJFA 4B3RQ 2NZOA 2Q2UA 3H3VH 3KF6A 3ERSX 1Y1VH 1K9MC 3HOVG 1EFWA 5IYBG 5C3EH 3STBC 1XTDA 4DV7Q 3NBHB 4BY1G 1GD7A 1W3SA 1Q86C 4DR7L 1TXYA 1IBLL 2RHQB 3KOJA 4LF6Q 2D0PA 1Y1WH 4NB3A 3KDFA 1QZHA 4P75A 4O0AA 1PYBA 1NBWA 1YZ6A 4EQ5A 3PIOA 2JA5H 5IP7G 1J6QA 3PUZA 4JI0Q 3TS2A 2UXBL 3KJOA 2KBNA 3E0EA 3ULJA 2QEXA 3B6YA 4BY7H 2ZTEA 4BA1I 4X64L 1XNRQ 5IYBH 5C3EG 5LMNQ 1EUJA 3Q8DA 1CSQA 3G4SA 1EQRA 3WWVA 3CCVA 1Y14B 3T1HL 3M4QA 1E1TA 1C0AA 1GO3E 2I5LX 2HHHQ 1J5EL 3T1HQ 4YY3L 3H0GG 2OTLA 2ASBA 4JV5L 4X62Q 4YCVA 3CCRA 3MEFA 1ASZA 3TQYA 4X62L 4HJAA 2CQOA 1QUQB 1SROA 4JOIC 1A8VA 3DLLA 3M3YH 1VQBA 3BZKA 3PO2H 2N78A 3CCJA 3HOVH 1HJPA 4K0KQ 3L2PA 4DV4L 4LF7Q 4LF5Q 1SR3A 3PSIA 3UE0A 4GN4B 3HKSA 4GLAC 4P74A 3UE1A 5C0XJ 4DV0L 1BKBA 2JJQA 1OTCA 1LTLA 4ME3A 3A0JA 4OONA 1L1OB 4R4TA 1O7IA 3ZJYC 2JA5G 3BU2A 5BR8Q 3H15A 5JEAJ 1Q12A 1CKOA 2PQAA 4QQBX 3EIVA 4B3SQ 1KL9A 4X65L 2UUBL 4IOCA 4JI3Q 4JOIA 4QGUA 1WFQA 2AWNA 3CCEA 1EQQA 3PO2G 1T9HA 3HOUG 3UDGA 1E3PA 1LM0A 4JI2Q 1VQMA 2R93G 1PYSB 4DK6C 1HZAA 4HJ7A 4JC0A 1VQIA 4DV7L 3CMAA 1N33L 1YEZA 4DV2L 1K73C 1Q1EA 1SRUA 1HZ9A 3HKZE 3IRBA 3NELA 5LMUL 2WAQG 2KENA 4A3CG 5IT9c 1N33Q 1VQPA 1HNZQ 5GROA 1VCIA 3L7ZC 1ASYA 3PGZA 1PH7A 2YTXA 4HJ9A 4GN3B 4A76A 4C3HH 2LXJA 3S1MH 1E1OA 1RIPA 4JI8L 1PVOA 2KHIA 1QUQA 1BBUA 2F3IA 2UUCQ 2B29A 2UXCQ 2R6GA 5LMNL 3M4PA 4JI3L 4X65Q 3J81j 2UUBQ 2B3GA 4L5TA 1K8AC 2UUCL 2VNUD 4POGA 1U0LA 3GTLH 4A3KG 4WJ4A 5IP7H 3HOWH 2NN6G 1YVCA 4L5SA 4A3FG 1N9WA 1PV4A 1EYGA 2NVXH 2V1CC 3RLOA 2JE6I 1IL2A 1Y1WG 3T1YL 3HKZG 3OTOQ 4XTCS 1UE5A 1YHQA 4P72A 4QL5A 3RZDH 1VQ9A 4R1JA 2KCMA 1HNWQ 4HIDA 1XNQL 4DV4Q 4LF7L 5M5YH 2ATWA 2R7ZH 2K4KA 2Y0SE 4BBSG 3S2HH 3S1QH 4R4QA 3M9BA 1TWFH 4A3MG 1KRTA 1KD1C 3RZOH 2AWOA 5JJIA 1Q82C 4GN5A 1KQSA 4TVAB 1I50H 4LFAQ 2ZTCA 4QY7A 1VQAA 1N34L 3KYHC 5DLQE 1IBLQ 3CCLA 2JA8H 3W1BA 1XMOQ 4DKAC 1N32L 2IHEA 1SN8A 2OQ0A 3HOXG 3HFZB 4PZ6A 2QA4A 4DV5Q 2PI2A 4PZ8A 1YJWA 2MQHA 3UDXA 1CKNB 2VQFL 1CKMA 2R92G 4P71A 4QIWE 3UDFA 1GM5A 4DUZQ 4OO1I 4LF4Q 1VQ7A 4B3SL 2YU9H 1VQFA 1Q7YC 1I3QH 2JA8G 2E5LQ 3OYYA 3FKIH 3AFPA 5IWAQ 3I55A 4AIMA 1YI2A 3CCUA 2VW9A 3K8AA 3AQQA 1Q1BA 3G6EA 1R9TH 3CW2C 3RNUA 4R4IA 3PUXA 3ER0A 3NENA 1Q81C 4H02A 4JBJA 2R7ZG 4BBSH 3A74A 1AE2A 1KRSA 2EIFA 1PH3A 2Q2IA 5FLXc 3F2BA 2UUAQ 3OW2A 2F4VL 3OTOL 3E9IA 4HJ8A 1CSPA 1JJCB 3K7UC 1K8GA 2VQFQ 3KF6B 4JI8Q 4DR3L 4A3KH 4IJLA 4DR2Q 1EWIA 1AE3A 1VS0A 1PHJA 1E24A 3JC66 2E5LL 3A5UA 1TWGH 4TQUS 4JV5Q 2PNHA 1IZ6A 2KCTA 2LXKA 2VQEL 1CKNA 4DUYL 4JYAL 1JMCA 3I56A 2RCNA 4NXNL 1CUKA 4P73A 3CCQA 1PH6A 2WAQE 4AYBG 4OX9L 1P8LA 2VL6A 2VY3A 4DV6L 1YHAA 2OWOA 1VQ6A 1TWAH 3AFQA 2E8GA 3J81c 3TS0A 4JI6Q 4JI7L 4A3DG 1N32Q 4IOAA 4K0KL 1UE6A 3T1YQ 2XTIA 1X55A 3E9HA 3H0GH 2UXDL 4YY3Q 3S16H 1HR0Q 2Z6KC 3I4NG 3A5ZB 2UU9Q 1G6PA 1L1OC 1S72A 4DR1Q 4A3IG 2AKWB 2R7FA 2GVAA 1JJGA 3RLFA 2OTJA 4LUOA 2WFWA 4LF8Q 1U5KA 1OXVA 2N3SA 3S1RH 1X65A 4HIOA 4IJHA 4LF8L 1G51A 2N49A 1L0WA 3ULPA 1XJVA 4B3MQ 3M4OH 5GADC 4YWLA 4GKKL 2OCEA 1SLJA 3GTOH 2MO0A 2HHHL 4DAYB 1N8RC 2KHJA 2HT1A 3G71A 4LF5L 1GVPA 1S3OA 3S15H 1B70B 2PQAB 4LUVA 1XPOA 4A3GG 4OXPA 2IT1A 2JA9A 2OQKA 1V43A 2ZJRA 2Z6KA 3D31A 1OXXK 1L1OA 1EIFA 4GLVB 4NPSA 4PZ7A 1Z47A 4DV1L 5JJLA 5M3MG 1PH8A 4GLXA 3J80i 2JA6H 5H1SE 1PA6A 5FJ8H 4HIKA 2BH2A 3KDFB 4DK3C 4BBRG 4A3CH 1KC8C 4KHPL 1VQ5A 1WCMH 2R7DA 4B3ML 3GTKH 1B8AA 3H3VI 2VUMG 3GTJH 5C4XG 4IPHA 1NY4A 4BXXG 4R4CA 2RF4A 4DR6L 1A62A 4OWXB 4B3RL 2R93H 1K83H 2VZAA 5M3FH 4GNXB 4OX9Q 3HOUH 3PO3H 2DUDA 4DV3L 3KLWA 5IYCH 5C44G 5GQOA 2ZJQA 1IBKQ 4A3EG 1KXLA 3HOYG 1X6OA 4OO1G 4MTNA 3CC4A 4DV2Q 1I94Q 4UP9A 1PH1A 1V1QA 3CC7A 2K5NA 1QVGA 4YCUA 4APVA 2HIVA 5E7NA 1LUZA 2I0QA 1N36Q 1HR0W 2DGYA 5AJ3L 4YCWA 4DAMA 2MO1A 3I7FA 1VQOA 1HZBA 2F52A 2Q2HA 3EBEA 2JK8A 4JI1L 3FP9A 4YWMA 1NE3A 1PH4A 1Y1VG 1H95A 1IBML 3PUYA 1QVCA 3HOYH 3CPWA 3KF8B 3HOZH 1J5EQ 4A3JG 2EXDA 3M85A 4MNOA 1VQ8A 1FGUA 3CCMA 5J3BA 4PG3A 3STBD 2YYZA 5FLMH 1VQDA 5EAYA 4BXXH 4DR7Q 4LUZA 4A3LG 1IXRA 3I4MG 4LF9L 2VUMH 2B63H 5C0XI 3AEVA 1K0RA 4GS3A 2NN6I 2H5XA 4HJ5A 2PI2E 2E2HH 1EIYB 1Z9FA 4DV6Q 1G291 1QZGA 3S24A 2A8VA 3RN5A 3W5OA 1Q8KA 2I5MX 4A75A 4AQYL 4A3JH 4GNXA 3GTPH 1WJJA 3FHWA 5M5WH 1YJ9A 3HOZG 4BY7G 2YTYA 1OXTA 1XMOL 1JB7A 3RR5A 4IPDA 1IBKL 4JI4Q 1YHBA 4A4IA 5IYDH 4BA2I 4A3GH 2AHOB 2K50A 4A93G 5M5XH 3RLNA 2CFMA 3CAMA 1VQLA 4B3TL 4MZ9A 4GKJL 1WOCA 4BY1H 5IYDG 3NEMA 4IO9A 1YBYA 2AMCB 4KHZA 4YWKA 1B7YB 2CWAA 2ZM6L 3S1NH 1MIUA 3I4OA 1YNXA 2LSSA 4KHPQ 1JT8A 5ELNA 1PH5A 4PMWA 4DV3Q 2IX1A 1I5FA 4YHHQ 1XPUA 1EOVA 2JA7G 3J81i 5M3FG 1W2BA 4DR4Q 4Y52H 1GKHA 1HR0L 5LMUQ 2Y0SG 4R4OA 4J15A 3CCSA 4HIMA 5C4XH 2B63G 5GAEC 4A3BH 1L2FA 1MKHA 2K5HA 2IHFA 1XNQQ 3CQZH 3DM3A 5IE8A 1MJEA 2HIXA 3PUVA 4A3DH 3F8TA 4DUZL 2ID0A 3MXNB 1BBWA 4LFCQ 4DR1L 5IP9H 4JI5L 1NTGA 3J7A5 1E22A 4RG1A 4LF6L 4X64Q 3M7NA 3BZCA 2Z0SA 5C0XG 3BJUA 1BVSA 4UP8A 1HH2P 4KI0A 4L5RC 4IFDG 1HNXL 1DGSA 2IY5B 2JA7H 4JI6L 1VQHA 2RHSB 2E2JH 3TEHB 3CF5A 1FVIA 5JEAG 4DV5L 4DR3Q 3PF4A 4DV0Q 2UXDQ 4DNIA 2GN5A 2D62A 2A19A 4AH6A 3RN2A 1NJIC 2NVTH 3W1GA 4JBWA 4X66L 5JJKA 4LF4L 1XPRA 5HGQA 1HNWL 1I6HH 3CP0A 4LW1A 5IY0A 4LFBL 3U4ZA 2JEAI 4OWTB 1JJ2A 1VQKA 1AH9A 3K81C 3U58A 1WI5A 2N8NA 3CXCA 1M90C 1X9NA 4LFBQ 3K7AH 3CMEA 2YV5A 1LYLA 3EN2A 2GVBA 3K0XA 4JBKA 3J80c 1IBMQ 4IFDJ 1D7QA 4DR5L 3G48A 2D0OA 5ELOA 2E2IH 2UUAL 4JI0L 2IX0A 4A3LH 5IP9G 5AJ3Q 2L15A 5FLMG 4OWWB 3J7ZC 2K52A 4GNXC 2UU9L 5BR8L 4YHHL 1X54A 1XMQL 4GKKQ 1PFSA 3GTQH 1X3EA 4IPGA 1TWCH 2PMZE 1VQJA 4AYBE 4DV1Q 2NVYH 1VQ4A 1A0IA 2YTVA 1SMXA 5GAHC 2ZM6Q 4LF9Q 1QVFA 3I4MH 2CKZB 2CWPA 1TWHH 3F1ZA 1C7YA 4WJ3M 1RL2A 3LGJA 4GKJQ 2UXBQ 4C2MH 1KHIA 1SFOH 1HZCA 4XIGS 3S17H 4DR4L 2BH8A 3UDIA 1VQGA 4NXNQ 1P16A 5C4JH 3KFUA 3U4VA 2MFIA 3CPFA 3GD7A 1KIXA 4GOPA 1OXSC 4DR5Q 3KJPA 4NXMQ 4EX5A 1JE5A 2JQOA 2WP8J 4A3EH 1Q46A 2A1AA 4JG2A 3PV0A 1FL0A 5IYCG 4JBMA 1VQCA 4A93H 3PO3G 2QGQA 1E7ZA
chains in the Genus database with same CATH superfamily
3GTGH 3HOWG 4QB4A 1E2VA 2ENBA 3PF5A 3ICEA 4A3EB 5KEEA 3DMUA 1V8QA 3PMFA 2EYOA 2ZTDA 4DGZA 4IFDI 1QB5D 2B8GA 4F87A 1M1KC 4C3HG 2A69C 2QW7A 2MUYA 4CHTB 4DNRB 4X66Q 1UEBA 3SEBA 1MSHA 2ZXPA 3HZXA 4ABNA 3R2TA 1UWVA 3BYTB 3Q23A 1NAPA 1PH2A 3Q0AA 2EYJA 4UDUC 4DR2L 4HCSA 4GOPB 1XMQQ 2B2TA 3JAMc 2BA0A 4L5QA 1VQNA 4A3MH 1HNZL 4BY7B 3L0OA 3GP7A 3OPOA 4RGTA 2F0QA 3GTMH 4KKUA 5JEAH 2WB1G 1YIJA 3K80C 3MAQA 5HY6A 1SMYD 4I7AA 1ILPA 4WFN3 3S14H 5EBDA 3FKIB 2NVQH 5CV5A 1I3QB 3GTLB 1G2SA 4B3TQ 1X56A 3U50C 3ND9A 1JOOA 3FMCA 1YNNC 1HXYD 1YJNA 2WB1B 3SGIA 4RFBA 2MNAA 4A3BG 1I4HA 4X6AH 3VA7A 3HOXH 4JI7Q 2Q2TA 3PCOB 1ML0D 2K6AA 1NMFA 3OIPA 4FF4A 2JA6G 1PRTB 4QJFA 4RA8A 2OT2A 1CK1A 4EQNA 1GUNA 3T16A 1Y1VH 3NHHA 5IGDA 2NUCA 1K9MC 4L8JA 3NBHB 4BY1G 1GD7A 4C1NI 4DR7L 3KK7A 1TXYA 2D0PA 1B50A 1Y1WH 2JA5H 4P75A 4O0AA 1PYBA 4FXGC 4EQ5A 4JI0Q 1ZYRC 1D6EC 4RWSC 3QJYA 3ULJA 2EYMA 4BY7H 2ZTEA 4X64L 4XQJA 5E4XA 3Q8DA 1EQRA 2F0LA 2E2JB 2RQXA 1J5EL 1B4OA 3H0GG 1WCMB 1EY5A 1SNQA 2ASBA 2M00A 4X62Q 1HCZA 1D1KA 2B2TC 3D4RA 3TQYA 2B63B 1A3VA 4H7BA 1LO5D 2RVLA 3M3YH 3PO2H 2N78A 4DXFA 2HQEA 2K33A 3CCJA 5EKLA 1U4RA 3L2PA 1SR3A 3PIO3 4GN4B 3HKSA 2E2DC 5BN4A 2JJQA 1OTCA 1O7IA 2PPBC 5M5XB 1IHZA 2MJ8A 1Q12A 4G57A 5DM63 4B3SQ 3HOVH 1B1ZA 4JW0A 4QGUA 1RDPD 1U9RA 1PYSB 2FMMA 4DK6C 4RGMA 3NTIA 1VQIA 2IL8A 1N33L 1QILA 1K73C 3HKZE 1KDBA 2WAQG 1VQPA 1HNZQ 4WRDA 5GROA 1VCIA 2NBFA 1ASYA 1PH7A 1PVOA 2KHIA 1QUQA 1HPCA 4X65Q 1ZYRD 2R7ZB 4C3IG 3MVVA 4L5TA 1K8AC 2UUCL 2VNUD 4POGA 3GTLH 4IUUA 1YVCA 4L5SA 3S17B 4A3FG 1E2WA 4KJNA 5ELEA 3WOEA 2XRSD 4UHVA 2E74C 2JA8B 4P72A 4QIWB 3NSWA 4HIDA 1XNQL 1Y8PB 4LF7L 1BF4A 1BNZA 2R7ZH 2K4KA 3DM1A 3JAML 4CDDC 4R4QA 3M9BA 1TWFH 5I9PA 2K28A 1SMYC 2ICIA 1DONA 3H6MA 2AQ2B 4DAPA 2ZTCA 1N34L 5DLQE 3E0JA 2JA8H 3W1BA 1N32L 2IHEA 2IX3A 4DV5Q 2PI2A 2MQHA 1AZPA 2VQFL 5CBAE 2PW5A 4DUZQ 2D9UA 3S9WA 4DU9A 2JA8G 2EJMA 3EA6A 4DK1A 5IWAQ 4AIMA 1YI2A 1TS3A 5EPJA 2VW9A 3K8AA 3PIP3 3PUXA 2F3VA 4H02A 4DFAA 3U9SA 2R7ZG 2F0UA 2EIFA 1PH3A 2Q2IA 3F2BA 2F4VL 1EWHA 3GTPB 3TZUA 2VQFQ 4IJLA 1F2MA 1VS0A 4F8MA 1E24A 3NP8A 1EY8A 2E5LL 3A5UA 4KY7A 4JV5Q 3CRKC 1CQVA 1TKWB 1LT4D 2KEDA 1JMCA 4NXNL 2VB2X 3KLSX 5EGTA 4DXGA 1VQ6A 4DV6L 3AFQA 2NWGA 3PO2B 5C4HA 5JOBA 1KTKA 1A6XA 1X55A 4YY3Q 2Z6KC 2UU9Q 5A2QE 1L1OC 1XX8A 1PFMA 3FDTA 4ZUIA 2GVAA 2OTJA 5I6YA 2WFWA 1U5KA 2E2IB 4K14A 1G51A 2N49A 1XJVA 1IL8A 4ZQ3A 3T53B 3GTOH 4O42A 4IURA 4LF5L 1RJTA 1IW7C 2XWBB 2JA9A 4FF3A 2ZJRA 2Z6KA 1MD2D 1OXXK 1H9KA 1CTMA 5LL6S 1EIHA 1JWMD 1A3UA 3OIQA 3WDNA 1VQ5A 1WCMH 5KNDA 3H3VI 3GTJH 1H9RA 1FNUA 3SK8A 4HMJA 5JAVA 5M5YB 1A62A 3C1EA 2F3WA 3HOUH 5M3FH 4GNXB 2EZVA 1D1IA 4X3KA 5D3DA 3TP7A 4CGYB 2B39A 3HOYG 1EIGA 4DV2Q 2MPMA 1D5MC 1PH1A 2EYPA 1V1QA 4YCUA 2A73B 3CU7A 2DJFC 5E7NA 2I0QA 1ZXTA 1JICA 4YCWA 3QWNA 5CV7A 5F2DA 2F52A 1VQ9A 2JK8A 4JI1L 1PH4A 1NE3A 3K0YA 3N52A 1H95A 1PZJD 3HOYH 3K5OA 4A3JG 1J5EQ 4BWGB 1PDQA 3FEWX 1SEBD 1MGSA 4DR7Q 3CQZB 4LUZA 4B08A 2VUMH 3AEVA 1K0RA 4A3FB 4CKBA 2H5XA 1PYWD 2A8VA 1WTPA 1HRJA 1Q8KA 4AQYL 4BY7G 2GA4B 3KLSA 2JN4A 4K8JA 1JB7A 1IBKL 3TZDA 1BCPF 1QNKA 2K50A 5M5XH 3RLNA 4A3JB 4G4KA 4B3TL 4GKJL 2F03A 1KAAA 4OL7A 1HA6A 5IGGA 1Y8NB 1B7YB 2CWAA 2J0TD 2PZUA 1MIUA 1F9QA 4K2LA 5IT9E 1JT8A 1H9SA 5ELNA 4N8FA 1I5FA 4YHHQ 1XPUA 4ODGA 2CQAA 1W6KA 3I70A 2Y0SG 1DYQA 1X3QA 1CFMA 4A3BH 1JCKB 3R8BA 1TWHB 2Y0SB 1PFBA 3NXWA 1RKNA 2K1BA 5IP9H 1NTGA 3SXHA 3BZCA 4FVMA 4NKLA 3TP8A 4KI0A 1BXTA 1GOZA 1GUGA 3NTKA 4DV5L 2EXZA 2C5CA 1PMRA 2EOTA 2F1MA 4DNIA 2GN5A 2A19A 1SSOA 5JJKA 3W1GA 4X66L 3S1QB 2PNRC 1WTRA 2M2LA 3CP0A 5IY0A 4V0BA 1CA6A 1AH9A 1VQKA 3K81C 4KY5A 3JAME 1ESRA 1LT3D 4G7ZC 4KN7C 3CMEA 2IJ0A 4FF2A 2GVBA 1HFNA 1D7QA 4C3JG 1AFPA 5ELOA 2E2IH 3K5NA 4A3LH 2IX0A 5CC4A 5IP9G 3H09A 5AJ3Q 1Z6HA 3J7ZC 1X54A 2O2LD 1NCVA 1X3EA 4HAEA 4IPGA 3K5MA 2PMZE 1VQ4A 2EYHA 2NVYH 5EPKA 4ZK9B 2Z4IA 3F1ZA 3FRPB 1RL2A 1JWUD 3S2DB 1HZCA 4XIGS 3S17H 1C48A 5IODA 2QF7A 1GXDC 3M3YB 2MFIA 1CQFA 4GOPA 1BDOA 2WACA 4RKLA 2XWJB 1JE5A 2JQOA 4JG2A 1EU4A 1FL0A 1EFID 5IYCG 2P5ZX 2QGQA 1GJXA 1FYCA 4CKEA 4O2DA 2I5HA 1HQRD 2DNEA 5FOBB 2FXQA 3FKIG 3GDEA 4JCVE 3ULLA 1BCPB 1FJGL 2B8FA 3LNNA 4DF7A 4GOPC 2F0WA 4IPCA 1SE4A 5LMNW 4LNQA 3GO5A 1LABA 5E3FA 2MP1A 2WKDA 3PUWA 4BBRH 3I72A 1R9TB 1QOHA 3S1NB 1CT1D 4ZLTF 5M3MH 3F2DA 1F9RA 1TY0A 1CZWA 3AYHB 3PO3B 1MHWC 1VMCA 4OEMB 2NVYB 2K75A 3VDYA 3CD6A 5CV9A 1N36L 1LTRD 1X3GA 4AQYQ 3MC0B 2SOBA 1UE1A 4DR6Q 2F0EA 1SE8A 1YITA 5GAGC 3PIPA 3VR2A 2F4VQ 1RTOA 2CCZA 2TSSA 1X3FA 2XGTA 2WKCA 1MJCA 1NR4A 1DOKA 3AMUA 4YIJA 5ELCA 1NMGA 2R92H 1V9PA 4RMFA 3I4NH 5IWAL 1LLRD 4FDBA 4NXML 1FNVA 4OELB 1AP0A 4TRDA 1EZ6A 3VA5A 1WD0A 3C46A 1STAA 2R93B 3OWFA 1N34Q 1SFOB 5LL6X 2KECA 5KIXA 4B3RQ 2Q2UA 3H3VH 3KF6A 5DM73 2Z6BA 1SXTA 1Q86C 1LTID 3DWPA 1EQTA 2RHQB 1IBLL 3KOJA 4LF6Q 4NB3A 3I4LA 1I4QA 1F77A 2EY1A 4CJ2C 5IP7G 2UXBL 1STBA 4RCNA 5L37A 1CSQA 3G4SA 1NR2A 3CCVA 1Y14B 2DY7A 2HUGA 2FMCA 2AQ1B 4QCLA 3S2HB 1GO3E 3S1MB 1C0AA 2J4XA 1B3AA 3T1HQ 1K8MA 2SDFA 3CCRA 3S14B 3MEFA 1V1OA 4X62L 4HJAA 1SROA 1TT2A 3A8JE 2F0DA 3DLLA 1TWAB 3S15B 4DV4L 1H9MA 2DJGC 4GLAC 5C0XJ 4DV0L 1BKBA 3Q6SA 1PLFA 4OONA 1L1OB 3ZJYC 5CV8A 3H15A 3UI2A 1EY4A 1KLGD 1CKOA 4QQBX 5I4DA 3EIVA 4HTHA 4C3IB 1KL9A 4JI3Q 4IOCA 2AWNA 3CCEA 1SNPA 3A55A 1E3PA 1LM0A 4DAVA 3P1HA 4CJ0B 1C4QA 5KYLA 2EY6A 4DV7L 3CMAA 2KQ3A 1HZ9A 3Q24A 2B2VC 3IRBA 3V2TA 5LMUL 1SYCA 2KENA 1O78A 5KYIA 1X3PA 3L7ZC 3I91A 3PGZA 2PCFB 2YTXA 1UEAB 4GN3B 3S1MH 1E1OA 4XDXA 1JOKA 2V4DA 2UXCQ 2R6GA 3GV6A 2KHSA 2F0NA 2UUBQ 3T51B 2F0OA 4IZ8A 1U0LA 4A3KG 4WJ4A 4GZYC 3HOUB 1PV4A 1EYGA 1STHA 1HQMC 3HKZG 2RBMA 3OTOQ 4QUFA 5M9OA 1AN8A 2D2CC 2ATWA 2NVQB 3VR4A 3S2HH 1HHVA 3MXUA 4RKBA 4A3MG 3S1QH 1KRTA 1I6VC 3TBIB 1KD1C 3J80L 1QG7A 5JJIA 1SJED 1I50H 3HOXB 4LFAQ 4QY7A 1VQAA 3KBXA 1IBLQ 1XMOQ 2A6EC 4DKAC 5FO9B 4Z9CB 1RD9D 2RA4A 5J1ZA 4KMUC 5CYUA 1FR3A 1CHPD 2RSOA 3QG1A 3GTJB 1WTXA 2YU9H 4PMCA 2E5LQ 2KA7A 3OYYA 5BN3A 4FXDA 3ER0A 3NENA 4RHRA 4DAYA 1G6ZA 3QO2A 1AE2A 4ZCKA 1KRSA 3MWYW 2UUAQ 5FLXc 2IW3A 5KRUA 3HOWB 1CSPA 1JJCB 2MGSA 2X6LA 4KKTA 5M3MB 2PW7A 4DR2Q 1EWIA 1TWGH 4KJOA 2X69A 2PNHA 4KHVA 2VQEL 1CKNA 1B9NA 2VXWA 1CUKA 1O80A 2IPKD 3CCQA 4MTKA 1PTOD 4OX9L 1P8LA 1TS4A 1SBBB 1YHAA 1TWGB 2CW0D 2MHVA 3TS0A 4JI7L 1N32Q 3H0GH 2UXDL 1HR0Q 3I4NG 2QKIC 3A5ZB 3SK6A 1G6PA 2A69D 4A3IG 4G7HC 2AKWB 1JJGA 4LUOA 1VDZA 2G9DA 2G5DA 1B2TA 1OXVA 4CDCC 1GUTA 1X65A 4HIOA 4IJHA 4LF8L 2MO0A 2HHHL 4DAYB 1BCPD 1N8RC 2KHJA 3OMCA 3HG9A 1GVPA 2L0CA 4OXPA 5C5MA 1Y69U 3D31A 1L1OA 5JJLA 4DV1L 3OMGA 4GLXA 2JA6H 1PA6A 4PV1C 3D4WA 4BBRG 4A3CH 1KC8C 3I73A 2M9VA 2BOSA 1K0SA 2VUMG 4N8X1 1DOMA 5C4XG 1NY4A 4DR6L 4OWXB 3D3RA 2VZAA 1QWYA 3I90A 3PO3H 2Q8TA 4DV3L 3KLWA 5IYCH 5GQOA 1EEID 3D6CA 4MTNA 3Q22A 1I94Q 4UP9A 1QVGA 3P20A 2F0IA 3TP5A 4HCEA 2HIVA 4XYOA 1Q3LA 1LUZA 1IYUA 1HR0W 1NUCA 2DGYA 3MXPA 5AJ3L 2CH4A 2MO1A 4DAMA 3J7AV 1D2BA 2WAQB 4YWMA 4OO1H 3AB9A 5JVG3 3KF8B 3HOZH 4MNOA 1FGUA 5J39A 5J3BA 4PG3A 3MXGA 5JVH3 5FLMH 5EAYA 1C8CA 1IXRA 4LF9L 2LMCB 2B63H 3K58A 1AZQA 1MSGA 1PTOF 2NN6I 1EIYB 1Z9FA 1XXGA 1TS2A 2L55A 3M4OB 4A75A 3HOZG 1YJ9A 1OXTA 3V96A 4JI4Q 1YHBA 4RCOA 4TSSA 4A4IA 2CH4W 2X6GA 2CFMA 1AEXA 5IIFA 5M5WB 1F2YA 3EJIA 3NEMA 4IO9A 2A5HA 2AMCB 3E5SA 4KHZA 2PZTA 4KHPQ 2D5DA 1FNWA 3H0GB 4HR7B 4E6IA 1EOVA 3K5LA 1ET9A 1HR0L 2HCCA 3CCSA 2XIWA 4HIMA 5C4XH 2KCNA 5G3LF 1L2FA 1MKHA 1PTOC 1SDFA 1XNQQ 3CQZH 3DM3A 5IE8A 3PUVA 1SYDA 1Y1WB 5C44B 4LFCQ 4DR1L 5CBEE 4XXEA 4X64Q 3M7NA 5C0XG 3BJUA 1BVSA 5C3XA 4L5RC 3OWEB 1HNXL 4JI6L 1VQHA 2RHSB 2E2JH 2WV6D 5JEAG 4DA2A 1IKMA 5EJWA 4OIJA 1UNSA 2EDGA 3A8IE 3RZDB 3EROA 4LW1A 5A35A 5ELFA 1RTNA 3U4ZA 3URYA 5I2XA 2K05A 5T1IA 1SJHD 3CXCA 1YNJC 4LFBQ 1X9NA 1SNCA 2YV5A 1LYLA 4JBKA 4IFDJ 4DR5L 3G48A 4P2CB 2D0OA 5K36H 4GKKQ 1PFSA 3GTQH 1EY7A 4AYBE 1KXLA 1STNA 1WTWA 1QJOA 2CKZB 2CWPA 1ONLA 3LGJA 4GKJQ 4RAUC 2BH8A 3CKIB 2AQ3B 3P75A 5C4JH 2BDOA 3U4VA 1PFNA 1KIXA 2EJFC 3KJPA 4NXMQ 4IUTA 3MXNA 1T5EA 3PV0A 4Q0FA 4ULLA 2QDLA 3PO3G 5EKKA 2WINB 2KUMA 4ZRZA 4JI4L 3D0FA 1PZKD 3TP6A 1LT5D 3JAMi 4C3IH 2O4XA 1UAPA 1VQEA 3O13A 4C3JH 2K14A 1WCMG 1PH9A 1S40A 4OGQC 4DK0A 5FJ8G 2NZHA 1G8ZD 1WTVA 1D8LA 5EKIA 2C35B 2E76C 1BOSA 1SNMA 1UE7A 4DUYQ 1I94L 4UY8C 2K32A 4LFAL 1DOLA 4JI5Q 2J7ZA 2K5VA 4A3IH 1Q8IA 1U4PA 2C9OA 3TREA 4KLKA 1A63A 5EPLA 4PNYA 3TN2A 2F0GA 5D14A 1HTLD 2ES2A 1OXUA 4LWCA 1C9OA 1Y1VB 2HQLA 2JYOA 3ERQA 2ZXRA 1V1PB 4ZAIA 2UXCL 3H94A 3HS0C 2NYZD 4POFA 4CJ1B 2VQEQ 3LWEA 4UP7A 2A68D 2WIIB 4CKCA 1BQQT 3KF8A 1G91A 2NZOA 3F2UA 3R93A 1FD7D 3HOVG 1EFWA 5IYBG 4DV7Q 1H9SB 4X3TA 1ESFA 3GTOB 4K6DA 2B2WA 5FLXE 3KDFA 1ENAA 4TKOB 1NBWA 1YZ6A 2KBNA 4MN3A 2QEXA 3B6YA 3NE5B 4ZKCB 4BA1I 3W3AA 1XNRQ 5IYBH 5LMNQ 2TMPA 4PMBA 1EUJA 3WWVA 3KUPA 1E1TA 3IFDA 1F9SA 4FYDA 2OTLA 1W6JA 4JV5L 4RGOS 3VYRA 3RMHA 4KN4C 4C3HB 2CQOA 2FJ2A 3QR8A 3GV3A 1V1PA 4K0KQ 3MA2B 1D5XC 1YNND 2NZ1D 3PSIA 3LX0A 1LTLA 4ME3A 4R4TA 5BR8Q 1R4QB 1B3QA 3T4AC 1DM0B 2UUBL 1ENFA 1EQQA 3NUCA 1U4MA 1JE4A 3OHXC 3HOUG 2A68C 3CRLC 5I2YA 4U68A 4CDFC 2KOLA 2F0JA 2F0HA 3BDOA 4DV2L 1Q1EA 3I3CA 5DAUA 5IT9c 2IWHA 2A6ED 4A93B 4HJ9A 4A76A 3RUZA 1TIID 4C3HH 3NQIA 4V190 2UUCQ 2B29A 1LTBD 2KEEA 3M4PA 4JI3L 1KDCA 1YNJD 1KLUD 2B3GA 1EYCA 1LTAD 4DN4M 1SYFA 1J8IA 1N9WA 1TWFB 2JA5B 3RLOA 2F0FA 1Y1WG 3T1YL 4XTCS 1UE5A 4XT3B 1YHQA 3RZDH 3I4MB 2KCMA 5KGUA 3H3VC 4DV4Q 5M5YH 1EY6A 1EL0A 1HFGA 2NN6H 4Y7NB 2AWOA 1KQSA 2CVRA 5LHY1 5C4ZA 3IL8A 1QE6A 4DNTB 2K5DA 1GHKA 3VR3A 2LFNA 2NB0A 1SN8A 3DUZA 3S16B 1I4PA 4LJZC 4PZ8A 5HURA 1MI2A 1JWSD 1CKNB 1WD1A 1JORA 3SK4A 4K2KA 4OO1I 4LF4Q 3SVMA 1VQ7A 1VQFA 3C3LA 1Q7YC 1I3QH 3FKIH 3VYTA 1BR9A 3HP3A 3AQQA 1Q1BA 1R9TH 4R4IA 2KJXA 1LACA 1B9MA 4A3KB 2A6HC 5ELBA 2Q8IB 3OW2A 3NK9A 3OTOL 4HJ8A 1KNAA 4QUCA 1SNDA 3K7UC 1K8GA 2JA6B 2L11A 2Z9HA 4JI8Q 2RDHA 2B2VA 2O5JC 1HTPA 5BN5A 4KD3A 1KNEA 2K7VA 4IFDH 4TQUS 3FPPA 3NPPA 2KCTA 4A3GB 3J7AF 1TVXA 5EBCA 3GTMB 2HDLA 2RCNA 3QIAA 1PH6A 2WAQE 2VY3A 5CGKA 1TWAH 4JI6Q 4A3DG 2RDFA 4K0KL 1UE6A 1II3A 3SR1A 3T1YQ 3EVQA 3E9HA 3OW7A 2L1BA 1S72A 3BVGA 4DR1Q 5TSSA 5KNCA 3RLFA 4LF8Q 4NMZA 3OSOA 2N3SA 2KCCA 1PXUA 5IGEA 4ME5A 1L0WA 3ULPA 4B3MQ 5FK9C 4GKKL 2QDBA 3GTQB 1S3OA 4A3GG 1XPOA 1TWCB 2IT1A 1QCBD 3WOFA 1V43A 2L4NA 4IQZA 2SEBD 4PZ7A 4NPSA 1LTSD 5C4JB 3J80i 1E2ZA 4HIKA 1I4XA 3KDFB 4DK3C 4KHPL 2R7DA 1F2LA 3GTKH 1B8AA 1GHJA 1SE2A 3QOLA 4NW2A 4BXXG 2F4IA 1K83H 4A3IB 2DUDA 2OXPA 3R2IA 1NNXA 5HGTA 5C44G 3BZDB 3PQIA 1X6OA 4OO1G 4MHEA 5ELDA 3NQTA 2K5NA 3VYSA 2G9HD 4APVA 3RZOB 2OF1A 3HRZC 4H44C 4IN3A 1N36Q 4O1NA 1F9PA 3J81E 4L6TB 1VQOA 4JK1C 2Q2HA 1Y1VG 3CPWA 2Z1CA 3BDCA 3M85A 3STBD 4LMQD 2YYZA 1VQDA 4BXXH 4A3LG 3I4MG 3VR6A 3NWTA 2XNAC 1Y8OB 4ILWA 4HJ5A 2PI2E 2E2HH 4DV6Q 3S24A 1EY9A 4C3JB 3GTPH 4HEDA 3FHWA 4RHSA 1I4RA 2YTYA 3RR5A 4C2MB 4IPDA 2I07B 5IYDH 3N6RA 1H9JA 4J8QA 2AHOB 3VYUA 4A93G 3M4YA 3CHBD 1VQLA 2RKSA 1WOCA 1ET6A 4BY1H 5IYDG 3NTHA 4EGVA 1Z7TA 3I4OA 1LT6D 2LSSA 4WJWA 3ZYYX 4JPBW 4PMWA 1PH5A 2K03A 2IX1A 5CMDA 2JA7G 3J81i 5M3FG 4Y52H 3QOJA 3MFGA 5LMUQ 4R4OA 4J15A 2B63G 1S4ZA 4IUQA 5GAEC 4LK1C 2IHFA 4A3DH 1ENCA 1STGA 1O7LA 4DUZL 2ID0A 1BBWA 4HMIA 4JI5L 1E22A 4RG1A 4LF6L 4KKSA 2Z0SA 1HH2P 1J9OA 1ICFB 4IFDG 2IY5B 2JA7H 1S5FD 5NUCA 1KDAA 3TEHB 1FVIA 2PZWA 3PF4A 4DV0Q 4ID6A 2UXDQ 1L0XB 1XPRA 5HGQA 3MTSA 4KY6A 4CDEC 2F0SA 5JJZA 1I6HH 3D4DA 4LFBL 4OWTB 1JJ2A 5FKAC 5C5LA 2QILA 1WTQA 3U58A 1SE3A 1WI5A 3GTKB 1M90C 3HEJA 3TMEA 1CM9A 3EN2A 4J6HA 1HA5A 1IBMQ 1WTOA 2L12A 2UUAL 3D6WA 4JI0L 2F0MA 2A6HD 2H4OA 5FLMG 4OWWB 2UU9L 4YHHL 5I6WA 1XMQL 1JOQA 4PQXA 4H13C 1GUSA 4QF4A 1TWCH 1VQJA 1A0IA 1SMXA 1D5ZC 5GAHC 1QVFA 3I4MH 1TWHH 3H91A 4WJ3M 1CA5A 1VF7A 2UXBQ 2EE1A 3BYYB 4HSVA 1SFOH 5FLXL 3UDIA 1VQGA 4NXNQ 1K3BC 1P16A 3X3MA 3MHBA 3R3OA 1B44D 1R4PB 3GD7A 2ZXOA 2EY2A 1OXSC 4DR5Q 1JC7A 1Q90A 5CR3A 4EX5A 1BCPC 2WP8J 4X3UA 3S1RB 1Q46A 4JBMA 1VQCA 1FGBD 4A93H 3J80E 1E7ZA 1EU3A 3DHQA 3K57A 2B2YC 1FJGQ 3A7AB 4UPAA 1I4GA 5C44H 1XWEA 2L5TA 5K36G 3CC2A 5CORA 2JEBI 4FO2A 4JI2L 4MIUA 2XRQD 3I2ZA 1HNXQ 2BA1A 4XQNA 2WB1E 4K6LA 3GTGB 2ICEC 2JXMB 1F2ZA 2F0KA 1K28A 2EPBA 1K3RA 3KBGA 4LFCL 4B9WA 2B2YA 1I50B 1BUVT 4ALPA 4JYAQ 1K8OA 4JI1Q 2VS1A 2ZJPA 2FFKB 1IYJB 4J1MA 2EYFA 3LWUA 3QB3A 1KAWA 4A3FH 2EQSA 1U4LA 1WYDA 1TU2B 1XNRL 2O5IC 2ALYB 2Z4HA 4X3SA 4DPGA 3TRZA 4IUVA 1PTOB 2K04A 3F2CA 5C6AA 3C2PA 4XQQA 1NSNS 1X32A 2A74C 2QEJC 2PMZB 1E0BA 3SK5A 1TR5A 1EWCA 4RH6A 3FPUB 1UUPA 1LTGD 5D65A 4Y7NH 3I8ZA 3S2DH 1BBXC 3K6OA 5IT9L 4IUPA 2NVTB 1EQVA 5KNBA 3A54A 4AYBB 3ERSX 5C3EH 3G6JB 3STBC 1XTDA 3TSSA 4A3BB 4C1NK 1W3SA 4S3SA 3DXJC 1JR0D 4Q5VA 2LY7A 1PRTC 2OEOA 2LKVA 5CV6A 1QZHA 3PIOA 3TS2A 4U673 1J6QA 3PUZA 3A56A 2PO4A 3KJOA 1AW7A 2F0PA 3E0EA 5C3EG 3ITPA 3SHLA 3J81L 1GUOA 3ND8A 3T1HL 3M4QA 4L63B 2HHHQ 2I5LX 2VB3X 4H0LC 2JA7B 2B2UA 3U9OA 4F88A 4YY3L 4NDXA 1STYA 5FO7B 4YCVA 4K5VA 2N88A 1ASZA 5C4XB 1QUQB 1WVLA 1CHQD 3EQLC 4JOIC 1A8VA 5JPNC 4ZUJA 1DXMA 1VQBA 3BZKA 1HJPA 1RHPA 5C3WA 4R8IA 4LF7Q 4LF5Q 3UE0A 4P74A 3UE1A 1LV9A 3A0JA 2XSCA 2JA5G 3G7LA 3BU2A 2KVMA 5JEAJ 2PQAA 1OO9B 2N55A 3GQBA 4BBSB 4X65L 4JOIA 1WFQA 3PO2G 2SNSA 1T9HA 3UDGA 1EOTA 1S5CD 4JI2Q 1VQMA 2R93G 2BCOA 1HZAA 4WORA 4HJ7A 4JC0A 4M1UB 3BVMA 1EY0A 1YEZA 4B9XA 1SRUA 3OOCA 3NELA 4A3CG 4BS9A 1N33Q 3BG3A 1G2TA 3IKJA 4ZKBB 1SYEA 5IGBA 2LXJA 1RIPA 4JI8L 1PRTD 1BBUA 2F3IA 2DNCA 5LMNL 3HOZB 3EFXD 1DZ1A 3J81j 1STEA 2DN8A 3BDLA 3A7LA 5IP7H 3HOWH 2NN6G 2AUKA 2NVXH 1IL2A 2V1CC 2JE6I 1DD2A 1EEFD 2BE5D 2I46A 4QL5A 2HD3A 4R1JA 1HNWQ 3E6ZX 2CW0C 2Y0SE 4BBSG 3KLRA 3RZOH 4EQOA 2H1EA 2RDGA 4GN5A 1Q82C 2Z8LA 4R8NA 4TVAB 1EYAA 2Q8RE 3KYHC 3CCLA 5CV4A 1M4VA 2OQ0A 3HOXG 3HFZB 4PZ6A 2QA4A 1YJWA 2FHTA 5IOCA 3UDXA 1A3TA 1CKMA 1RF2D 4P71A 5C3EB 4QIWE 3UDFA 1GM5A 2R92G 2R61A 5G3LD 4B3SL 3L9AX 1PTOH 1HUMA 5M3FB 3AFPA 3I55A 3A8KE 3CCUA 3G6EA 3CW2C 3RNUA 1Q81C 4JBJA 4ZYSA 4BBSH 4I65A 3A74A 3M7GA 4FP5D 1ZEQX 1ILQA 3E9IA 4BBRB 3HOVB 2PYKA 3KF6B 4DR3L 3HKZB 4A3KH 1XYIA 2E75C 1AE3A 1PHJA 3JC66 4BY1B 1IZ6A 1JB3A 2LXKA 4DUYL 5AFWA 4JYAL 3I56A 3DWQA 4P73A 4AYBG 2NTTA 2VL6A 2OWOA 3J81c 2E8GA 3BS1A 4IOAA 3T56B 5I9OA 2E2HB 2XTIA 4G7OC 3S16H 5T1GA 4KV6A 2K5WA 3T13A 1HUNA 2NTSA 2R7FA 4HN7A 1O7ZA 2L9HA 4FNFA 3DWAA 3S1RH 2F0TA 3ONAB 3M4OH 5E1FA 4YWLA 5GADC 2OCEA 1ICWA 1SLJA 3MZ5A 4K8IA 5A2QL 2HT1A 1L0YB 2QCPX 4QMGA 3G71A 3S15H 1B70B 2PQAB 4LUVA 2OQKA 2EVBA 5D3IB 2FINB 4GLVB 1EIFA 1WTHA 1Z47A 4EQPA 2LS01 5M3MG 1PH8A 1PRTF 5H1SE 2EYLA 2ZT9C 5FJ8H 4RGNA 2BH2A 2R92B 3TDQA 1RCVD 4UAIA 4B3ML 1CI3M 2R3ZA 4IPHA 3MEHA 4R4CA 3L3OC 2RF4A 4B3RL 2R93H 2K01A 1TS5A 4OX9Q 4EVOA 3IFTA 1SYGA 2F0VA 1DJRD 2RCFA 2ZJQA 3C1FA 1IBKQ 4A3EG 1B53A 3CC4A 1A2TA 1A2UA 1VMPA 3CC7A 1EZ8A 5E4WC 4N9TA 2BE5C 1IW7D 1VF5C 4R9WA 3AU7A 3I7FA 1HZBA 3EBEA 3FP9A 3V05A 5IGCA 1IBML 3PUYA 1QVCA 3SDZA 1ZKOA 3BVZA 2EXDA 1QNUA 1VQ8A 5J22A 3CCMA 4A3MB 4OIKA 3E3XA 2CHBD 4FF1A 4A3DB 4M8AA 1BO0A 2BDNA 5C0XI 5K5PA 4GS3A 3IAYA 3DEOA 1G291 1QZGA 1SAPA 3RN5A 3W5OA 3VR5A 2I5MX 4A3JH 4GNXA 1TQOA 1LTTD 1WJJA 5M5WH 3X3NA 1XMOL 3D8GA 4BA2I 4A3GH 3HGBA 1O7YA 2EJGC 3CAMA 4F7XA 4MZ9A 3NBIA 4KK7A 4LAAA 3RD4A 3MFYA 1YBYA 4YWKA 5C0XH 2ZM6L 3S1NH 1DCZA 5FO8B 1YNXA 5ISRA 4DV3Q 4DR4Q 1W2BA 1GKHA 2B2WC 2JSOA 2XVSA 2K5HA 5JPMC 1MJEA 4KTAA 3HOYB 2HIXA 4FXKC 3F8TA 3MXNB 1TY2A 4IALA 3J7A5 4KD4A 2HDMA 2VUMB 1SNOA 2B2UC 4UP8A 5IGFA 4K5WA 1CZGA 3NBHA 1DGSA 4HSPA 4CBVA 5EQ0A 3CF5A 4DR3Q 3K59A 1I6HB 3K7AB 2SNMA 3RN2A 4NP5A 1T5XD 2D62A 4AH6A 1NJIC 2YU9B 4JVZA 2NVTH 2HCIA 4JBWA 4LF4L 1GUWA 1HNWL 1EYDA 4XT1B 1RODA 1KABA 2JEAI 3J7YW 2PQEA 2DY8A 2N8NA 1K83B 3K7AH 3DEPA 1A15A 3K0XA 4XYQA 3J80c 1S5ED 1MBYA 3P7JA 4C56C 2L15A 1M8AA 4GNXC 1S5DD 2K52A 1XTCD 5BR8L 2XN9C 3I4NB 2NVXB 3SE0A 4DV1Q 1JQYD 4N9PA 2EY5A 2YTVA 2ZM6Q 4LF9Q 2K5QA 1C7YA 2AUJD 4OHJA 4C2MH 1KHIA 5DNFA 4DR4L 5COYA 1IKLA 3KFUA 4IUNA 3NWSA 2RSNA 1S5BD 3CPFA 3FVQA 4I7ZC 1PZID 4K5XA 2JP1A 1IYVA 4A3EH 2A1AA 5DEHA 3W2DA 1SYBA
chains in the Genus database with same CATH topology
3GTGH 4O2DA 3HOWG 2I5HA 4JI4L 3D0FA 3PF5A 2FXQA 3FKIG 3GDEA 4JCVE 3ULLA 1FJGQ 3JAMi 3ICEA 4C3IH 4UPAA 5C44H 1FJGL 2ZTDA 4IFDI 3CC2A 5K36G 1M1KC 2JEBI 1VQEA 4JI2L 4GOPC 3I2ZA 1HNXQ 2BA1A 2WB1E 4IPCA 4C3JH 2K14A 4X66Q 5LMNW 4LNQA 1UEBA 3GO5A 1WCMG 1PH9A 1S40A 1UWVA 3PUWA 4BBRH 1PH2A 1K3RA 5FJ8G 2NZHA 4DR2L 4LFCL 4GOPB 1D8LA 1XMQQ 5M3MH 3F2DA 2C35B 3JAMc 2BA0A 4L5QA 3AYHB 1VQNA 4A3MH 4ALPA 1UE7A 1I94L 4DUYQ 1HNZL 4UY8C 4JYAQ 4JI1Q 3L0OA 2VS1A 2ZJPA 4LFAL 2K75A 4JI5Q 3VDYA 1IYJB 3CD6A 1N36L 3GTMH 1X3GA 4AQYQ 2WB1G 1KAWA 1UE1A 2K5VA 3K80C 4A3IH 2EQSA 4A3FH 1YIJA 4DR6Q 1WYDA 5HY6A 1SE8A 1YITA 1XNRL 2ALYB 5GAGC 4DPGA 3PIPA 3S14H 3TRZA 2F4VQ 2CCZA 2NVQH 1X3FA 2XGTA 3F2CA 3TREA 4KLKA 1A63A 4B3TQ 1MJCA 1X56A 3U50C 1NMGA 2ES2A 2R92H 1OXUA 4LWCA 1V9PA 4RMFA 3I4NH 1YJNA 3SGIA 1C9OA 5IWAL 4FDBA 2HQLA 2MNAA 4NXML 4A3BG 4X6AH 2UXCL 3HOXH 4POFA 2VQEQ 4JI7Q 2Q2TA 4UP7A 4Y7NH 3PCOB 1N34Q 3S2DH 1NMFA 2JA6G 4QJFA 4B3RQ 2NZOA 2Q2UA 3H3VH 3KF6A 3ERSX 1Y1VH 1K9MC 3HOVG 1EFWA 5IYBG 5C3EH 3STBC 1XTDA 4DV7Q 3NBHB 4BY1G 1GD7A 1W3SA 1Q86C 4DR7L 1TXYA 1IBLL 2RHQB 3KOJA 4LF6Q 2D0PA 1Y1WH 4NB3A 3KDFA 1QZHA 4P75A 4O0AA 1PYBA 1NBWA 1YZ6A 4EQ5A 3PIOA 2JA5H 5IP7G 1J6QA 3PUZA 4JI0Q 3TS2A 2UXBL 3KJOA 2KBNA 3E0EA 3ULJA 2QEXA 3B6YA 4BY7H 2ZTEA 4BA1I 4X64L 1XNRQ 5IYBH 5C3EG 5LMNQ 1EUJA 3Q8DA 1CSQA 3G4SA 1EQRA 3WWVA 3CCVA 1Y14B 3T1HL 3M4QA 1E1TA 1C0AA 1GO3E 2I5LX 2HHHQ 1J5EL 3T1HQ 4YY3L 3H0GG 2OTLA 2ASBA 4JV5L 4X62Q 4YCVA 3CCRA 3MEFA 1ASZA 3TQYA 4X62L 4HJAA 2CQOA 1QUQB 1SROA 4JOIC 1A8VA 3DLLA 3M3YH 1VQBA 3BZKA 3PO2H 2N78A 3CCJA 3HOVH 1HJPA 4K0KQ 3L2PA 4DV4L 4LF7Q 4LF5Q 1SR3A 3PSIA 3UE0A 4GN4B 3HKSA 4GLAC 4P74A 3UE1A 5C0XJ 4DV0L 1BKBA 2JJQA 1OTCA 1LTLA 4ME3A 3A0JA 4OONA 1L1OB 4R4TA 1O7IA 3ZJYC 2JA5G 3BU2A 5BR8Q 3H15A 5JEAJ 1Q12A 1CKOA 2PQAA 4QQBX 3EIVA 4B3SQ 1KL9A 4X65L 2UUBL 4IOCA 4JI3Q 4JOIA 4QGUA 1WFQA 2AWNA 3CCEA 1EQQA 3PO2G 1T9HA 3HOUG 3UDGA 1E3PA 1LM0A 4JI2Q 1VQMA 2R93G 1PYSB 4DK6C 1HZAA 4HJ7A 4JC0A 1VQIA 4DV7L 3CMAA 1N33L 1YEZA 4DV2L 1K73C 1Q1EA 1SRUA 1HZ9A 3HKZE 3IRBA 3NELA 5LMUL 2WAQG 2KENA 4A3CG 5IT9c 1N33Q 1VQPA 1HNZQ 5GROA 1VCIA 3L7ZC 1ASYA 3PGZA 1PH7A 2YTXA 4HJ9A 4GN3B 4A76A 4C3HH 2LXJA 3S1MH 1E1OA 1RIPA 4JI8L 1PVOA 2KHIA 1QUQA 1BBUA 2F3IA 2UUCQ 2B29A 2UXCQ 2R6GA 5LMNL 3M4PA 4JI3L 4X65Q 3J81j 2UUBQ 2B3GA 4L5TA 1K8AC 2UUCL 2VNUD 4POGA 1U0LA 3GTLH 4A3KG 4WJ4A 5IP7H 3HOWH 2NN6G 1YVCA 4L5SA 4A3FG 1N9WA 1PV4A 1EYGA 2NVXH 2V1CC 3RLOA 2JE6I 1IL2A 1Y1WG 3T1YL 3HKZG 3OTOQ 4XTCS 1UE5A 1YHQA 4P72A 4QL5A 3RZDH 1VQ9A 4R1JA 2KCMA 1HNWQ 4HIDA 1XNQL 4DV4Q 4LF7L 5M5YH 2ATWA 2R7ZH 2K4KA 2Y0SE 4BBSG 3S2HH 3S1QH 4R4QA 3M9BA 1TWFH 4A3MG 1KRTA 1KD1C 3RZOH 2AWOA 5JJIA 1Q82C 4GN5A 1KQSA 4TVAB 1I50H 4LFAQ 2ZTCA 4QY7A 1VQAA 1N34L 3KYHC 5DLQE 1IBLQ 3CCLA 2JA8H 3W1BA 1XMOQ 4DKAC 1N32L 2IHEA 1SN8A 2OQ0A 3HOXG 3HFZB 4PZ6A 2QA4A 4DV5Q 2PI2A 4PZ8A 1YJWA 2MQHA 3UDXA 1CKNB 2VQFL 1CKMA 2R92G 4P71A 4QIWE 3UDFA 1GM5A 4DUZQ 4OO1I 4LF4Q 1VQ7A 4B3SL 2YU9H 1VQFA 1Q7YC 1I3QH 2JA8G 2E5LQ 3OYYA 3FKIH 3AFPA 5IWAQ 3I55A 4AIMA 1YI2A 3CCUA 2VW9A 3K8AA 3AQQA 1Q1BA 3G6EA 1R9TH 3CW2C 3RNUA 4R4IA 3PUXA 3ER0A 3NENA 1Q81C 4H02A 4JBJA 2R7ZG 4BBSH 3A74A 1AE2A 1KRSA 2EIFA 1PH3A 2Q2IA 5FLXc 3F2BA 2UUAQ 3OW2A 2F4VL 3OTOL 3E9IA 4HJ8A 1CSPA 1JJCB 3K7UC 1K8GA 2VQFQ 3KF6B 4JI8Q 4DR3L 4A3KH 4IJLA 4DR2Q 1EWIA 1AE3A 1VS0A 1PHJA 1E24A 3JC66 2E5LL 3A5UA 1TWGH 4TQUS 4JV5Q 2PNHA 1IZ6A 2KCTA 2LXKA 2VQEL 1CKNA 4DUYL 4JYAL 1JMCA 3I56A 2RCNA 4NXNL 1CUKA 4P73A 3CCQA 1PH6A 2WAQE 4AYBG 4OX9L 1P8LA 2VL6A 2VY3A 4DV6L 1YHAA 2OWOA 1VQ6A 1TWAH 3AFQA 2E8GA 3J81c 3TS0A 4JI6Q 4JI7L 4A3DG 1N32Q 4IOAA 4K0KL 1UE6A 3T1YQ 2XTIA 1X55A 3E9HA 3H0GH 2UXDL 4YY3Q 3S16H 1HR0Q 2Z6KC 3I4NG 3A5ZB 2UU9Q 1G6PA 1L1OC 1S72A 4DR1Q 4A3IG 2AKWB 2R7FA 2GVAA 1JJGA 3RLFA 2OTJA 4LUOA 2WFWA 4LF8Q 1U5KA 1OXVA 2N3SA 3S1RH 1X65A 4HIOA 4IJHA 4LF8L 1G51A 2N49A 1L0WA 3ULPA 1XJVA 4B3MQ 3M4OH 5GADC 4YWLA 4GKKL 2OCEA 1SLJA 3GTOH 2MO0A 2HHHL 4DAYB 1N8RC 2KHJA 2HT1A 3G71A 4LF5L 1GVPA 1S3OA 3S15H 1B70B 2PQAB 4LUVA 1XPOA 4A3GG 4OXPA 2IT1A 2JA9A 2OQKA 1V43A 2ZJRA 2Z6KA 3D31A 1OXXK 1L1OA 1EIFA 4GLVB 4NPSA 4PZ7A 1Z47A 4DV1L 5JJLA 5M3MG 1PH8A 4GLXA 3J80i 2JA6H 5H1SE 1PA6A 5FJ8H 4HIKA 2BH2A 3KDFB 4DK3C 4BBRG 4A3CH 1KC8C 4KHPL 1VQ5A 1WCMH 2R7DA 4B3ML 3GTKH 1B8AA 3H3VI 2VUMG 3GTJH 5C4XG 4IPHA 1NY4A 4BXXG 4R4CA 2RF4A 4DR6L 1A62A 4OWXB 4B3RL 2R93H 1K83H 2VZAA 5M3FH 4GNXB 4OX9Q 3HOUH 3PO3H 2DUDA 4DV3L 3KLWA 5IYCH 5C44G 5GQOA 2ZJQA 1IBKQ 4A3EG 1KXLA 3HOYG 1X6OA 4OO1G 4MTNA 3CC4A 4DV2Q 1I94Q 4UP9A 1PH1A 1V1QA 3CC7A 2K5NA 1QVGA 4YCUA 4APVA 2HIVA 5E7NA 1LUZA 2I0QA 1N36Q 1HR0W 2DGYA 5AJ3L 4YCWA 4DAMA 2MO1A 3I7FA 1VQOA 1HZBA 2F52A 2Q2HA 3EBEA 2JK8A 4JI1L 3FP9A 4YWMA 1NE3A 1PH4A 1Y1VG 1H95A 1IBML 3PUYA 1QVCA 3HOYH 3CPWA 3KF8B 3HOZH 1J5EQ 4A3JG 2EXDA 3M85A 4MNOA 1VQ8A 1FGUA 3CCMA 5J3BA 4PG3A 3STBD 2YYZA 5FLMH 1VQDA 5EAYA 4BXXH 4DR7Q 4LUZA 4A3LG 1IXRA 3I4MG 4LF9L 2VUMH 2B63H 5C0XI 3AEVA 1K0RA 4GS3A 2NN6I 2H5XA 4HJ5A 2PI2E 2E2HH 1EIYB 1Z9FA 4DV6Q 1G291 1QZGA 3S24A 2A8VA 3RN5A 3W5OA 1Q8KA 2I5MX 4A75A 4AQYL 4A3JH 4GNXA 3GTPH 1WJJA 3FHWA 5M5WH 1YJ9A 3HOZG 4BY7G 2YTYA 1OXTA 1XMOL 1JB7A 3RR5A 4IPDA 1IBKL 4JI4Q 1YHBA 4A4IA 5IYDH 4BA2I 4A3GH 2AHOB 2K50A 4A93G 5M5XH 3RLNA 2CFMA 3CAMA 1VQLA 4B3TL 4MZ9A 4GKJL 1WOCA 4BY1H 5IYDG 3NEMA 4IO9A 1YBYA 2AMCB 4KHZA 4YWKA 1B7YB 2CWAA 2ZM6L 3S1NH 1MIUA 3I4OA 1YNXA 2LSSA 4KHPQ 1JT8A 5ELNA 1PH5A 4PMWA 4DV3Q 2IX1A 1I5FA 4YHHQ 1XPUA 1EOVA 2JA7G 3J81i 5M3FG 1W2BA 4DR4Q 4Y52H 1GKHA 1HR0L 5LMUQ 2Y0SG 4R4OA 4J15A 3CCSA 4HIMA 5C4XH 2B63G 5GAEC 4A3BH 1L2FA 1MKHA 2K5HA 2IHFA 1XNQQ 3CQZH 3DM3A 5IE8A 1MJEA 2HIXA 3PUVA 4A3DH 3F8TA 4DUZL 2ID0A 3MXNB 1BBWA 4LFCQ 4DR1L 5IP9H 4JI5L 1NTGA 3J7A5 1E22A 4RG1A 4LF6L 4X64Q 3M7NA 3BZCA 2Z0SA 5C0XG 3BJUA 1BVSA 4UP8A 1HH2P 4KI0A 4L5RC 4IFDG 1HNXL 1DGSA 2IY5B 2JA7H 4JI6L 1VQHA 2RHSB 2E2JH 3TEHB 3CF5A 1FVIA 5JEAG 4DV5L 4DR3Q 3PF4A 4DV0Q 2UXDQ 4DNIA 2GN5A 2D62A 2A19A 4AH6A 3RN2A 1NJIC 2NVTH 3W1GA 4JBWA 4X66L 5JJKA 4LF4L 1XPRA 5HGQA 1HNWL 1I6HH 3CP0A 4LW1A 5IY0A 4LFBL 3U4ZA 2JEAI 4OWTB 1JJ2A 1VQKA 1AH9A 3K81C 3U58A 1WI5A 2N8NA 3CXCA 1M90C 1X9NA 4LFBQ 3K7AH 3CMEA 2YV5A 1LYLA 3EN2A 2GVBA 3K0XA 4JBKA 3J80c 1IBMQ 4IFDJ 1D7QA 4DR5L 3G48A 2D0OA 5ELOA 2E2IH 2UUAL 4JI0L 2IX0A 4A3LH 5IP9G 5AJ3Q 2L15A 5FLMG 4OWWB 3J7ZC 2K52A 4GNXC 2UU9L 5BR8L 4YHHL 1X54A 1XMQL 4GKKQ 1PFSA 3GTQH 1X3EA 4IPGA 1TWCH 2PMZE 1VQJA 4AYBE 4DV1Q 2NVYH 1VQ4A 1A0IA 2YTVA 1SMXA 5GAHC 2ZM6Q 4LF9Q 1QVFA 3I4MH 2CKZB 2CWPA 1TWHH 3F1ZA 1C7YA 4WJ3M 1RL2A 3LGJA 4GKJQ 2UXBQ 4C2MH 1KHIA 1SFOH 1HZCA 4XIGS 3S17H 4DR4L 2BH8A 3UDIA 1VQGA 4NXNQ 1P16A 5C4JH 3KFUA 3U4VA 2MFIA 3CPFA 3GD7A 1KIXA 4GOPA 1OXSC 4DR5Q 3KJPA 4NXMQ 4EX5A 1JE5A 2JQOA 2WP8J 4A3EH 1Q46A 2A1AA 4JG2A 3PV0A 1FL0A 5IYCG 4JBMA 1VQCA 4A93H 3PO3G 2QGQA 1E7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTG H;  4O2D A;  3HOW G;  2I5H A;  4JI4 L;  3D0F A;  3PF5 A;  2FXQ A;  3FKI G;  3GDE A;  4JCV E;  3ULL A;  1FJG Q;  3JAM i;  3ICE A;  4C3I H;  4UPA A;  5C44 H;  1FJG L;  2ZTD A;  4IFD I;  3CC2 A;  5K36 G;  1M1K C;  2JEB I;  1VQE A;  4JI2 L;  4GOP C;  3I2Z A;  1HNX Q;  2BA1 A;  2WB1 E;  4IPC A;  4C3J H;  2K14 A;  4X66 Q;  5LMN W;  4LNQ A;  1UEB A;  3GO5 A;  1WCM G;  1PH9 A;  1S40 A;  1UWV A;  3PUW A;  4BBR H;  1PH2 A;  1K3R A;  5FJ8 G;  2NZH A;  4DR2 L;  4LFC L;  4GOP B;  1D8L A;  1XMQ Q;  5M3M H;  3F2D A;  2C35 B;  3JAM c;  2BA0 A;  4L5Q A;  3AYH B;  1VQN A;  4A3M H;  4ALP A;  1UE7 A;  1I94 L;  4DUY Q;  1HNZ L;  4UY8 C;  4JYA Q;  4JI1 Q;  3L0O A;  2VS1 A;  2ZJP A;  4LFA L;  2K75 A;  4JI5 Q;  3VDY A;  1IYJ B;  3CD6 A;  1N36 L;  3GTM H;  1X3G A;  4AQY Q;  2WB1 G;  1KAW A;  1UE1 A;  2K5V A;  3K80 C;  4A3I H;  2EQS A;  4A3F H;  1YIJ A;  4DR6 Q;  1WYD A;  5HY6 A;  1SE8 A;  1YIT A;  1XNR L;  2ALY B;  5GAG C;  4DPG A;  3PIP A;  3S14 H;  3TRZ A;  2F4V Q;  2CCZ A;  2NVQ H;  1X3F A;  2XGT A;  3F2C A;  3TRE A;  4KLK A;  1A63 A;  4B3T Q;  1MJC A;  1X56 A;  3U50 C;  1NMG A;  2ES2 A;  2R92 H;  1OXU A;  4LWC A;  1V9P A;  4RMF A;  3I4N H;  1YJN A;  3SGI A;  1C9O A;  5IWA L;  4FDB A;  2HQL A;  2MNA A;  4NXM L;  4A3B G;  4X6A H;  2UXC L;  3HOX H;  4POF A;  2VQE Q;  4JI7 Q;  2Q2T A;  4UP7 A;  4Y7N H;  3PCO B;  1N34 Q;  3S2D H;  1NMF A;  2JA6 G;  4QJF A;  4B3R Q;  2NZO A;  2Q2U A;  3H3V H;  3KF6 A;  3ERS X;  1Y1V H;  1K9M C;  3HOV G;  1EFW A;  5IYB G;  5C3E H;  3STB C;  1XTD A;  4DV7 Q;  3NBH B;  4BY1 G;  1GD7 A;  1W3S A;  1Q86 C;  4DR7 L;  1TXY A;  1IBL L;  2RHQ B;  3KOJ A;  4LF6 Q;  2D0P A;  1Y1W H;  4NB3 A;  3KDF A;  1QZH A;  4P75 A;  4O0A A;  1PYB A;  1NBW A;  1YZ6 A;  4EQ5 A;  3PIO A;  2JA5 H;  5IP7 G;  1J6Q A;  3PUZ A;  4JI0 Q;  3TS2 A;  2UXB L;  3KJO A;  2KBN A;  3E0E A;  3ULJ A;  2QEX A;  3B6Y A;  4BY7 H;  2ZTE A;  4BA1 I;  4X64 L;  1XNR Q;  5IYB H;  5C3E G;  5LMN Q;  1EUJ A;  3Q8D A;  1CSQ A;  3G4S A;  1EQR A;  3WWV A;  3CCV A;  1Y14 B;  3T1H L;  3M4Q A;  1E1T A;  1C0A A;  1GO3 E;  2I5L X;  2HHH Q;  1J5E L;  3T1H Q;  4YY3 L;  3H0G G;  2OTL A;  2ASB A;  4JV5 L;  4X62 Q;  4YCV A;  3CCR A;  3MEF A;  1ASZ A;  3TQY A;  4X62 L;  4HJA A;  2CQO A;  1QUQ B;  1SRO A;  4JOI C;  1A8V A;  3DLL A;  3M3Y H;  1VQB A;  3BZK A;  3PO2 H;  2N78 A;  3CCJ A;  3HOV H;  1HJP A;  4K0K Q;  3L2P A;  4DV4 L;  4LF7 Q;  4LF5 Q;  1SR3 A;  3PSI A;  3UE0 A;  4GN4 B;  3HKS A;  4GLA C;  4P74 A;  3UE1 A;  5C0X J;  4DV0 L;  1BKB A;  2JJQ A;  1OTC A;  1LTL A;  4ME3 A;  3A0J A;  4OON A;  1L1O B;  4R4T A;  1O7I A;  3ZJY C;  2JA5 G;  3BU2 A;  5BR8 Q;  3H15 A;  5JEA J;  1Q12 A;  1CKO A;  2PQA A;  4QQB X;  3EIV A;  4B3S Q;  1KL9 A;  4X65 L;  2UUB L;  4IOC A;  4JI3 Q;  4JOI A;  4QGU A;  1WFQ A;  2AWN A;  3CCE A;  1EQQ A;  3PO2 G;  1T9H A;  3HOU G;  3UDG A;  1E3P A;  1LM0 A;  4JI2 Q;  1VQM A;  2R93 G;  1PYS B;  4DK6 C;  1HZA A;  4HJ7 A;  4JC0 A;  1VQI A;  4DV7 L;  3CMA A;  1N33 L;  1YEZ A;  4DV2 L;  1K73 C;  1Q1E A;  1SRU A;  1HZ9 A;  3HKZ E;  3IRB A;  3NEL A;  5LMU L;  2WAQ G;  2KEN A;  4A3C G;  5IT9 c;  1N33 Q;  1VQP A;  1HNZ Q;  5GRO A;  1VCI A;  3L7Z C;  1ASY A;  3PGZ A;  1PH7 A;  2YTX A;  4HJ9 A;  4GN3 B;  4A76 A;  4C3H H;  2LXJ A;  3S1M H;  1E1O A;  1RIP A;  4JI8 L;  1PVO A;  2KHI A;  1QUQ A;  1BBU A;  2F3I A;  2UUC Q;  2B29 A;  2UXC Q;  2R6G A;  5LMN L;  3M4P A;  4JI3 L;  4X65 Q;  3J81 j;  2UUB Q;  2B3G A;  4L5T A;  1K8A C;  2UUC L;  2VNU D;  4POG A;  1U0L A;  3GTL H;  4A3K G;  4WJ4 A;  5IP7 H;  3HOW H;  2NN6 G;  1YVC A;  4L5S A;  4A3F G;  1N9W A;  1PV4 A;  1EYG A;  2NVX H;  2V1C C;  3RLO A;  2JE6 I;  1IL2 A;  1Y1W G;  3T1Y L;  3HKZ G;  3OTO Q;  4XTC S;  1UE5 A;  1YHQ A;  4P72 A;  4QL5 A;  3RZD H;  1VQ9 A;  4R1J A;  2KCM A;  1HNW Q;  4HID A;  1XNQ L;  4DV4 Q;  4LF7 L;  5M5Y H;  2ATW A;  2R7Z H;  2K4K A;  2Y0S E;  4BBS G;  3S2H H;  3S1Q H;  4R4Q A;  3M9B A;  1TWF H;  4A3M G;  1KRT A;  1KD1 C;  3RZO H;  2AWO A;  5JJI A;  1Q82 C;  4GN5 A;  1KQS A;  4TVA B;  1I50 H;  4LFA Q;  2ZTC A;  4QY7 A;  1VQA A;  1N34 L;  3KYH C;  5DLQ E;  1IBL Q;  3CCL A;  2JA8 H;  3W1B A;  1XMO Q;  4DKA C;  1N32 L;  2IHE A;  1SN8 A;  2OQ0 A;  3HOX G;  3HFZ B;  4PZ6 A;  2QA4 A;  4DV5 Q;  2PI2 A;  4PZ8 A;  1YJW A;  2MQH A;  3UDX A;  1CKN B;  2VQF L;  1CKM A;  2R92 G;  4P71 A;  4QIW E;  3UDF A;  1GM5 A;  4DUZ Q;  4OO1 I;  4LF4 Q;  1VQ7 A;  4B3S L;  2YU9 H;  1VQF A;  1Q7Y C;  1I3Q H;  2JA8 G;  2E5L Q;  3OYY A;  3FKI H;  3AFP A;  5IWA Q;  3I55 A;  4AIM A;  1YI2 A;  3CCU A;  2VW9 A;  3K8A A;  3AQQ A;  1Q1B A;  3G6E A;  1R9T H;  3CW2 C;  3RNU A;  4R4I A;  3PUX A;  3ER0 A;  3NEN A;  1Q81 C;  4H02 A;  4JBJ A;  2R7Z G;  4BBS H;  3A74 A;  1AE2 A;  1KRS A;  2EIF A;  1PH3 A;  2Q2I A;  5FLX c;  3F2B A;  2UUA Q;  3OW2 A;  2F4V L;  3OTO L;  3E9I A;  4HJ8 A;  1CSP A;  1JJC B;  3K7U C;  1K8G A;  2VQF Q;  3KF6 B;  4JI8 Q;  4DR3 L;  4A3K H;  4IJL A;  4DR2 Q;  1EWI A;  1AE3 A;  1VS0 A;  1PHJ A;  1E24 A;  3JC6 6;  2E5L L;  3A5U A;  1TWG H;  4TQU S;  4JV5 Q;  2PNH A;  1IZ6 A;  2KCT A;  2LXK A;  2VQE L;  1CKN A;  4DUY L;  4JYA L;  1JMC A;  3I56 A;  2RCN A;  4NXN L;  1CUK A;  4P73 A;  3CCQ A;  1PH6 A;  2WAQ E;  4AYB G;  4OX9 L;  1P8L A;  2VL6 A;  2VY3 A;  4DV6 L;  1YHA A;  2OWO A;  1VQ6 A;  1TWA H;  3AFQ A;  2E8G A;  3J81 c;  3TS0 A;  4JI6 Q;  4JI7 L;  4A3D G;  1N32 Q;  4IOA A;  4K0K L;  1UE6 A;  3T1Y Q;  2XTI A;  1X55 A;  3E9H A;  3H0G H;  2UXD L;  4YY3 Q;  3S16 H;  1HR0 Q;  2Z6K C;  3I4N G;  3A5Z B;  2UU9 Q;  1G6P A;  1L1O C;  1S72 A;  4DR1 Q;  4A3I G;  2AKW B;  2R7F A;  2GVA A;  1JJG A;  3RLF A;  2OTJ A;  4LUO A;  2WFW A;  4LF8 Q;  1U5K A;  1OXV A;  2N3S A;  3S1R H;  1X65 A;  4HIO A;  4IJH A;  4LF8 L;  1G51 A;  2N49 A;  1L0W A;  3ULP A;  1XJV A;  4B3M Q;  3M4O H;  5GAD C;  4YWL A;  4GKK L;  2OCE A;  1SLJ A;  3GTO H;  2MO0 A;  2HHH L;  4DAY B;  1N8R C;  2KHJ A;  2HT1 A;  3G71 A;  4LF5 L;  1GVP A;  1S3O A;  3S15 H;  1B70 B;  2PQA B;  4LUV A;  1XPO A;  4A3G G;  4OXP A;  2IT1 A;  2JA9 A;  2OQK A;  1V43 A;  2ZJR A;  2Z6K A;  3D31 A;  1OXX K;  1L1O A;  1EIF A;  4GLV B;  4NPS A;  4PZ7 A;  1Z47 A;  4DV1 L;  5JJL A;  5M3M G;  1PH8 A;  4GLX A;  3J80 i;  2JA6 H;  5H1S E;  1PA6 A;  5FJ8 H;  4HIK A;  2BH2 A;  3KDF B;  4DK3 C;  4BBR G;  4A3C H;  1KC8 C;  4KHP L;  1VQ5 A;  1WCM H;  2R7D A;  4B3M L;  3GTK H;  1B8A A;  3H3V I;  2VUM G;  3GTJ H;  5C4X G;  4IPH A;  1NY4 A;  4BXX G;  4R4C A;  2RF4 A;  4DR6 L;  1A62 A;  4OWX B;  4B3R L;  2R93 H;  1K83 H;  2VZA A;  5M3F H;  4GNX B;  4OX9 Q;  3HOU H;  3PO3 H;  2DUD A;  4DV3 L;  3KLW A;  5IYC H;  5C44 G;  5GQO A;  2ZJQ A;  1IBK Q;  4A3E G;  1KXL A;  3HOY G;  1X6O A;  4OO1 G;  4MTN A;  3CC4 A;  4DV2 Q;  1I94 Q;  4UP9 A;  1PH1 A;  1V1Q A;  3CC7 A;  2K5N A;  1QVG A;  4YCU A;  4APV A;  2HIV A;  5E7N A;  1LUZ A;  2I0Q A;  1N36 Q;  1HR0 W;  2DGY A;  5AJ3 L;  4YCW A;  4DAM A;  2MO1 A;  3I7F A;  1VQO A;  1HZB A;  2F52 A;  2Q2H A;  3EBE A;  2JK8 A;  4JI1 L;  3FP9 A;  4YWM A;  1NE3 A;  1PH4 A;  1Y1V G;  1H95 A;  1IBM L;  3PUY A;  1QVC A;  3HOY H;  3CPW A;  3KF8 B;  3HOZ H;  1J5E Q;  4A3J G;  2EXD A;  3M85 A;  4MNO A;  1VQ8 A;  1FGU A;  3CCM A;  5J3B A;  4PG3 A;  3STB D;  2YYZ A;  5FLM H;  1VQD A;  5EAY A;  4BXX H;  4DR7 Q;  4LUZ A;  4A3L G;  1IXR A;  3I4M G;  4LF9 L;  2VUM H;  2B63 H;  5C0X I;  3AEV A;  1K0R A;  4GS3 A;  2NN6 I;  2H5X A;  4HJ5 A;  2PI2 E;  2E2H H;  1EIY B;  1Z9F A;  4DV6 Q;  1G29 1;  1QZG A;  3S24 A;  2A8V A;  3RN5 A;  3W5O A;  1Q8K A;  2I5M X;  4A75 A;  4AQY L;  4A3J H;  4GNX A;  3GTP H;  1WJJ A;  3FHW A;  5M5W H;  1YJ9 A;  3HOZ G;  4BY7 G;  2YTY A;  1OXT A;  1XMO L;  1JB7 A;  3RR5 A;  4IPD A;  1IBK L;  4JI4 Q;  1YHB A;  4A4I A;  5IYD H;  4BA2 I;  4A3G H;  2AHO B;  2K50 A;  4A93 G;  5M5X H;  3RLN A;  2CFM A;  3CAM A;  1VQL A;  4B3T L;  4MZ9 A;  4GKJ L;  1WOC A;  4BY1 H;  5IYD G;  3NEM A;  4IO9 A;  1YBY A;  2AMC B;  4KHZ A;  4YWK A;  1B7Y B;  2CWA A;  2ZM6 L;  3S1N H;  1MIU A;  3I4O A;  1YNX A;  2LSS A;  4KHP Q;  1JT8 A;  5ELN A;  1PH5 A;  4PMW A;  4DV3 Q;  2IX1 A;  1I5F A;  4YHH Q;  1XPU A;  1EOV A;  2JA7 G;  3J81 i;  5M3F G;  1W2B A;  4DR4 Q;  4Y52 H;  1GKH A;  1HR0 L;  5LMU Q;  2Y0S G;  4R4O A;  4J15 A;  3CCS A;  4HIM A;  5C4X H;  2B63 G;  5GAE C;  4A3B H;  1L2F A;  1MKH A;  2K5H A;  2IHF A;  1XNQ Q;  3CQZ H;  3DM3 A;  5IE8 A;  1MJE A;  2HIX A;  3PUV A;  4A3D H;  3F8T A;  4DUZ L;  2ID0 A;  3MXN B;  1BBW A;  4LFC Q;  4DR1 L;  5IP9 H;  4JI5 L;  1NTG A;  3J7A 5;  1E22 A;  4RG1 A;  4LF6 L;  4X64 Q;  3M7N A;  3BZC A;  2Z0S A;  5C0X G;  3BJU A;  1BVS A;  4UP8 A;  1HH2 P;  4KI0 A;  4L5R C;  4IFD G;  1HNX L;  1DGS A;  2IY5 B;  2JA7 H;  4JI6 L;  1VQH A;  2RHS B;  2E2J H;  3TEH B;  3CF5 A;  1FVI A;  5JEA G;  4DV5 L;  4DR3 Q;  3PF4 A;  4DV0 Q;  2UXD Q;  4DNI A;  2GN5 A;  2D62 A;  2A19 A;  4AH6 A;  3RN2 A;  1NJI C;  2NVT H;  3W1G A;  4JBW A;  4X66 L;  5JJK A;  4LF4 L;  1XPR A;  5HGQ A;  1HNW L;  1I6H H;  3CP0 A;  4LW1 A;  5IY0 A;  4LFB L;  3U4Z A;  2JEA I;  4OWT B;  1JJ2 A;  1VQK A;  1AH9 A;  3K81 C;  3U58 A;  1WI5 A;  2N8N A;  3CXC A;  1M90 C;  1X9N A;  4LFB Q;  3K7A H;  3CME A;  2YV5 A;  1LYL A;  3EN2 A;  2GVB A;  3K0X A;  4JBK A;  3J80 c;  1IBM Q;  4IFD J;  1D7Q A;  4DR5 L;  3G48 A;  2D0O A;  5ELO A;  2E2I H;  2UUA L;  4JI0 L;  2IX0 A;  4A3L H;  5IP9 G;  5AJ3 Q;  2L15 A;  5FLM G;  4OWW B;  3J7Z C;  2K52 A;  4GNX C;  2UU9 L;  5BR8 L;  4YHH L;  1X54 A;  1XMQ L;  4GKK Q;  1PFS A;  3GTQ H;  1X3E A;  4IPG A;  1TWC H;  2PMZ E;  1VQJ A;  4AYB E;  4DV1 Q;  2NVY H;  1VQ4 A;  1A0I A;  2YTV A;  1SMX A;  5GAH C;  2ZM6 Q;  4LF9 Q;  1QVF A;  3I4M H;  2CKZ B;  2CWP A;  1TWH H;  3F1Z A;  1C7Y A;  4WJ3 M;  1RL2 A;  3LGJ A;  4GKJ Q;  2UXB Q;  4C2M H;  1KHI A;  1SFO H;  1HZC A;  4XIG S;  3S17 H;  4DR4 L;  2BH8 A;  3UDI A;  1VQG A;  4NXN Q;  1P16 A;  5C4J H;  3KFU A;  3U4V A;  2MFI A;  3CPF A;  3GD7 A;  1KIX A;  4GOP A;  1OXS C;  4DR5 Q;  3KJP A;  4NXM Q;  4EX5 A;  1JE5 A;  2JQO A;  2WP8 J;  4A3E H;  1Q46 A;  2A1A A;  4JG2 A;  3PV0 A;  1FL0 A;  5IYC G;  4JBM A;  1VQC A;  4A93 H;  3PO3 G;  2QGQ A;  1E7Z A; 
#chains in the Genus database with same CATH topology
 3GTG H;  3HOW G;  4QB4 A;  1E2V A;  2ENB A;  3PF5 A;  3ICE A;  4A3E B;  5KEE A;  3DMU A;  1V8Q A;  3PMF A;  2EYO A;  2ZTD A;  4DGZ A;  4IFD I;  1QB5 D;  2B8G A;  4F87 A;  1M1K C;  4C3H G;  2A69 C;  2QW7 A;  2MUY A;  4CHT B;  4DNR B;  4X66 Q;  1UEB A;  3SEB A;  1MSH A;  2ZXP A;  3HZX A;  4ABN A;  3R2T A;  1UWV A;  3BYT B;  3Q23 A;  1NAP A;  1PH2 A;  3Q0A A;  2EYJ A;  4UDU C;  4DR2 L;  4HCS A;  4GOP B;  1XMQ Q;  2B2T A;  3JAM c;  2BA0 A;  4L5Q A;  1VQN A;  4A3M H;  1HNZ L;  4BY7 B;  3L0O A;  3GP7 A;  3OPO A;  4RGT A;  2F0Q A;  3GTM H;  4KKU A;  5JEA H;  2WB1 G;  1YIJ A;  3K80 C;  3MAQ A;  5HY6 A;  1SMY D;  4I7A A;  1ILP A;  4WFN 3;  3S14 H;  5EBD A;  3FKI B;  2NVQ H;  5CV5 A;  1I3Q B;  3GTL B;  1G2S A;  4B3T Q;  1X56 A;  3U50 C;  3ND9 A;  1JOO A;  3FMC A;  1YNN C;  1HXY D;  1YJN A;  2WB1 B;  3SGI A;  4RFB A;  2MNA A;  4A3B G;  1I4H A;  4X6A H;  3VA7 A;  3HOX H;  4JI7 Q;  2Q2T A;  3PCO B;  1ML0 D;  2K6A A;  1NMF A;  3OIP A;  4FF4 A;  2JA6 G;  1PRT B;  4QJF A;  4RA8 A;  2OT2 A;  1CK1 A;  4EQN A;  1GUN A;  3T16 A;  1Y1V H;  3NHH A;  5IGD A;  2NUC A;  1K9M C;  4L8J A;  3NBH B;  4BY1 G;  1GD7 A;  4C1N I;  4DR7 L;  3KK7 A;  1TXY A;  2D0P A;  1B50 A;  1Y1W H;  2JA5 H;  4P75 A;  4O0A A;  1PYB A;  4FXG C;  4EQ5 A;  4JI0 Q;  1ZYR C;  1D6E C;  4RWS C;  3QJY A;  3ULJ A;  2EYM A;  4BY7 H;  2ZTE A;  4X64 L;  4XQJ A;  5E4X A;  3Q8D A;  1EQR A;  2F0L A;  2E2J B;  2RQX A;  1J5E L;  1B4O A;  3H0G G;  1WCM B;  1EY5 A;  1SNQ A;  2ASB A;  2M00 A;  4X62 Q;  1HCZ A;  1D1K A;  2B2T C;  3D4R A;  3TQY A;  2B63 B;  1A3V A;  4H7B A;  1LO5 D;  2RVL A;  3M3Y H;  3PO2 H;  2N78 A;  4DXF A;  2HQE A;  2K33 A;  3CCJ A;  5EKL A;  1U4R A;  3L2P A;  1SR3 A;  3PIO 3;  4GN4 B;  3HKS A;  2E2D C;  5BN4 A;  2JJQ A;  1OTC A;  1O7I A;  2PPB C;  5M5X B;  1IHZ A;  2MJ8 A;  1Q12 A;  4G57 A;  5DM6 3;  4B3S Q;  3HOV H;  1B1Z A;  4JW0 A;  4QGU A;  1RDP D;  1U9R A;  1PYS B;  2FMM A;  4DK6 C;  4RGM A;  3NTI A;  1VQI A;  2IL8 A;  1N33 L;  1QIL A;  1K73 C;  3HKZ E;  1KDB A;  2WAQ G;  1VQP A;  1HNZ Q;  4WRD A;  5GRO A;  1VCI A;  2NBF A;  1ASY A;  1PH7 A;  1PVO A;  2KHI A;  1QUQ A;  1HPC A;  4X65 Q;  1ZYR D;  2R7Z B;  4C3I G;  3MVV A;  4L5T A;  1K8A C;  2UUC L;  2VNU D;  4POG A;  3GTL H;  4IUU A;  1YVC A;  4L5S A;  3S17 B;  4A3F G;  1E2W A;  4KJN A;  5ELE A;  3WOE A;  2XRS D;  4UHV A;  2E74 C;  2JA8 B;  4P72 A;  4QIW B;  3NSW A;  4HID A;  1XNQ L;  1Y8P B;  4LF7 L;  1BF4 A;  1BNZ A;  2R7Z H;  2K4K A;  3DM1 A;  3JAM L;  4CDD C;  4R4Q A;  3M9B A;  1TWF H;  5I9P A;  2K28 A;  1SMY C;  2ICI A;  1DON A;  3H6M A;  2AQ2 B;  4DAP A;  2ZTC A;  1N34 L;  5DLQ E;  3E0J A;  2JA8 H;  3W1B A;  1N32 L;  2IHE A;  2IX3 A;  4DV5 Q;  2PI2 A;  2MQH A;  1AZP A;  2VQF L;  5CBA E;  2PW5 A;  4DUZ Q;  2D9U A;  3S9W A;  4DU9 A;  2JA8 G;  2EJM A;  3EA6 A;  4DK1 A;  5IWA Q;  4AIM A;  1YI2 A;  1TS3 A;  5EPJ A;  2VW9 A;  3K8A A;  3PIP 3;  3PUX A;  2F3V A;  4H02 A;  4DFA A;  3U9S A;  2R7Z G;  2F0U A;  2EIF A;  1PH3 A;  2Q2I A;  3F2B A;  2F4V L;  1EWH A;  3GTP B;  3TZU A;  2VQF Q;  4IJL A;  1F2M A;  1VS0 A;  4F8M A;  1E24 A;  3NP8 A;  1EY8 A;  2E5L L;  3A5U A;  4KY7 A;  4JV5 Q;  3CRK C;  1CQV A;  1TKW B;  1LT4 D;  2KED A;  1JMC A;  4NXN L;  2VB2 X;  3KLS X;  5EGT A;  4DXG A;  1VQ6 A;  4DV6 L;  3AFQ A;  2NWG A;  3PO2 B;  5C4H A;  5JOB A;  1KTK A;  1A6X A;  1X55 A;  4YY3 Q;  2Z6K C;  2UU9 Q;  5A2Q E;  1L1O C;  1XX8 A;  1PFM A;  3FDT A;  4ZUI A;  2GVA A;  2OTJ A;  5I6Y A;  2WFW A;  1U5K A;  2E2I B;  4K14 A;  1G51 A;  2N49 A;  1XJV A;  1IL8 A;  4ZQ3 A;  3T53 B;  3GTO H;  4O42 A;  4IUR A;  4LF5 L;  1RJT A;  1IW7 C;  2XWB B;  2JA9 A;  4FF3 A;  2ZJR A;  2Z6K A;  1MD2 D;  1OXX K;  1H9K A;  1CTM A;  5LL6 S;  1EIH A;  1JWM D;  1A3U A;  3OIQ A;  3WDN A;  1VQ5 A;  1WCM H;  5KND A;  3H3V I;  3GTJ H;  1H9R A;  1FNU A;  3SK8 A;  4HMJ A;  5JAV A;  5M5Y B;  1A62 A;  3C1E A;  2F3W A;  3HOU H;  5M3F H;  4GNX B;  2EZV A;  1D1I A;  4X3K A;  5D3D A;  3TP7 A;  4CGY B;  2B39 A;  3HOY G;  1EIG A;  4DV2 Q;  2MPM A;  1D5M C;  1PH1 A;  2EYP A;  1V1Q A;  4YCU A;  2A73 B;  3CU7 A;  2DJF C;  5E7N A;  2I0Q A;  1ZXT A;  1JIC A;  4YCW A;  3QWN A;  5CV7 A;  5F2D A;  2F52 A;  1VQ9 A;  2JK8 A;  4JI1 L;  1PH4 A;  1NE3 A;  3K0Y A;  3N52 A;  1H95 A;  1PZJ D;  3HOY H;  3K5O A;  4A3J G;  1J5E Q;  4BWG B;  1PDQ A;  3FEW X;  1SEB D;  1MGS A;  4DR7 Q;  3CQZ B;  4LUZ A;  4B08 A;  2VUM H;  3AEV A;  1K0R A;  4A3F B;  4CKB A;  2H5X A;  1PYW D;  2A8V A;  1WTP A;  1HRJ A;  1Q8K A;  4AQY L;  4BY7 G;  2GA4 B;  3KLS A;  2JN4 A;  4K8J A;  1JB7 A;  1IBK L;  3TZD A;  1BCP F;  1QNK A;  2K50 A;  5M5X H;  3RLN A;  4A3J B;  4G4K A;  4B3T L;  4GKJ L;  2F03 A;  1KAA A;  4OL7 A;  1HA6 A;  5IGG A;  1Y8N B;  1B7Y B;  2CWA A;  2J0T D;  2PZU A;  1MIU A;  1F9Q A;  4K2L A;  5IT9 E;  1JT8 A;  1H9S A;  5ELN A;  4N8F A;  1I5F A;  4YHH Q;  1XPU A;  4ODG A;  2CQA A;  1W6K A;  3I70 A;  2Y0S G;  1DYQ A;  1X3Q A;  1CFM A;  4A3B H;  1JCK B;  3R8B A;  1TWH B;  2Y0S B;  1PFB A;  3NXW A;  1RKN A;  2K1B A;  5IP9 H;  1NTG A;  3SXH A;  3BZC A;  4FVM A;  4NKL A;  3TP8 A;  4KI0 A;  1BXT A;  1GOZ A;  1GUG A;  3NTK A;  4DV5 L;  2EXZ A;  2C5C A;  1PMR A;  2EOT A;  2F1M A;  4DNI A;  2GN5 A;  2A19 A;  1SSO A;  5JJK A;  3W1G A;  4X66 L;  3S1Q B;  2PNR C;  1WTR A;  2M2L A;  3CP0 A;  5IY0 A;  4V0B A;  1CA6 A;  1AH9 A;  1VQK A;  3K81 C;  4KY5 A;  3JAM E;  1ESR A;  1LT3 D;  4G7Z C;  4KN7 C;  3CME A;  2IJ0 A;  4FF2 A;  2GVB A;  1HFN A;  1D7Q A;  4C3J G;  1AFP A;  5ELO A;  2E2I H;  3K5N A;  4A3L H;  2IX0 A;  5CC4 A;  5IP9 G;  3H09 A;  5AJ3 Q;  1Z6H A;  3J7Z C;  1X54 A;  2O2L D;  1NCV A;  1X3E A;  4HAE A;  4IPG A;  3K5M A;  2PMZ E;  1VQ4 A;  2EYH A;  2NVY H;  5EPK A;  4ZK9 B;  2Z4I A;  3F1Z A;  3FRP B;  1RL2 A;  1JWU D;  3S2D B;  1HZC A;  4XIG S;  3S17 H;  1C48 A;  5IOD A;  2QF7 A;  1GXD C;  3M3Y B;  2MFI A;  1CQF A;  4GOP A;  1BDO A;  2WAC A;  4RKL A;  2XWJ B;  1JE5 A;  2JQO A;  4JG2 A;  1EU4 A;  1FL0 A;  1EFI D;  5IYC G;  2P5Z X;  2QGQ A;  1GJX A;  1FYC A;  4CKE A;  4O2D A;  2I5H A;  1HQR D;  2DNE A;  5FOB B;  2FXQ A;  3FKI G;  3GDE A;  4JCV E;  3ULL A;  1BCP B;  1FJG L;  2B8F A;  3LNN A;  4DF7 A;  4GOP C;  2F0W A;  4IPC A;  1SE4 A;  5LMN W;  4LNQ A;  3GO5 A;  1LAB A;  5E3F A;  2MP1 A;  2WKD A;  3PUW A;  4BBR H;  3I72 A;  1R9T B;  1QOH A;  3S1N B;  1CT1 D;  4ZLT F;  5M3M H;  3F2D A;  1F9R A;  1TY0 A;  1CZW A;  3AYH B;  3PO3 B;  1MHW C;  1VMC A;  4OEM B;  2NVY B;  2K75 A;  3VDY A;  3CD6 A;  5CV9 A;  1N36 L;  1LTR D;  1X3G A;  4AQY Q;  3MC0 B;  2SOB A;  1UE1 A;  4DR6 Q;  2F0E A;  1SE8 A;  1YIT A;  5GAG C;  3PIP A;  3VR2 A;  2F4V Q;  1RTO A;  2CCZ A;  2TSS A;  1X3F A;  2XGT A;  2WKC A;  1MJC A;  1NR4 A;  1DOK A;  3AMU A;  4YIJ A;  5ELC A;  1NMG A;  2R92 H;  1V9P A;  4RMF A;  3I4N H;  5IWA L;  1LLR D;  4FDB A;  4NXM L;  1FNV A;  4OEL B;  1AP0 A;  4TRD A;  1EZ6 A;  3VA5 A;  1WD0 A;  3C46 A;  1STA A;  2R93 B;  3OWF A;  1N34 Q;  1SFO B;  5LL6 X;  2KEC A;  5KIX A;  4B3R Q;  2Q2U A;  3H3V H;  3KF6 A;  5DM7 3;  2Z6B A;  1SXT A;  1Q86 C;  1LTI D;  3DWP A;  1EQT A;  2RHQ B;  1IBL L;  3KOJ A;  4LF6 Q;  4NB3 A;  3I4L A;  1I4Q A;  1F77 A;  2EY1 A;  4CJ2 C;  5IP7 G;  2UXB L;  1STB A;  4RCN A;  5L37 A;  1CSQ A;  3G4S A;  1NR2 A;  3CCV A;  1Y14 B;  2DY7 A;  2HUG A;  2FMC A;  2AQ1 B;  4QCL A;  3S2H B;  1GO3 E;  3S1M B;  1C0A A;  2J4X A;  1B3A A;  3T1H Q;  1K8M A;  2SDF A;  3CCR A;  3S14 B;  3MEF A;  1V1O A;  4X62 L;  4HJA A;  1SRO A;  1TT2 A;  3A8J E;  2F0D A;  3DLL A;  1TWA B;  3S15 B;  4DV4 L;  1H9M A;  2DJG C;  4GLA C;  5C0X J;  4DV0 L;  1BKB A;  3Q6S A;  1PLF A;  4OON A;  1L1O B;  3ZJY C;  5CV8 A;  3H15 A;  3UI2 A;  1EY4 A;  1KLG D;  1CKO A;  4QQB X;  5I4D A;  3EIV A;  4HTH A;  4C3I B;  1KL9 A;  4JI3 Q;  4IOC A;  2AWN A;  3CCE A;  1SNP A;  3A55 A;  1E3P A;  1LM0 A;  4DAV A;  3P1H A;  4CJ0 B;  1C4Q A;  5KYL A;  2EY6 A;  4DV7 L;  3CMA A;  2KQ3 A;  1HZ9 A;  3Q24 A;  2B2V C;  3IRB A;  3V2T A;  5LMU L;  1SYC A;  2KEN A;  1O78 A;  5KYI A;  1X3P A;  3L7Z C;  3I91 A;  3PGZ A;  2PCF B;  2YTX A;  1UEA B;  4GN3 B;  3S1M H;  1E1O A;  4XDX A;  1JOK A;  2V4D A;  2UXC Q;  2R6G A;  3GV6 A;  2KHS A;  2F0N A;  2UUB Q;  3T51 B;  2F0O A;  4IZ8 A;  1U0L A;  4A3K G;  4WJ4 A;  4GZY C;  3HOU B;  1PV4 A;  1EYG A;  1STH A;  1HQM C;  3HKZ G;  2RBM A;  3OTO Q;  4QUF A;  5M9O A;  1AN8 A;  2D2C C;  2ATW A;  2NVQ B;  3VR4 A;  3S2H H;  1HHV A;  3MXU A;  4RKB A;  4A3M G;  3S1Q H;  1KRT A;  1I6V C;  3TBI B;  1KD1 C;  3J80 L;  1QG7 A;  5JJI A;  1SJE D;  1I50 H;  3HOX B;  4LFA Q;  4QY7 A;  1VQA A;  3KBX A;  1IBL Q;  1XMO Q;  2A6E C;  4DKA C;  5FO9 B;  4Z9C B;  1RD9 D;  2RA4 A;  5J1Z A;  4KMU C;  5CYU A;  1FR3 A;  1CHP D;  2RSO A;  3QG1 A;  3GTJ B;  1WTX A;  2YU9 H;  4PMC A;  2E5L Q;  2KA7 A;  3OYY A;  5BN3 A;  4FXD A;  3ER0 A;  3NEN A;  4RHR A;  4DAY A;  1G6Z A;  3QO2 A;  1AE2 A;  4ZCK A;  1KRS A;  3MWY W;  2UUA Q;  5FLX c;  2IW3 A;  5KRU A;  3HOW B;  1CSP A;  1JJC B;  2MGS A;  2X6L A;  4KKT A;  5M3M B;  2PW7 A;  4DR2 Q;  1EWI A;  1TWG H;  4KJO A;  2X69 A;  2PNH A;  4KHV A;  2VQE L;  1CKN A;  1B9N A;  2VXW A;  1CUK A;  1O80 A;  2IPK D;  3CCQ A;  4MTK A;  1PTO D;  4OX9 L;  1P8L A;  1TS4 A;  1SBB B;  1YHA A;  1TWG B;  2CW0 D;  2MHV A;  3TS0 A;  4JI7 L;  1N32 Q;  3H0G H;  2UXD L;  1HR0 Q;  3I4N G;  2QKI C;  3A5Z B;  3SK6 A;  1G6P A;  2A69 D;  4A3I G;  4G7H C;  2AKW B;  1JJG A;  4LUO A;  1VDZ A;  2G9D A;  2G5D A;  1B2T A;  1OXV A;  4CDC C;  1GUT A;  1X65 A;  4HIO A;  4IJH A;  4LF8 L;  2MO0 A;  2HHH L;  4DAY B;  1BCP D;  1N8R C;  2KHJ A;  3OMC A;  3HG9 A;  1GVP A;  2L0C A;  4OXP A;  5C5M A;  1Y69 U;  3D31 A;  1L1O A;  5JJL A;  4DV1 L;  3OMG A;  4GLX A;  2JA6 H;  1PA6 A;  4PV1 C;  3D4W A;  4BBR G;  4A3C H;  1KC8 C;  3I73 A;  2M9V A;  2BOS A;  1K0S A;  2VUM G;  4N8X 1;  1DOM A;  5C4X G;  1NY4 A;  4DR6 L;  4OWX B;  3D3R A;  2VZA A;  1QWY A;  3I90 A;  3PO3 H;  2Q8T A;  4DV3 L;  3KLW A;  5IYC H;  5GQO A;  1EEI D;  3D6C A;  4MTN A;  3Q22 A;  1I94 Q;  4UP9 A;  1QVG A;  3P20 A;  2F0I A;  3TP5 A;  4HCE A;  2HIV A;  4XYO A;  1Q3L A;  1LUZ A;  1IYU A;  1HR0 W;  1NUC A;  2DGY A;  3MXP A;  5AJ3 L;  2CH4 A;  2MO1 A;  4DAM A;  3J7A V;  1D2B A;  2WAQ B;  4YWM A;  4OO1 H;  3AB9 A;  5JVG 3;  3KF8 B;  3HOZ H;  4MNO A;  1FGU A;  5J39 A;  5J3B A;  4PG3 A;  3MXG A;  5JVH 3;  5FLM H;  5EAY A;  1C8C A;  1IXR A;  4LF9 L;  2LMC B;  2B63 H;  3K58 A;  1AZQ A;  1MSG A;  1PTO F;  2NN6 I;  1EIY B;  1Z9F A;  1XXG A;  1TS2 A;  2L55 A;  3M4O B;  4A75 A;  3HOZ G;  1YJ9 A;  1OXT A;  3V96 A;  4JI4 Q;  1YHB A;  4RCO A;  4TSS A;  4A4I A;  2CH4 W;  2X6G A;  2CFM A;  1AEX A;  5IIF A;  5M5W B;  1F2Y A;  3EJI A;  3NEM A;  4IO9 A;  2A5H A;  2AMC B;  3E5S A;  4KHZ A;  2PZT A;  4KHP Q;  2D5D A;  1FNW A;  3H0G B;  4HR7 B;  4E6I A;  1EOV A;  3K5L A;  1ET9 A;  1HR0 L;  2HCC A;  3CCS A;  2XIW A;  4HIM A;  5C4X H;  2KCN A;  5G3L F;  1L2F A;  1MKH A;  1PTO C;  1SDF A;  1XNQ Q;  3CQZ H;  3DM3 A;  5IE8 A;  3PUV A;  1SYD A;  1Y1W B;  5C44 B;  4LFC Q;  4DR1 L;  5CBE E;  4XXE A;  4X64 Q;  3M7N A;  5C0X G;  3BJU A;  1BVS A;  5C3X A;  4L5R C;  3OWE B;  1HNX L;  4JI6 L;  1VQH A;  2RHS B;  2E2J H;  2WV6 D;  5JEA G;  4DA2 A;  1IKM A;  5EJW A;  4OIJ A;  1UNS A;  2EDG A;  3A8I E;  3RZD B;  3ERO A;  4LW1 A;  5A35 A;  5ELF A;  1RTN A;  3U4Z A;  3URY A;  5I2X A;  2K05 A;  5T1I A;  1SJH D;  3CXC A;  1YNJ C;  4LFB Q;  1X9N A;  1SNC A;  2YV5 A;  1LYL A;  4JBK A;  4IFD J;  4DR5 L;  3G48 A;  4P2C B;  2D0O A;  5K36 H;  4GKK Q;  1PFS A;  3GTQ H;  1EY7 A;  4AYB E;  1KXL A;  1STN A;  1WTW A;  1QJO A;  2CKZ B;  2CWP A;  1ONL A;  3LGJ A;  4GKJ Q;  4RAU C;  2BH8 A;  3CKI B;  2AQ3 B;  3P75 A;  5C4J H;  2BDO A;  3U4V A;  1PFN A;  1KIX A;  2EJF C;  3KJP A;  4NXM Q;  4IUT A;  3MXN A;  1T5E A;  3PV0 A;  4Q0F A;  4ULL A;  2QDL A;  3PO3 G;  5EKK A;  2WIN B;  2KUM A;  4ZRZ A;  4JI4 L;  3D0F A;  1PZK D;  3TP6 A;  1LT5 D;  3JAM i;  4C3I H;  2O4X A;  1UAP A;  1VQE A;  3O13 A;  4C3J H;  2K14 A;  1WCM G;  1PH9 A;  1S40 A;  4OGQ C;  4DK0 A;  5FJ8 G;  2NZH A;  1G8Z D;  1WTV A;  1D8L A;  5EKI A;  2C35 B;  2E76 C;  1BOS A;  1SNM A;  1UE7 A;  4DUY Q;  1I94 L;  4UY8 C;  2K32 A;  4LFA L;  1DOL A;  4JI5 Q;  2J7Z A;  2K5V A;  4A3I H;  1Q8I A;  1U4P A;  2C9O A;  3TRE A;  4KLK A;  1A63 A;  5EPL A;  4PNY A;  3TN2 A;  2F0G A;  5D14 A;  1HTL D;  2ES2 A;  1OXU A;  4LWC A;  1C9O A;  1Y1V B;  2HQL A;  2JYO A;  3ERQ A;  2ZXR A;  1V1P B;  4ZAI A;  2UXC L;  3H94 A;  3HS0 C;  2NYZ D;  4POF A;  4CJ1 B;  2VQE Q;  3LWE A;  4UP7 A;  2A68 D;  2WII B;  4CKC A;  1BQQ T;  3KF8 A;  1G91 A;  2NZO A;  3F2U A;  3R93 A;  1FD7 D;  3HOV G;  1EFW A;  5IYB G;  4DV7 Q;  1H9S B;  4X3T A;  1ESF A;  3GTO B;  4K6D A;  2B2W A;  5FLX E;  3KDF A;  1ENA A;  4TKO B;  1NBW A;  1YZ6 A;  2KBN A;  4MN3 A;  2QEX A;  3B6Y A;  3NE5 B;  4ZKC B;  4BA1 I;  3W3A A;  1XNR Q;  5IYB H;  5LMN Q;  2TMP A;  4PMB A;  1EUJ A;  3WWV A;  3KUP A;  1E1T A;  3IFD A;  1F9S A;  4FYD A;  2OTL A;  1W6J A;  4JV5 L;  4RGO S;  3VYR A;  3RMH A;  4KN4 C;  4C3H B;  2CQO A;  2FJ2 A;  3QR8 A;  3GV3 A;  1V1P A;  4K0K Q;  3MA2 B;  1D5X C;  1YNN D;  2NZ1 D;  3PSI A;  3LX0 A;  1LTL A;  4ME3 A;  4R4T A;  5BR8 Q;  1R4Q B;  1B3Q A;  3T4A C;  1DM0 B;  2UUB L;  1ENF A;  1EQQ A;  3NUC A;  1U4M A;  1JE4 A;  3OHX C;  3HOU G;  2A68 C;  3CRL C;  5I2Y A;  4U68 A;  4CDF C;  2KOL A;  2F0J A;  2F0H A;  3BDO A;  4DV2 L;  1Q1E A;  3I3C A;  5DAU A;  5IT9 c;  2IWH A;  2A6E D;  4A93 B;  4HJ9 A;  4A76 A;  3RUZ A;  1TII D;  4C3H H;  3NQI A;  4V19 0;  2UUC Q;  2B29 A;  1LTB D;  2KEE A;  3M4P A;  4JI3 L;  1KDC A;  1YNJ D;  1KLU D;  2B3G A;  1EYC A;  1LTA D;  4DN4 M;  1SYF A;  1J8I A;  1N9W A;  1TWF B;  2JA5 B;  3RLO A;  2F0F A;  1Y1W G;  3T1Y L;  4XTC S;  1UE5 A;  4XT3 B;  1YHQ A;  3RZD H;  3I4M B;  2KCM A;  5KGU A;  3H3V C;  4DV4 Q;  5M5Y H;  1EY6 A;  1EL0 A;  1HFG A;  2NN6 H;  4Y7N B;  2AWO A;  1KQS A;  2CVR A;  5LHY 1;  5C4Z A;  3IL8 A;  1QE6 A;  4DNT B;  2K5D A;  1GHK A;  3VR3 A;  2LFN A;  2NB0 A;  1SN8 A;  3DUZ A;  3S16 B;  1I4P A;  4LJZ C;  4PZ8 A;  5HUR A;  1MI2 A;  1JWS D;  1CKN B;  1WD1 A;  1JOR A;  3SK4 A;  4K2K A;  4OO1 I;  4LF4 Q;  3SVM A;  1VQ7 A;  1VQF A;  3C3L A;  1Q7Y C;  1I3Q H;  3FKI H;  3VYT A;  1BR9 A;  3HP3 A;  3AQQ A;  1Q1B A;  1R9T H;  4R4I A;  2KJX A;  1LAC A;  1B9M A;  4A3K B;  2A6H C;  5ELB A;  2Q8I B;  3OW2 A;  3NK9 A;  3OTO L;  4HJ8 A;  1KNA A;  4QUC A;  1SND A;  3K7U C;  1K8G A;  2JA6 B;  2L11 A;  2Z9H A;  4JI8 Q;  2RDH A;  2B2V A;  2O5J C;  1HTP A;  5BN5 A;  4KD3 A;  1KNE A;  2K7V A;  4IFD H;  4TQU S;  3FPP A;  3NPP A;  2KCT A;  4A3G B;  3J7A F;  1TVX A;  5EBC A;  3GTM B;  2HDL A;  2RCN A;  3QIA A;  1PH6 A;  2WAQ E;  2VY3 A;  5CGK A;  1TWA H;  4JI6 Q;  4A3D G;  2RDF A;  4K0K L;  1UE6 A;  1II3 A;  3SR1 A;  3T1Y Q;  3EVQ A;  3E9H A;  3OW7 A;  2L1B A;  1S72 A;  3BVG A;  4DR1 Q;  5TSS A;  5KNC A;  3RLF A;  4LF8 Q;  4NMZ A;  3OSO A;  2N3S A;  2KCC A;  1PXU A;  5IGE A;  4ME5 A;  1L0W A;  3ULP A;  4B3M Q;  5FK9 C;  4GKK L;  2QDB A;  3GTQ B;  1S3O A;  4A3G G;  1XPO A;  1TWC B;  2IT1 A;  1QCB D;  3WOF A;  1V43 A;  2L4N A;  4IQZ A;  2SEB D;  4PZ7 A;  4NPS A;  1LTS D;  5C4J B;  3J80 i;  1E2Z A;  4HIK A;  1I4X A;  3KDF B;  4DK3 C;  4KHP L;  2R7D A;  1F2L A;  3GTK H;  1B8A A;  1GHJ A;  1SE2 A;  3QOL A;  4NW2 A;  4BXX G;  2F4I A;  1K83 H;  4A3I B;  2DUD A;  2OXP A;  3R2I A;  1NNX A;  5HGT A;  5C44 G;  3BZD B;  3PQI A;  1X6O A;  4OO1 G;  4MHE A;  5ELD A;  3NQT A;  2K5N A;  3VYS A;  2G9H D;  4APV A;  3RZO B;  2OF1 A;  3HRZ C;  4H44 C;  4IN3 A;  1N36 Q;  4O1N A;  1F9P A;  3J81 E;  4L6T B;  1VQO A;  4JK1 C;  2Q2H A;  1Y1V G;  3CPW A;  2Z1C A;  3BDC A;  3M85 A;  3STB D;  4LMQ D;  2YYZ A;  1VQD A;  4BXX H;  4A3L G;  3I4M G;  3VR6 A;  3NWT A;  2XNA C;  1Y8O B;  4ILW A;  4HJ5 A;  2PI2 E;  2E2H H;  4DV6 Q;  3S24 A;  1EY9 A;  4C3J B;  3GTP H;  4HED A;  3FHW A;  4RHS A;  1I4R A;  2YTY A;  3RR5 A;  4C2M B;  4IPD A;  2I07 B;  5IYD H;  3N6R A;  1H9J A;  4J8Q A;  2AHO B;  3VYU A;  4A93 G;  3M4Y A;  3CHB D;  1VQL A;  2RKS A;  1WOC A;  1ET6 A;  4BY1 H;  5IYD G;  3NTH A;  4EGV A;  1Z7T A;  3I4O A;  1LT6 D;  2LSS A;  4WJW A;  3ZYY X;  4JPB W;  4PMW A;  1PH5 A;  2K03 A;  2IX1 A;  5CMD A;  2JA7 G;  3J81 i;  5M3F G;  4Y52 H;  3QOJ A;  3MFG A;  5LMU Q;  4R4O A;  4J15 A;  2B63 G;  1S4Z A;  4IUQ A;  5GAE C;  4LK1 C;  2IHF A;  4A3D H;  1ENC A;  1STG A;  1O7L A;  4DUZ L;  2ID0 A;  1BBW A;  4HMI A;  4JI5 L;  1E22 A;  4RG1 A;  4LF6 L;  4KKS A;  2Z0S A;  1HH2 P;  1J9O A;  1ICF B;  4IFD G;  2IY5 B;  2JA7 H;  1S5F D;  5NUC A;  1KDA A;  3TEH B;  1FVI A;  2PZW A;  3PF4 A;  4DV0 Q;  4ID6 A;  2UXD Q;  1L0X B;  1XPR A;  5HGQ A;  3MTS A;  4KY6 A;  4CDE C;  2F0S A;  5JJZ A;  1I6H H;  3D4D A;  4LFB L;  4OWT B;  1JJ2 A;  5FKA C;  5C5L A;  2QIL A;  1WTQ A;  3U58 A;  1SE3 A;  1WI5 A;  3GTK B;  1M90 C;  3HEJ A;  3TME A;  1CM9 A;  3EN2 A;  4J6H A;  1HA5 A;  1IBM Q;  1WTO A;  2L12 A;  2UUA L;  3D6W A;  4JI0 L;  2F0M A;  2A6H D;  2H4O A;  5FLM G;  4OWW B;  2UU9 L;  4YHH L;  5I6W A;  1XMQ L;  1JOQ A;  4PQX A;  4H13 C;  1GUS A;  4QF4 A;  1TWC H;  1VQJ A;  1A0I A;  1SMX A;  1D5Z C;  5GAH C;  1QVF A;  3I4M H;  1TWH H;  3H91 A;  4WJ3 M;  1CA5 A;  1VF7 A;  2UXB Q;  2EE1 A;  3BYY B;  4HSV A;  1SFO H;  5FLX L;  3UDI A;  1VQG A;  4NXN Q;  1K3B C;  1P16 A;  3X3M A;  3MHB A;  3R3O A;  1B44 D;  1R4P B;  3GD7 A;  2ZXO A;  2EY2 A;  1OXS C;  4DR5 Q;  1JC7 A;  1Q90 A;  5CR3 A;  4EX5 A;  1BCP C;  2WP8 J;  4X3U A;  3S1R B;  1Q46 A;  4JBM A;  1VQC A;  1FGB D;  4A93 H;  3J80 E;  1E7Z A;  1EU3 A;  3DHQ A;  3K57 A;  2B2Y C;  1FJG Q;  3A7A B;  4UPA A;  1I4G A;  5C44 H;  1XWE A;  2L5T A;  5K36 G;  3CC2 A;  5COR A;  2JEB I;  4FO2 A;  4JI2 L;  4MIU A;  2XRQ D;  3I2Z A;  1HNX Q;  2BA1 A;  4XQN A;  2WB1 E;  4K6L A;  3GTG B;  2ICE C;  2JXM B;  1F2Z A;  2F0K A;  1K28 A;  2EPB A;  1K3R A;  3KBG A;  4LFC L;  4B9W A;  2B2Y A;  1I50 B;  1BUV T;  4ALP A;  4JYA Q;  1K8O A;  4JI1 Q;  2VS1 A;  2ZJP A;  2FFK B;  1IYJ B;  4J1M A;  2EYF A;  3LWU A;  3QB3 A;  1KAW A;  4A3F H;  2EQS A;  1U4L A;  1WYD A;  1TU2 B;  1XNR L;  2O5I C;  2ALY B;  2Z4H A;  4X3S A;  4DPG A;  3TRZ A;  4IUV A;  1PTO B;  2K04 A;  3F2C A;  5C6A A;  3C2P A;  4XQQ A;  1NSN S;  1X32 A;  2A74 C;  2QEJ C;  2PMZ B;  1E0B A;  3SK5 A;  1TR5 A;  1EWC A;  4RH6 A;  3FPU B;  1UUP A;  1LTG D;  5D65 A;  4Y7N H;  3I8Z A;  3S2D H;  1BBX C;  3K6O A;  5IT9 L;  4IUP A;  2NVT B;  1EQV A;  5KNB A;  3A54 A;  4AYB B;  3ERS X;  5C3E H;  3G6J B;  3STB C;  1XTD A;  3TSS A;  4A3B B;  4C1N K;  1W3S A;  4S3S A;  3DXJ C;  1JR0 D;  4Q5V A;  2LY7 A;  1PRT C;  2OEO A;  2LKV A;  5CV6 A;  1QZH A;  3PIO A;  3TS2 A;  4U67 3;  1J6Q A;  3PUZ A;  3A56 A;  2PO4 A;  3KJO A;  1AW7 A;  2F0P A;  3E0E A;  5C3E G;  3ITP A;  3SHL A;  3J81 L;  1GUO A;  3ND8 A;  3T1H L;  3M4Q A;  4L63 B;  2HHH Q;  2I5L X;  2VB3 X;  4H0L C;  2JA7 B;  2B2U A;  3U9O A;  4F88 A;  4YY3 L;  4NDX A;  1STY A;  5FO7 B;  4YCV A;  4K5V A;  2N88 A;  1ASZ A;  5C4X B;  1QUQ B;  1WVL A;  1CHQ D;  3EQL C;  4JOI C;  1A8V A;  5JPN C;  4ZUJ A;  1DXM A;  1VQB A;  3BZK A;  1HJP A;  1RHP A;  5C3W A;  4R8I A;  4LF7 Q;  4LF5 Q;  3UE0 A;  4P74 A;  3UE1 A;  1LV9 A;  3A0J A;  2XSC A;  2JA5 G;  3G7L A;  3BU2 A;  2KVM A;  5JEA J;  2PQA A;  1OO9 B;  2N55 A;  3GQB A;  4BBS B;  4X65 L;  4JOI A;  1WFQ A;  3PO2 G;  2SNS A;  1T9H A;  3UDG A;  1EOT A;  1S5C D;  4JI2 Q;  1VQM A;  2R93 G;  2BCO A;  1HZA A;  4WOR A;  4HJ7 A;  4JC0 A;  4M1U B;  3BVM A;  1EY0 A;  1YEZ A;  4B9X A;  1SRU A;  3OOC A;  3NEL A;  4A3C G;  4BS9 A;  1N33 Q;  3BG3 A;  1G2T A;  3IKJ A;  4ZKB B;  1SYE A;  5IGB A;  2LXJ A;  1RIP A;  4JI8 L;  1PRT D;  1BBU A;  2F3I A;  2DNC A;  5LMN L;  3HOZ B;  3EFX D;  1DZ1 A;  3J81 j;  1STE A;  2DN8 A;  3BDL A;  3A7L A;  5IP7 H;  3HOW H;  2NN6 G;  2AUK A;  2NVX H;  1IL2 A;  2V1C C;  2JE6 I;  1DD2 A;  1EEF D;  2BE5 D;  2I46 A;  4QL5 A;  2HD3 A;  4R1J A;  1HNW Q;  3E6Z X;  2CW0 C;  2Y0S E;  4BBS G;  3KLR A;  3RZO H;  4EQO A;  2H1E A;  2RDG A;  4GN5 A;  1Q82 C;  2Z8L A;  4R8N A;  4TVA B;  1EYA A;  2Q8R E;  3KYH C;  3CCL A;  5CV4 A;  1M4V A;  2OQ0 A;  3HOX G;  3HFZ B;  4PZ6 A;  2QA4 A;  1YJW A;  2FHT A;  5IOC A;  3UDX A;  1A3T A;  1CKM A;  1RF2 D;  4P71 A;  5C3E B;  4QIW E;  3UDF A;  1GM5 A;  2R92 G;  2R61 A;  5G3L D;  4B3S L;  3L9A X;  1PTO H;  1HUM A;  5M3F B;  3AFP A;  3I55 A;  3A8K E;  3CCU A;  3G6E A;  3CW2 C;  3RNU A;  1Q81 C;  4JBJ A;  4ZYS A;  4BBS H;  4I65 A;  3A74 A;  3M7G A;  4FP5 D;  1ZEQ X;  1ILQ A;  3E9I A;  4BBR B;  3HOV B;  2PYK A;  3KF6 B;  4DR3 L;  3HKZ B;  4A3K H;  1XYI A;  2E75 C;  1AE3 A;  1PHJ A;  3JC6 6;  4BY1 B;  1IZ6 A;  1JB3 A;  2LXK A;  4DUY L;  5AFW A;  4JYA L;  3I56 A;  3DWQ A;  4P73 A;  4AYB G;  2NTT A;  2VL6 A;  2OWO A;  3J81 c;  2E8G A;  3BS1 A;  4IOA A;  3T56 B;  5I9O A;  2E2H B;  2XTI A;  4G7O C;  3S16 H;  5T1G A;  4KV6 A;  2K5W A;  3T13 A;  1HUN A;  2NTS A;  2R7F A;  4HN7 A;  1O7Z A;  2L9H A;  4FNF A;  3DWA A;  3S1R H;  2F0T A;  3ONA B;  3M4O H;  5E1F A;  4YWL A;  5GAD C;  2OCE A;  1ICW A;  1SLJ A;  3MZ5 A;  4K8I A;  5A2Q L;  2HT1 A;  1L0Y B;  2QCP X;  4QMG A;  3G71 A;  3S15 H;  1B70 B;  2PQA B;  4LUV A;  2OQK A;  2EVB A;  5D3I B;  2FIN B;  4GLV B;  1EIF A;  1WTH A;  1Z47 A;  4EQP A;  2LS0 1;  5M3M G;  1PH8 A;  1PRT F;  5H1S E;  2EYL A;  2ZT9 C;  5FJ8 H;  4RGN A;  2BH2 A;  2R92 B;  3TDQ A;  1RCV D;  4UAI A;  4B3M L;  1CI3 M;  2R3Z A;  4IPH A;  3MEH A;  4R4C A;  3L3O C;  2RF4 A;  4B3R L;  2R93 H;  2K01 A;  1TS5 A;  4OX9 Q;  4EVO A;  3IFT A;  1SYG A;  2F0V A;  1DJR D;  2RCF A;  2ZJQ A;  3C1F A;  1IBK Q;  4A3E G;  1B53 A;  3CC4 A;  1A2T A;  1A2U A;  1VMP A;  3CC7 A;  1EZ8 A;  5E4W C;  4N9T A;  2BE5 C;  1IW7 D;  1VF5 C;  4R9W A;  3AU7 A;  3I7F A;  1HZB A;  3EBE A;  3FP9 A;  3V05 A;  5IGC A;  1IBM L;  3PUY A;  1QVC A;  3SDZ A;  1ZKO A;  3BVZ A;  2EXD A;  1QNU A;  1VQ8 A;  5J22 A;  3CCM A;  4A3M B;  4OIK A;  3E3X A;  2CHB D;  4FF1 A;  4A3D B;  4M8A A;  1BO0 A;  2BDN A;  5C0X I;  5K5P A;  4GS3 A;  3IAY A;  3DEO A;  1G29 1;  1QZG A;  1SAP A;  3RN5 A;  3W5O A;  3VR5 A;  2I5M X;  4A3J H;  4GNX A;  1TQO A;  1LTT D;  1WJJ A;  5M5W H;  3X3N A;  1XMO L;  3D8G A;  4BA2 I;  4A3G H;  3HGB A;  1O7Y A;  2EJG C;  3CAM A;  4F7X A;  4MZ9 A;  3NBI A;  4KK7 A;  4LAA A;  3RD4 A;  3MFY A;  1YBY A;  4YWK A;  5C0X H;  2ZM6 L;  3S1N H;  1DCZ A;  5FO8 B;  1YNX A;  5ISR A;  4DV3 Q;  4DR4 Q;  1W2B A;  1GKH A;  2B2W C;  2JSO A;  2XVS A;  2K5H A;  5JPM C;  1MJE A;  4KTA A;  3HOY B;  2HIX A;  4FXK C;  3F8T A;  3MXN B;  1TY2 A;  4IAL A;  3J7A 5;  4KD4 A;  2HDM A;  2VUM B;  1SNO A;  2B2U C;  4UP8 A;  5IGF A;  4K5W A;  1CZG A;  3NBH A;  1DGS A;  4HSP A;  4CBV A;  5EQ0 A;  3CF5 A;  4DR3 Q;  3K59 A;  1I6H B;  3K7A B;  2SNM A;  3RN2 A;  4NP5 A;  1T5X D;  2D62 A;  4AH6 A;  1NJI C;  2YU9 B;  4JVZ A;  2NVT H;  2HCI A;  4JBW A;  4LF4 L;  1GUW A;  1HNW L;  1EYD A;  4XT1 B;  1ROD A;  1KAB A;  2JEA I;  3J7Y W;  2PQE A;  2DY8 A;  2N8N A;  1K83 B;  3K7A H;  3DEP A;  1A15 A;  3K0X A;  4XYQ A;  3J80 c;  1S5E D;  1MBY A;  3P7J A;  4C56 C;  2L15 A;  1M8A A;  4GNX C;  1S5D D;  2K52 A;  1XTC D;  5BR8 L;  2XN9 C;  3I4N B;  2NVX B;  3SE0 A;  4DV1 Q;  1JQY D;  4N9P A;  2EY5 A;  2YTV A;  2ZM6 Q;  4LF9 Q;  2K5Q A;  1C7Y A;  2AUJ D;  4OHJ A;  4C2M H;  1KHI A;  5DNF A;  4DR4 L;  5COY A;  1IKL A;  3KFU A;  4IUN A;  3NWS A;  2RSN A;  1S5B D;  3CPF A;  3FVQ A;  4I7Z C;  1PZI D;  4K5X A;  2JP1 A;  1IYV A;  4A3E H;  2A1A A;  5DEH A;  3W2D A;  1SYB A; 
#chains in the Genus database with same CATH homology
 3GTG H;  4O2D A;  3HOW G;  2I5H A;  4JI4 L;  3D0F A;  3PF5 A;  2FXQ A;  3FKI G;  3GDE A;  4JCV E;  3ULL A;  1FJG Q;  3JAM i;  3ICE A;  4C3I H;  4UPA A;  5C44 H;  1FJG L;  2ZTD A;  4IFD I;  3CC2 A;  5K36 G;  1M1K C;  2JEB I;  1VQE A;  4JI2 L;  4GOP C;  3I2Z A;  1HNX Q;  2BA1 A;  2WB1 E;  4IPC A;  4C3J H;  2K14 A;  4X66 Q;  5LMN W;  4LNQ A;  1UEB A;  3GO5 A;  1WCM G;  1PH9 A;  1S40 A;  1UWV A;  3PUW A;  4BBR H;  1PH2 A;  1K3R A;  5FJ8 G;  2NZH A;  4DR2 L;  4LFC L;  4GOP B;  1D8L A;  1XMQ Q;  5M3M H;  3F2D A;  2C35 B;  3JAM c;  2BA0 A;  4L5Q A;  3AYH B;  1VQN A;  4A3M H;  4ALP A;  1UE7 A;  1I94 L;  4DUY Q;  1HNZ L;  4UY8 C;  4JYA Q;  4JI1 Q;  3L0O A;  2VS1 A;  2ZJP A;  4LFA L;  2K75 A;  4JI5 Q;  3VDY A;  1IYJ B;  3CD6 A;  1N36 L;  3GTM H;  1X3G A;  4AQY Q;  2WB1 G;  1KAW A;  1UE1 A;  2K5V A;  3K80 C;  4A3I H;  2EQS A;  4A3F H;  1YIJ A;  4DR6 Q;  1WYD A;  5HY6 A;  1SE8 A;  1YIT A;  1XNR L;  2ALY B;  5GAG C;  4DPG A;  3PIP A;  3S14 H;  3TRZ A;  2F4V Q;  2CCZ A;  2NVQ H;  1X3F A;  2XGT A;  3F2C A;  3TRE A;  4KLK A;  1A63 A;  4B3T Q;  1MJC A;  1X56 A;  3U50 C;  1NMG A;  2ES2 A;  2R92 H;  1OXU A;  4LWC A;  1V9P A;  4RMF A;  3I4N H;  1YJN A;  3SGI A;  1C9O A;  5IWA L;  4FDB A;  2HQL A;  2MNA A;  4NXM L;  4A3B G;  4X6A H;  2UXC L;  3HOX H;  4POF A;  2VQE Q;  4JI7 Q;  2Q2T A;  4UP7 A;  4Y7N H;  3PCO B;  1N34 Q;  3S2D H;  1NMF A;  2JA6 G;  4QJF A;  4B3R Q;  2NZO A;  2Q2U A;  3H3V H;  3KF6 A;  3ERS X;  1Y1V H;  1K9M C;  3HOV G;  1EFW A;  5IYB G;  5C3E H;  3STB C;  1XTD A;  4DV7 Q;  3NBH B;  4BY1 G;  1GD7 A;  1W3S A;  1Q86 C;  4DR7 L;  1TXY A;  1IBL L;  2RHQ B;  3KOJ A;  4LF6 Q;  2D0P A;  1Y1W H;  4NB3 A;  3KDF A;  1QZH A;  4P75 A;  4O0A A;  1PYB A;  1NBW A;  1YZ6 A;  4EQ5 A;  3PIO A;  2JA5 H;  5IP7 G;  1J6Q A;  3PUZ A;  4JI0 Q;  3TS2 A;  2UXB L;  3KJO A;  2KBN A;  3E0E A;  3ULJ A;  2QEX A;  3B6Y A;  4BY7 H;  2ZTE A;  4BA1 I;  4X64 L;  1XNR Q;  5IYB H;  5C3E G;  5LMN Q;  1EUJ A;  3Q8D A;  1CSQ A;  3G4S A;  1EQR A;  3WWV A;  3CCV A;  1Y14 B;  3T1H L;  3M4Q A;  1E1T A;  1C0A A;  1GO3 E;  2I5L X;  2HHH Q;  1J5E L;  3T1H Q;  4YY3 L;  3H0G G;  2OTL A;  2ASB A;  4JV5 L;  4X62 Q;  4YCV A;  3CCR A;  3MEF A;  1ASZ A;  3TQY A;  4X62 L;  4HJA A;  2CQO A;  1QUQ B;  1SRO A;  4JOI C;  1A8V A;  3DLL A;  3M3Y H;  1VQB A;  3BZK A;  3PO2 H;  2N78 A;  3CCJ A;  3HOV H;  1HJP A;  4K0K Q;  3L2P A;  4DV4 L;  4LF7 Q;  4LF5 Q;  1SR3 A;  3PSI A;  3UE0 A;  4GN4 B;  3HKS A;  4GLA C;  4P74 A;  3UE1 A;  5C0X J;  4DV0 L;  1BKB A;  2JJQ A;  1OTC A;  1LTL A;  4ME3 A;  3A0J A;  4OON A;  1L1O B;  4R4T A;  1O7I A;  3ZJY C;  2JA5 G;  3BU2 A;  5BR8 Q;  3H15 A;  5JEA J;  1Q12 A;  1CKO A;  2PQA A;  4QQB X;  3EIV A;  4B3S Q;  1KL9 A;  4X65 L;  2UUB L;  4IOC A;  4JI3 Q;  4JOI A;  4QGU A;  1WFQ A;  2AWN A;  3CCE A;  1EQQ A;  3PO2 G;  1T9H A;  3HOU G;  3UDG A;  1E3P A;  1LM0 A;  4JI2 Q;  1VQM A;  2R93 G;  1PYS B;  4DK6 C;  1HZA A;  4HJ7 A;  4JC0 A;  1VQI A;  4DV7 L;  3CMA A;  1N33 L;  1YEZ A;  4DV2 L;  1K73 C;  1Q1E A;  1SRU A;  1HZ9 A;  3HKZ E;  3IRB A;  3NEL A;  5LMU L;  2WAQ G;  2KEN A;  4A3C G;  5IT9 c;  1N33 Q;  1VQP A;  1HNZ Q;  5GRO A;  1VCI A;  3L7Z C;  1ASY A;  3PGZ A;  1PH7 A;  2YTX A;  4HJ9 A;  4GN3 B;  4A76 A;  4C3H H;  2LXJ A;  3S1M H;  1E1O A;  1RIP A;  4JI8 L;  1PVO A;  2KHI A;  1QUQ A;  1BBU A;  2F3I A;  2UUC Q;  2B29 A;  2UXC Q;  2R6G A;  5LMN L;  3M4P A;  4JI3 L;  4X65 Q;  3J81 j;  2UUB Q;  2B3G A;  4L5T A;  1K8A C;  2UUC L;  2VNU D;  4POG A;  1U0L A;  3GTL H;  4A3K G;  4WJ4 A;  5IP7 H;  3HOW H;  2NN6 G;  1YVC A;  4L5S A;  4A3F G;  1N9W A;  1PV4 A;  1EYG A;  2NVX H;  2V1C C;  3RLO A;  2JE6 I;  1IL2 A;  1Y1W G;  3T1Y L;  3HKZ G;  3OTO Q;  4XTC S;  1UE5 A;  1YHQ A;  4P72 A;  4QL5 A;  3RZD H;  1VQ9 A;  4R1J A;  2KCM A;  1HNW Q;  4HID A;  1XNQ L;  4DV4 Q;  4LF7 L;  5M5Y H;  2ATW A;  2R7Z H;  2K4K A;  2Y0S E;  4BBS G;  3S2H H;  3S1Q H;  4R4Q A;  3M9B A;  1TWF H;  4A3M G;  1KRT A;  1KD1 C;  3RZO H;  2AWO A;  5JJI A;  1Q82 C;  4GN5 A;  1KQS A;  4TVA B;  1I50 H;  4LFA Q;  2ZTC A;  4QY7 A;  1VQA A;  1N34 L;  3KYH C;  5DLQ E;  1IBL Q;  3CCL A;  2JA8 H;  3W1B A;  1XMO Q;  4DKA C;  1N32 L;  2IHE A;  1SN8 A;  2OQ0 A;  3HOX G;  3HFZ B;  4PZ6 A;  2QA4 A;  4DV5 Q;  2PI2 A;  4PZ8 A;  1YJW A;  2MQH A;  3UDX A;  1CKN B;  2VQF L;  1CKM A;  2R92 G;  4P71 A;  4QIW E;  3UDF A;  1GM5 A;  4DUZ Q;  4OO1 I;  4LF4 Q;  1VQ7 A;  4B3S L;  2YU9 H;  1VQF A;  1Q7Y C;  1I3Q H;  2JA8 G;  2E5L Q;  3OYY A;  3FKI H;  3AFP A;  5IWA Q;  3I55 A;  4AIM A;  1YI2 A;  3CCU A;  2VW9 A;  3K8A A;  3AQQ A;  1Q1B A;  3G6E A;  1R9T H;  3CW2 C;  3RNU A;  4R4I A;  3PUX A;  3ER0 A;  3NEN A;  1Q81 C;  4H02 A;  4JBJ A;  2R7Z G;  4BBS H;  3A74 A;  1AE2 A;  1KRS A;  2EIF A;  1PH3 A;  2Q2I A;  5FLX c;  3F2B A;  2UUA Q;  3OW2 A;  2F4V L;  3OTO L;  3E9I A;  4HJ8 A;  1CSP A;  1JJC B;  3K7U C;  1K8G A;  2VQF Q;  3KF6 B;  4JI8 Q;  4DR3 L;  4A3K H;  4IJL A;  4DR2 Q;  1EWI A;  1AE3 A;  1VS0 A;  1PHJ A;  1E24 A;  3JC6 6;  2E5L L;  3A5U A;  1TWG H;  4TQU S;  4JV5 Q;  2PNH A;  1IZ6 A;  2KCT A;  2LXK A;  2VQE L;  1CKN A;  4DUY L;  4JYA L;  1JMC A;  3I56 A;  2RCN A;  4NXN L;  1CUK A;  4P73 A;  3CCQ A;  1PH6 A;  2WAQ E;  4AYB G;  4OX9 L;  1P8L A;  2VL6 A;  2VY3 A;  4DV6 L;  1YHA A;  2OWO A;  1VQ6 A;  1TWA H;  3AFQ A;  2E8G A;  3J81 c;  3TS0 A;  4JI6 Q;  4JI7 L;  4A3D G;  1N32 Q;  4IOA A;  4K0K L;  1UE6 A;  3T1Y Q;  2XTI A;  1X55 A;  3E9H A;  3H0G H;  2UXD L;  4YY3 Q;  3S16 H;  1HR0 Q;  2Z6K C;  3I4N G;  3A5Z B;  2UU9 Q;  1G6P A;  1L1O C;  1S72 A;  4DR1 Q;  4A3I G;  2AKW B;  2R7F A;  2GVA A;  1JJG A;  3RLF A;  2OTJ A;  4LUO A;  2WFW A;  4LF8 Q;  1U5K A;  1OXV A;  2N3S A;  3S1R H;  1X65 A;  4HIO A;  4IJH A;  4LF8 L;  1G51 A;  2N49 A;  1L0W A;  3ULP A;  1XJV A;  4B3M Q;  3M4O H;  5GAD C;  4YWL A;  4GKK L;  2OCE A;  1SLJ A;  3GTO H;  2MO0 A;  2HHH L;  4DAY B;  1N8R C;  2KHJ A;  2HT1 A;  3G71 A;  4LF5 L;  1GVP A;  1S3O A;  3S15 H;  1B70 B;  2PQA B;  4LUV A;  1XPO A;  4A3G G;  4OXP A;  2IT1 A;  2JA9 A;  2OQK A;  1V43 A;  2ZJR A;  2Z6K A;  3D31 A;  1OXX K;  1L1O A;  1EIF A;  4GLV B;  4NPS A;  4PZ7 A;  1Z47 A;  4DV1 L;  5JJL A;  5M3M G;  1PH8 A;  4GLX A;  3J80 i;  2JA6 H;  5H1S E;  1PA6 A;  5FJ8 H;  4HIK A;  2BH2 A;  3KDF B;  4DK3 C;  4BBR G;  4A3C H;  1KC8 C;  4KHP L;  1VQ5 A;  1WCM H;  2R7D A;  4B3M L;  3GTK H;  1B8A A;  3H3V I;  2VUM G;  3GTJ H;  5C4X G;  4IPH A;  1NY4 A;  4BXX G;  4R4C A;  2RF4 A;  4DR6 L;  1A62 A;  4OWX B;  4B3R L;  2R93 H;  1K83 H;  2VZA A;  5M3F H;  4GNX B;  4OX9 Q;  3HOU H;  3PO3 H;  2DUD A;  4DV3 L;  3KLW A;  5IYC H;  5C44 G;  5GQO A;  2ZJQ A;  1IBK Q;  4A3E G;  1KXL A;  3HOY G;  1X6O A;  4OO1 G;  4MTN A;  3CC4 A;  4DV2 Q;  1I94 Q;  4UP9 A;  1PH1 A;  1V1Q A;  3CC7 A;  2K5N A;  1QVG A;  4YCU A;  4APV A;  2HIV A;  5E7N A;  1LUZ A;  2I0Q A;  1N36 Q;  1HR0 W;  2DGY A;  5AJ3 L;  4YCW A;  4DAM A;  2MO1 A;  3I7F A;  1VQO A;  1HZB A;  2F52 A;  2Q2H A;  3EBE A;  2JK8 A;  4JI1 L;  3FP9 A;  4YWM A;  1NE3 A;  1PH4 A;  1Y1V G;  1H95 A;  1IBM L;  3PUY A;  1QVC A;  3HOY H;  3CPW A;  3KF8 B;  3HOZ H;  1J5E Q;  4A3J G;  2EXD A;  3M85 A;  4MNO A;  1VQ8 A;  1FGU A;  3CCM A;  5J3B A;  4PG3 A;  3STB D;  2YYZ A;  5FLM H;  1VQD A;  5EAY A;  4BXX H;  4DR7 Q;  4LUZ A;  4A3L G;  1IXR A;  3I4M G;  4LF9 L;  2VUM H;  2B63 H;  5C0X I;  3AEV A;  1K0R A;  4GS3 A;  2NN6 I;  2H5X A;  4HJ5 A;  2PI2 E;  2E2H H;  1EIY B;  1Z9F A;  4DV6 Q;  1G29 1;  1QZG A;  3S24 A;  2A8V A;  3RN5 A;  3W5O A;  1Q8K A;  2I5M X;  4A75 A;  4AQY L;  4A3J H;  4GNX A;  3GTP H;  1WJJ A;  3FHW A;  5M5W H;  1YJ9 A;  3HOZ G;  4BY7 G;  2YTY A;  1OXT A;  1XMO L;  1JB7 A;  3RR5 A;  4IPD A;  1IBK L;  4JI4 Q;  1YHB A;  4A4I A;  5IYD H;  4BA2 I;  4A3G H;  2AHO B;  2K50 A;  4A93 G;  5M5X H;  3RLN A;  2CFM A;  3CAM A;  1VQL A;  4B3T L;  4MZ9 A;  4GKJ L;  1WOC A;  4BY1 H;  5IYD G;  3NEM A;  4IO9 A;  1YBY A;  2AMC B;  4KHZ A;  4YWK A;  1B7Y B;  2CWA A;  2ZM6 L;  3S1N H;  1MIU A;  3I4O A;  1YNX A;  2LSS A;  4KHP Q;  1JT8 A;  5ELN A;  1PH5 A;  4PMW A;  4DV3 Q;  2IX1 A;  1I5F A;  4YHH Q;  1XPU A;  1EOV A;  2JA7 G;  3J81 i;  5M3F G;  1W2B A;  4DR4 Q;  4Y52 H;  1GKH A;  1HR0 L;  5LMU Q;  2Y0S G;  4R4O A;  4J15 A;  3CCS A;  4HIM A;  5C4X H;  2B63 G;  5GAE C;  4A3B H;  1L2F A;  1MKH A;  2K5H A;  2IHF A;  1XNQ Q;  3CQZ H;  3DM3 A;  5IE8 A;  1MJE A;  2HIX A;  3PUV A;  4A3D H;  3F8T A;  4DUZ L;  2ID0 A;  3MXN B;  1BBW A;  4LFC Q;  4DR1 L;  5IP9 H;  4JI5 L;  1NTG A;  3J7A 5;  1E22 A;  4RG1 A;  4LF6 L;  4X64 Q;  3M7N A;  3BZC A;  2Z0S A;  5C0X G;  3BJU A;  1BVS A;  4UP8 A;  1HH2 P;  4KI0 A;  4L5R C;  4IFD G;  1HNX L;  1DGS A;  2IY5 B;  2JA7 H;  4JI6 L;  1VQH A;  2RHS B;  2E2J H;  3TEH B;  3CF5 A;  1FVI A;  5JEA G;  4DV5 L;  4DR3 Q;  3PF4 A;  4DV0 Q;  2UXD Q;  4DNI A;  2GN5 A;  2D62 A;  2A19 A;  4AH6 A;  3RN2 A;  1NJI C;  2NVT H;  3W1G A;  4JBW A;  4X66 L;  5JJK A;  4LF4 L;  1XPR A;  5HGQ A;  1HNW L;  1I6H H;  3CP0 A;  4LW1 A;  5IY0 A;  4LFB L;  3U4Z A;  2JEA I;  4OWT B;  1JJ2 A;  1VQK A;  1AH9 A;  3K81 C;  3U58 A;  1WI5 A;  2N8N A;  3CXC A;  1M90 C;  1X9N A;  4LFB Q;  3K7A H;  3CME A;  2YV5 A;  1LYL A;  3EN2 A;  2GVB A;  3K0X A;  4JBK A;  3J80 c;  1IBM Q;  4IFD J;  1D7Q A;  4DR5 L;  3G48 A;  2D0O A;  5ELO A;  2E2I H;  2UUA L;  4JI0 L;  2IX0 A;  4A3L H;  5IP9 G;  5AJ3 Q;  2L15 A;  5FLM G;  4OWW B;  3J7Z C;  2K52 A;  4GNX C;  2UU9 L;  5BR8 L;  4YHH L;  1X54 A;  1XMQ L;  4GKK Q;  1PFS A;  3GTQ H;  1X3E A;  4IPG A;  1TWC H;  2PMZ E;  1VQJ A;  4AYB E;  4DV1 Q;  2NVY H;  1VQ4 A;  1A0I A;  2YTV A;  1SMX A;  5GAH C;  2ZM6 Q;  4LF9 Q;  1QVF A;  3I4M H;  2CKZ B;  2CWP A;  1TWH H;  3F1Z A;  1C7Y A;  4WJ3 M;  1RL2 A;  3LGJ A;  4GKJ Q;  2UXB Q;  4C2M H;  1KHI A;  1SFO H;  1HZC A;  4XIG S;  3S17 H;  4DR4 L;  2BH8 A;  3UDI A;  1VQG A;  4NXN Q;  1P16 A;  5C4J H;  3KFU A;  3U4V A;  2MFI A;  3CPF A;  3GD7 A;  1KIX A;  4GOP A;  1OXS C;  4DR5 Q;  3KJP A;  4NXM Q;  4EX5 A;  1JE5 A;  2JQO A;  2WP8 J;  4A3E H;  1Q46 A;  2A1A A;  4JG2 A;  3PV0 A;  1FL0 A;  5IYC G;  4JBM A;  1VQC A;  4A93 H;  3PO3 G;  2QGQ A;  1E7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...