1VQDA

Gene v protein mutant with val 35 replaced by ile 35 and ile 47 replaced by leu 47 (v35i, i47l)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYIDLGNEYPVLVKLTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Potential use of additivity of mutational effects in simplifying protein engineering.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
total genus 10
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqdA00
1EQQA 3ULJA 4BXXG 2KBNA 3KLWA 1Q81C 3E9IA 5LMNL 4R4IA 2NZOA 5HGQA 1B8AA 1AE2A 1M1KC 1OXVA 4B3RQ 4A3GH 1P16A 4DR7Q 3RZOH 4A93G 2I5LX 1XNRQ 2JEBI 3I2ZA 1GO3E 2Q2UA 2JE6I 3WWVA 2JEAI 1T9HA 1TWCH 4AIMA 1HR0Q 3I4OA 3PO2G 1UE1A 3SGIA 4QY7A 3ULLA 4LF5L 4LNQA 1MJCA 1I5FA 1PFSA 3CQZH 1X9NA 1SFOH 5LMUL 5M3MG 5M3MH 1CUKA 4JV5Q 2BA1A 4JI4Q 4P74A 5FLMG 4L5TA 5IWAQ 5FLMH 4DR2L 4NXNL 5BR8L 3Q8DA 4IJLA 4BY7G 4HJ8A 1X3GA 2Z6KC 4YHHL 1E7ZA 4JI3Q 4LF4L 4C3JH 3FHWA 4JI0L 2VW9A 1VQAA 1WJJA 2B3GA 3M3YH 1GVPA 5GAGC 1HZCA 1LM0A 1KHIA 5M5XH 1L1OC 1JB7A 4GOPB 4B3SL 4LF8L 1JE5A 5IP9H 3M4PA 4LW1A 2B29A 2VQEL 3FKIH 3HKZE 1CKMA 3U58A 3CC4A 1VQ6A 3TS2A 4DAYB 4YWMA 1KQSA 2DUDA 1WI5A 3HKZG 2UUAQ 4JYAL 2GN5A 4JI5L 1U5KA 1TWHH 2Y0SE 4HJ5A 1Q82C 1N8RC 3HOVG 4RG1A 1N32L 1QZHA 1UWVA 2BA0A 1A62A 3PUVA 3M4OH 2Y0SG 1KXLA 2WB1E 4YWKA 5M3FH 1TWFH 2R92G 4BBRG 1PH2A 1SMXA 3AYHB 1VQFA 2N49A 2R7FA 1NE3A 1B70B 2WB1G 1VQDA 2IT1A 3KF8B 4EX5A 1E1OA 2CKZB 3W5OA 3JAMi 2CQOA 2D0PA 1HNZL 3VDYA 1IZ6A 4HIMA 4X62Q 2JA7G 4MTNA 4APVA 2JA7H 1KAWA 3UDGA 4B3TL 3NBHB 1SLJA 3MEFA 3J81i 1VQ8A 3HOZH 3H15A 1A8VA 3E9HA 4JG2A 3CCSA 4DR1Q 1U0LA 1BBWA 1X6OA 3CCJA 4R1JA 1EOVA 4C2MH 1Q12A 2K5NA 3T1HL 5C3EG 1AH9A 2KHJA 3HOUH 1TWAH 4C3IH 4A3FH 1N36Q 1J5EL 4K0KQ 3J80c 1IBKL 2Q2TA 3ERSX 4LFBL 3K7AH 4PZ8A 2JA5H 1YZ6A 1SR3A 3GTLH 1PH3A 3H0GG 3H0GH 3S2HH 1WCMH 4Y7NH 2UXCL 1Y1VG 1Y1VH 2ZM6Q 2GVAA 1SRUA 2LXKA 4X64Q 3UDIA 3RNUA 5IP7G 1IL2A 4B3ML 3KDFA 4MNOA 2IX1A 4R4CA 3CCRA 1CKNA 2ZJPA 1LYLA 4DUZL 4WJ4A 1VQHA 2N78A 1Y1WH 2RHQB 1CKOA 4OONA 4P75A 3RN5A 4DUYQ 3B6YA 3JC66 3RLFA 4YY3Q 4DV2L 3GTKH 1NBWA 5JJKA 4ALPA 2JQOA 2ATWA 1Y14B 5JEAG 2ASBA 3PUZA 3UDXA 4UP8A 2ZTDA 3PV0A 1HZAA 3PUYA 4LF6L 3CMAA 5IYCG 3AEVA 4DR4L 2K5VA 5AJ3L 3KOJA 2WP8J 3A74A 3K8AA 4A3DG 5IYDH 2MO0A 1OTCA 3RLOA 4WJ3M 5FJ8G 4XIGS 4DV3Q 4POGA 2VQFL 4DV0L 1BKBA 4XTCS 1PH1A 4LF5Q 2R93G 4NB3A 4UP7A 2K4KA 4YWLA 1Q7YC 4DV4L 1TXYA 3K81C 5C0XI 3GDEA 2MNAA 3K80C 4DR2Q 4NXML 2HT1A 1HR0W 1GKHA 4DV1Q 1KL9A 5IYBG 3KDFB 2K52A 1XJVA 4NXNQ 3I4MG 4QIWE 4O0AA 3I4MH 2JA9A 1EFWA 1OXUA 4HJ7A 1CKNB 3GTGH 4BA2I 3KYHC 3MXNB 3CPWA 4JI0Q 4AH6A 1PYBA 1RL2A 2RF4A 4KHZA 2NVQH 4AQYQ 4A3GG 4OO1G 4X66L 3PF4A 4LF8Q 1IBLL 1PH8A 4DR3Q 1L2FA 1PYSB 2FXQA 3STBD 3HOXH 4QGUA 3L2PA 4GNXA 2E5LL 3F2BA 1VQKA 3CPFA 1VQGA 2UXBQ 1HH2P 3RR5A 3PGZA 5IY0A 1HNXL 4JYAQ 5E7NA 3CF5A 1HJPA 4DV5L 3CD6A 4JI2L 1X56A 5EAYA 2D0OA 2KENA 2NN6I 3GTQH 2YYZA 1NTGA 5FLXc 1JJCB 3OYYA 2UUCL 3CCLA 2UU9Q 3HFZB 4OWTB 1KRSA 2VZAA 4FDBA 4JI8Q 4LFAL 5H1SE 2F3IA 1YVCA 3A0JA 4H02A 1Z9FA 4IOCA 1KD1C 2JA8H 4HJ9A 2NVYH 3CXCA 4GKJQ 1XNQL 4A3EG 2IHFA 2RHSB 3D31A 4YCUA 4A3EH 2QGQA 1XMQQ 4DV6L 1N33L 3UDFA 4GLVB 4LF9Q 2VUMH 5IP9G 1C0AA 2R7DA 4X6AH 3GTOH 1N34L 1FJGQ 3FKIG 2AKWB 2MQHA 2ZTEA 4JC0A 3STBC 5C4XH 1B7YB 1VQ9A 2VNUD 4DV7L 3HOYH 2I0QA 1Q46A 3J7A5 1VQ4A 4GKKQ 4JI6L 4KHPQ 2R7ZG 2F4VL 3K7UC 2Q2IA 4R4OA 1K73C 4JI7Q 4O2DA 1V9PA 1ASZA 4A3BH 4R4QA 2OTJA 3BZCA 1KIXA 3S1MH 1YJWA 5M3FG 4TQUS 3I4NG 3I4NH 2VL6A 2V1CC 2E8GA 4JCVE 3U4VA 1IBKQ 2VS1A 4A76A 1HZ9A 4OWWB 1VQIA 3AFQA 4GNXB 1VCIA 2JJQA 1E1TA 4DR7L 3NEMA 4GOPC 1XNRL 3J80i 3I56A 4BY1H 3S15H 2UXDL 1HR0L 4GLAC 4UPAA 2IX0A 3CC2A 3F8TA 2PQAA 2JA6H 2N3SA 5GAEC 4B3MQ 3RLNA 1PH7A 3J81j 3HOZG 3S1QH 4JV5L 4JI4L 5IWAL 4JI1Q 1OXTA 1S40A 2YV5A 4BA1I 1VQNA 2AWOA 2N8NA 5IT9c 2JK8A 1VQJA 2UUBQ 2K50A 2DGYA 4A3FG 3HOUG 2OCEA 1BVSA 3PF5A 4IFDG 4X65Q 3NELA 1PH6A 2JA5G 3T1YQ 1I94Q 4LFCQ 1W3SA 4A3KG 4HIKA 4A3KH 4OX9L 1D7QA 1IBMQ 3S24A 1WCMG 1K8AC 1J6QA 4GN3B 3DLLA 2K5HA 3F2CA 4GS3A 5M5WH 1E22A 2OQ0A 4IOAA 1I6HH 1TWGH 2PI2A 1QZGA 1VQLA 4P72A 4A4IA 4DR5Q 5LMNW 3E0EA 4IJHA 1K83H 3PIPA 1VQPA 3L0OA 4LUOA 2WFWA 2Z0SA 1YNXA 1Y1WG 4A3LH 3CCMA 1S3OA 4L5SA 2PQAB 3OTOL 4NXMQ 3PO3H 3I55A 2QEXA 3GD7A 4HJAA 3LGJA 2WAQE 1K0RA 4DPGA 1RIPA 3I7FA 4L5QA 5C0XJ 1YHQA 2AMCB 1D8LA 3BZKA 4X62L 1O7IA 4DAMA 2HHHL 5LMNQ 3PSIA 2R7ZH 2KCTA 1XPRA 1G291 4LUZA 2K75A 1UE5A 5IYBH 4J15A 1YIJA 1IYJB 1QVCA 2KCMA 5IYDG 4IPGA 1E3PA 1X3FA 1EIFA 4JBWA 5HY6A 1E24A 3ER0A 4QJFA 4A75A 1S72A 2GVBA 2QA4A 3KJOA 1EUJA 2Z6KA 3A5ZB 1JJ2A 5LMUQ 4K0KL 1CSQA 3PUWA 4JBMA 2YTXA 4DV5Q 4JI2Q 4UP9A 1XTDA 1L1OA 3EN2A 3M9BA 5BR8Q 1PA6A 4ME3A 3U50C 1VQOA 4LFAQ 4JOIC 5ELOA 3TREA 1VQBA 4MZ9A 2ZM6L 4YHHQ 1PH9A 2YTYA 2E2IH 2ALYB 2K14A 1KRTA 1V43A 4P73A 4X64L 3A5UA 1XMOL 1K3RA 1K9MC 1V1QA 1SE8A 4IPCA 1XNQQ 1K8GA 4A3JH 4DV6Q 4B3SQ 1N33Q 3S17H 1P8LA 2ZTCA 2MFIA 1G51A 3F2DA 2VQEQ 2F52A 3HOXG 1SN8A 2OTLA 1I3QH 1QUQA 1WYDA 3NENA 4EQ5A 1EIYB 5GQOA 2F4VQ 3HOWH 4DUYL 2PMZE 4KLKA 1YJNA 4Y52H 4YY3L 4JI6Q 3RZDH 4JI5Q 1EWIA 5C44H 3KF6A 2HQLA 1X65A 1LTLA 2MO1A 1Z47A 2IHEA 3ULPA 4L5RC 4RMFA 4BXXH 4C3HH 3J7ZC 1FGUA 1HNWL 2LXJA 2NVXH 1XPOA 3UE1A 4LF7L 2JA8G 2ZJRA 4A93H 1PV4A 3OW2A 1VQMA 2BH2A 1FVIA 3D0FA 3KJPA 2E2JH 4IO9A 1M90C 1BBUA 1HNZQ 2UXDQ 4HIOA 3CP0A 3CAMA 3GTMH 3PO2H 2VUMG 1L1OB 4DV3L 2YU9H 4DR6L 3PIOA 3G48A 4B3TQ 1Q1EA 3CW2C 5C4XG 2PI2E 3HOYG 1JT8A 1PVOA 1UE6A 3CCVA 5JJIA 1OXXK 3DM3A 2CFMA 4DNIA 4DV1L 3ZJYC 1FL0A 4A3BG 4TVAB 4OWXB 4BY7H 3T1HQ 1NMGA 1J5EQ 3H3VI 3GTPH 1QUQB 1JMCA 4AQYL 4LFBQ 4B3RL 1YHBA 2AHOB 1NMFA 2A1AA 1R9TH 4OX9Q 1WOCA 4BY1G 1IXRA 3KF6B 4DR3L 1VS0A 1VQCA 1PH5A 3S2DH 3BJUA 2UXCQ 3FP9A 4PMWA 4YCWA 2JA6G 4GLXA 3M4QA 2IY5B 1LUZA 1MKHA 4JBKA 2UXBL 2CWPA 2BH8A 1YHAA 3EBEA 1X55A 3GO5A 4OO1I 1AE3A 4A3CG 2R6GA 4A3CH 3HOVH 1YBYA 2HIXA 3W1BA 1EQRA 4A3MG 4DUZQ 1X3EA 4A3MH 1PHJA 4GN4B 3TS0A 1HZBA 4DKAC 2UU9L 4JI8L 4GNXC 3IRBA 4BBSG 3CCQA 2R92H 4BBRH 4BBSH 4JI3L 1A0IA 3OTOQ 1QVGA 4DV2Q 1EYGA 3UE0A 3U4ZA 2ZJQA 4GKJL 1I50H 1GM5A 3AQQA 4GN5A 4PZ7A 2B63G 2NVTH 2HHHQ 2B63H 1XMQL 1DGSA 3G4SA 4LF9L 1C9OA 4LF6Q 4QQBX 1FJGL 4DR4Q 5AJ3Q 3S14H 4QL5A 2H5XA 4LUVA 3G71A 1YITA 1A63A 1H95A 2E2HH 5GAHC 5C0XG 3GTJH 4NPSA 1N9WA 4R4TA 3M85A 3TEHB 3CC7A 2UUAL 3S1NH 4GKKL 4KHPL 3RN2A 4JI7L 3HKSA 2VQFQ 4DV0Q 4JOIA 4DR1L 2A19A 3CMEA 5K36G 2YTVA 5C3EH 3M7NA 5JJLA 1XPUA 4A3LG 1NJIC 4JBJA 4DV4Q 3JAMc 4PZ6A 1KC8C 3PO3G 1N32Q 1X54A 4LWCA 3CCEA 2I5HA 1QVFA 1YI2A 3L7ZC 3W1GA 5ELNA 2WAQG 1SROA 3J81c 1XMOQ 1CSPA 5IP7H 4DK3C 2ID0A 1GD7A 2AWNA 1VQ7A 1JJGA 4X66Q 3AFPA 3K0XA 3S16H 1G6PA 4IFDJ 1IBLQ 1YEZA 2NN6G 2OWOA 5M5YH 1C7YA 3F1ZA 2EXDA 4JI1L 4P71A 1UEBA 3ICEA 2CCZA 2ES2A 2E5LQ 3PCOB 2UUBL 4UY8C 1N36L 4OXPA 1HNXQ 2C35B 1UE7A 3TQYA 2KHIA 2D62A 4AYBE 5GROA 4X65L 5C4JH 3S1RH 2I5MX 1YJ9A 1W2BA 4LFCL 1Q8KA 3T1YL 1I94L 2UUCQ 1MIUA 2NZHA 3CCUA 1IBML 4AYBG 1ASYA 3G6EA 4KI0A 2L15A 1HNWQ 4YCVA 1NY4A 5IYCH 3EIVA 1VQ5A 4LF7Q 2XTIA 1OXSC 5DLQE 1L0WA 4IFDI 4IPDA 3BU2A 1PH4A 2VY3A 2PNHA 1Q1BA 4PG3A 4DK6C 4POFA 2EQSA 4HIDA 4A3JG 4A3DH 2RCNA 2Q2HA 4DR5L 4DR6Q 5FJ8H 2LSSA 2R93H 4A3IG 2OQKA 1WFQA 4A3IH 1N34Q 2CWAA 5JEAJ 3H3VH 5IE8A 2HIVA 4DV7Q 1MJEA 3HOWG 5J3BA 3KFUA 4IPHA 3PUXA 3TRZA 2A8VA 1VQEA 4GOPA 2EIFA 1Q86C 5C44G 4LF4Q 5GADC 2XGTA
chains in the Genus database with same CATH superfamily
1QNUA 5D3IB 1AZPA 1X32A 2F03A 1FD7D 3BDCA 4R4IA 1QWYA 1B8AA 2EVBA 3NP8A 1M1KC 4B3RQ 1TS3A 1P16A 3RZOH 2I5LX 1C48A 2JEBI 2WB1B 3I2ZA 2Q2UA 1E0BA 3WWVA 2JEAI 1JWMD 1RTOA 1HR0Q 3I4OA 4KJNA 4LF5L 4LNQA 1MJCA 1PFSA 1X9NA 1D2BA 1CUKA 3DEOA 5C3WA 2D2CC 2ZXPA 4JI4Q 5FLMG 4DR2L 3JAME 4HTHA 5CV7A 3NTKA 1YNND 4HJ8A 2Z6KC 4KD4A 4LF4L 2O4XA 5LL6S 1JOOA 2I46A 2VW9A 1VF5C 5GAGC 4S3SA 1KHIA 5D3DA 1DD2A 1KTKA 1JE5A 4WRDA 3GTLB 2TMPA 2K1BA 4N9TA 5E4WC 3FKIH 4Y7NB 3HKZE 1ZYRC 3TS2A 4YWMA 3HS0C 2UUAQ 3HKZG 1IYUA 5T1IA 3VR2A 1S5ED 1TWHH 4HJ5A 3MTSA 2BA0A 4ZLTF 3M4OH 2WB1E 2EY1A 3OMCA 2PYKA 4BBRG 1H9MA 2VB3X 2F0QA 2WB1G 3JAMi 3GTKB 1PTOH 4WFN3 2L5TA 1D5XC 4APVA 1KAWA 1STBA 3C1FA 3NBHB 1SLJA 1VQ8A 3HOZH 2ZXOA 2MP1A 4JG2A 1U4PA 1RODA 3EVQA 1X6OA 3CCJA 4R1JA 2HCIA 2EY2A 3HOUH 1TWAH 4K0KQ 2EDGA 1MD2D 1EU3A 1RTNA 2Q2TA 3ERSX 1ENCA 3KBXA 4LFBL 2RCFA 2JA5H 3AB9A 3S2HH 1WCMH 1Y1VH 1SRUA 4X64Q 1JCKB 1IYVA 1O7YA 1IL8A 4U673 4B3ML 2NVQB 5C5LA 2EY5A 4R8NA 3RZOB 4R4CA 2ZJPA 2SOBA 2N78A 2RHQB 1CKOA 1SAPA 3JAML 3RN5A 3B6YA 5NUCA 2PQEA 1NBWA 2RSNA 3ZYYX 5JJKA 4Z9CB 2RDFA 2ZTDA 1HZAA 3MHBA 4LF6L 3AEVA 1S5DD 5AJ3L 1B50A 2AQ1B 3NWSA 3K8AA 5IYDH 4A3EB 1LTID 4XIGS 4DV3Q 4CDCC 2VQFL 4LF5Q 4HSVA 1TU2B 3FKIB 1TXYA 1R4QB 3E6ZX 2A68C 4DR2Q 3K80C 2A6HD 3H94A 4ABNA 1EFWA 4HJ7A 3EJIA 1RF2D 3CPWA 1DOLA 3TZUA 4AH6A 1RL2A 3I4NB 3NHHA 3PF4A 3G7LA 4MN3A 1BNZA 5EKLA 1A3UA 1ZEQX 3PIP3 1IBLL 5ELCA 1PTOB 1L2FA 4HMJA 1B3AA 5C5MA 2K5QA 3BVZA 3CPFA 1G6ZA 3FPUB 3PGZA 4JK1C 5E7NA 3FEWX 1HJPA 2WINB 3CF5A 4JI2L 3HOZB 3J80E 4R8IA 2UUCL 4QF4A 4OWTB 4ULLA 4JI8Q 4IOCA 1DM0B 1Z9FA 2R61A 1XX8A 1TWAB 3BG3A 3HOUB 3OOCA 3CXCA 4GKJQ 1EY4A 4A3EG 2RHSB 1N33L 2JA5B 2A74C 4KY6A 1TQOA 3FKIG 3MFYA 1H9SB 3HGBA 1CTMA 4DV7L 2VNUD 1I6HB 2F4VL 2K05A 5CV6A 4O2DA 2G9DA 1ASZA 2OTJA 2ICIA 1YJWA 4EGVA 3I4NG 2VS1A 1HZ9A 2B2VA 1V1PB 4GNXB 1XNRL 3J80i 3D4DA 2UXDL 4UPAA 3EROA 2IX0A 1R4PB 5CORA 2L12A 4B3MQ 2MPMA 3HOZG 3S1QH 1WVLA 1ENAA 2SNMA 1OXTA 2RBMA 1S40A 1EY6A 2KVMA 5IT9c 2K50A 3HOUG 1JE4A 1KNEA 2OCEA 1K0SA 2JA5G 1SNDA 2AUJD 3K6OA 1WCMG 3KLSX 2WV6D 1I4GA 1UUPA 4OL7A 4P2CB 2RDGA 3F2CA 3FPPA 1QZGA 4P72A 4CJ2C 1K83H 1VQPA 2ZXRA 2EYFA 2KHSA 2Z0SA 1BQQT 1YNXA 3I73A 3BDLA 3I55A 4B9WA 3QWNA 4HJAA 2CH4W 4DPGA 2LFNA 4ZUJA 4OELB 2K75A 1UE5A 1PFBA 2R3ZA 3DWAA 2LS01 5A2QE 1QVCA 3C1EA 5JPNC 5JVH3 5IYDG 5HY6A 4O42A 3HG9A 4JBWA 2EIFA 1S72A 2GVBA 2QA4A 1A3VA 3HP3A 3A5ZB 4FNFA 5LMUQ 1IHZA 4JI2Q 1Q3LA 1ET6A 3NSWA 3TN2A 1BOSA 5ELOA 1XJVA 4MZ9A 2ZM6L 4YHHQ 2YTYA 2K14A 1K9MC 1V1QA 1M8AA 2K5WA 3BYTB 5AFWA 1N33Q 1P8LA 2MFIA 2F0EA 1SXTA 1TS2A 4ZKBB 1SE3A 2VQEQ 1SN8A 2NTTA 3R2TA 4FXDA 1JWUD 1Y8NB 1YNJC 5J1ZA 3VR6A 4Y52H 4JI5Q 4FXGC 2Z4IA 3Q0AA 2MO1A 3HOVB 2IHEA 4H44C 1JOKA 2C5CA 5I9PA 1CA5A 3L9AX 3UE1A 1O7ZA 4LF7L 4BBSB 2ZJRA 4A93H 4DN4M 5IGEA 2BH2A 1BBUA 1WD1A 2UXDQ 3CAMA 3GTMH 3PO2H 1L1OB 4DR6L 3G48A 3T51B 2PI2E 4CKBA 3DM3A 5IGBA 2F0JA 3ZJYC 4TVAB 4OWXB 1LTBD 3TP6A 3H3VI 5C3EB 2FINB 2AUKA 1LTAD 4IALA 1R9TH 4K8IA 4CGYB 1WOCA 5BN4A 3PQIA 1VS0A 5A2QL 5CV8A 2KEDA 2JP1A 4G7OC 4YCWA 3IL8A 2EYLA 4J8QA 1MKHA 2UXBL 2BH8A 4OHJA 1DYQA 4A3CG 2HIXA 1TR5A 3W1BA 1SYCA 2HUGA 2MGSA 5I2XA 5KNBA 4GN4B 2UU9L 1J8IA 2Z1CA 4BBSG 3CCQA 2EYHA 5J39A 3U4ZA 1HQMC 1GM5A 4PNYA 4PZ7A 3VA7A 2F3VA 3G4SA 1KDAA 2K04A 4DK0A 4LUVA 2PNRC 3OWFA 1YITA 2E2HH 1A2UA 5GAHC 3GTJH 4NPSA 3M85A 3NXWA 4R4TA 3TEHB 3CC7A 3S1NH 4GKKL 2B2TA 3RN2A 3C46A 1QE6A 4JOIA 1EYCA 4ODGA 2SEBD 3M7NA 3A8IE 1ESFA 3D4WA 3R93A 4DV4Q 3JAMc 4PZ6A 4ILWA 2B2UC 1AZQA 1FNWA 1S5BD 4LWCA 4I7AA 3E0JA 3CCEA 2XRSD 5C4HA 1HA6A 3SR1A 3VYRA 3CHBD 5ELNA 1CSPA 3K58A 1GD7A 2Q8RE 4X66Q 1SNPA 1G6PA 4A93B 2OWOA 1YEZA 3F1ZA 1PRTB 4JI1L 3ICEA 1QCBD 3LX0A 3PO2B 3PCOB 1SFOB 4OXPA 2K6AA 1STYA 5M3MB 5GROA 5C4JH 2I5MX 1HXYD 4LFCL 1Q8KA 1I94L 5JEAH 3CCUA 3G6EA 2Z8LA 4KI0A 4YCVA 5IYCH 2F0LA 3EIVA 3OPOA 4LF7Q 1OXSC 2IJ0A 5DLQE 1L0WA 2XNAC 4ME5A 1G2TA 1EL0A 4RGTA 1R9TB 4DR6Q 2F0OA 2LSSA 2R93H 2CWAA 3H3VH 1BCPC 5FKAC 5J3BA 5TSSA 1EZ8A 1TIID 1VQEA 1U4RA 1EQQA 4FO2A 2KBNA 4RHSA 1Q81C 2Y0SB 2RA4A 3J7YW 4A93G 4RKBA 2PZTA 4KKSA 2JE6I 1EEID 3PO2G 1X3PA 3SGIA 1GUOA 5FK9C 3ULLA 2HQEA 3KLSA 5M3MG 4DXFA 4P74A 3H91A 5FLMH 4NXNL 3K5NA 3Q8DA 3R2IA 1X3GA 1E7ZA 1TY2A 1WJJA 3M4YA 3GP7A 3M3YH 4KHVA 2F3WA 1CZGA 1JB7A 3VR3A 4GOPB 1CZWA 3FRPB 1BR9A 4LW1A 3H0GB 1VQ6A 3ONAB 2Y0SE 1A62A 2Y0SG 2EOTA 1KXLA 5M3FH 1SMXA 1VQFA 4X3KA 2DY7A 2IT1A 2CQOA 2D0PA 4QMGA 1HNZL 3VDYA 1MGSA 3L3OC 3A8JE 4JW0A 5CBAE 1I4QA 1ZKOA 1IKLA 1A8VA 4FF4A 3K5OA 4DR1Q 5C4ZA 1Q12A 3RD4A 3T1HL 2PW7A 3J80c 1IW7C 4PZ8A 2BE5D 1YZ6A 2RQXA 3GTLH 4XYOA 3H0GG 2AQ2B 1UNSA 3SXHA 4Y7NH 2M9VA 4V190 1BUVT 1HPCA 1VMCA 3RNUA 1IL2A 3NBIA 4MNOA 2IX1A 1II3A 1CFMA 1LACA 1LYLA 2F0KA 4WJ4A 4DNRB 4OONA 2F0SA 4DUYQ 3PMFA 3RLFA 3GTKH 1MSGA 3SEBA 5L37A 3NE5B 2OF1A 4ALPA 2V4DA 1Y14B 5JEAG 3PUZA 1GUNA 3PUYA 1DXMA 5IYCG 2K5VA 2CW0D 3D3RA 1PMRA 5M9OA 2E2DC 3M3YB 4WJ3M 3CRLC 2NBFA 4DV0L 3QB3A 2R93G 3S9WA 3N52A 4N9PA 5CC4A 2MUYA 5T1GA 3K81C 3X3MA 4NXML 2BCOA 1HR0W 4NXNQ 1SYGA 4FF1A 4FP5D 1N32L 2QDBA 3KYHC 1H9SA 5M3FB 5LHY1 4KHZA 2NVQH 3ND9A 1EWHA 4H13C 1NUCA 4DR3Q 4BY1B 4PQXA 1V1PA 4GNXA 4WJWA 1HNXL 1TS5A 5EAYA 2D0OA 2NN6I 2YYZA 4B08A 2A6HC 2VZAA 4FXKC 3A0JA 4RGNA 1XNQL 2F0PA 2P5ZX 4A3EH 2KA7A 2QGQA 1XMQQ 3UDFA 4LF9Q 2VUMH 4X6AH 4A3KB 1N34L 1BXTA 1Q46A 3I4LA 4DA2A 1Q8IA 3J7A5 4XQNA 1DOKA 5FLXL 4KHPQ 4JI7Q 2Q2IA 1K73C 1TWGB 4A3BH 4KKTA 1KIXA 4K14A 5M3FG 3I4NH 3U4VA 1IW7D 1VQIA 3AFQA 3A56A 4DR7L 3NEMA 4RAUC 5KIXA 3SK5A 5EPJA 3PO3B 2EPBA 3MFGA 1KLGD 2HDMA 3R3OA 2R7ZB 1CHPD 3F8TA 1LT3D 5KYLA 2Q8TA 2JA6H 1ESRA 1CK1A 2N3SA 1PH7A 4JV5L 4FF2A 3DWPA 1TS4A 4MHEA 4MTKA 4J6HA 5IWAL 5CGKA 5FO7B 2GA4B 2M00A 3TZDA 4X65Q 4OX9L 1W3SA 4A3KG 1I4XA 4HIKA 2B2YC 3DUZA 2E75C 1SNOA 5FOBB 2HCCA 2VXWA 4UDUC 1SNQA 2K5HA 1BCPF 4CKCA 3C3LA 2F0UA 2E2IB 4IOAA 1I6HH 2PI2A 1DOMA 3AMUA 2NWGA 4IJHA 4F8MA 3PIPA 5K36H 4DNTB 3V2TA 5I6WA 4A3LH 1FNUA 1S3OA 3OTOL 4NXMQ 4XXEA 2QEXA 3GD7A 3CU7A 5C0XJ 1RIPA 1YHQA 2R7ZG 1D8LA 4X62L 4G57A 3PSIA 4C3HB 1H9KA 1XPRA 3TMEA 2NVXB 4NP5A 4IUNA 3GV3A 5BN3A 1HUMA 4ID6A 2F0GA 1SJED 1QNKA 2NN6H 2KOLA 1EIFA 1GHJA 1E24A 1F2ZA 1SYEA 3ER0A 2VUMB 1SYFA 1CSQA 3PUWA 2X6LA 1KNAA 1L1OA 3ITPA 4ME3A 1VQOA 1O7LA 1GHKA 4A3BB 1VQBA 4KD3A 4LF4Q 5CV5A 3OSOA 4P73A 1K3RA 1Y8PB 1PTOD 3GTPB 1SE8A 2F0HA 4K2KA 1XNQQ 2L0CA 4KV6A 4XT3B 1JOQA 2ZTCA 3SK6A 2WKCA 1G51A 1V8QA 2F52A 3QIAA 3A54A 2JA6B 1T5EA 4CDEC 1J9OA 4YY3L 3RZDH 5C44H 4N8X1 3NQTA 3NPPA 3ULPA 1PFMA 4RMFA 3EQLC 3TBIB 4C3HG 4CHTB 3TP8A 1FGUA 1HNWL 1U4LA 5IGDA 3D0FA 3KJPA 2E2JH 4IO9A 4HIOA 4TSSA 4U68A 2VUMG 2B63B 3Q6SA 3PIOA 1Q1EA 1JT8A 3S14B 4G7ZC 1UE6A 3Q23A 2WIIB 1OXXK 1EFID 4DNIA 1WTQA 4NW2A 3LWUA 4DV1L 1FL0A 1FR3A 4A3BG 1AP0A 3VYSA 4X3TA 1LTRD 1FYCA 1QUQB 4AQYL 4LFBQ 2KCNA 1PDQA 1YHBA 1NMFA 3J81E 4OX9Q 4G7HC 3S2DH 3BJUA 1BO0A 2QF7A 2BOSA 2JA6G 3MVVA 4JBKA 2CWPA 3EBEA 3GO5A 1AE3A 2R6GA 5CYUA 1O80A 3HOVH 4A3CH 3NTIA 3TS0A 1HZBA 4DKAC 3CKIB 3IRBA 2R92H 4BBSH 3WOEA 1QVGA 3OTOQ 1EYGA 4IUQA 5FO9B 3UE0A 1JC7A 1I50H 3AQQA 4GN5A 3G6JB 2B63G 2Z6BA 1EY0A 4C1NI 1ICWA 4LF6Q 4QQBX 1FJGL 2J0TD 5AJ3Q 3VYTA 4QL5A 2H5XA 3G71A 1A63A 1PLFA 1N9WA 5ELEA 2N88A 2VQFQ 1NR4A 3CMEA 5K36G 2L55A 5C3EH 5JJLA 3D8GA 5EBCA 1NJIC 4A3LG 3I90A 2OT2A 1KC8C 2IW3A 3A7AB 1X54A 3RZDB 4HSPA 5C44B 1F9SA 2I5HA 3W1GA 4EQOA 1SJHD 4HMIA 1SROA 3FMCA 3QG1A 1WTRA 2B2VC 4N8FA 1JJGA 3QJYA 4LAAA 5CR3A 1IBLQ 2NN6G 2E2JB 1LT5D 2EXDA 3MXNA 5DAUA 1TWCB 2L4NA 2CCZA 5COYA 1C4QA 4LMQD 2UUBL 1F2YA 1L0YB 2C35B 3QOJA 4ZK9B 1YJ9A 4FF3A 3T1YL 2UUCQ 1I4PA 1MIUA 2NZHA 3J81L 1IBML 1HNWQ 1LO5D 2K7VA 5IOCA 4KTAA 2XTIA 1ZXTA 3A7LA 4IFDI 1PH4A 3BU2A 4XDXA 4R9WA 2VY3A 3LWEA 4A3DH 4DR5L 1STHA 4Q0FA 2OQKA 3S2DB 5IE8A 4DV7Q 2PCFB 4IPHA 4ZCKA 2B2WA 4GOPA 1WTVA 1VQLA 5E4XA 2DNCA 5C44G 1Q86C 2F4VQ 3OIPA 3ULJA 3SDZA 5IGGA 3KLWA 3E9IA 5LMNL 1HFGA 1MSHA 4L6TB 1LT4D 5HGQA 1AE2A 3WDNA 1OXVA 3NK9A 2R92B 1XTCD 5EGTA 3T13A 1XNRQ 4GZYC 2BDNA 1LTGD 1I50B 1Y69U 2JA7B 1SEBD 3CQZH 1SFOH 4OIKA 1HQRD 4ZQ3A 5M3MH 2BA1A 3KUPA 1BF4A 2RVLA 5BR8L 1B2TA 4IJLA 3D6CA 2K33A 4JPBW 1CA6A 4C3IB 2B3GA 1LM0A 3J7AF 4RKLA 5I4DA 3K7AB 4B3SL 4LF8L 1CQVA 5IP9H 2B29A 1CKMA 3CC4A 2O5JC 1F9QA 2DUDA 1WI5A 1U4MA 2DJFC 2B2UA 4H0LC 2GN5A 4CBVA 1ILPA 3HOVG 1UWVA 5JPMC 1QOHA 4YWKA 2R92G 1PH2A 2R7FA 1VQDA 3BS1A 2ZT9C 3KF8B 4EX5A 1E1OA 2RKSA 2JA7G 1A2TA 4B3TL 4X3SA 3MEFA 3E9HA 5G3LF 1WTXA 4K2LA 4FYDA 3CCSA 1U0LA 5ISRA 2RDHA 4C2MH 1EOVA 4A3DB 2K5NA 5C3EG 1QG7A 2KHJA 1PZKD 4C3IG 4A3FH 4DGZA 1J5EL 3O13A 4IFDH 1EYAA 3U9SA 3MAQA 1JORA 1LTTD 3ERQA 1CI3M 1SR3A 1SBBB 3A8KE 3H0GH 2UXCL 3I4MB 2ZM6Q 3GTGB 3E3XA 3UDIA 1PRTD 4QIWB 1RDPD 4K5VA 1PYWD 1XYIA 4JVZA 1STGA 4DUZL 1VQHA 3H3VC 1Y1WH 2F4IA 1B44D 3CQZB 4DV2L 1HFNA 4E6IA 2JQOA 1H9JA 1NR2A 1PZJD 3K5LA 2BE5C 3UDXA 3I91A 4F88A 1B9NA 4DR4L 5CBEE 2F0WA 3KOJA 2WP8J 4K5WA 2JA8B 2NVYB 1T5XD 1RJTA 4WORA 4A3DG 2LY7A 2MO0A 1OTCA 3RLOA 2F0TA 4POGA 1E2VA 4XTCS 3ND8A 2FMCA 3OMGA 4C56C 1PH1A 3DMUA 4UP7A 2EYOA 1Q7YC 1XWEA 4HN7A 5C4XB 5DEHA 3D4RA 2HT1A 3AU7A 1GKHA 3BYYB 1KL9A 4I65A 3KDFB 5DM73 1WTWA 3OHXC 1QB5D 4QIWE 4O0AA 3I4MG 1OXUA 1CKNB 3MWYW 4LK1C 3MXNB 4F87A 5JAVA 4ZAIA 1F9PA 1PYBA 3HRZC 1EOTA 2EE1A 2PZWA 2CW0C 2N55A 4LF8Q 1PH8A 1PYSB 2FXQA 3STBD 3HOXH 4QGUA 2KCCA 1PXUA 3L2PA 2E5LL 3T56B 1VQKA 2UXBQ 2IL8A 3IKJA 4DV5L 3CD6A 5KEEA 1TT2A 2KENA 3LNNA 3GTQH 1NTGA 2EY6A 3VR5A 1JJCB 3CCLA 2UU9Q 1SNCA 4LFAL 3DXJC 4FDBA 4C2MB 4H02A 1D5MC 3IFDA 3W2DA 3NWTA 4A3FB 4K6DA 1NNXA 1D1IA 3D31A 4YCUA 3DWQA 4DU9A 4DV6L 1C0AA 5IP9G 2R7DA 3GTOH 4IN3A 2ZTEA 4JC0A 1Q90A 4QB4A 3HOYH 3IAYA 2B8FA 1F2LA 3X3NA 1VMPA 1VQ4A 4GKKQ 4JI6L 1SE2A 2X6GA 3HEJA 3K7UC 4R4OA 4NMZA 4R4QA 1A6XA 3S1MH 3KK7A 2VL6A 2V1CC 4DFAA 4JCVE 1Y1WB 3A55A 4OIJA 4A76A 4OWWB 1DCZA 1VCIA 4L8JA 3I56A 4BY1H 1HR0L 1AFPA 3P75A 2WAQB 1EY7A 5GAEC 2FMMA 2SNSA 4JI4L 1D5ZC 5C3XA 4RFBA 4JI1Q 1VQNA 2AWOA 1VQJA 3OWEB 3V05A 4A3FG 5D65A 1BVSA 5KYIA 4IFDG 1Z6HA 1PH6A 2M2LA 1I94Q 4LFCQ 1EWCA 4A3KH 4BS9A 1K8AC 1UEAB 4GN3B 3DLLA 3BVMA 2I07B 4GS3A 4I7ZC 5M5WH 1E22A 1LT6D 2OQ0A 1EIGA 1TWGH 1F77A 4A4IA 1FGBD 5IT9L 4DXGA 3L0OA 3RUZA 4Q5VA 1Y1WG 4RA8A 5KRUA 3HOXB 1I3QB 5FLXE 2XRQD 4L5SA 2PQAB 3WOFA 4KK7A 3PO3H 2KUMA 1K0RA 2DNEA 2WAQE 4UHVA 5DNFA 1ASYA 2AMCB 2PMZB 3GTQB 1TY0A 2R7ZH 1EY5A 2KCTA 3NUCA 4LUZA 2H4OA 2D5DA 4J15A 4EVOA 1YIJA 2KCMA 3NTHA 1E3PA 4A75A 4QJFA 3KJOA 2Z6KA 4HEDA 1JJ2A 3GTOB 4K0KL 4JBMA 4DV5Q 3HOYB 1BCPB 4UP9A 1XTDA 4NKLA 1PA6A 3DEPA 5CMDA 4LFAQ 3TREA 1SNMA 1ML0D 1PH9A 3S1MB 2E2IH 4X64L 3A5UA 1V43A 1XMOL 1AW7A 5K5PA 5C6AA 1K8GA 4DV6Q 3TP5A 2PZUA 1A3TA 2XSCA 3F2DA 3HOXG 1QUQA 1SSOA 1S5CD 2PMZE 4JI6Q 3H09A 4ZRZA 1SMYC 3HKZB 1W6KA 2HQLA 4QUCA 4BXXH 4C3HH 3J7ZC 4DAYA 4A3MB 2EJFC 1SYDA 2NVXH 4BBRB 4BWGB 3OW2A 1VQMA 1FVIA 1PTOC 1M90C 1HNZQ 3CP0A 2NTSA 2B8GA 4M8AA 4DV3L 1W6JA 2MJ8A 3HOYG 1PVOA 1B1ZA 4H7BA 5M5WB 2CFMA 2B2YA 4BY7H 3T1HQ 4DAPA 1TKWB 4K6LA 3GTPH 1JMCA 3DHQA 2A1AA 4BY1G 3I70A 1IXRA 3KF6B 1VQCA 5E3FA 3TP7A 2IX3A 4GLXA 3H6MA 3M4QA 1LUZA 1SDFA 4OO1I 4HCEA 2NUCA 1QILA 1EQRA 4A3MG 5M5YB 1X3EA 1RCVD 4V0BA 3BVGA 3C2PA 4JI8L 4GNXC 3MEHA 4JI3L 1A0IA 1AN8A 1XXGA 4GKJL 2NVTH 2B63H 1EQVA 5KNCA 1STEA 3W3AA 2JXMB 3KLRA 3S14H 3U9OA 4KMUC 1H95A 2F0VA 2LKVA 2KECA 4CJ0B 1UAPA 3HKSA 3M7GA 4DV0Q 1LV9A 2ENBA 4DF7A 4A3IB 1G8ZD 3T16A 2G5DA 3PO3G 1N32Q 2F0MA 2K03A 1YI2A 1XMOQ 5IP7H 4DK3C 1VQ7A 3S16H 2EYMA 4IFDJ 1C7YA 1UEBA 3I3CA 4L63B 2KJXA 1N36L 1HNXQ 1SMYD 2A73B 1UE7A 1STNA 1EZ6A 2AQ3B 2KHIA 1ILQA 1O78A 4FVMA 5E1FA 3S1RH 5JOBA 1NAPA 3FDTA 1RKNA 1NY4A 4BY7B 2L1BA 1VQ5A 3D6WA 4PG3A 3J7AV 4POFA 2EQSA 2Q2HA 3R8BA 1ONLA 5FJ8H 5IIFA 4A3IG 1N34Q 1WFQA 4ZKCB 5JEAJ 1PFNA 2HIVA 1WTHA 2OEOA 3KFUA 3IFTA 1QJOA 3PUXA 3EFXD 2A8VA 2RSOA 4CDDC 5GADC 5IYBH 1TWHB 4BXXG 1LABA 3M4OB 2NZOA 4RGOS 4A3GH 4DR7Q 3QO2A 4OO1H 1DJRD 1EU4A 1GO3E 2L9HA 5EKKA 1T9HA 1TWCH 4RWSC 4AIMA 2XWBB 2NVTB 4QCLA 1UE1A 4QY7A 1ZYRD 1JICA 1I5FA 5LMUL 3KF8A 1OO9B 4TKOB 4JV5Q 2DJGC 4L5TA 5IWAQ 3VR4A 1KLUD 2F1MA 4BY7G 1FNVA 3T4AC 2JN4A 3QOLA 2PW5A 3MC0B 4YHHL 4JI3Q 4C3JH 3FHWA 4RCOA 4JI0L 1VQAA 2K28A 3VYUA 1GVPA 1KAAA 1HZCA 5M5XH 5I9OA 1L1OC 1G91A 3M4PA 2VQEL 3S2HB 1WCMB 3U58A 1Y1VB 4DAYB 2FFKB 1G2SA 1KQSA 4LJZC 2D9UA 4JYAL 4JI5L 1GUSA 3UI2A 1U5KA 1Q82C 1N8RC 4RG1A 3S16B 1QZHA 3PUVA 5JJZA 1TWFH 1H9RA 2DN8A 3SK4A 3MXGA 2N49A 3AYHB 2QKIC 1LLRD 1B70B 1NE3A 1SE4A 1JB3A 2E76C 2CKZB 2ICEC 3W5OA 1NCVA 1IZ6A 4HIMA 4X62Q 4HR7B 3S1RB 4MTNA 4RCNA 2JA7H 2A5HA 3UDGA 1HTPA 1WTOA 3J81i 2F0IA 1CT1D 1KDBA 3H15A 5EBDA 4KN7C 1Z7TA 3MA2B 1BBWA 1MI2A 2XIWA 1AH9A 4C3IH 1N36Q 1IBKL 5I6YA 1HTLD 1MBYA 3K7AH 1S5FD 5HURA 1GUWA 3K0YA 3PIO3 2EJGC 1PH3A 1Y1VG 2GVAA 2LXKA 1JQYD 5IP7G 1K28A 2G9HD 4QUFA 3KDFA 4A3GB 5HGTA 3DM1A 2FHTA 3CCRA 4M1UB 1CKNA 1CHQD 1CM9A 5ELDA 3J80L 4HCSA 4P75A 2A68D 3JC66 5G3LD 4YY3Q 1PTOF 3TDQA 2ATWA 3SE0A 3T53B 2ASBA 3TSSA 4UP8A 3PV0A 1C8CA 3CMAA 2F0NA 4EQPA 1EY9A 3K57A 3A74A 4C3JB 1PRTC 1K8OA 5M5XB 2FJ2A 5FJ8G 1BKBA 4NB3A 2K4KA 1K8MA 4YWLA 4F7XA 4DV4L 2EYPA 2J7ZA 5C0XI 1M4VA 3GDEA 2MNAA 4UAIA 2CQAA 4DV1Q 5IYBG 2K52A 4B9XA 3I4MH 2JA9A 4BA2I 3GTGH 4X3UA 4JI0Q 1TWFB 2RF4A 4CDFC 4AQYQ 4A3GG 4OO1G 1GOZA 4X66L 2K5DA 1GUTA 2PPBC 4XQJA 1X3QA 3F2BA 1VQGA 4PMCA 1HH2P 3RR5A 5IY0A 4JYAQ 3GV6A 1X56A 3S1QB 5FLXc 3OYYA 3HFZB 3URYA 1KRSA 2JSOA 2WACA 5H1SE 2J4XA 2F3IA 1YVCA 4C3JG 1KD1C 2JA8H 1EQTA 4HJ9A 2NVYH 5FO8B 2IHFA 2MHVA 4GLVB 5ELFA 5DM63 4RGMA 2AKWB 1FJGQ 2MQHA 3STBC 1VQ9A 5C4XH 1HHVA 1B7YB 4PMBA 2I0QA 4RHRA 1E2WA 1V9PA 4IUUA 2A69C 3NQIA 3BZCA 1K83B 4TQUS 2HD3A 2E8GA 3SK8A 1IBKQ 5CV9A 4KY5A 4CKEA 2B2WC 2JJQA 1E1TA 4GOPC 4XQQA 3SHLA 2O5IC 3S15H 1NSNS 4GLAC 3HZXA 3CC2A 2PQAA 3RLNA 4ZYSA 3J81j 4J1MA 4OGQC 2K01A 5LL6X 1DZ1A 2YV5A 4CJ1B 4BA1I 2N8NA 5BN5A 2JK8A 2UUBQ 2DGYA 1PZID 1I4HA 3PF5A 2EJMA 3NELA 1DONA 2F0DA 3CRKC 4KKUA 3T1YQ 4K5XA 1D7QA 2VB2X 1IBMQ 3S24A 1VF7A 1J6QA 2K32A 3GQBA 2F0FA 3SVMA 1EEFD 5C0XH 5EPLA 4HAEA 1SYBA 2BDOA 4DR5Q 5LMNW 3E0EA 3MZ5A 1TVXA 4LUOA 1LTSD 2WFWA 3MXPA 4ZUIA 1BBXC 2O2LD 4XYQA 3CCMA 4G4KA 4IZ8A 1STAA 3LGJA 3I7FA 4L5QA 2HHHL 3BZKA 3EA6A 1KABA 1O7IA 4DAMA 5LMNQ 4MIUA 1ENFA 1G291 3OIQA 2Q8IB 2A6EC 2KEEA 1IYJB 3P7JA 4IPGA 4DR1L 1X3FA 4KY7A 4KJOA 3F2UA 3GTMB 2XWJB 1EUJA 1YNJD 3BDOA 1MHWC 5KGUA 2YTXA 1HRJA 1B4OA 1WTPA 2QEJC 2B2TC 2NYZD 3EN2A 3M9BA 5BR8Q 5IGCA 3I8ZA 3U50C 3K59A 4JOIC 5J22A 2ALYB 1I4RA 2XN9C 1KRTA 3OW7A 4RH6A 2JYOA 4IPCA 2SDFA 1B3QA 5KNDA 5ELBA 3QR8A 1AEXA 1CQFA 4A3JH 4B3SQ 3S17H 5EPKA 5IODA 1HA5A 2CH4A 3S15B 5A35A 2OTLA 1I3QH 4EQ5A 1WYDA 3NENA 1EIYB 5GQOA 3HOWH 4DUYL 2DY8A 4KLKA 1YJNA 1S4ZA 5IGFA 5IT9E 1EWIA 3KF6A 1X65A 1GUGA 1LTLA 2A69D 1Z47A 4IUVA 4L5RC 3Q24A 1EY8A 1U9RA 2LXJA 3FVQA 1XPOA 2NZ1D 2JA8G 1PV4A 1RD9D 1ET9A 2EYJA 3E5SA 5JVG3 1RHPA 4TRDA 1L0XB 2YU9H 2H1EA 4B3TQ 1K3BC 3CW2C 5C4XG 1GXDC 1V1OA 2X69A 3BZDB 5JJIA 2E2HB 3GTJB 2QDLA 3S1NB 1WD0A 2C9OA 3NBHA 5D14A 1NMGA 1J5EQ 1VDZA 3VA5A 1D6EC 2PO4A 3N6RA 2XVSA 2E74C 4DAVA 4IUTA 4B3RL 2AHOB 4IUPA 4EQNA 1HUNA 2LMCB 1F2MA 4DR3L 2UXCQ 1PH5A 1B53A 3K5MA 4K8JA 3FP9A 4PMWA 5I2YA 4O1NA 2IY5B 4OEMB 1HCZA 1JWSD 1IKMA 1YHAA 1X55A 4C1NK 1YBYA 1BDOA 4DUZQ 4A3MH 1PHJA 4PV1C 1YNNC 2QCPX 4BBRH 2HDLA 4DV2Q 5CV4A 1I6VC 2ZJQA 1PRTF 3I72A 2QILA 2HHHQ 5C4JB 1XMQL 4XT1B 1DGSA 4LF9L 1C9OA 4AYBB 3P20A 4DR4Q 2CVRA 2A6ED 1E2ZA 5C0XG 2UUAL 4KHPL 4JI7L 2IWHA 4A3JB 1EIHA 2EXZA 3S17B 2A19A 1KDCA 2YTVA 4KN4C 2R93B 3V96A 1XPUA 4JBJA 2EZVA 1JR0D 3HOWB 5F2DA 4YIJA 2WKDA 2TSSA 2NB0A 1QVFA 3L7ZC 5EJWA 2WAQG 3J81c 2Z4HA 3KBGA 3P1HA 2ID0A 2AWNA 1GJXA 3AFPA 3K0XA 4IQZA 3RMHA 5M5YH 4P71A 1A15A 1B9MA 1BCPD 2ES2A 2YU9B 2E5LQ 4UY8C 1D1KA 2Z9HA 3TQYA 4X65L 2D62A 4AYBE 1W2BA 2L11A 2QW7A 2KQ3A 4AYBG 2L15A 1EYDA 4NDXA 3Q22A 4IPDA 2PNHA 1Q1BA 4DK6C 4A3JG 4HIDA 2IPKD 2CHBD 2RCNA 1ICFB 2B39A 1F9RA 4A3IH 4IURA 5EQ0A 3HOWG 1MJEA 3MXUA 4DK1A 5EKIA 3TRZA 2OXPA 3CCVA 1Y8OB 2XGTA
chains in the Genus database with same CATH topology
1EQQA 3ULJA 4BXXG 2KBNA 3KLWA 1Q81C 3E9IA 5LMNL 4R4IA 2NZOA 5HGQA 1B8AA 1AE2A 1M1KC 1OXVA 4B3RQ 4A3GH 1P16A 4DR7Q 3RZOH 4A93G 2I5LX 1XNRQ 2JEBI 3I2ZA 1GO3E 2Q2UA 2JE6I 3WWVA 2JEAI 1T9HA 1TWCH 4AIMA 1HR0Q 3I4OA 3PO2G 1UE1A 3SGIA 4QY7A 3ULLA 4LF5L 4LNQA 1MJCA 1I5FA 1PFSA 3CQZH 1X9NA 1SFOH 5LMUL 5M3MG 5M3MH 1CUKA 4JV5Q 2BA1A 4JI4Q 4P74A 5FLMG 4L5TA 5IWAQ 5FLMH 4DR2L 4NXNL 5BR8L 3Q8DA 4IJLA 4BY7G 4HJ8A 1X3GA 2Z6KC 4YHHL 1E7ZA 4JI3Q 4LF4L 4C3JH 3FHWA 4JI0L 2VW9A 1VQAA 1WJJA 2B3GA 3M3YH 1GVPA 5GAGC 1HZCA 1LM0A 1KHIA 5M5XH 1L1OC 1JB7A 4GOPB 4B3SL 4LF8L 1JE5A 5IP9H 3M4PA 4LW1A 2B29A 2VQEL 3FKIH 3HKZE 1CKMA 3U58A 3CC4A 1VQ6A 3TS2A 4DAYB 4YWMA 1KQSA 2DUDA 1WI5A 3HKZG 2UUAQ 4JYAL 2GN5A 4JI5L 1U5KA 1TWHH 2Y0SE 4HJ5A 1Q82C 1N8RC 3HOVG 4RG1A 1N32L 1QZHA 1UWVA 2BA0A 1A62A 3PUVA 3M4OH 2Y0SG 1KXLA 2WB1E 4YWKA 5M3FH 1TWFH 2R92G 4BBRG 1PH2A 1SMXA 3AYHB 1VQFA 2N49A 2R7FA 1NE3A 1B70B 2WB1G 1VQDA 2IT1A 3KF8B 4EX5A 1E1OA 2CKZB 3W5OA 3JAMi 2CQOA 2D0PA 1HNZL 3VDYA 1IZ6A 4HIMA 4X62Q 2JA7G 4MTNA 4APVA 2JA7H 1KAWA 3UDGA 4B3TL 3NBHB 1SLJA 3MEFA 3J81i 1VQ8A 3HOZH 3H15A 1A8VA 3E9HA 4JG2A 3CCSA 4DR1Q 1U0LA 1BBWA 1X6OA 3CCJA 4R1JA 1EOVA 4C2MH 1Q12A 2K5NA 3T1HL 5C3EG 1AH9A 2KHJA 3HOUH 1TWAH 4C3IH 4A3FH 1N36Q 1J5EL 4K0KQ 3J80c 1IBKL 2Q2TA 3ERSX 4LFBL 3K7AH 4PZ8A 2JA5H 1YZ6A 1SR3A 3GTLH 1PH3A 3H0GG 3H0GH 3S2HH 1WCMH 4Y7NH 2UXCL 1Y1VG 1Y1VH 2ZM6Q 2GVAA 1SRUA 2LXKA 4X64Q 3UDIA 3RNUA 5IP7G 1IL2A 4B3ML 3KDFA 4MNOA 2IX1A 4R4CA 3CCRA 1CKNA 2ZJPA 1LYLA 4DUZL 4WJ4A 1VQHA 2N78A 1Y1WH 2RHQB 1CKOA 4OONA 4P75A 3RN5A 4DUYQ 3B6YA 3JC66 3RLFA 4YY3Q 4DV2L 3GTKH 1NBWA 5JJKA 4ALPA 2JQOA 2ATWA 1Y14B 5JEAG 2ASBA 3PUZA 3UDXA 4UP8A 2ZTDA 3PV0A 1HZAA 3PUYA 4LF6L 3CMAA 5IYCG 3AEVA 4DR4L 2K5VA 5AJ3L 3KOJA 2WP8J 3A74A 3K8AA 4A3DG 5IYDH 2MO0A 1OTCA 3RLOA 4WJ3M 5FJ8G 4XIGS 4DV3Q 4POGA 2VQFL 4DV0L 1BKBA 4XTCS 1PH1A 4LF5Q 2R93G 4NB3A 4UP7A 2K4KA 4YWLA 1Q7YC 4DV4L 1TXYA 3K81C 5C0XI 3GDEA 2MNAA 3K80C 4DR2Q 4NXML 2HT1A 1HR0W 1GKHA 4DV1Q 1KL9A 5IYBG 3KDFB 2K52A 1XJVA 4NXNQ 3I4MG 4QIWE 4O0AA 3I4MH 2JA9A 1EFWA 1OXUA 4HJ7A 1CKNB 3GTGH 4BA2I 3KYHC 3MXNB 3CPWA 4JI0Q 4AH6A 1PYBA 1RL2A 2RF4A 4KHZA 2NVQH 4AQYQ 4A3GG 4OO1G 4X66L 3PF4A 4LF8Q 1IBLL 1PH8A 4DR3Q 1L2FA 1PYSB 2FXQA 3STBD 3HOXH 4QGUA 3L2PA 4GNXA 2E5LL 3F2BA 1VQKA 3CPFA 1VQGA 2UXBQ 1HH2P 3RR5A 3PGZA 5IY0A 1HNXL 4JYAQ 5E7NA 3CF5A 1HJPA 4DV5L 3CD6A 4JI2L 1X56A 5EAYA 2D0OA 2KENA 2NN6I 3GTQH 2YYZA 1NTGA 5FLXc 1JJCB 3OYYA 2UUCL 3CCLA 2UU9Q 3HFZB 4OWTB 1KRSA 2VZAA 4FDBA 4JI8Q 4LFAL 5H1SE 2F3IA 1YVCA 3A0JA 4H02A 1Z9FA 4IOCA 1KD1C 2JA8H 4HJ9A 2NVYH 3CXCA 4GKJQ 1XNQL 4A3EG 2IHFA 2RHSB 3D31A 4YCUA 4A3EH 2QGQA 1XMQQ 4DV6L 1N33L 3UDFA 4GLVB 4LF9Q 2VUMH 5IP9G 1C0AA 2R7DA 4X6AH 3GTOH 1N34L 1FJGQ 3FKIG 2AKWB 2MQHA 2ZTEA 4JC0A 3STBC 5C4XH 1B7YB 1VQ9A 2VNUD 4DV7L 3HOYH 2I0QA 1Q46A 3J7A5 1VQ4A 4GKKQ 4JI6L 4KHPQ 2R7ZG 2F4VL 3K7UC 2Q2IA 4R4OA 1K73C 4JI7Q 4O2DA 1V9PA 1ASZA 4A3BH 4R4QA 2OTJA 3BZCA 1KIXA 3S1MH 1YJWA 5M3FG 4TQUS 3I4NG 3I4NH 2VL6A 2V1CC 2E8GA 4JCVE 3U4VA 1IBKQ 2VS1A 4A76A 1HZ9A 4OWWB 1VQIA 3AFQA 4GNXB 1VCIA 2JJQA 1E1TA 4DR7L 3NEMA 4GOPC 1XNRL 3J80i 3I56A 4BY1H 3S15H 2UXDL 1HR0L 4GLAC 4UPAA 2IX0A 3CC2A 3F8TA 2PQAA 2JA6H 2N3SA 5GAEC 4B3MQ 3RLNA 1PH7A 3J81j 3HOZG 3S1QH 4JV5L 4JI4L 5IWAL 4JI1Q 1OXTA 1S40A 2YV5A 4BA1I 1VQNA 2AWOA 2N8NA 5IT9c 2JK8A 1VQJA 2UUBQ 2K50A 2DGYA 4A3FG 3HOUG 2OCEA 1BVSA 3PF5A 4IFDG 4X65Q 3NELA 1PH6A 2JA5G 3T1YQ 1I94Q 4LFCQ 1W3SA 4A3KG 4HIKA 4A3KH 4OX9L 1D7QA 1IBMQ 3S24A 1WCMG 1K8AC 1J6QA 4GN3B 3DLLA 2K5HA 3F2CA 4GS3A 5M5WH 1E22A 2OQ0A 4IOAA 1I6HH 1TWGH 2PI2A 1QZGA 1VQLA 4P72A 4A4IA 4DR5Q 5LMNW 3E0EA 4IJHA 1K83H 3PIPA 1VQPA 3L0OA 4LUOA 2WFWA 2Z0SA 1YNXA 1Y1WG 4A3LH 3CCMA 1S3OA 4L5SA 2PQAB 3OTOL 4NXMQ 3PO3H 3I55A 2QEXA 3GD7A 4HJAA 3LGJA 2WAQE 1K0RA 4DPGA 1RIPA 3I7FA 4L5QA 5C0XJ 1YHQA 2AMCB 1D8LA 3BZKA 4X62L 1O7IA 4DAMA 2HHHL 5LMNQ 3PSIA 2R7ZH 2KCTA 1XPRA 1G291 4LUZA 2K75A 1UE5A 5IYBH 4J15A 1YIJA 1IYJB 1QVCA 2KCMA 5IYDG 4IPGA 1E3PA 1X3FA 1EIFA 4JBWA 5HY6A 1E24A 3ER0A 4QJFA 4A75A 1S72A 2GVBA 2QA4A 3KJOA 1EUJA 2Z6KA 3A5ZB 1JJ2A 5LMUQ 4K0KL 1CSQA 3PUWA 4JBMA 2YTXA 4DV5Q 4JI2Q 4UP9A 1XTDA 1L1OA 3EN2A 3M9BA 5BR8Q 1PA6A 4ME3A 3U50C 1VQOA 4LFAQ 4JOIC 5ELOA 3TREA 1VQBA 4MZ9A 2ZM6L 4YHHQ 1PH9A 2YTYA 2E2IH 2ALYB 2K14A 1KRTA 1V43A 4P73A 4X64L 3A5UA 1XMOL 1K3RA 1K9MC 1V1QA 1SE8A 4IPCA 1XNQQ 1K8GA 4A3JH 4DV6Q 4B3SQ 1N33Q 3S17H 1P8LA 2ZTCA 2MFIA 1G51A 3F2DA 2VQEQ 2F52A 3HOXG 1SN8A 2OTLA 1I3QH 1QUQA 1WYDA 3NENA 4EQ5A 1EIYB 5GQOA 2F4VQ 3HOWH 4DUYL 2PMZE 4KLKA 1YJNA 4Y52H 4YY3L 4JI6Q 3RZDH 4JI5Q 1EWIA 5C44H 3KF6A 2HQLA 1X65A 1LTLA 2MO1A 1Z47A 2IHEA 3ULPA 4L5RC 4RMFA 4BXXH 4C3HH 3J7ZC 1FGUA 1HNWL 2LXJA 2NVXH 1XPOA 3UE1A 4LF7L 2JA8G 2ZJRA 4A93H 1PV4A 3OW2A 1VQMA 2BH2A 1FVIA 3D0FA 3KJPA 2E2JH 4IO9A 1M90C 1BBUA 1HNZQ 2UXDQ 4HIOA 3CP0A 3CAMA 3GTMH 3PO2H 2VUMG 1L1OB 4DV3L 2YU9H 4DR6L 3PIOA 3G48A 4B3TQ 1Q1EA 3CW2C 5C4XG 2PI2E 3HOYG 1JT8A 1PVOA 1UE6A 3CCVA 5JJIA 1OXXK 3DM3A 2CFMA 4DNIA 4DV1L 3ZJYC 1FL0A 4A3BG 4TVAB 4OWXB 4BY7H 3T1HQ 1NMGA 1J5EQ 3H3VI 3GTPH 1QUQB 1JMCA 4AQYL 4LFBQ 4B3RL 1YHBA 2AHOB 1NMFA 2A1AA 1R9TH 4OX9Q 1WOCA 4BY1G 1IXRA 3KF6B 4DR3L 1VS0A 1VQCA 1PH5A 3S2DH 3BJUA 2UXCQ 3FP9A 4PMWA 4YCWA 2JA6G 4GLXA 3M4QA 2IY5B 1LUZA 1MKHA 4JBKA 2UXBL 2CWPA 2BH8A 1YHAA 3EBEA 1X55A 3GO5A 4OO1I 1AE3A 4A3CG 2R6GA 4A3CH 3HOVH 1YBYA 2HIXA 3W1BA 1EQRA 4A3MG 4DUZQ 1X3EA 4A3MH 1PHJA 4GN4B 3TS0A 1HZBA 4DKAC 2UU9L 4JI8L 4GNXC 3IRBA 4BBSG 3CCQA 2R92H 4BBRH 4BBSH 4JI3L 1A0IA 3OTOQ 1QVGA 4DV2Q 1EYGA 3UE0A 3U4ZA 2ZJQA 4GKJL 1I50H 1GM5A 3AQQA 4GN5A 4PZ7A 2B63G 2NVTH 2HHHQ 2B63H 1XMQL 1DGSA 3G4SA 4LF9L 1C9OA 4LF6Q 4QQBX 1FJGL 4DR4Q 5AJ3Q 3S14H 4QL5A 2H5XA 4LUVA 3G71A 1YITA 1A63A 1H95A 2E2HH 5GAHC 5C0XG 3GTJH 4NPSA 1N9WA 4R4TA 3M85A 3TEHB 3CC7A 2UUAL 3S1NH 4GKKL 4KHPL 3RN2A 4JI7L 3HKSA 2VQFQ 4DV0Q 4JOIA 4DR1L 2A19A 3CMEA 5K36G 2YTVA 5C3EH 3M7NA 5JJLA 1XPUA 4A3LG 1NJIC 4JBJA 4DV4Q 3JAMc 4PZ6A 1KC8C 3PO3G 1N32Q 1X54A 4LWCA 3CCEA 2I5HA 1QVFA 1YI2A 3L7ZC 3W1GA 5ELNA 2WAQG 1SROA 3J81c 1XMOQ 1CSPA 5IP7H 4DK3C 2ID0A 1GD7A 2AWNA 1VQ7A 1JJGA 4X66Q 3AFPA 3K0XA 3S16H 1G6PA 4IFDJ 1IBLQ 1YEZA 2NN6G 2OWOA 5M5YH 1C7YA 3F1ZA 2EXDA 4JI1L 4P71A 1UEBA 3ICEA 2CCZA 2ES2A 2E5LQ 3PCOB 2UUBL 4UY8C 1N36L 4OXPA 1HNXQ 2C35B 1UE7A 3TQYA 2KHIA 2D62A 4AYBE 5GROA 4X65L 5C4JH 3S1RH 2I5MX 1YJ9A 1W2BA 4LFCL 1Q8KA 3T1YL 1I94L 2UUCQ 1MIUA 2NZHA 3CCUA 1IBML 4AYBG 1ASYA 3G6EA 4KI0A 2L15A 1HNWQ 4YCVA 1NY4A 5IYCH 3EIVA 1VQ5A 4LF7Q 2XTIA 1OXSC 5DLQE 1L0WA 4IFDI 4IPDA 3BU2A 1PH4A 2VY3A 2PNHA 1Q1BA 4PG3A 4DK6C 4POFA 2EQSA 4HIDA 4A3JG 4A3DH 2RCNA 2Q2HA 4DR5L 4DR6Q 5FJ8H 2LSSA 2R93H 4A3IG 2OQKA 1WFQA 4A3IH 1N34Q 2CWAA 5JEAJ 3H3VH 5IE8A 2HIVA 4DV7Q 1MJEA 3HOWG 5J3BA 3KFUA 4IPHA 3PUXA 3TRZA 2A8VA 1VQEA 4GOPA 2EIFA 1Q86C 5C44G 4LF4Q 5GADC 2XGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQQ A;  3ULJ A;  4BXX G;  2KBN A;  3KLW A;  1Q81 C;  3E9I A;  5LMN L;  4R4I A;  2NZO A;  5HGQ A;  1B8A A;  1AE2 A;  1M1K C;  1OXV A;  4B3R Q;  4A3G H;  1P16 A;  4DR7 Q;  3RZO H;  4A93 G;  2I5L X;  1XNR Q;  2JEB I;  3I2Z A;  1GO3 E;  2Q2U A;  2JE6 I;  3WWV A;  2JEA I;  1T9H A;  1TWC H;  4AIM A;  1HR0 Q;  3I4O A;  3PO2 G;  1UE1 A;  3SGI A;  4QY7 A;  3ULL A;  4LF5 L;  4LNQ A;  1MJC A;  1I5F A;  1PFS A;  3CQZ H;  1X9N A;  1SFO H;  5LMU L;  5M3M G;  5M3M H;  1CUK A;  4JV5 Q;  2BA1 A;  4JI4 Q;  4P74 A;  5FLM G;  4L5T A;  5IWA Q;  5FLM H;  4DR2 L;  4NXN L;  5BR8 L;  3Q8D A;  4IJL A;  4BY7 G;  4HJ8 A;  1X3G A;  2Z6K C;  4YHH L;  1E7Z A;  4JI3 Q;  4LF4 L;  4C3J H;  3FHW A;  4JI0 L;  2VW9 A;  1VQA A;  1WJJ A;  2B3G A;  3M3Y H;  1GVP A;  5GAG C;  1HZC A;  1LM0 A;  1KHI A;  5M5X H;  1L1O C;  1JB7 A;  4GOP B;  4B3S L;  4LF8 L;  1JE5 A;  5IP9 H;  3M4P A;  4LW1 A;  2B29 A;  2VQE L;  3FKI H;  3HKZ E;  1CKM A;  3U58 A;  3CC4 A;  1VQ6 A;  3TS2 A;  4DAY B;  4YWM A;  1KQS A;  2DUD A;  1WI5 A;  3HKZ G;  2UUA Q;  4JYA L;  2GN5 A;  4JI5 L;  1U5K A;  1TWH H;  2Y0S E;  4HJ5 A;  1Q82 C;  1N8R C;  3HOV G;  4RG1 A;  1N32 L;  1QZH A;  1UWV A;  2BA0 A;  1A62 A;  3PUV A;  3M4O H;  2Y0S G;  1KXL A;  2WB1 E;  4YWK A;  5M3F H;  1TWF H;  2R92 G;  4BBR G;  1PH2 A;  1SMX A;  3AYH B;  1VQF A;  2N49 A;  2R7F A;  1NE3 A;  1B70 B;  2WB1 G;  1VQD A;  2IT1 A;  3KF8 B;  4EX5 A;  1E1O A;  2CKZ B;  3W5O A;  3JAM i;  2CQO A;  2D0P A;  1HNZ L;  3VDY A;  1IZ6 A;  4HIM A;  4X62 Q;  2JA7 G;  4MTN A;  4APV A;  2JA7 H;  1KAW A;  3UDG A;  4B3T L;  3NBH B;  1SLJ A;  3MEF A;  3J81 i;  1VQ8 A;  3HOZ H;  3H15 A;  1A8V A;  3E9H A;  4JG2 A;  3CCS A;  4DR1 Q;  1U0L A;  1BBW A;  1X6O A;  3CCJ A;  4R1J A;  1EOV A;  4C2M H;  1Q12 A;  2K5N A;  3T1H L;  5C3E G;  1AH9 A;  2KHJ A;  3HOU H;  1TWA H;  4C3I H;  4A3F H;  1N36 Q;  1J5E L;  4K0K Q;  3J80 c;  1IBK L;  2Q2T A;  3ERS X;  4LFB L;  3K7A H;  4PZ8 A;  2JA5 H;  1YZ6 A;  1SR3 A;  3GTL H;  1PH3 A;  3H0G G;  3H0G H;  3S2H H;  1WCM H;  4Y7N H;  2UXC L;  1Y1V G;  1Y1V H;  2ZM6 Q;  2GVA A;  1SRU A;  2LXK A;  4X64 Q;  3UDI A;  3RNU A;  5IP7 G;  1IL2 A;  4B3M L;  3KDF A;  4MNO A;  2IX1 A;  4R4C A;  3CCR A;  1CKN A;  2ZJP A;  1LYL A;  4DUZ L;  4WJ4 A;  1VQH A;  2N78 A;  1Y1W H;  2RHQ B;  1CKO A;  4OON A;  4P75 A;  3RN5 A;  4DUY Q;  3B6Y A;  3JC6 6;  3RLF A;  4YY3 Q;  4DV2 L;  3GTK H;  1NBW A;  5JJK A;  4ALP A;  2JQO A;  2ATW A;  1Y14 B;  5JEA G;  2ASB A;  3PUZ A;  3UDX A;  4UP8 A;  2ZTD A;  3PV0 A;  1HZA A;  3PUY A;  4LF6 L;  3CMA A;  5IYC G;  3AEV A;  4DR4 L;  2K5V A;  5AJ3 L;  3KOJ A;  2WP8 J;  3A74 A;  3K8A A;  4A3D G;  5IYD H;  2MO0 A;  1OTC A;  3RLO A;  4WJ3 M;  5FJ8 G;  4XIG S;  4DV3 Q;  4POG A;  2VQF L;  4DV0 L;  1BKB A;  4XTC S;  1PH1 A;  4LF5 Q;  2R93 G;  4NB3 A;  4UP7 A;  2K4K A;  4YWL A;  1Q7Y C;  4DV4 L;  1TXY A;  3K81 C;  5C0X I;  3GDE A;  2MNA A;  3K80 C;  4DR2 Q;  4NXM L;  2HT1 A;  1HR0 W;  1GKH A;  4DV1 Q;  1KL9 A;  5IYB G;  3KDF B;  2K52 A;  1XJV A;  4NXN Q;  3I4M G;  4QIW E;  4O0A A;  3I4M H;  2JA9 A;  1EFW A;  1OXU A;  4HJ7 A;  1CKN B;  3GTG H;  4BA2 I;  3KYH C;  3MXN B;  3CPW A;  4JI0 Q;  4AH6 A;  1PYB A;  1RL2 A;  2RF4 A;  4KHZ A;  2NVQ H;  4AQY Q;  4A3G G;  4OO1 G;  4X66 L;  3PF4 A;  4LF8 Q;  1IBL L;  1PH8 A;  4DR3 Q;  1L2F A;  1PYS B;  2FXQ A;  3STB D;  3HOX H;  4QGU A;  3L2P A;  4GNX A;  2E5L L;  3F2B A;  1VQK A;  3CPF A;  1VQG A;  2UXB Q;  1HH2 P;  3RR5 A;  3PGZ A;  5IY0 A;  1HNX L;  4JYA Q;  5E7N A;  3CF5 A;  1HJP A;  4DV5 L;  3CD6 A;  4JI2 L;  1X56 A;  5EAY A;  2D0O A;  2KEN A;  2NN6 I;  3GTQ H;  2YYZ A;  1NTG A;  5FLX c;  1JJC B;  3OYY A;  2UUC L;  3CCL A;  2UU9 Q;  3HFZ B;  4OWT B;  1KRS A;  2VZA A;  4FDB A;  4JI8 Q;  4LFA L;  5H1S E;  2F3I A;  1YVC A;  3A0J A;  4H02 A;  1Z9F A;  4IOC A;  1KD1 C;  2JA8 H;  4HJ9 A;  2NVY H;  3CXC A;  4GKJ Q;  1XNQ L;  4A3E G;  2IHF A;  2RHS B;  3D31 A;  4YCU A;  4A3E H;  2QGQ A;  1XMQ Q;  4DV6 L;  1N33 L;  3UDF A;  4GLV B;  4LF9 Q;  2VUM H;  5IP9 G;  1C0A A;  2R7D A;  4X6A H;  3GTO H;  1N34 L;  1FJG Q;  3FKI G;  2AKW B;  2MQH A;  2ZTE A;  4JC0 A;  3STB C;  5C4X H;  1B7Y B;  1VQ9 A;  2VNU D;  4DV7 L;  3HOY H;  2I0Q A;  1Q46 A;  3J7A 5;  1VQ4 A;  4GKK Q;  4JI6 L;  4KHP Q;  2R7Z G;  2F4V L;  3K7U C;  2Q2I A;  4R4O A;  1K73 C;  4JI7 Q;  4O2D A;  1V9P A;  1ASZ A;  4A3B H;  4R4Q A;  2OTJ A;  3BZC A;  1KIX A;  3S1M H;  1YJW A;  5M3F G;  4TQU S;  3I4N G;  3I4N H;  2VL6 A;  2V1C C;  2E8G A;  4JCV E;  3U4V A;  1IBK Q;  2VS1 A;  4A76 A;  1HZ9 A;  4OWW B;  1VQI A;  3AFQ A;  4GNX B;  1VCI A;  2JJQ A;  1E1T A;  4DR7 L;  3NEM A;  4GOP C;  1XNR L;  3J80 i;  3I56 A;  4BY1 H;  3S15 H;  2UXD L;  1HR0 L;  4GLA C;  4UPA A;  2IX0 A;  3CC2 A;  3F8T A;  2PQA A;  2JA6 H;  2N3S A;  5GAE C;  4B3M Q;  3RLN A;  1PH7 A;  3J81 j;  3HOZ G;  3S1Q H;  4JV5 L;  4JI4 L;  5IWA L;  4JI1 Q;  1OXT A;  1S40 A;  2YV5 A;  4BA1 I;  1VQN A;  2AWO A;  2N8N A;  5IT9 c;  2JK8 A;  1VQJ A;  2UUB Q;  2K50 A;  2DGY A;  4A3F G;  3HOU G;  2OCE A;  1BVS A;  3PF5 A;  4IFD G;  4X65 Q;  3NEL A;  1PH6 A;  2JA5 G;  3T1Y Q;  1I94 Q;  4LFC Q;  1W3S A;  4A3K G;  4HIK A;  4A3K H;  4OX9 L;  1D7Q A;  1IBM Q;  3S24 A;  1WCM G;  1K8A C;  1J6Q A;  4GN3 B;  3DLL A;  2K5H A;  3F2C A;  4GS3 A;  5M5W H;  1E22 A;  2OQ0 A;  4IOA A;  1I6H H;  1TWG H;  2PI2 A;  1QZG A;  1VQL A;  4P72 A;  4A4I A;  4DR5 Q;  5LMN W;  3E0E A;  4IJH A;  1K83 H;  3PIP A;  1VQP A;  3L0O A;  4LUO A;  2WFW A;  2Z0S A;  1YNX A;  1Y1W G;  4A3L H;  3CCM A;  1S3O A;  4L5S A;  2PQA B;  3OTO L;  4NXM Q;  3PO3 H;  3I55 A;  2QEX A;  3GD7 A;  4HJA A;  3LGJ A;  2WAQ E;  1K0R A;  4DPG A;  1RIP A;  3I7F A;  4L5Q A;  5C0X J;  1YHQ A;  2AMC B;  1D8L A;  3BZK A;  4X62 L;  1O7I A;  4DAM A;  2HHH L;  5LMN Q;  3PSI A;  2R7Z H;  2KCT A;  1XPR A;  1G29 1;  4LUZ A;  2K75 A;  1UE5 A;  5IYB H;  4J15 A;  1YIJ A;  1IYJ B;  1QVC A;  2KCM A;  5IYD G;  4IPG A;  1E3P A;  1X3F A;  1EIF A;  4JBW A;  5HY6 A;  1E24 A;  3ER0 A;  4QJF A;  4A75 A;  1S72 A;  2GVB A;  2QA4 A;  3KJO A;  1EUJ A;  2Z6K A;  3A5Z B;  1JJ2 A;  5LMU Q;  4K0K L;  1CSQ A;  3PUW A;  4JBM A;  2YTX A;  4DV5 Q;  4JI2 Q;  4UP9 A;  1XTD A;  1L1O A;  3EN2 A;  3M9B A;  5BR8 Q;  1PA6 A;  4ME3 A;  3U50 C;  1VQO A;  4LFA Q;  4JOI C;  5ELO A;  3TRE A;  1VQB A;  4MZ9 A;  2ZM6 L;  4YHH Q;  1PH9 A;  2YTY A;  2E2I H;  2ALY B;  2K14 A;  1KRT A;  1V43 A;  4P73 A;  4X64 L;  3A5U A;  1XMO L;  1K3R A;  1K9M C;  1V1Q A;  1SE8 A;  4IPC A;  1XNQ Q;  1K8G A;  4A3J H;  4DV6 Q;  4B3S Q;  1N33 Q;  3S17 H;  1P8L A;  2ZTC A;  2MFI A;  1G51 A;  3F2D A;  2VQE Q;  2F52 A;  3HOX G;  1SN8 A;  2OTL A;  1I3Q H;  1QUQ A;  1WYD A;  3NEN A;  4EQ5 A;  1EIY B;  5GQO A;  2F4V Q;  3HOW H;  4DUY L;  2PMZ E;  4KLK A;  1YJN A;  4Y52 H;  4YY3 L;  4JI6 Q;  3RZD H;  4JI5 Q;  1EWI A;  5C44 H;  3KF6 A;  2HQL A;  1X65 A;  1LTL A;  2MO1 A;  1Z47 A;  2IHE A;  3ULP A;  4L5R C;  4RMF A;  4BXX H;  4C3H H;  3J7Z C;  1FGU A;  1HNW L;  2LXJ A;  2NVX H;  1XPO A;  3UE1 A;  4LF7 L;  2JA8 G;  2ZJR A;  4A93 H;  1PV4 A;  3OW2 A;  1VQM A;  2BH2 A;  1FVI A;  3D0F A;  3KJP A;  2E2J H;  4IO9 A;  1M90 C;  1BBU A;  1HNZ Q;  2UXD Q;  4HIO A;  3CP0 A;  3CAM A;  3GTM H;  3PO2 H;  2VUM G;  1L1O B;  4DV3 L;  2YU9 H;  4DR6 L;  3PIO A;  3G48 A;  4B3T Q;  1Q1E A;  3CW2 C;  5C4X G;  2PI2 E;  3HOY G;  1JT8 A;  1PVO A;  1UE6 A;  3CCV A;  5JJI A;  1OXX K;  3DM3 A;  2CFM A;  4DNI A;  4DV1 L;  3ZJY C;  1FL0 A;  4A3B G;  4TVA B;  4OWX B;  4BY7 H;  3T1H Q;  1NMG A;  1J5E Q;  3H3V I;  3GTP H;  1QUQ B;  1JMC A;  4AQY L;  4LFB Q;  4B3R L;  1YHB A;  2AHO B;  1NMF A;  2A1A A;  1R9T H;  4OX9 Q;  1WOC A;  4BY1 G;  1IXR A;  3KF6 B;  4DR3 L;  1VS0 A;  1VQC A;  1PH5 A;  3S2D H;  3BJU A;  2UXC Q;  3FP9 A;  4PMW A;  4YCW A;  2JA6 G;  4GLX A;  3M4Q A;  2IY5 B;  1LUZ A;  1MKH A;  4JBK A;  2UXB L;  2CWP A;  2BH8 A;  1YHA A;  3EBE A;  1X55 A;  3GO5 A;  4OO1 I;  1AE3 A;  4A3C G;  2R6G A;  4A3C H;  3HOV H;  1YBY A;  2HIX A;  3W1B A;  1EQR A;  4A3M G;  4DUZ Q;  1X3E A;  4A3M H;  1PHJ A;  4GN4 B;  3TS0 A;  1HZB A;  4DKA C;  2UU9 L;  4JI8 L;  4GNX C;  3IRB A;  4BBS G;  3CCQ A;  2R92 H;  4BBR H;  4BBS H;  4JI3 L;  1A0I A;  3OTO Q;  1QVG A;  4DV2 Q;  1EYG A;  3UE0 A;  3U4Z A;  2ZJQ A;  4GKJ L;  1I50 H;  1GM5 A;  3AQQ A;  4GN5 A;  4PZ7 A;  2B63 G;  2NVT H;  2HHH Q;  2B63 H;  1XMQ L;  1DGS A;  3G4S A;  4LF9 L;  1C9O A;  4LF6 Q;  4QQB X;  1FJG L;  4DR4 Q;  5AJ3 Q;  3S14 H;  4QL5 A;  2H5X A;  4LUV A;  3G71 A;  1YIT A;  1A63 A;  1H95 A;  2E2H H;  5GAH C;  5C0X G;  3GTJ H;  4NPS A;  1N9W A;  4R4T A;  3M85 A;  3TEH B;  3CC7 A;  2UUA L;  3S1N H;  4GKK L;  4KHP L;  3RN2 A;  4JI7 L;  3HKS A;  2VQF Q;  4DV0 Q;  4JOI A;  4DR1 L;  2A19 A;  3CME A;  5K36 G;  2YTV A;  5C3E H;  3M7N A;  5JJL A;  1XPU A;  4A3L G;  1NJI C;  4JBJ A;  4DV4 Q;  3JAM c;  4PZ6 A;  1KC8 C;  3PO3 G;  1N32 Q;  1X54 A;  4LWC A;  3CCE A;  2I5H A;  1QVF A;  1YI2 A;  3L7Z C;  3W1G A;  5ELN A;  2WAQ G;  1SRO A;  3J81 c;  1XMO Q;  1CSP A;  5IP7 H;  4DK3 C;  2ID0 A;  1GD7 A;  2AWN A;  1VQ7 A;  1JJG A;  4X66 Q;  3AFP A;  3K0X A;  3S16 H;  1G6P A;  4IFD J;  1IBL Q;  1YEZ A;  2NN6 G;  2OWO A;  5M5Y H;  1C7Y A;  3F1Z A;  2EXD A;  4JI1 L;  4P71 A;  1UEB A;  3ICE A;  2CCZ A;  2ES2 A;  2E5L Q;  3PCO B;  2UUB L;  4UY8 C;  1N36 L;  4OXP A;  1HNX Q;  2C35 B;  1UE7 A;  3TQY A;  2KHI A;  2D62 A;  4AYB E;  5GRO A;  4X65 L;  5C4J H;  3S1R H;  2I5M X;  1YJ9 A;  1W2B A;  4LFC L;  1Q8K A;  3T1Y L;  1I94 L;  2UUC Q;  1MIU A;  2NZH A;  3CCU A;  1IBM L;  4AYB G;  1ASY A;  3G6E A;  4KI0 A;  2L15 A;  1HNW Q;  4YCV A;  1NY4 A;  5IYC H;  3EIV A;  1VQ5 A;  4LF7 Q;  2XTI A;  1OXS C;  5DLQ E;  1L0W A;  4IFD I;  4IPD A;  3BU2 A;  1PH4 A;  2VY3 A;  2PNH A;  1Q1B A;  4PG3 A;  4DK6 C;  4POF A;  2EQS A;  4HID A;  4A3J G;  4A3D H;  2RCN A;  2Q2H A;  4DR5 L;  4DR6 Q;  5FJ8 H;  2LSS A;  2R93 H;  4A3I G;  2OQK A;  1WFQ A;  4A3I H;  1N34 Q;  2CWA A;  5JEA J;  3H3V H;  5IE8 A;  2HIV A;  4DV7 Q;  1MJE A;  3HOW G;  5J3B A;  3KFU A;  4IPH A;  3PUX A;  3TRZ A;  2A8V A;  1VQE A;  4GOP A;  2EIF A;  1Q86 C;  5C44 G;  4LF4 Q;  5GAD C;  2XGT A; 
#chains in the Genus database with same CATH topology
 1QNU A;  5D3I B;  1AZP A;  1X32 A;  2F03 A;  1FD7 D;  3BDC A;  4R4I A;  1QWY A;  1B8A A;  2EVB A;  3NP8 A;  1M1K C;  4B3R Q;  1TS3 A;  1P16 A;  3RZO H;  2I5L X;  1C48 A;  2JEB I;  2WB1 B;  3I2Z A;  2Q2U A;  1E0B A;  3WWV A;  2JEA I;  1JWM D;  1RTO A;  1HR0 Q;  3I4O A;  4KJN A;  4LF5 L;  4LNQ A;  1MJC A;  1PFS A;  1X9N A;  1D2B A;  1CUK A;  3DEO A;  5C3W A;  2D2C C;  2ZXP A;  4JI4 Q;  5FLM G;  4DR2 L;  3JAM E;  4HTH A;  5CV7 A;  3NTK A;  1YNN D;  4HJ8 A;  2Z6K C;  4KD4 A;  4LF4 L;  2O4X A;  5LL6 S;  1JOO A;  2I46 A;  2VW9 A;  1VF5 C;  5GAG C;  4S3S A;  1KHI A;  5D3D A;  1DD2 A;  1KTK A;  1JE5 A;  4WRD A;  3GTL B;  2TMP A;  2K1B A;  4N9T A;  5E4W C;  3FKI H;  4Y7N B;  3HKZ E;  1ZYR C;  3TS2 A;  4YWM A;  3HS0 C;  2UUA Q;  3HKZ G;  1IYU A;  5T1I A;  3VR2 A;  1S5E D;  1TWH H;  4HJ5 A;  3MTS A;  2BA0 A;  4ZLT F;  3M4O H;  2WB1 E;  2EY1 A;  3OMC A;  2PYK A;  4BBR G;  1H9M A;  2VB3 X;  2F0Q A;  2WB1 G;  3JAM i;  3GTK B;  1PTO H;  4WFN 3;  2L5T A;  1D5X C;  4APV A;  1KAW A;  1STB A;  3C1F A;  3NBH B;  1SLJ A;  1VQ8 A;  3HOZ H;  2ZXO A;  2MP1 A;  4JG2 A;  1U4P A;  1ROD A;  3EVQ A;  1X6O A;  3CCJ A;  4R1J A;  2HCI A;  2EY2 A;  3HOU H;  1TWA H;  4K0K Q;  2EDG A;  1MD2 D;  1EU3 A;  1RTN A;  2Q2T A;  3ERS X;  1ENC A;  3KBX A;  4LFB L;  2RCF A;  2JA5 H;  3AB9 A;  3S2H H;  1WCM H;  1Y1V H;  1SRU A;  4X64 Q;  1JCK B;  1IYV A;  1O7Y A;  1IL8 A;  4U67 3;  4B3M L;  2NVQ B;  5C5L A;  2EY5 A;  4R8N A;  3RZO B;  4R4C A;  2ZJP A;  2SOB A;  2N78 A;  2RHQ B;  1CKO A;  1SAP A;  3JAM L;  3RN5 A;  3B6Y A;  5NUC A;  2PQE A;  1NBW A;  2RSN A;  3ZYY X;  5JJK A;  4Z9C B;  2RDF A;  2ZTD A;  1HZA A;  3MHB A;  4LF6 L;  3AEV A;  1S5D D;  5AJ3 L;  1B50 A;  2AQ1 B;  3NWS A;  3K8A A;  5IYD H;  4A3E B;  1LTI D;  4XIG S;  4DV3 Q;  4CDC C;  2VQF L;  4LF5 Q;  4HSV A;  1TU2 B;  3FKI B;  1TXY A;  1R4Q B;  3E6Z X;  2A68 C;  4DR2 Q;  3K80 C;  2A6H D;  3H94 A;  4ABN A;  1EFW A;  4HJ7 A;  3EJI A;  1RF2 D;  3CPW A;  1DOL A;  3TZU A;  4AH6 A;  1RL2 A;  3I4N B;  3NHH A;  3PF4 A;  3G7L A;  4MN3 A;  1BNZ A;  5EKL A;  1A3U A;  1ZEQ X;  3PIP 3;  1IBL L;  5ELC A;  1PTO B;  1L2F A;  4HMJ A;  1B3A A;  5C5M A;  2K5Q A;  3BVZ A;  3CPF A;  1G6Z A;  3FPU B;  3PGZ A;  4JK1 C;  5E7N A;  3FEW X;  1HJP A;  2WIN B;  3CF5 A;  4JI2 L;  3HOZ B;  3J80 E;  4R8I A;  2UUC L;  4QF4 A;  4OWT B;  4ULL A;  4JI8 Q;  4IOC A;  1DM0 B;  1Z9F A;  2R61 A;  1XX8 A;  1TWA B;  3BG3 A;  3HOU B;  3OOC A;  3CXC A;  4GKJ Q;  1EY4 A;  4A3E G;  2RHS B;  1N33 L;  2JA5 B;  2A74 C;  4KY6 A;  1TQO A;  3FKI G;  3MFY A;  1H9S B;  3HGB A;  1CTM A;  4DV7 L;  2VNU D;  1I6H B;  2F4V L;  2K05 A;  5CV6 A;  4O2D A;  2G9D A;  1ASZ A;  2OTJ A;  2ICI A;  1YJW A;  4EGV A;  3I4N G;  2VS1 A;  1HZ9 A;  2B2V A;  1V1P B;  4GNX B;  1XNR L;  3J80 i;  3D4D A;  2UXD L;  4UPA A;  3ERO A;  2IX0 A;  1R4P B;  5COR A;  2L12 A;  4B3M Q;  2MPM A;  3HOZ G;  3S1Q H;  1WVL A;  1ENA A;  2SNM A;  1OXT A;  2RBM A;  1S40 A;  1EY6 A;  2KVM A;  5IT9 c;  2K50 A;  3HOU G;  1JE4 A;  1KNE A;  2OCE A;  1K0S A;  2JA5 G;  1SND A;  2AUJ D;  3K6O A;  1WCM G;  3KLS X;  2WV6 D;  1I4G A;  1UUP A;  4OL7 A;  4P2C B;  2RDG A;  3F2C A;  3FPP A;  1QZG A;  4P72 A;  4CJ2 C;  1K83 H;  1VQP A;  2ZXR A;  2EYF A;  2KHS A;  2Z0S A;  1BQQ T;  1YNX A;  3I73 A;  3BDL A;  3I55 A;  4B9W A;  3QWN A;  4HJA A;  2CH4 W;  4DPG A;  2LFN A;  4ZUJ A;  4OEL B;  2K75 A;  1UE5 A;  1PFB A;  2R3Z A;  3DWA A;  2LS0 1;  5A2Q E;  1QVC A;  3C1E A;  5JPN C;  5JVH 3;  5IYD G;  5HY6 A;  4O42 A;  3HG9 A;  4JBW A;  2EIF A;  1S72 A;  2GVB A;  2QA4 A;  1A3V A;  3HP3 A;  3A5Z B;  4FNF A;  5LMU Q;  1IHZ A;  4JI2 Q;  1Q3L A;  1ET6 A;  3NSW A;  3TN2 A;  1BOS A;  5ELO A;  1XJV A;  4MZ9 A;  2ZM6 L;  4YHH Q;  2YTY A;  2K14 A;  1K9M C;  1V1Q A;  1M8A A;  2K5W A;  3BYT B;  5AFW A;  1N33 Q;  1P8L A;  2MFI A;  2F0E A;  1SXT A;  1TS2 A;  4ZKB B;  1SE3 A;  2VQE Q;  1SN8 A;  2NTT A;  3R2T A;  4FXD A;  1JWU D;  1Y8N B;  1YNJ C;  5J1Z A;  3VR6 A;  4Y52 H;  4JI5 Q;  4FXG C;  2Z4I A;  3Q0A A;  2MO1 A;  3HOV B;  2IHE A;  4H44 C;  1JOK A;  2C5C A;  5I9P A;  1CA5 A;  3L9A X;  3UE1 A;  1O7Z A;  4LF7 L;  4BBS B;  2ZJR A;  4A93 H;  4DN4 M;  5IGE A;  2BH2 A;  1BBU A;  1WD1 A;  2UXD Q;  3CAM A;  3GTM H;  3PO2 H;  1L1O B;  4DR6 L;  3G48 A;  3T51 B;  2PI2 E;  4CKB A;  3DM3 A;  5IGB A;  2F0J A;  3ZJY C;  4TVA B;  4OWX B;  1LTB D;  3TP6 A;  3H3V I;  5C3E B;  2FIN B;  2AUK A;  1LTA D;  4IAL A;  1R9T H;  4K8I A;  4CGY B;  1WOC A;  5BN4 A;  3PQI A;  1VS0 A;  5A2Q L;  5CV8 A;  2KED A;  2JP1 A;  4G7O C;  4YCW A;  3IL8 A;  2EYL A;  4J8Q A;  1MKH A;  2UXB L;  2BH8 A;  4OHJ A;  1DYQ A;  4A3C G;  2HIX A;  1TR5 A;  3W1B A;  1SYC A;  2HUG A;  2MGS A;  5I2X A;  5KNB A;  4GN4 B;  2UU9 L;  1J8I A;  2Z1C A;  4BBS G;  3CCQ A;  2EYH A;  5J39 A;  3U4Z A;  1HQM C;  1GM5 A;  4PNY A;  4PZ7 A;  3VA7 A;  2F3V A;  3G4S A;  1KDA A;  2K04 A;  4DK0 A;  4LUV A;  2PNR C;  3OWF A;  1YIT A;  2E2H H;  1A2U A;  5GAH C;  3GTJ H;  4NPS A;  3M85 A;  3NXW A;  4R4T A;  3TEH B;  3CC7 A;  3S1N H;  4GKK L;  2B2T A;  3RN2 A;  3C46 A;  1QE6 A;  4JOI A;  1EYC A;  4ODG A;  2SEB D;  3M7N A;  3A8I E;  1ESF A;  3D4W A;  3R93 A;  4DV4 Q;  3JAM c;  4PZ6 A;  4ILW A;  2B2U C;  1AZQ A;  1FNW A;  1S5B D;  4LWC A;  4I7A A;  3E0J A;  3CCE A;  2XRS D;  5C4H A;  1HA6 A;  3SR1 A;  3VYR A;  3CHB D;  5ELN A;  1CSP A;  3K58 A;  1GD7 A;  2Q8R E;  4X66 Q;  1SNP A;  1G6P A;  4A93 B;  2OWO A;  1YEZ A;  3F1Z A;  1PRT B;  4JI1 L;  3ICE A;  1QCB D;  3LX0 A;  3PO2 B;  3PCO B;  1SFO B;  4OXP A;  2K6A A;  1STY A;  5M3M B;  5GRO A;  5C4J H;  2I5M X;  1HXY D;  4LFC L;  1Q8K A;  1I94 L;  5JEA H;  3CCU A;  3G6E A;  2Z8L A;  4KI0 A;  4YCV A;  5IYC H;  2F0L A;  3EIV A;  3OPO A;  4LF7 Q;  1OXS C;  2IJ0 A;  5DLQ E;  1L0W A;  2XNA C;  4ME5 A;  1G2T A;  1EL0 A;  4RGT A;  1R9T B;  4DR6 Q;  2F0O A;  2LSS A;  2R93 H;  2CWA A;  3H3V H;  1BCP C;  5FKA C;  5J3B A;  5TSS A;  1EZ8 A;  1TII D;  1VQE A;  1U4R A;  1EQQ A;  4FO2 A;  2KBN A;  4RHS A;  1Q81 C;  2Y0S B;  2RA4 A;  3J7Y W;  4A93 G;  4RKB A;  2PZT A;  4KKS A;  2JE6 I;  1EEI D;  3PO2 G;  1X3P A;  3SGI A;  1GUO A;  5FK9 C;  3ULL A;  2HQE A;  3KLS A;  5M3M G;  4DXF A;  4P74 A;  3H91 A;  5FLM H;  4NXN L;  3K5N A;  3Q8D A;  3R2I A;  1X3G A;  1E7Z A;  1TY2 A;  1WJJ A;  3M4Y A;  3GP7 A;  3M3Y H;  4KHV A;  2F3W A;  1CZG A;  1JB7 A;  3VR3 A;  4GOP B;  1CZW A;  3FRP B;  1BR9 A;  4LW1 A;  3H0G B;  1VQ6 A;  3ONA B;  2Y0S E;  1A62 A;  2Y0S G;  2EOT A;  1KXL A;  5M3F H;  1SMX A;  1VQF A;  4X3K A;  2DY7 A;  2IT1 A;  2CQO A;  2D0P A;  4QMG A;  1HNZ L;  3VDY A;  1MGS A;  3L3O C;  3A8J E;  4JW0 A;  5CBA E;  1I4Q A;  1ZKO A;  1IKL A;  1A8V A;  4FF4 A;  3K5O A;  4DR1 Q;  5C4Z A;  1Q12 A;  3RD4 A;  3T1H L;  2PW7 A;  3J80 c;  1IW7 C;  4PZ8 A;  2BE5 D;  1YZ6 A;  2RQX A;  3GTL H;  4XYO A;  3H0G G;  2AQ2 B;  1UNS A;  3SXH A;  4Y7N H;  2M9V A;  4V19 0;  1BUV T;  1HPC A;  1VMC A;  3RNU A;  1IL2 A;  3NBI A;  4MNO A;  2IX1 A;  1II3 A;  1CFM A;  1LAC A;  1LYL A;  2F0K A;  4WJ4 A;  4DNR B;  4OON A;  2F0S A;  4DUY Q;  3PMF A;  3RLF A;  3GTK H;  1MSG A;  3SEB A;  5L37 A;  3NE5 B;  2OF1 A;  4ALP A;  2V4D A;  1Y14 B;  5JEA G;  3PUZ A;  1GUN A;  3PUY A;  1DXM A;  5IYC G;  2K5V A;  2CW0 D;  3D3R A;  1PMR A;  5M9O A;  2E2D C;  3M3Y B;  4WJ3 M;  3CRL C;  2NBF A;  4DV0 L;  3QB3 A;  2R93 G;  3S9W A;  3N52 A;  4N9P A;  5CC4 A;  2MUY A;  5T1G A;  3K81 C;  3X3M A;  4NXM L;  2BCO A;  1HR0 W;  4NXN Q;  1SYG A;  4FF1 A;  4FP5 D;  1N32 L;  2QDB A;  3KYH C;  1H9S A;  5M3F B;  5LHY 1;  4KHZ A;  2NVQ H;  3ND9 A;  1EWH A;  4H13 C;  1NUC A;  4DR3 Q;  4BY1 B;  4PQX A;  1V1P A;  4GNX A;  4WJW A;  1HNX L;  1TS5 A;  5EAY A;  2D0O A;  2NN6 I;  2YYZ A;  4B08 A;  2A6H C;  2VZA A;  4FXK C;  3A0J A;  4RGN A;  1XNQ L;  2F0P A;  2P5Z X;  4A3E H;  2KA7 A;  2QGQ A;  1XMQ Q;  3UDF A;  4LF9 Q;  2VUM H;  4X6A H;  4A3K B;  1N34 L;  1BXT A;  1Q46 A;  3I4L A;  4DA2 A;  1Q8I A;  3J7A 5;  4XQN A;  1DOK A;  5FLX L;  4KHP Q;  4JI7 Q;  2Q2I A;  1K73 C;  1TWG B;  4A3B H;  4KKT A;  1KIX A;  4K14 A;  5M3F G;  3I4N H;  3U4V A;  1IW7 D;  1VQI A;  3AFQ A;  3A56 A;  4DR7 L;  3NEM A;  4RAU C;  5KIX A;  3SK5 A;  5EPJ A;  3PO3 B;  2EPB A;  3MFG A;  1KLG D;  2HDM A;  3R3O A;  2R7Z B;  1CHP D;  3F8T A;  1LT3 D;  5KYL A;  2Q8T A;  2JA6 H;  1ESR A;  1CK1 A;  2N3S A;  1PH7 A;  4JV5 L;  4FF2 A;  3DWP A;  1TS4 A;  4MHE A;  4MTK A;  4J6H A;  5IWA L;  5CGK A;  5FO7 B;  2GA4 B;  2M00 A;  3TZD A;  4X65 Q;  4OX9 L;  1W3S A;  4A3K G;  1I4X A;  4HIK A;  2B2Y C;  3DUZ A;  2E75 C;  1SNO A;  5FOB B;  2HCC A;  2VXW A;  4UDU C;  1SNQ A;  2K5H A;  1BCP F;  4CKC A;  3C3L A;  2F0U A;  2E2I B;  4IOA A;  1I6H H;  2PI2 A;  1DOM A;  3AMU A;  2NWG A;  4IJH A;  4F8M A;  3PIP A;  5K36 H;  4DNT B;  3V2T A;  5I6W A;  4A3L H;  1FNU A;  1S3O A;  3OTO L;  4NXM Q;  4XXE A;  2QEX A;  3GD7 A;  3CU7 A;  5C0X J;  1RIP A;  1YHQ A;  2R7Z G;  1D8L A;  4X62 L;  4G57 A;  3PSI A;  4C3H B;  1H9K A;  1XPR A;  3TME A;  2NVX B;  4NP5 A;  4IUN A;  3GV3 A;  5BN3 A;  1HUM A;  4ID6 A;  2F0G A;  1SJE D;  1QNK A;  2NN6 H;  2KOL A;  1EIF A;  1GHJ A;  1E24 A;  1F2Z A;  1SYE A;  3ER0 A;  2VUM B;  1SYF A;  1CSQ A;  3PUW A;  2X6L A;  1KNA A;  1L1O A;  3ITP A;  4ME3 A;  1VQO A;  1O7L A;  1GHK A;  4A3B B;  1VQB A;  4KD3 A;  4LF4 Q;  5CV5 A;  3OSO A;  4P73 A;  1K3R A;  1Y8P B;  1PTO D;  3GTP B;  1SE8 A;  2F0H A;  4K2K A;  1XNQ Q;  2L0C A;  4KV6 A;  4XT3 B;  1JOQ A;  2ZTC A;  3SK6 A;  2WKC A;  1G51 A;  1V8Q A;  2F52 A;  3QIA A;  3A54 A;  2JA6 B;  1T5E A;  4CDE C;  1J9O A;  4YY3 L;  3RZD H;  5C44 H;  4N8X 1;  3NQT A;  3NPP A;  3ULP A;  1PFM A;  4RMF A;  3EQL C;  3TBI B;  4C3H G;  4CHT B;  3TP8 A;  1FGU A;  1HNW L;  1U4L A;  5IGD A;  3D0F A;  3KJP A;  2E2J H;  4IO9 A;  4HIO A;  4TSS A;  4U68 A;  2VUM G;  2B63 B;  3Q6S A;  3PIO A;  1Q1E A;  1JT8 A;  3S14 B;  4G7Z C;  1UE6 A;  3Q23 A;  2WII B;  1OXX K;  1EFI D;  4DNI A;  1WTQ A;  4NW2 A;  3LWU A;  4DV1 L;  1FL0 A;  1FR3 A;  4A3B G;  1AP0 A;  3VYS A;  4X3T A;  1LTR D;  1FYC A;  1QUQ B;  4AQY L;  4LFB Q;  2KCN A;  1PDQ A;  1YHB A;  1NMF A;  3J81 E;  4OX9 Q;  4G7H C;  3S2D H;  3BJU A;  1BO0 A;  2QF7 A;  2BOS A;  2JA6 G;  3MVV A;  4JBK A;  2CWP A;  3EBE A;  3GO5 A;  1AE3 A;  2R6G A;  5CYU A;  1O80 A;  3HOV H;  4A3C H;  3NTI A;  3TS0 A;  1HZB A;  4DKA C;  3CKI B;  3IRB A;  2R92 H;  4BBS H;  3WOE A;  1QVG A;  3OTO Q;  1EYG A;  4IUQ A;  5FO9 B;  3UE0 A;  1JC7 A;  1I50 H;  3AQQ A;  4GN5 A;  3G6J B;  2B63 G;  2Z6B A;  1EY0 A;  4C1N I;  1ICW A;  4LF6 Q;  4QQB X;  1FJG L;  2J0T D;  5AJ3 Q;  3VYT A;  4QL5 A;  2H5X A;  3G71 A;  1A63 A;  1PLF A;  1N9W A;  5ELE A;  2N88 A;  2VQF Q;  1NR4 A;  3CME A;  5K36 G;  2L55 A;  5C3E H;  5JJL A;  3D8G A;  5EBC A;  1NJI C;  4A3L G;  3I90 A;  2OT2 A;  1KC8 C;  2IW3 A;  3A7A B;  1X54 A;  3RZD B;  4HSP A;  5C44 B;  1F9S A;  2I5H A;  3W1G A;  4EQO A;  1SJH D;  4HMI A;  1SRO A;  3FMC A;  3QG1 A;  1WTR A;  2B2V C;  4N8F A;  1JJG A;  3QJY A;  4LAA A;  5CR3 A;  1IBL Q;  2NN6 G;  2E2J B;  1LT5 D;  2EXD A;  3MXN A;  5DAU A;  1TWC B;  2L4N A;  2CCZ A;  5COY A;  1C4Q A;  4LMQ D;  2UUB L;  1F2Y A;  1L0Y B;  2C35 B;  3QOJ A;  4ZK9 B;  1YJ9 A;  4FF3 A;  3T1Y L;  2UUC Q;  1I4P A;  1MIU A;  2NZH A;  3J81 L;  1IBM L;  1HNW Q;  1LO5 D;  2K7V A;  5IOC A;  4KTA A;  2XTI A;  1ZXT A;  3A7L A;  4IFD I;  1PH4 A;  3BU2 A;  4XDX A;  4R9W A;  2VY3 A;  3LWE A;  4A3D H;  4DR5 L;  1STH A;  4Q0F A;  2OQK A;  3S2D B;  5IE8 A;  4DV7 Q;  2PCF B;  4IPH A;  4ZCK A;  2B2W A;  4GOP A;  1WTV A;  1VQL A;  5E4X A;  2DNC A;  5C44 G;  1Q86 C;  2F4V Q;  3OIP A;  3ULJ A;  3SDZ A;  5IGG A;  3KLW A;  3E9I A;  5LMN L;  1HFG A;  1MSH A;  4L6T B;  1LT4 D;  5HGQ A;  1AE2 A;  3WDN A;  1OXV A;  3NK9 A;  2R92 B;  1XTC D;  5EGT A;  3T13 A;  1XNR Q;  4GZY C;  2BDN A;  1LTG D;  1I50 B;  1Y69 U;  2JA7 B;  1SEB D;  3CQZ H;  1SFO H;  4OIK A;  1HQR D;  4ZQ3 A;  5M3M H;  2BA1 A;  3KUP A;  1BF4 A;  2RVL A;  5BR8 L;  1B2T A;  4IJL A;  3D6C A;  2K33 A;  4JPB W;  1CA6 A;  4C3I B;  2B3G A;  1LM0 A;  3J7A F;  4RKL A;  5I4D A;  3K7A B;  4B3S L;  4LF8 L;  1CQV A;  5IP9 H;  2B29 A;  1CKM A;  3CC4 A;  2O5J C;  1F9Q A;  2DUD A;  1WI5 A;  1U4M A;  2DJF C;  2B2U A;  4H0L C;  2GN5 A;  4CBV A;  1ILP A;  3HOV G;  1UWV A;  5JPM C;  1QOH A;  4YWK A;  2R92 G;  1PH2 A;  2R7F A;  1VQD A;  3BS1 A;  2ZT9 C;  3KF8 B;  4EX5 A;  1E1O A;  2RKS A;  2JA7 G;  1A2T A;  4B3T L;  4X3S A;  3MEF A;  3E9H A;  5G3L F;  1WTX A;  4K2L A;  4FYD A;  3CCS A;  1U0L A;  5ISR A;  2RDH A;  4C2M H;  1EOV A;  4A3D B;  2K5N A;  5C3E G;  1QG7 A;  2KHJ A;  1PZK D;  4C3I G;  4A3F H;  4DGZ A;  1J5E L;  3O13 A;  4IFD H;  1EYA A;  3U9S A;  3MAQ A;  1JOR A;  1LTT D;  3ERQ A;  1CI3 M;  1SR3 A;  1SBB B;  3A8K E;  3H0G H;  2UXC L;  3I4M B;  2ZM6 Q;  3GTG B;  3E3X A;  3UDI A;  1PRT D;  4QIW B;  1RDP D;  4K5V A;  1PYW D;  1XYI A;  4JVZ A;  1STG A;  4DUZ L;  1VQH A;  3H3V C;  1Y1W H;  2F4I A;  1B44 D;  3CQZ B;  4DV2 L;  1HFN A;  4E6I A;  2JQO A;  1H9J A;  1NR2 A;  1PZJ D;  3K5L A;  2BE5 C;  3UDX A;  3I91 A;  4F88 A;  1B9N A;  4DR4 L;  5CBE E;  2F0W A;  3KOJ A;  2WP8 J;  4K5W A;  2JA8 B;  2NVY B;  1T5X D;  1RJT A;  4WOR A;  4A3D G;  2LY7 A;  2MO0 A;  1OTC A;  3RLO A;  2F0T A;  4POG A;  1E2V A;  4XTC S;  3ND8 A;  2FMC A;  3OMG A;  4C56 C;  1PH1 A;  3DMU A;  4UP7 A;  2EYO A;  1Q7Y C;  1XWE A;  4HN7 A;  5C4X B;  5DEH A;  3D4R A;  2HT1 A;  3AU7 A;  1GKH A;  3BYY B;  1KL9 A;  4I65 A;  3KDF B;  5DM7 3;  1WTW A;  3OHX C;  1QB5 D;  4QIW E;  4O0A A;  3I4M G;  1OXU A;  1CKN B;  3MWY W;  4LK1 C;  3MXN B;  4F87 A;  5JAV A;  4ZAI A;  1F9P A;  1PYB A;  3HRZ C;  1EOT A;  2EE1 A;  2PZW A;  2CW0 C;  2N55 A;  4LF8 Q;  1PH8 A;  1PYS B;  2FXQ A;  3STB D;  3HOX H;  4QGU A;  2KCC A;  1PXU A;  3L2P A;  2E5L L;  3T56 B;  1VQK A;  2UXB Q;  2IL8 A;  3IKJ A;  4DV5 L;  3CD6 A;  5KEE A;  1TT2 A;  2KEN A;  3LNN A;  3GTQ H;  1NTG A;  2EY6 A;  3VR5 A;  1JJC B;  3CCL A;  2UU9 Q;  1SNC A;  4LFA L;  3DXJ C;  4FDB A;  4C2M B;  4H02 A;  1D5M C;  3IFD A;  3W2D A;  3NWT A;  4A3F B;  4K6D A;  1NNX A;  1D1I A;  3D31 A;  4YCU A;  3DWQ A;  4DU9 A;  4DV6 L;  1C0A A;  5IP9 G;  2R7D A;  3GTO H;  4IN3 A;  2ZTE A;  4JC0 A;  1Q90 A;  4QB4 A;  3HOY H;  3IAY A;  2B8F A;  1F2L A;  3X3N A;  1VMP A;  1VQ4 A;  4GKK Q;  4JI6 L;  1SE2 A;  2X6G A;  3HEJ A;  3K7U C;  4R4O A;  4NMZ A;  4R4Q A;  1A6X A;  3S1M H;  3KK7 A;  2VL6 A;  2V1C C;  4DFA A;  4JCV E;  1Y1W B;  3A55 A;  4OIJ A;  4A76 A;  4OWW B;  1DCZ A;  1VCI A;  4L8J A;  3I56 A;  4BY1 H;  1HR0 L;  1AFP A;  3P75 A;  2WAQ B;  1EY7 A;  5GAE C;  2FMM A;  2SNS A;  4JI4 L;  1D5Z C;  5C3X A;  4RFB A;  4JI1 Q;  1VQN A;  2AWO A;  1VQJ A;  3OWE B;  3V05 A;  4A3F G;  5D65 A;  1BVS A;  5KYI A;  4IFD G;  1Z6H A;  1PH6 A;  2M2L A;  1I94 Q;  4LFC Q;  1EWC A;  4A3K H;  4BS9 A;  1K8A C;  1UEA B;  4GN3 B;  3DLL A;  3BVM A;  2I07 B;  4GS3 A;  4I7Z C;  5M5W H;  1E22 A;  1LT6 D;  2OQ0 A;  1EIG A;  1TWG H;  1F77 A;  4A4I A;  1FGB D;  5IT9 L;  4DXG A;  3L0O A;  3RUZ A;  4Q5V A;  1Y1W G;  4RA8 A;  5KRU A;  3HOX B;  1I3Q B;  5FLX E;  2XRQ D;  4L5S A;  2PQA B;  3WOF A;  4KK7 A;  3PO3 H;  2KUM A;  1K0R A;  2DNE A;  2WAQ E;  4UHV A;  5DNF A;  1ASY A;  2AMC B;  2PMZ B;  3GTQ B;  1TY0 A;  2R7Z H;  1EY5 A;  2KCT A;  3NUC A;  4LUZ A;  2H4O A;  2D5D A;  4J15 A;  4EVO A;  1YIJ A;  2KCM A;  3NTH A;  1E3P A;  4A75 A;  4QJF A;  3KJO A;  2Z6K A;  4HED A;  1JJ2 A;  3GTO B;  4K0K L;  4JBM A;  4DV5 Q;  3HOY B;  1BCP B;  4UP9 A;  1XTD A;  4NKL A;  1PA6 A;  3DEP A;  5CMD A;  4LFA Q;  3TRE A;  1SNM A;  1ML0 D;  1PH9 A;  3S1M B;  2E2I H;  4X64 L;  3A5U A;  1V43 A;  1XMO L;  1AW7 A;  5K5P A;  5C6A A;  1K8G A;  4DV6 Q;  3TP5 A;  2PZU A;  1A3T A;  2XSC A;  3F2D A;  3HOX G;  1QUQ A;  1SSO A;  1S5C D;  2PMZ E;  4JI6 Q;  3H09 A;  4ZRZ A;  1SMY C;  3HKZ B;  1W6K A;  2HQL A;  4QUC A;  4BXX H;  4C3H H;  3J7Z C;  4DAY A;  4A3M B;  2EJF C;  1SYD A;  2NVX H;  4BBR B;  4BWG B;  3OW2 A;  1VQM A;  1FVI A;  1PTO C;  1M90 C;  1HNZ Q;  3CP0 A;  2NTS A;  2B8G A;  4M8A A;  4DV3 L;  1W6J A;  2MJ8 A;  3HOY G;  1PVO A;  1B1Z A;  4H7B A;  5M5W B;  2CFM A;  2B2Y A;  4BY7 H;  3T1H Q;  4DAP A;  1TKW B;  4K6L A;  3GTP H;  1JMC A;  3DHQ A;  2A1A A;  4BY1 G;  3I70 A;  1IXR A;  3KF6 B;  1VQC A;  5E3F A;  3TP7 A;  2IX3 A;  4GLX A;  3H6M A;  3M4Q A;  1LUZ A;  1SDF A;  4OO1 I;  4HCE A;  2NUC A;  1QIL A;  1EQR A;  4A3M G;  5M5Y B;  1X3E A;  1RCV D;  4V0B A;  3BVG A;  3C2P A;  4JI8 L;  4GNX C;  3MEH A;  4JI3 L;  1A0I A;  1AN8 A;  1XXG A;  4GKJ L;  2NVT H;  2B63 H;  1EQV A;  5KNC A;  1STE A;  3W3A A;  2JXM B;  3KLR A;  3S14 H;  3U9O A;  4KMU C;  1H95 A;  2F0V A;  2LKV A;  2KEC A;  4CJ0 B;  1UAP A;  3HKS A;  3M7G A;  4DV0 Q;  1LV9 A;  2ENB A;  4DF7 A;  4A3I B;  1G8Z D;  3T16 A;  2G5D A;  3PO3 G;  1N32 Q;  2F0M A;  2K03 A;  1YI2 A;  1XMO Q;  5IP7 H;  4DK3 C;  1VQ7 A;  3S16 H;  2EYM A;  4IFD J;  1C7Y A;  1UEB A;  3I3C A;  4L63 B;  2KJX A;  1N36 L;  1HNX Q;  1SMY D;  2A73 B;  1UE7 A;  1STN A;  1EZ6 A;  2AQ3 B;  2KHI A;  1ILQ A;  1O78 A;  4FVM A;  5E1F A;  3S1R H;  5JOB A;  1NAP A;  3FDT A;  1RKN A;  1NY4 A;  4BY7 B;  2L1B A;  1VQ5 A;  3D6W A;  4PG3 A;  3J7A V;  4POF A;  2EQS A;  2Q2H A;  3R8B A;  1ONL A;  5FJ8 H;  5IIF A;  4A3I G;  1N34 Q;  1WFQ A;  4ZKC B;  5JEA J;  1PFN A;  2HIV A;  1WTH A;  2OEO A;  3KFU A;  3IFT A;  1QJO A;  3PUX A;  3EFX D;  2A8V A;  2RSO A;  4CDD C;  5GAD C;  5IYB H;  1TWH B;  4BXX G;  1LAB A;  3M4O B;  2NZO A;  4RGO S;  4A3G H;  4DR7 Q;  3QO2 A;  4OO1 H;  1DJR D;  1EU4 A;  1GO3 E;  2L9H A;  5EKK A;  1T9H A;  1TWC H;  4RWS C;  4AIM A;  2XWB B;  2NVT B;  4QCL A;  1UE1 A;  4QY7 A;  1ZYR D;  1JIC A;  1I5F A;  5LMU L;  3KF8 A;  1OO9 B;  4TKO B;  4JV5 Q;  2DJG C;  4L5T A;  5IWA Q;  3VR4 A;  1KLU D;  2F1M A;  4BY7 G;  1FNV A;  3T4A C;  2JN4 A;  3QOL A;  2PW5 A;  3MC0 B;  4YHH L;  4JI3 Q;  4C3J H;  3FHW A;  4RCO A;  4JI0 L;  1VQA A;  2K28 A;  3VYU A;  1GVP A;  1KAA A;  1HZC A;  5M5X H;  5I9O A;  1L1O C;  1G91 A;  3M4P A;  2VQE L;  3S2H B;  1WCM B;  3U58 A;  1Y1V B;  4DAY B;  2FFK B;  1G2S A;  1KQS A;  4LJZ C;  2D9U A;  4JYA L;  4JI5 L;  1GUS A;  3UI2 A;  1U5K A;  1Q82 C;  1N8R C;  4RG1 A;  3S16 B;  1QZH A;  3PUV A;  5JJZ A;  1TWF H;  1H9R A;  2DN8 A;  3SK4 A;  3MXG A;  2N49 A;  3AYH B;  2QKI C;  1LLR D;  1B70 B;  1NE3 A;  1SE4 A;  1JB3 A;  2E76 C;  2CKZ B;  2ICE C;  3W5O A;  1NCV A;  1IZ6 A;  4HIM A;  4X62 Q;  4HR7 B;  3S1R B;  4MTN A;  4RCN A;  2JA7 H;  2A5H A;  3UDG A;  1HTP A;  1WTO A;  3J81 i;  2F0I A;  1CT1 D;  1KDB A;  3H15 A;  5EBD A;  4KN7 C;  1Z7T A;  3MA2 B;  1BBW A;  1MI2 A;  2XIW A;  1AH9 A;  4C3I H;  1N36 Q;  1IBK L;  5I6Y A;  1HTL D;  1MBY A;  3K7A H;  1S5F D;  5HUR A;  1GUW A;  3K0Y A;  3PIO 3;  2EJG C;  1PH3 A;  1Y1V G;  2GVA A;  2LXK A;  1JQY D;  5IP7 G;  1K28 A;  2G9H D;  4QUF A;  3KDF A;  4A3G B;  5HGT A;  3DM1 A;  2FHT A;  3CCR A;  4M1U B;  1CKN A;  1CHQ D;  1CM9 A;  5ELD A;  3J80 L;  4HCS A;  4P75 A;  2A68 D;  3JC6 6;  5G3L D;  4YY3 Q;  1PTO F;  3TDQ A;  2ATW A;  3SE0 A;  3T53 B;  2ASB A;  3TSS A;  4UP8 A;  3PV0 A;  1C8C A;  3CMA A;  2F0N A;  4EQP A;  1EY9 A;  3K57 A;  3A74 A;  4C3J B;  1PRT C;  1K8O A;  5M5X B;  2FJ2 A;  5FJ8 G;  1BKB A;  4NB3 A;  2K4K A;  1K8M A;  4YWL A;  4F7X A;  4DV4 L;  2EYP A;  2J7Z A;  5C0X I;  1M4V A;  3GDE A;  2MNA A;  4UAI A;  2CQA A;  4DV1 Q;  5IYB G;  2K52 A;  4B9X A;  3I4M H;  2JA9 A;  4BA2 I;  3GTG H;  4X3U A;  4JI0 Q;  1TWF B;  2RF4 A;  4CDF C;  4AQY Q;  4A3G G;  4OO1 G;  1GOZ A;  4X66 L;  2K5D A;  1GUT A;  2PPB C;  4XQJ A;  1X3Q A;  3F2B A;  1VQG A;  4PMC A;  1HH2 P;  3RR5 A;  5IY0 A;  4JYA Q;  3GV6 A;  1X56 A;  3S1Q B;  5FLX c;  3OYY A;  3HFZ B;  3URY A;  1KRS A;  2JSO A;  2WAC A;  5H1S E;  2J4X A;  2F3I A;  1YVC A;  4C3J G;  1KD1 C;  2JA8 H;  1EQT A;  4HJ9 A;  2NVY H;  5FO8 B;  2IHF A;  2MHV A;  4GLV B;  5ELF A;  5DM6 3;  4RGM A;  2AKW B;  1FJG Q;  2MQH A;  3STB C;  1VQ9 A;  5C4X H;  1HHV A;  1B7Y B;  4PMB A;  2I0Q A;  4RHR A;  1E2W A;  1V9P A;  4IUU A;  2A69 C;  3NQI A;  3BZC A;  1K83 B;  4TQU S;  2HD3 A;  2E8G A;  3SK8 A;  1IBK Q;  5CV9 A;  4KY5 A;  4CKE A;  2B2W C;  2JJQ A;  1E1T A;  4GOP C;  4XQQ A;  3SHL A;  2O5I C;  3S15 H;  1NSN S;  4GLA C;  3HZX A;  3CC2 A;  2PQA A;  3RLN A;  4ZYS A;  3J81 j;  4J1M A;  4OGQ C;  2K01 A;  5LL6 X;  1DZ1 A;  2YV5 A;  4CJ1 B;  4BA1 I;  2N8N A;  5BN5 A;  2JK8 A;  2UUB Q;  2DGY A;  1PZI D;  1I4H A;  3PF5 A;  2EJM A;  3NEL A;  1DON A;  2F0D A;  3CRK C;  4KKU A;  3T1Y Q;  4K5X A;  1D7Q A;  2VB2 X;  1IBM Q;  3S24 A;  1VF7 A;  1J6Q A;  2K32 A;  3GQB A;  2F0F A;  3SVM A;  1EEF D;  5C0X H;  5EPL A;  4HAE A;  1SYB A;  2BDO A;  4DR5 Q;  5LMN W;  3E0E A;  3MZ5 A;  1TVX A;  4LUO A;  1LTS D;  2WFW A;  3MXP A;  4ZUI A;  1BBX C;  2O2L D;  4XYQ A;  3CCM A;  4G4K A;  4IZ8 A;  1STA A;  3LGJ A;  3I7F A;  4L5Q A;  2HHH L;  3BZK A;  3EA6 A;  1KAB A;  1O7I A;  4DAM A;  5LMN Q;  4MIU A;  1ENF A;  1G29 1;  3OIQ A;  2Q8I B;  2A6E C;  2KEE A;  1IYJ B;  3P7J A;  4IPG A;  4DR1 L;  1X3F A;  4KY7 A;  4KJO A;  3F2U A;  3GTM B;  2XWJ B;  1EUJ A;  1YNJ D;  3BDO A;  1MHW C;  5KGU A;  2YTX A;  1HRJ A;  1B4O A;  1WTP A;  2QEJ C;  2B2T C;  2NYZ D;  3EN2 A;  3M9B A;  5BR8 Q;  5IGC A;  3I8Z A;  3U50 C;  3K59 A;  4JOI C;  5J22 A;  2ALY B;  1I4R A;  2XN9 C;  1KRT A;  3OW7 A;  4RH6 A;  2JYO A;  4IPC A;  2SDF A;  1B3Q A;  5KND A;  5ELB A;  3QR8 A;  1AEX A;  1CQF A;  4A3J H;  4B3S Q;  3S17 H;  5EPK A;  5IOD A;  1HA5 A;  2CH4 A;  3S15 B;  5A35 A;  2OTL A;  1I3Q H;  4EQ5 A;  1WYD A;  3NEN A;  1EIY B;  5GQO A;  3HOW H;  4DUY L;  2DY8 A;  4KLK A;  1YJN A;  1S4Z A;  5IGF A;  5IT9 E;  1EWI A;  3KF6 A;  1X65 A;  1GUG A;  1LTL A;  2A69 D;  1Z47 A;  4IUV A;  4L5R C;  3Q24 A;  1EY8 A;  1U9R A;  2LXJ A;  3FVQ A;  1XPO A;  2NZ1 D;  2JA8 G;  1PV4 A;  1RD9 D;  1ET9 A;  2EYJ A;  3E5S A;  5JVG 3;  1RHP A;  4TRD A;  1L0X B;  2YU9 H;  2H1E A;  4B3T Q;  1K3B C;  3CW2 C;  5C4X G;  1GXD C;  1V1O A;  2X69 A;  3BZD B;  5JJI A;  2E2H B;  3GTJ B;  2QDL A;  3S1N B;  1WD0 A;  2C9O A;  3NBH A;  5D14 A;  1NMG A;  1J5E Q;  1VDZ A;  3VA5 A;  1D6E C;  2PO4 A;  3N6R A;  2XVS A;  2E74 C;  4DAV A;  4IUT A;  4B3R L;  2AHO B;  4IUP A;  4EQN A;  1HUN A;  2LMC B;  1F2M A;  4DR3 L;  2UXC Q;  1PH5 A;  1B53 A;  3K5M A;  4K8J A;  3FP9 A;  4PMW A;  5I2Y A;  4O1N A;  2IY5 B;  4OEM B;  1HCZ A;  1JWS D;  1IKM A;  1YHA A;  1X55 A;  4C1N K;  1YBY A;  1BDO A;  4DUZ Q;  4A3M H;  1PHJ A;  4PV1 C;  1YNN C;  2QCP X;  4BBR H;  2HDL A;  4DV2 Q;  5CV4 A;  1I6V C;  2ZJQ A;  1PRT F;  3I72 A;  2QIL A;  2HHH Q;  5C4J B;  1XMQ L;  4XT1 B;  1DGS A;  4LF9 L;  1C9O A;  4AYB B;  3P20 A;  4DR4 Q;  2CVR A;  2A6E D;  1E2Z A;  5C0X G;  2UUA L;  4KHP L;  4JI7 L;  2IWH A;  4A3J B;  1EIH A;  2EXZ A;  3S17 B;  2A19 A;  1KDC A;  2YTV A;  4KN4 C;  2R93 B;  3V96 A;  1XPU A;  4JBJ A;  2EZV A;  1JR0 D;  3HOW B;  5F2D A;  4YIJ A;  2WKD A;  2TSS A;  2NB0 A;  1QVF A;  3L7Z C;  5EJW A;  2WAQ G;  3J81 c;  2Z4H A;  3KBG A;  3P1H A;  2ID0 A;  2AWN A;  1GJX A;  3AFP A;  3K0X A;  4IQZ A;  3RMH A;  5M5Y H;  4P71 A;  1A15 A;  1B9M A;  1BCP D;  2ES2 A;  2YU9 B;  2E5L Q;  4UY8 C;  1D1K A;  2Z9H A;  3TQY A;  4X65 L;  2D62 A;  4AYB E;  1W2B A;  2L11 A;  2QW7 A;  2KQ3 A;  4AYB G;  2L15 A;  1EYD A;  4NDX A;  3Q22 A;  4IPD A;  2PNH A;  1Q1B A;  4DK6 C;  4A3J G;  4HID A;  2IPK D;  2CHB D;  2RCN A;  1ICF B;  2B39 A;  1F9R A;  4A3I H;  4IUR A;  5EQ0 A;  3HOW G;  1MJE A;  3MXU A;  4DK1 A;  5EKI A;  3TRZ A;  2OXP A;  3CCV A;  1Y8O B;  2XGT A; 
#chains in the Genus database with same CATH homology
 1EQQ A;  3ULJ A;  4BXX G;  2KBN A;  3KLW A;  1Q81 C;  3E9I A;  5LMN L;  4R4I A;  2NZO A;  5HGQ A;  1B8A A;  1AE2 A;  1M1K C;  1OXV A;  4B3R Q;  4A3G H;  1P16 A;  4DR7 Q;  3RZO H;  4A93 G;  2I5L X;  1XNR Q;  2JEB I;  3I2Z A;  1GO3 E;  2Q2U A;  2JE6 I;  3WWV A;  2JEA I;  1T9H A;  1TWC H;  4AIM A;  1HR0 Q;  3I4O A;  3PO2 G;  1UE1 A;  3SGI A;  4QY7 A;  3ULL A;  4LF5 L;  4LNQ A;  1MJC A;  1I5F A;  1PFS A;  3CQZ H;  1X9N A;  1SFO H;  5LMU L;  5M3M G;  5M3M H;  1CUK A;  4JV5 Q;  2BA1 A;  4JI4 Q;  4P74 A;  5FLM G;  4L5T A;  5IWA Q;  5FLM H;  4DR2 L;  4NXN L;  5BR8 L;  3Q8D A;  4IJL A;  4BY7 G;  4HJ8 A;  1X3G A;  2Z6K C;  4YHH L;  1E7Z A;  4JI3 Q;  4LF4 L;  4C3J H;  3FHW A;  4JI0 L;  2VW9 A;  1VQA A;  1WJJ A;  2B3G A;  3M3Y H;  1GVP A;  5GAG C;  1HZC A;  1LM0 A;  1KHI A;  5M5X H;  1L1O C;  1JB7 A;  4GOP B;  4B3S L;  4LF8 L;  1JE5 A;  5IP9 H;  3M4P A;  4LW1 A;  2B29 A;  2VQE L;  3FKI H;  3HKZ E;  1CKM A;  3U58 A;  3CC4 A;  1VQ6 A;  3TS2 A;  4DAY B;  4YWM A;  1KQS A;  2DUD A;  1WI5 A;  3HKZ G;  2UUA Q;  4JYA L;  2GN5 A;  4JI5 L;  1U5K A;  1TWH H;  2Y0S E;  4HJ5 A;  1Q82 C;  1N8R C;  3HOV G;  4RG1 A;  1N32 L;  1QZH A;  1UWV A;  2BA0 A;  1A62 A;  3PUV A;  3M4O H;  2Y0S G;  1KXL A;  2WB1 E;  4YWK A;  5M3F H;  1TWF H;  2R92 G;  4BBR G;  1PH2 A;  1SMX A;  3AYH B;  1VQF A;  2N49 A;  2R7F A;  1NE3 A;  1B70 B;  2WB1 G;  1VQD A;  2IT1 A;  3KF8 B;  4EX5 A;  1E1O A;  2CKZ B;  3W5O A;  3JAM i;  2CQO A;  2D0P A;  1HNZ L;  3VDY A;  1IZ6 A;  4HIM A;  4X62 Q;  2JA7 G;  4MTN A;  4APV A;  2JA7 H;  1KAW A;  3UDG A;  4B3T L;  3NBH B;  1SLJ A;  3MEF A;  3J81 i;  1VQ8 A;  3HOZ H;  3H15 A;  1A8V A;  3E9H A;  4JG2 A;  3CCS A;  4DR1 Q;  1U0L A;  1BBW A;  1X6O A;  3CCJ A;  4R1J A;  1EOV A;  4C2M H;  1Q12 A;  2K5N A;  3T1H L;  5C3E G;  1AH9 A;  2KHJ A;  3HOU H;  1TWA H;  4C3I H;  4A3F H;  1N36 Q;  1J5E L;  4K0K Q;  3J80 c;  1IBK L;  2Q2T A;  3ERS X;  4LFB L;  3K7A H;  4PZ8 A;  2JA5 H;  1YZ6 A;  1SR3 A;  3GTL H;  1PH3 A;  3H0G G;  3H0G H;  3S2H H;  1WCM H;  4Y7N H;  2UXC L;  1Y1V G;  1Y1V H;  2ZM6 Q;  2GVA A;  1SRU A;  2LXK A;  4X64 Q;  3UDI A;  3RNU A;  5IP7 G;  1IL2 A;  4B3M L;  3KDF A;  4MNO A;  2IX1 A;  4R4C A;  3CCR A;  1CKN A;  2ZJP A;  1LYL A;  4DUZ L;  4WJ4 A;  1VQH A;  2N78 A;  1Y1W H;  2RHQ B;  1CKO A;  4OON A;  4P75 A;  3RN5 A;  4DUY Q;  3B6Y A;  3JC6 6;  3RLF A;  4YY3 Q;  4DV2 L;  3GTK H;  1NBW A;  5JJK A;  4ALP A;  2JQO A;  2ATW A;  1Y14 B;  5JEA G;  2ASB A;  3PUZ A;  3UDX A;  4UP8 A;  2ZTD A;  3PV0 A;  1HZA A;  3PUY A;  4LF6 L;  3CMA A;  5IYC G;  3AEV A;  4DR4 L;  2K5V A;  5AJ3 L;  3KOJ A;  2WP8 J;  3A74 A;  3K8A A;  4A3D G;  5IYD H;  2MO0 A;  1OTC A;  3RLO A;  4WJ3 M;  5FJ8 G;  4XIG S;  4DV3 Q;  4POG A;  2VQF L;  4DV0 L;  1BKB A;  4XTC S;  1PH1 A;  4LF5 Q;  2R93 G;  4NB3 A;  4UP7 A;  2K4K A;  4YWL A;  1Q7Y C;  4DV4 L;  1TXY A;  3K81 C;  5C0X I;  3GDE A;  2MNA A;  3K80 C;  4DR2 Q;  4NXM L;  2HT1 A;  1HR0 W;  1GKH A;  4DV1 Q;  1KL9 A;  5IYB G;  3KDF B;  2K52 A;  1XJV A;  4NXN Q;  3I4M G;  4QIW E;  4O0A A;  3I4M H;  2JA9 A;  1EFW A;  1OXU A;  4HJ7 A;  1CKN B;  3GTG H;  4BA2 I;  3KYH C;  3MXN B;  3CPW A;  4JI0 Q;  4AH6 A;  1PYB A;  1RL2 A;  2RF4 A;  4KHZ A;  2NVQ H;  4AQY Q;  4A3G G;  4OO1 G;  4X66 L;  3PF4 A;  4LF8 Q;  1IBL L;  1PH8 A;  4DR3 Q;  1L2F A;  1PYS B;  2FXQ A;  3STB D;  3HOX H;  4QGU A;  3L2P A;  4GNX A;  2E5L L;  3F2B A;  1VQK A;  3CPF A;  1VQG A;  2UXB Q;  1HH2 P;  3RR5 A;  3PGZ A;  5IY0 A;  1HNX L;  4JYA Q;  5E7N A;  3CF5 A;  1HJP A;  4DV5 L;  3CD6 A;  4JI2 L;  1X56 A;  5EAY A;  2D0O A;  2KEN A;  2NN6 I;  3GTQ H;  2YYZ A;  1NTG A;  5FLX c;  1JJC B;  3OYY A;  2UUC L;  3CCL A;  2UU9 Q;  3HFZ B;  4OWT B;  1KRS A;  2VZA A;  4FDB A;  4JI8 Q;  4LFA L;  5H1S E;  2F3I A;  1YVC A;  3A0J A;  4H02 A;  1Z9F A;  4IOC A;  1KD1 C;  2JA8 H;  4HJ9 A;  2NVY H;  3CXC A;  4GKJ Q;  1XNQ L;  4A3E G;  2IHF A;  2RHS B;  3D31 A;  4YCU A;  4A3E H;  2QGQ A;  1XMQ Q;  4DV6 L;  1N33 L;  3UDF A;  4GLV B;  4LF9 Q;  2VUM H;  5IP9 G;  1C0A A;  2R7D A;  4X6A H;  3GTO H;  1N34 L;  1FJG Q;  3FKI G;  2AKW B;  2MQH A;  2ZTE A;  4JC0 A;  3STB C;  5C4X H;  1B7Y B;  1VQ9 A;  2VNU D;  4DV7 L;  3HOY H;  2I0Q A;  1Q46 A;  3J7A 5;  1VQ4 A;  4GKK Q;  4JI6 L;  4KHP Q;  2R7Z G;  2F4V L;  3K7U C;  2Q2I A;  4R4O A;  1K73 C;  4JI7 Q;  4O2D A;  1V9P A;  1ASZ A;  4A3B H;  4R4Q A;  2OTJ A;  3BZC A;  1KIX A;  3S1M H;  1YJW A;  5M3F G;  4TQU S;  3I4N G;  3I4N H;  2VL6 A;  2V1C C;  2E8G A;  4JCV E;  3U4V A;  1IBK Q;  2VS1 A;  4A76 A;  1HZ9 A;  4OWW B;  1VQI A;  3AFQ A;  4GNX B;  1VCI A;  2JJQ A;  1E1T A;  4DR7 L;  3NEM A;  4GOP C;  1XNR L;  3J80 i;  3I56 A;  4BY1 H;  3S15 H;  2UXD L;  1HR0 L;  4GLA C;  4UPA A;  2IX0 A;  3CC2 A;  3F8T A;  2PQA A;  2JA6 H;  2N3S A;  5GAE C;  4B3M Q;  3RLN A;  1PH7 A;  3J81 j;  3HOZ G;  3S1Q H;  4JV5 L;  4JI4 L;  5IWA L;  4JI1 Q;  1OXT A;  1S40 A;  2YV5 A;  4BA1 I;  1VQN A;  2AWO A;  2N8N A;  5IT9 c;  2JK8 A;  1VQJ A;  2UUB Q;  2K50 A;  2DGY A;  4A3F G;  3HOU G;  2OCE A;  1BVS A;  3PF5 A;  4IFD G;  4X65 Q;  3NEL A;  1PH6 A;  2JA5 G;  3T1Y Q;  1I94 Q;  4LFC Q;  1W3S A;  4A3K G;  4HIK A;  4A3K H;  4OX9 L;  1D7Q A;  1IBM Q;  3S24 A;  1WCM G;  1K8A C;  1J6Q A;  4GN3 B;  3DLL A;  2K5H A;  3F2C A;  4GS3 A;  5M5W H;  1E22 A;  2OQ0 A;  4IOA A;  1I6H H;  1TWG H;  2PI2 A;  1QZG A;  1VQL A;  4P72 A;  4A4I A;  4DR5 Q;  5LMN W;  3E0E A;  4IJH A;  1K83 H;  3PIP A;  1VQP A;  3L0O A;  4LUO A;  2WFW A;  2Z0S A;  1YNX A;  1Y1W G;  4A3L H;  3CCM A;  1S3O A;  4L5S A;  2PQA B;  3OTO L;  4NXM Q;  3PO3 H;  3I55 A;  2QEX A;  3GD7 A;  4HJA A;  3LGJ A;  2WAQ E;  1K0R A;  4DPG A;  1RIP A;  3I7F A;  4L5Q A;  5C0X J;  1YHQ A;  2AMC B;  1D8L A;  3BZK A;  4X62 L;  1O7I A;  4DAM A;  2HHH L;  5LMN Q;  3PSI A;  2R7Z H;  2KCT A;  1XPR A;  1G29 1;  4LUZ A;  2K75 A;  1UE5 A;  5IYB H;  4J15 A;  1YIJ A;  1IYJ B;  1QVC A;  2KCM A;  5IYD G;  4IPG A;  1E3P A;  1X3F A;  1EIF A;  4JBW A;  5HY6 A;  1E24 A;  3ER0 A;  4QJF A;  4A75 A;  1S72 A;  2GVB A;  2QA4 A;  3KJO A;  1EUJ A;  2Z6K A;  3A5Z B;  1JJ2 A;  5LMU Q;  4K0K L;  1CSQ A;  3PUW A;  4JBM A;  2YTX A;  4DV5 Q;  4JI2 Q;  4UP9 A;  1XTD A;  1L1O A;  3EN2 A;  3M9B A;  5BR8 Q;  1PA6 A;  4ME3 A;  3U50 C;  1VQO A;  4LFA Q;  4JOI C;  5ELO A;  3TRE A;  1VQB A;  4MZ9 A;  2ZM6 L;  4YHH Q;  1PH9 A;  2YTY A;  2E2I H;  2ALY B;  2K14 A;  1KRT A;  1V43 A;  4P73 A;  4X64 L;  3A5U A;  1XMO L;  1K3R A;  1K9M C;  1V1Q A;  1SE8 A;  4IPC A;  1XNQ Q;  1K8G A;  4A3J H;  4DV6 Q;  4B3S Q;  1N33 Q;  3S17 H;  1P8L A;  2ZTC A;  2MFI A;  1G51 A;  3F2D A;  2VQE Q;  2F52 A;  3HOX G;  1SN8 A;  2OTL A;  1I3Q H;  1QUQ A;  1WYD A;  3NEN A;  4EQ5 A;  1EIY B;  5GQO A;  2F4V Q;  3HOW H;  4DUY L;  2PMZ E;  4KLK A;  1YJN A;  4Y52 H;  4YY3 L;  4JI6 Q;  3RZD H;  4JI5 Q;  1EWI A;  5C44 H;  3KF6 A;  2HQL A;  1X65 A;  1LTL A;  2MO1 A;  1Z47 A;  2IHE A;  3ULP A;  4L5R C;  4RMF A;  4BXX H;  4C3H H;  3J7Z C;  1FGU A;  1HNW L;  2LXJ A;  2NVX H;  1XPO A;  3UE1 A;  4LF7 L;  2JA8 G;  2ZJR A;  4A93 H;  1PV4 A;  3OW2 A;  1VQM A;  2BH2 A;  1FVI A;  3D0F A;  3KJP A;  2E2J H;  4IO9 A;  1M90 C;  1BBU A;  1HNZ Q;  2UXD Q;  4HIO A;  3CP0 A;  3CAM A;  3GTM H;  3PO2 H;  2VUM G;  1L1O B;  4DV3 L;  2YU9 H;  4DR6 L;  3PIO A;  3G48 A;  4B3T Q;  1Q1E A;  3CW2 C;  5C4X G;  2PI2 E;  3HOY G;  1JT8 A;  1PVO A;  1UE6 A;  3CCV A;  5JJI A;  1OXX K;  3DM3 A;  2CFM A;  4DNI A;  4DV1 L;  3ZJY C;  1FL0 A;  4A3B G;  4TVA B;  4OWX B;  4BY7 H;  3T1H Q;  1NMG A;  1J5E Q;  3H3V I;  3GTP H;  1QUQ B;  1JMC A;  4AQY L;  4LFB Q;  4B3R L;  1YHB A;  2AHO B;  1NMF A;  2A1A A;  1R9T H;  4OX9 Q;  1WOC A;  4BY1 G;  1IXR A;  3KF6 B;  4DR3 L;  1VS0 A;  1VQC A;  1PH5 A;  3S2D H;  3BJU A;  2UXC Q;  3FP9 A;  4PMW A;  4YCW A;  2JA6 G;  4GLX A;  3M4Q A;  2IY5 B;  1LUZ A;  1MKH A;  4JBK A;  2UXB L;  2CWP A;  2BH8 A;  1YHA A;  3EBE A;  1X55 A;  3GO5 A;  4OO1 I;  1AE3 A;  4A3C G;  2R6G A;  4A3C H;  3HOV H;  1YBY A;  2HIX A;  3W1B A;  1EQR A;  4A3M G;  4DUZ Q;  1X3E A;  4A3M H;  1PHJ A;  4GN4 B;  3TS0 A;  1HZB A;  4DKA C;  2UU9 L;  4JI8 L;  4GNX C;  3IRB A;  4BBS G;  3CCQ A;  2R92 H;  4BBR H;  4BBS H;  4JI3 L;  1A0I A;  3OTO Q;  1QVG A;  4DV2 Q;  1EYG A;  3UE0 A;  3U4Z A;  2ZJQ A;  4GKJ L;  1I50 H;  1GM5 A;  3AQQ A;  4GN5 A;  4PZ7 A;  2B63 G;  2NVT H;  2HHH Q;  2B63 H;  1XMQ L;  1DGS A;  3G4S A;  4LF9 L;  1C9O A;  4LF6 Q;  4QQB X;  1FJG L;  4DR4 Q;  5AJ3 Q;  3S14 H;  4QL5 A;  2H5X A;  4LUV A;  3G71 A;  1YIT A;  1A63 A;  1H95 A;  2E2H H;  5GAH C;  5C0X G;  3GTJ H;  4NPS A;  1N9W A;  4R4T A;  3M85 A;  3TEH B;  3CC7 A;  2UUA L;  3S1N H;  4GKK L;  4KHP L;  3RN2 A;  4JI7 L;  3HKS A;  2VQF Q;  4DV0 Q;  4JOI A;  4DR1 L;  2A19 A;  3CME A;  5K36 G;  2YTV A;  5C3E H;  3M7N A;  5JJL A;  1XPU A;  4A3L G;  1NJI C;  4JBJ A;  4DV4 Q;  3JAM c;  4PZ6 A;  1KC8 C;  3PO3 G;  1N32 Q;  1X54 A;  4LWC A;  3CCE A;  2I5H A;  1QVF A;  1YI2 A;  3L7Z C;  3W1G A;  5ELN A;  2WAQ G;  1SRO A;  3J81 c;  1XMO Q;  1CSP A;  5IP7 H;  4DK3 C;  2ID0 A;  1GD7 A;  2AWN A;  1VQ7 A;  1JJG A;  4X66 Q;  3AFP A;  3K0X A;  3S16 H;  1G6P A;  4IFD J;  1IBL Q;  1YEZ A;  2NN6 G;  2OWO A;  5M5Y H;  1C7Y A;  3F1Z A;  2EXD A;  4JI1 L;  4P71 A;  1UEB A;  3ICE A;  2CCZ A;  2ES2 A;  2E5L Q;  3PCO B;  2UUB L;  4UY8 C;  1N36 L;  4OXP A;  1HNX Q;  2C35 B;  1UE7 A;  3TQY A;  2KHI A;  2D62 A;  4AYB E;  5GRO A;  4X65 L;  5C4J H;  3S1R H;  2I5M X;  1YJ9 A;  1W2B A;  4LFC L;  1Q8K A;  3T1Y L;  1I94 L;  2UUC Q;  1MIU A;  2NZH A;  3CCU A;  1IBM L;  4AYB G;  1ASY A;  3G6E A;  4KI0 A;  2L15 A;  1HNW Q;  4YCV A;  1NY4 A;  5IYC H;  3EIV A;  1VQ5 A;  4LF7 Q;  2XTI A;  1OXS C;  5DLQ E;  1L0W A;  4IFD I;  4IPD A;  3BU2 A;  1PH4 A;  2VY3 A;  2PNH A;  1Q1B A;  4PG3 A;  4DK6 C;  4POF A;  2EQS A;  4HID A;  4A3J G;  4A3D H;  2RCN A;  2Q2H A;  4DR5 L;  4DR6 Q;  5FJ8 H;  2LSS A;  2R93 H;  4A3I G;  2OQK A;  1WFQ A;  4A3I H;  1N34 Q;  2CWA A;  5JEA J;  3H3V H;  5IE8 A;  2HIV A;  4DV7 Q;  1MJE A;  3HOW G;  5J3B A;  3KFU A;  4IPH A;  3PUX A;  3TRZ A;  2A8V A;  1VQE A;  4GOP A;  2EIF A;  1Q86 C;  5C44 G;  4LF4 Q;  5GAD C;  2XGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...