1VQIA

Gene v protein mutant with ile 47 replaced by val 47 (i47v)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKVTLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Context dependence of mutational effects in a protein: the crystal structures of the V35I, I47V and V35I/I47V gene V protein core mutants.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
total genus 10
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqiA00
3I4NH 4HJ9A 1Q12A 5H1SE 5IWAL 2IX0A 3CPFA 4QL5A 1KXLA 1IBML 1VQDA 4ME3A 4FDBA 1VQPA 2N78A 3E9IA 4HIMA 4PZ8A 2VQEL 4JYAL 2ZM6Q 1BBWA 2A8VA 4GKKL 3WWVA 2LSSA 4EQ5A 2I5LX 4P74A 4JI1Q 1HR0W 4LFAQ 3MEFA 1R9TH 3S1NH 1XMOQ 1EQRA 1WCMG 4DK3C 4A3EG 1PH8A 3AEVA 1X56A 1PHJA 4IFDJ 2L15A 4MZ9A 3AQQA 5LMNQ 2WAQE 3DM3A 5C3EH 3BZCA 2N8NA 4A3DH 4IJLA 1HNZL 4OXPA 1PH2A 1YVCA 3RLFA 5M3FG 2KHJA 2ATWA 4QGUA 1HJPA 5C44G 4RMFA 2Z6KA 3S15H 2NZHA 2RHQB 3PIOA 1Y1WH 1UE7A 1QUQA 1WCMH 1EQQA 3BU2A 1MIUA 4JI8L 2RHSB 3GTKH 3RR5A 2B3GA 3CCLA 3BJUA 1KQSA 2F4VL 1I94L 4BXXG 4C3HH 4POGA 2OWOA 4PZ7A 3HFZB 2R7ZG 3MXNB 5FLMH 3PSIA 3UE1A 4OX9L 5C44H 1NE3A 2GVAA 3FKIG 4B3SL 3G48A 4LF5Q 5IYBH 4IPCA 4UP7A 5LMUL 2YTXA 2GN5A 3HOWH 2HHHL 4DUYQ 4KLKA 1SMXA 3EIVA 4YWMA 3GTGH 4JV5Q 3KYHC 1NMGA 4DV4L 3T1YQ 4LNQA 3H3VI 4LF8L 1V9PA 1D7QA 1VQFA 2D0OA 4HJ5A 4DNIA 1JB7A 3W1BA 1Q82C 2AMCB 2WAQG 1Y1VH 5C4JH 3ER0A 3M3YH 2VNUD 1MKHA 2R7ZH 3TS2A 1KC8C 4DV3L 3B6YA 3J80i 1XNQQ 2WB1G 4A76A 3HOZH 4UP9A 2PQAA 1X55A 4A3JG 3M4OH 4LF9L 1SRUA 2VQEQ 1G6PA 1YHAA 4X64Q 2VZAA 1HZBA 4JOIA 4GKKQ 3GTOH 1I50H 3HOVH 1VQMA 1IXRA 2E2JH 4NB3A 1YNXA 1TWGH 2UUAQ 1XPOA 1S40A 1ASYA 1VQNA 2LXJA 2VY3A 5FJ8G 4AQYQ 1QZGA 1YEZA 1QVCA 2QEXA 3CCMA 2ZM6L 4A3MG 2Q2IA 1WOCA 4A3IH 4JI1L 3RLNA 1PH9A 3ICEA 1M90C 1K83H 3SGIA 1PH4A 1KHIA 1TXYA 3I7FA 4OWTB 4XTCS 4DR3Q 1VQLA 2JA5G 3TEHB 3S2HH 4YY3Q 5LMNL 1GD7A 4QIWE 4DR5L 3I4MH 4LFCL 1L0WA 2E2HH 2DUDA 1N34Q 4GOPA 3K81C 1RIPA 4OX9Q 2D0PA 1HNXQ 1E1OA 4OONA 4A3KG 3HOXG 1B70B 1HZAA 5LMUQ 4J15A 4C3IH 1VCIA 4JCVE 1G291 3J7ZC 2I0QA 2BH2A 1PYBA 4KHZA 3W1GA 4BBRG 3K7UC 2D62A 3GTMH 3KDFA 5GADC 4BBSG 3M7NA 2R92H 4DR6Q 5IY0A 1PH1A 4L5SA 1IL2A 1SR3A 2CWAA 3Q8DA 5IP7H 3DLLA 2R6GA 4NXMQ 4A3KH 4LUZA 1NTGA 3H0GG 4JG2A 3OTOL 3CPWA 3A5UA 2R93H 4YCWA 4LF9Q 1OXVA 1K0RA 1C7YA 1K8GA 3LGJA 4P73A 1PH6A 1GM5A 3KJOA 4LFBQ 1PH7A 4A3FH 3J81j 1FGUA 4JI4Q 5M5WH 1N9WA 2PMZE 4TVAB 1NY4A 4A3LG 1VQGA 4JI2Q 1JMCA 1IYJB 3FP9A 2UXCQ 3CCVA 4B3ML 1XNQL 1CSQA 5IYDG 2UUBQ 3H15A 1W3SA 1LTLA 3GTJH 5GAGC 1HNWL 4DR7Q 1YBYA 2NN6I 4R4CA 1ASZA 4X64L 4HIOA 3CMEA 2OTJA 2VL6A 1E22A 2JJQA 3HKZE 5E7NA 1FL0A 1SLJA 4KI0A 3RLOA 3S1RH 4QJFA 1GKHA 2JK8A 2UUAL 3RN5A 3F8TA 2CCZA 3KF6A 3JAMc 1VQHA 5GROA 4JI5L 4AQYL 4BY1G 2YV5A 1HZCA 1N33Q 4DK6C 3TRZA 4DR5Q 3PF5A 5IT9c 3J81i 3TS0A 1YIJA 4LFCQ 3PUZA 1V1QA 4DPGA 3PUYA 2WB1E 4DV0Q 1A0IA 2MFIA 2JA9A 1PH5A 1CKNB 4LF4L 2V1CC 1A8VA 4GNXA 3AYHB 2F3IA 4A3EH 4DV5Q 1VQ9A 3HOUG 1PV4A 4KHPQ 2Y0SG 4DR3L 3OW2A 1KD1C 4QY7A 1EFWA 3PO3G 1S3OA 4YY3L 2K4KA 3GTLH 1HR0L 1UWVA 3NBHB 4BY1H 2AHOB 3ZJYC 2QA4A 1N34L 5M3FH 1E7ZA 5FLXc 4JBWA 1HNXL 4LF7Q 4IPDA 3I55A 2I5MX 2K52A 3D0FA 1AE2A 4BA1I 3PIPA 5IYCG 2ZTEA 3HKZG 3OTOQ 1I5FA 4GLVB 2UXBL 3I56A 4GLAC 1WJJA 1L2FA 2A1AA 3PV0A 5J3BA 3EN2A 2HT1A 4BXXH 1CKOA 4GN5A 4DR6L 1OXUA 2KCTA 3K0XA 4JC0A 4R1JA 3U50C 1VQJA 1XMQQ 4DAYB 1Q1BA 5HGQA 1L1OA 1X3GA 2GVBA 3HOYG 3FKIH 1BKBA 4BA2I 4NXML 3UE0A 1NJIC 1HH2P 1E3PA 4B3MQ 2VQFQ 1JJCB 4IFDI 1KIXA 2KBNA 4IO9A 1HNWQ 3AFQA 2K75A 2NZOA 4AYBG 3PO2G 4R4TA 1TWAH 2JQOA 2YTYA 4LFBL 3CP0A 2UU9Q 4DUZL 4IOAA 1WFQA 1YJ9A 4JBMA 4UY8C 1VQBA 4A3CG 3U4VA 3RNUA 1VQOA 2CKZB 4X62L 5GAHC 1AE3A 5IE8A 1YJWA 2NVXH 4JI4L 4OWWB 4JI2L 3IRBA 1CKMA 5EAYA 2Q2TA 2UXCL 4A3GG 4JI5Q 4OO1I 3CCRA 2BH8A 3UDGA 3E0EA 2UUBL 1TWFH 2B29A 3CAMA 2WP8J 3CD6A 1EWIA 4A3JH 3CC4A 2B63G 4R4QA 4DR7L 1Y14B 2HIXA 4QQBX 1Q86C 2HIVA 3PO2H 2OCEA 5C0XI 3J81c 3PUWA 3L0OA 3KFUA 3KOJA 4LF4Q 4A3BG 3FHWA 4JBJA 3GDEA 1K9MC 2JEBI 4Y52H 1A62A 5LMNW 3D31A 5JJIA 1EUJA 1P16A 4DV7Q 1EOVA 3G71A 1GO3E 3KLWA 1OTCA 2UXDQ 2R7FA 3GO5A 2Z6KC 2E5LQ 2YU9H 2AWOA 3HKSA 1FVIA 1GVPA 4AH6A 5FJ8H 4HJ7A 2DGYA 4DR2L 1HR0Q 1N33L 4DR4Q 3F1ZA 1A63A 3ERSX 2B63H 2JA8G 1UE5A 1XTDA 1HZ9A 2HQLA 3TQYA 4P71A 3CCQA 4A3MH 5IP9G 2YTVA 4DV0L 1JJ2A 1EYGA 1EIYB 2ZJRA 1JJGA 3F2CA 5GQOA 4YHHQ 3S16H 1KRSA 3UDIA 1VQCA 4DV5L 4KHPL 1X3EA 2UXBQ 4BY7G 1UEBA 2IHFA 2KENA 4LW1A 4B3TQ 3CW2C 2BA0A 1PVOA 1VQIA 3CXCA 2JA5H 2PNHA 3S14H 3S17H 1DGSA 4YCVA 2K5NA 2F52A 3CCJA 1UE1A 1I6HH 2JA8H 5M3MG 2PI2E 4LF7L 2AKWB 1N8RC 2EIFA 1WI5A 4JI6Q 3KF6B 3HOXH 3RN2A 1G51A 3H3VH 3J80c 3K8AA 2AWNA 2JA7G 2A19A 1PH3A 2R7DA 4YWLA 2E2IH 4BBRH 3A74A 4PZ6A 1Q81C 1BBUA 3STBD 1N36Q 2VUMG 3S2DH 1WYDA 3A0JA 4DUZQ 4BBSH 4K0KQ 3L7ZC 1H95A 2Y0SE 2ALYB 2IT1A 3NEMA 1QUQB 4GNXB 4OO1G 4X62Q 1VQ6A 1XMQL 2KCMA 2ZJQA 4A4IA 4JOIC 5ELNA 4JI0L 1VQ5A 2VQFL 4IPGA 2JEAI 3H0GH 5C0XG 4HJ8A 1YITA 4YWKA 1VQ4A 3PF4A 1C9OA 2VS1A 1U0LA 3GD7A 3S1QH 1Q8KA 4B3RQ 1N32Q 1B8AA 2OQKA 4DV1L 4NXNQ 3STBC 1VQEA 2UU9L 5GAEC 3CCUA 3UDFA 2RF4A 5M5XH 4L5RC 4X66Q 5M5YH 3F2BA 2NVTH 3F2DA 2EQSA 1QZHA 3BZKA 4MTNA 1IBLQ 4A3LH 5BR8L 1V43A 2PI2A 1KRTA 1J5EL 1VQKA 1IBKQ 3PCOB 1YHBA 4DR2Q 1YHQA 5IYDH 4AIMA 3NENA 5C3EG 1Z9FA 1AH9A 4JI3L 4LF6Q 4A3DG 1L1OB 1XJVA 2MO1A 3ULPA 1QVFA 2FXQA 4AYBE 1NBWA 2N49A 1CUKA 2PQAB 1B7YB 4LWCA 3U58A 4DV7L 4GOPC 2OTLA 1Y1WG 4DV6Q 2UXDL 2RCNA 1CSPA 5JEAG 2E5LL 4DR1L 3E9HA 4DR4L 2IHEA 4O0AA 1FJGQ 3I2ZA 4APVA 2ES2A 1PFSA 5ELOA 4P75A 4UPAA 1Z47A 2WFWA 4C2MH 1LYLA 3KJPA 4YHHL 1T9HA 2LXKA 5FLMG 1VQ7A 3U4ZA 3K7AH 3W5OA 1KL9A 4B3TL 3HOUH 4XIGS 4DV2Q 3CQZH 3S1MH 1E1TA 5IYBG 4O2DA 1YZ6A 1YJNA 3GTPH 3HOWG 3PO3H 4DAMA 4C3JH 3M9BA 4H02A 1XNRQ 3JC66 2ZJPA 4JI6L 3PUXA 2NN6G 5C0XJ 1Y1VG 2K14A 3A5ZB 4JI0Q 4JI7Q 5IYCH 3NELA 3G6EA 4OWXB 3AFPA 3I4OA 1VQ8A 5C4XG 3HOZG 2CFMA 3PGZA 4GOPB 4DV1Q 1YI2A 5DLQE 1N36L 2K50A 1Q7YC 2XGTA 4L5QA 4X65L 4K0KL 4GKJL 3CC2A 1K73C 1D8LA 1OXSC 4A75A 2NVYH 1Q46A 4YCUA 4IOCA 3HOVG 1P8LA 1X3FA 2MO0A 5BR8Q 3HOYH 3RZOH 3T1HL 1UE6A 1VS0A 1X54A 5AJ3Q 1J5EQ 4X6AH 3EBEA 4GS3A 1X65A 1Q1EA 1E24A 3KDFB 1CKNA 1JE5A 4B3RL 1PA6A 5IWAQ 3M4PA 1N32L 2UUCL 2Z0SA 4IJHA 3VDYA 1XPRA 5C4XH 1IBMQ 2E8GA 4JI3Q 4NXNL 4R4OA 3M4QA 3CCEA 1PYSB 4L5TA 4X66L 4JYAQ 2KHIA 4A3IG 4A3CH 4A93G 3G4SA 1EIFA 1TWHH 5JJLA 5JEAJ 3CMAA 1X9NA 1IBLL 2IX1A 4UP8A 4RG1A 1M1KC 1X6OA 4A3GH 4DR1Q 2VW9A 4GNXC 1IBKL 4ALPA 2OQ0A 2H5XA 3CCSA 2C35B 4LF6L 1NMFA 4TQUS 4A3BH 4JBKA 1HNZQ 4R4IA 4A93H 4P72A 1S72A 2Q2HA 4LFAL 2BA1A 4DV6L 5JJKA 3M85A 1XMOL 4HJAA 3JAMi 1KAWA 4PMWA 3TREA 1W2BA 3OYYA 4JI8Q 1FJGL 4LUVA 1IZ6A 4GN3B 2JA6G 1OXTA 3PUVA 2ASBA 4IFDG 2F4VQ 1VQAA 1I94Q 5IP9H 2R92G 4GN4B 1BVSA 1O7IA 2YYZA 1LM0A 2IY5B 1SFOH 3S24A 5IP7G 3RZDH 2JE6I 2MNAA 2XTIA 4B3SQ 4PG3A 3ULJA 2ZTCA 4BY7H 3UDXA 4DV2L 2CQOA 4MNOA 2ZTDA 1L1OC 1SE8A 1SN8A 3J7A5 2R93G 4GLXA 5HY6A 2Q2UA 4WJ4A 2HHHQ 1MJCA 2MQHA 3K80C 4X65Q 4GKJQ 4DV4Q 5K36G 2N3SA 1XNRL 4LF8Q 2JA6H 1U5KA 2CWPA 2ID0A 2K5VA 5M3MH 1C0AA 1SROA 4A3FG 1K3RA 3T1HQ 4JI7L 3I4MG 1OXXK 1LUZA 1MJEA 4LUOA 4IPHA 1J6QA 4DV3Q 3I4NG 4Y7NH 2JA7H 2UUCQ 4LF5L 2I5HA 4POFA 1XPUA 1TWCH 4DUYL 2VUMH 2EXDA 4JV5L 3L2PA 1RL2A 3T1YL 1K8AC 3GTQH 4WJ3M 2K5HA 4HIKA 4HIDA 1JT8A 1I3QH 3CC7A 3CF5A 3ULLA 4DKAC 5AJ3L 2QGQA 4NPSA 4EX5A 2NVQH 3KF8B 1QVGA
chains in the Genus database with same CATH superfamily
4HCSA 1K0SA 1K28A 5EKIA 1VQDA 4WRDA 1VQPA 2VQEL 2A68C 2F3VA 2WB1B 1TWFB 4GKKL 3WWVA 5EPLA 4P74A 1U4LA 5BN3A 1KNAA 3HS0C 2EYMA 1R9TH 1EQRA 4LK1C 4DK3C 4A3EG 3AEVA 5EKKA 3ZYYX 5IT9L 3AQQA 5LMNQ 2WAQE 3DM3A 1SNQA 5C3EH 3BZCA 1B4OA 4IJLA 1YVCA 3RLFA 5M3FG 3ND8A 4QGUA 5C44G 3K59A 4RMFA 2J0TD 3S15H 3NE5B 4A3MB 4OGQC 3PIOA 1Y1WH 5I4DA 4XYOA 5JEAH 1DXMA 1LTSD 1YNND 4GZYC 4QB4A 2B3GA 3BJUA 1I94L 1QJOA 3S14B 1STEA 2KEDA 3Q0AA 2R7ZG 4J8QA 5ELBA 2EE1A 2GVAA 3FKIG 2NTSA 3G48A 3HP3A 1HUNA 1EY8A 4LF5Q 5LMUL 2GN5A 2O4XA 1SMXA 4JV5Q 1YNNC 1NMGA 2I46A 4LF8L 1V9PA 1D7QA 3IFTA 1VQFA 2Z4HA 4DFAA 4DNIA 4BBRB 1EY4A 2AMCB 3E3XA 1Y1VH 3K57A 3S2DB 4BBSB 2DNCA 1IW7D 3B6YA 3PMFA 1LTAD 5M3MB 2WB1G 1MHWC 4WJWA 2O5IC 4UP9A 5C3XA 5EPKA 2VQEQ 4X64Q 2VZAA 1HZBA 4JOIA 1PMRA 4GKKQ 3S1QB 2DN8A 3HOVH 1IXRA 1AZPA 1YNXA 1TWGH 1GXDC 1I4RA 1RTNA 1XPOA 1LV9A 3KLRA 2E75C 3OMCA 1IW7C 4LJZC 5EBDA 5FJ8G 1QZGA 3VR6A 4KK7A 1QVCA 2QEXA 3TP7A 4A3MG 3DUZA 1WOCA 4JI1L 3RLNA 1JR0D 1PH9A 3ICEA 4M1UB 4MTKA 2OXPA 3KLSA 1SYFA 1II3A 3D4RA 1EU4A 2B2YC 2QEJC 4KD3A 4MN3A 2DJFC 3K81C 4Q0FA 4V190 1EY6A 1E1OA 2QDBA 1A3UA 4J6HA 1B70B 1HZAA 1H9JA 2E2DC 1RJTA 4XT1B 5LMUQ 4C3IH 1G291 2L0CA 3J7ZC 4FF1A 4BBRG 3W1GA 2BE5D 3K5MA 3CU7A 1SEBD 1CTMA 3S1MB 4BBSG 2Z1CA 4DR6Q 4DNRB 4L5SA 2CWAA 5IP7H 4K8JA 4C3JB 2CHBD 1DM0B 3E5SA 4A3KH 4JG2A 3OTOL 3CPWA 2JP1A 4K14A 1OXVA 2MJ8A 2BE5C 3LGJA 1GM5A 5CC4A 1FD7D 2K03A 2ZXOA 4ULLA 2PMZE 4A3LG 4JI2Q 1XNQL 1W3SA 3T53B 2EYOA 3RZOB 1STYA 1HNWL 4HIOA 5JPNC 2K05A 1Q3LA 5F2DA 3JAML 1KNEA 4QJFA 2UUAL 1BCPD 2CCZA 4QCLA 4JI5L 1D1IA 3IKJA 1N33Q 1NSNS 5IT9c 1YIJA 1IKMA 2ICEC 1VMCA 5KNCA 2MFIA 2JA9A 3NBIA 1CKNB 1Y8PB 1PH5A 2VB3X 4GNXA 1MSGA 1KDBA 2E74C 2NTTA 5T1GA 4A3EH 4EQNA 2QW7A 4DR3L 3OW2A 2B8FA 1KD1C 1BCPC 5BN4A 4YY3L 2K4KA 4K8IA 1SBBB 4FXKC 5JPMC 4C3JG 5FO7B 1AN8A 2AHOB 4X3KA 2QA4A 1N34L 5M3FH 3I55A 3PIPA 3OTOQ 1PRTD 4WORA 1IKLA 3DM1A 4GLAC 4N8FA 2A1AA 2K01A 2NBFA 5DAUA 2IWHA 3EN2A 2HT1A 4GN5A 2DNEA 1DOLA 1OXUA 2KCTA 2PW7A 3U50C 4DAYB 5HGQA 1I4QA 3HOYG 3FKIH 1E3PA 1S4ZA 3BG3A 1HA6A 5D3IB 2VQFQ 1PRTC 3BDCA 1KIXA 1HNWQ 3AFQA 1TWAH 2TMPA 4Y7NB 4LFBL 2UU9Q 2LS01 5DM73 1LACA 2CKZB 4X62L 1V1PB 5GAHC 1YJWA 4JI4L 2KHSA 5I6WA 3IRBA 4JW0A 3CRKC 4JI5Q 2K7VA 3CCRA 3UDGA 2UUBL 1TWFH 2B29A 1SYDA 2HIVA 4DXGA 1A3TA 2L12A 4G4KA 3FHWA 2JEBI 1O7ZA 5JJIA 1P16A 4DV7Q 1EOVA 3G71A 3KLWA 1OTCA 2UXDQ 5E4WC 5FJ8H 1GVPA 4AH6A 4DR2L 1DD2A 4DR4Q 1GUSA 2SDFA 1HZ9A 2HDMA 2HQLA 4P71A 3TQYA 4A3MH 1H9RA 4ZQ3A 1WTVA 4YHHQ 3QOLA 5AFWA 2L1BA 1VQCA 1X3EA 2IHFA 2BA0A 3S14H 3NQIA 3OOCA 1I6HH 1MI2A 1Q8IA 1UAPA 2AKWB 4JI6Q 2PO4A 1G51A 3KBGA 4NW2A 1PFBA 3TP8A 1PH3A 2E2IH 4BBRH 4PZ6A 1N36Q 3S2DH 2XVSA 4BBSH 1M4VA 3NEMA 4OO1G 1QUQB 2KQ3A 4X62Q 5ELEA 1XMQL 1BUVT 4HN7A 4KKSA 4TRDA 4JOIC 5ELNA 1VQ5A 1XYIA 2FINB 4IPGA 4X3SA 5C0XG 2JEAI 3M3YB 5KYIA 5C4JB 2VS1A 1VQ4A 3S1QH 4CBVA 5LHY1 1JOKA 2F0EA 4L5RC 3C46A 2F0HA 2EQSA 4RCNA 4MTNA 1E2VA 4A3LH 5BR8L 3FEWX 3OWEB 1IBKQ 3PCOB 4DR2Q 1I50B 3HEJA 2EYLA 2EJGC 2WAQB 2EY1A 1HUMA 3E6ZX 4A3DG 4UHVA 4HSPA 1QVFA 1D2BA 3MA2B 2N49A 2MPMA 2OTLA 2E5LL 4DR1L 1LO5D 1CZGA 1Z47A 3A54A 2N88A 3X3MA 3KJPA 4HEDA 4HR7B 5FLMG 4IUNA 3U4ZA 2A6HD 1CT1D 3W5OA 4B3TL 1MBYA 1JWMD 4XIGS 5FOBB 3A7LA 4RFBA 3S1MH 5IYBG 4O2DA 1YZ6A 3IL8A 3S9WA 4C3JH 3AB9A 3Q6SA 3I3CA 3PUXA 3A5ZB 5EGTA 3G6EA 2A6HC 2FMCA 5JOBA 1VQ8A 3IAYA 5C4XG 3PGZA 4EQOA 2K50A 4KKUA 4X65L 4K0KL 2C5CA 2R93B 1K73C 2QDLA 3NWTA 4A75A 4YCUA 5DM63 1X3FA 3HOYH 5BR8Q 2NB0A 3RZOH 4H7BA 2EYJA 3EBEA 1E24A 1CKNA 1JE5A 4A3FB 4IALA 2EYFA 1N32L 2UUCL 4IJHA 1XPRA 1IBMQ 1ML0D 3M4QA 3CCEA 4X66L 5E4XA 4A93G 3GTJB 5JEAJ 3LWUA 1GHKA 3OWFA 1JWSD 5JVH3 1TIID 4DR1Q 4GNXC 3W2DA 3L3OC 5IT9E 2C35B 4LF6L 2NUCA 2JN4A 1D5ZC 3NTIA 3BZDB 4P72A 4FYDA 4LFAL 2BA1A 2PQEA 5IGFA 5JJKA 5D65A 2M9VA 4DAYA 2B39A 3OYYA 1FJGL 1IZ6A 1NR4A 2ASBA 2F4VQ 3NPPA 2J7ZA 3M7GA 2YYZA 3DEOA 3EVQA 2HCIA 1SYEA 4B3SQ 2XSCA 2R93G 5JJZA 1V1PA 5HY6A 2HHHQ 2MQHA 4WFN3 4X65Q 1MSHA 1G2SA 1WTOA 1XNRL 2K5WA 1U5KA 4IFDH 4JI7L 4A3FG 2PMZB 3I4MG 1LUZA 1MJEA 4IPHA 4Y7NH 1R4QB 1H9MA 2UUCQ 3I72A 2I5HA 5IGGA 4IUTA 1BO0A 3L2PA 3T1YL 1K8AC 4OO1H 1JT8A 1VF7A 5EJWA 1BDOA 4I65A 1RODA 4DKAC 4ZUIA 1ONLA 5C0XH 4HJ9A 5IWAL 4QL5A 2F0JA 3E9IA 4HIMA 4PZ8A 2A8VA 4FF3A 1HR0W 4LFAQ 3DEPA 1C4QA 1CZWA 2D2CC 3VYRA 1X56A 1NR2A 1F2YA 1ESFA 4A3DH 1QWYA 2YU9B 4OXPA 2KHJA 2K5DA 1HJPA 2Z6KA 5CORA 3N52A 3H91A 3BVMA 1QUQA 3BU2A 1MIUA 4S3SA 4JI8L 3RR5A 3D8GA 4BXXG 1KQSA 4X3TA 4POGA 3S17B 4CJ1B 2OWOA 4PZ7A 2F0WA 3HFZB 5FLMH 3PSIA 4EX5A 2F1MA 3I91A 5IYBH 4K6LA 1AEXA 4DV4L 3T1YQ 3H3VI 1KTKA 2EJMA 2IPKD 4ILWA 2D0OA 1JB7A 3M3YH 1AH9A 5C4JH 3ER0A 1KC8C 2RDHA 2F0DA 4A76A 1B50A 5KGUA 3H0GB 1EEID 4CGYB 3R2TA 1I50H 1VQMA 1TWCB 1S40A 3OW7A 2LXJA 3TMEA 2NVTB 1B1ZA 4AQYQ 3L9AX 2ZXRA 2K1BA 3CCMA 1G8ZD 2Q2IA 3ITPA 3EA6A 1GUGA 1PZKD 1EL0A 1HQRD 5JVG3 2F0TA 1KHIA 1TXYA 4OWTB 1EWHA 2ICIA 2JA5G 3WOEA 4ZUJA 3TEHB 1M8AA 4PMBA 2L4NA 5LMNL 1GD7A 4QIWE 4EGVA 4DR5L 3VR4A 4LFCL 1L0WA 1HNXQ 1JICA 1BCPF 2EYPA 4EVOA 4A3KG 1ZKOA 1PZJD 2F0KA 4L63B 4C2MB 1VCIA 1GUWA 3T13A 3SEBA 1PYBA 4KHZA 1JOOA 1ZEQX 2AUKA 4DA2A 4NDXA 4CJ0B 5GADC 1LTTD 3M7NA 5IY0A 3PO3B 2Z6BA 1SR3A 2IJ0A 3SR1A 5L37A 2K33A 3GTKB 2R6GA 3H0GG 2R93H 3A5UA 4IURA 3D6CA 4L6TB 3A7AB 3D6WA 1EY9A 3KJOA 2QILA 4P2CB 4A3FH 3J81j 1FGUA 1LLRD 5I2XA 1N9WA 4TVAB 3T16A 2UXCQ 2TSSA 1TR5A 4B3ML 2BCOA 2DY7A 5IYDG 2F4IA 2HUGA 3H15A 3GTJH 5GAGC 3HG9A 2NN6I 3T4AC 1ASZA 4X64L 4KMUC 1OO9B 2OT2A 2OTJA 2VL6A 1E22A 3HKZE 3NTHA 5E7NA 2BDNA 3HGBA 1SLJA 4KI0A 4IUUA 2KVMA 1TY2A 2JK8A 3RN5A 1PYWD 2A73B 1TS3A 4FXDA 1D5MC 5GROA 4RGNA 2YV5A 4KKTA 4DR5Q 3PF5A 3TS0A 4LFCQ 4DPGA 3PUYA 4DV0Q 4IUPA 1H9SA 2FFKB 3AYHB 4A3BB 1VQ9A 4QY7A 1EFWA 4A3IB 3PO3G 1HR0L 1HXYD 4JK1C 1EYAA 3QIAA 4H0LC 4JBWA 5CV9A 1Y8NB 2H1EA 2K52A 4ID6A 3VA5A 1I5FA 3GQBA 3I56A 2E2HB 3RZDB 5J3BA 4KTAA 4BXXH 4BY7B 1PTOB 1HQMC 2PNRC 4DR6L 3K0XA 4JC0A 4BA2I 2GVBA 2JA6B 1CM9A 4B3MQ 3GTMB 1S5CD 2KBNA 4IO9A 2LY7A 3BVZA 2K75A 2NZOA 1WD1A 2JQOA 3CP0A 4DUZL 3X3NA 4JBMA 4UY8C 4A3CG 1AE3A 4JI2L 5I9OA 2Q2TA 2BH8A 3HZXA 2WP8J 3ERQA 2NVQB 1HTLD 5IGBA 3I4NB 2OCEA 3J81c 4A3BG 3R3OA 3KOJA 1F9PA 1BR9A 1WVLA 1A62A 5EKLA 1F9RA 1JORA 1EUJA 1K8OA 1S5DD 2Z6KC 2YU9H 2AWOA 1VF5C 4KJNA 1HR0Q 1N33L 2F0NA 4CDEC 3S1NB 1XTDA 1JJ2A 1EYGA 3Q23A 1JJGA 3QOJA 1KRSA 4X3UA 1JWUD 3URYA 3Q22A 4BY7G 2KENA 5J1ZA 2JA5H 4OEMB 3S17H 3WDNA 3BS1A 1DGSA 3CCJA 2F52A 1WTWA 2EZVA 1F77A 1U9RA 4DAVA 1WCMB 5M3MG 1TS4A 2XRQD 1E0BA 3KF6B 3RN2A 3DXJC 4C3HB 1F9QA 3SK5A 1EYDA 4OIKA 2AWNA 2KOLA 1Q81C 3K5NA 3QB3A 4DUZQ 1GJXA 3DMUA 2ALYB 4O42A 4KY6A 1ILQA 2ZJQA 2KCNA 1RTOA 2PZTA 1X3QA 2VQFL 2M00A 3H0GH 4HJ8A 1LTBD 2K04A 4B3RQ 1C9OA 3I4LA 2FHTA 3GD7A 1Q8KA 2RQXA 3KUPA 1B8AA 2OQKA 2UU9L 1JQYD 3DWAA 3NP8A 3VA7A 2NVTH 3M4OB 1QZHA 5CGKA 4LMQD 1QOHA 2GA4B 3TN2A 3GTOB 2X6GA 1YHBA 5IYDH 2E2JB 2I07B 3TP6A 1DYQA 2NWGA 5J22A 1L1OB 2EYHA 1SE2A 3TBIB 4G7ZC 2FXQA 4AYBE 4ZKBB 2PQAB 1CUKA 1B7YB 4LWCA 5CV8A 4DV7L 2UXDL 1A3VA 5JAVA 1EIGA 1SNMA 2WACA 3E9HA 4M8AA 1CHPD 5ELFA 4DR4L 1K83B 4O0AA 4APVA 1PFSA 5ELOA 4UPAA 1QG7A 5A2QE 4ZCKA 4C2MH 3S2HB 4YHHL 1EYCA 1T9HA 2EPBA 3NSWA 4K5WA 1KL9A 4DV2Q 3PO3H 1YJNA 1Z6HA 3MEHA 2ENBA 4FF4A 2XNAC 3I8ZA 2Z4IA 2FMMA 4IQZA 4JI6L 5C0XJ 2K14A 1DOMA 2IX3A 4XQJA 1G2TA 1N36L 3A8IE 3HOXB 1Q7YC 1QE6A 2XGTA 1B9NA 3KLSX 1TKWB 1EU3A 1D8LA 5IGDA 3NQTA 1I4XA 4IOCA 2MO0A 2F0LA 1UE6A 5AJ3Q 1X54A 4X6AH 2DY8A 3M4PA 5M5WB 2Z0SA 3VDYA 2F03A 3EROA 2WV6D 5CV4A 5IIFA 4R4OA 4JYAQ 5KNBA 5FKAC 3VR2A 4A3CH 5JJLA 1EIFA 1X6OA 1IBKL 4N9PA 3S1RB 3SK6A 1CQVA 2Q8IB 4QIWB 4XT3B 4TQUS 4A3BH 1ILPA 1NAPA 1HNZQ 3OIQA 3K6OA 2Z8LA 1JCKB 3MFGA 3M85A 1FNVA 1XMOL 1Y69U 4RGOS 1AZQA 4F88A 4PMWA 3TREA 1W2BA 1I4GA 3GTLB 4IFDG 1GOZA 1XTCD 3LX0A 4GN4B 4FNFA 2IY5B 1SAPA 3RZDH 2JE6I 4BY1B 2XTIA 1S5ED 2F0PA 4KHVA 3UDXA 4BY7H 1SN8A 3J7A5 2B2TA 4DXFA 1VDZA 4KN4C 5K36G 2JA6H 5M3MH 4RH6A 2Y0SB 4H44C 3V96A 1K3RA 1V1OA 3GTPB 3A55A 1PXUA 2HCCA 4DV3Q 3K58A 3A8KE 3LWEA 4POFA 1XPUA 4DUYL 4ZYSA 2EXDA 3HKZB 1LT5D 4KY7A 4WJ3M 1WD0A 3ONAB 4DGZA 4FF2A 2NVQH 4C1NK 1HCZA 3KF8B 2F0OA 2ATWA 3I4NH 1Q12A 1ZYRD 2M2LA 1SSOA 4RHSA 1IBML 2NVXB 5CMDA 1KXLA 4FDBA 3J81E 4TKOB 1U4MA 3KK7A 2ZM6Q 1BBWA 4EQ5A 5C3WA 3PO2B 1W6KA 3S1NH 1XMOQ 1PH8A 1PHJA 1I4PA 2RDGA 2LFNA 1ZYRC 4MZ9A 4K5XA 4RKLA 2N8NA 2KEEA 1PH2A 2B63B 1MD2D 2NZHA 1UE7A 4DAPA 1WCMH 3S16B 2RHSB 1RDPD 1XWEA 2D9UA 2IW3A 5IODA 5FLXL 2F4VL 1EY7A 4C3HH 2CVRA 4PV1C 2CW0D 2XRSD 3MXNB 3MFYA 3RUZA 5DEHA 4B3SL 1NE3A 3FDTA 4DK1A 4KJOA 2JA8B 4ZRZA 4UP7A 2EJFC 1SYBA 3N6RA 2HHHL 4DUYQ 4KLKA 4YWMA 3FRPB 3PQIA 4LNQA 3NXWA 1Q82C 3G6JB 2WAQG 4DU9A 4ABNA 1MKHA 5G3LD 3J80i 2B2WA 2PQAA 1IHZA 3PIO3 1SMYD 4LF9L 3M4OH 4RAUC 1QCBD 2JXMB 3GTOH 2JA7B 2E2JH 4U68A 4NB3A 1G91A 1CI3M 5M5XB 1VQNA 2A74C 2F0FA 3GP7A 2VB2X 1YEZA 2EDGA 1SMYC 4K2LA 2HQEA 1D6EC 1K83H 3SGIA 4XTCS 3I7FA 3S2HH 2F0SA 1CHQD 5A2QL 4ZK9B 1JOQA 1RIPA 4OONA 4PNYA 3D3RA 4TSSA 5I9PA 3K7AB 3BDLA 1QB5D 2L11A 2D62A 3S15B 1Y1WB 3AU7A 2HDLA 1IL2A 1E2ZA 3Q8DA 1TT2A 3DLLA 4NXMQ 4LUZA 4YCWA 4LF9Q 1C7YA 1K0RA 4DF7A 1SNDA 5K36H 4P73A 2QCPX 1PH7A 4BS9A 3O13A 5M5WH 2JYOA 1VQGA 1BBXC 1JMCA 1LTLA 4IUQA 1CA5A 4DR7Q 1YBYA 4R4CA 5CV6A 2RBMA 2JJQA 4AYBB 3S1RH 1J9OA 2G9DA 1GKHA 3A56A 3F8TA 1IL8A 1VQHA 4AQYL 1BQQT 3QJYA 1HZCA 3HOVB 1FNUA 4DK6C 4NKLA 4I7AA 3BDOA 3J81i 4A3GB 1EOTA 5FK9C 4LF4L 2G5DA 2V1CC 1A8VA 2F3IA 4DV5Q 4KHPQ 2XN9C 5E1FA 4KD4A 2PCFB 3R93A 3NBHB 4BY1H 1D5XC 3MAQA 3ZJYC 2B2TC 5FLXc 1HNXL 4LF7Q 1STAA 2I5MX 3D4WA 3D0FA 2F0MA 5IYCG 2ZTEA 1QNUA 3C1EA 1SFOB 1WJJA 1L2FA 2KUMA 1O7LA 1UEAB 3KF8A 1B3AA 1WTQA 1K8MA 1R4PB 4C3IB 5CV5A 1Q1BA 4E6IA 3A8JE 1HH2P 1NJIC 1JJCB 4MHEA 3U9OA 2PYKA 1HFGA 3QO2A 4PMCA 4AYBG 3CKIB 4R4TA 3IFDA 2BOSA 4IOAA 1WFQA 4RA8A 1VQBA 3U4VA 3RNUA 1VQOA 2VUMB 1D1KA 1STNA 5IE8A 2NVXH 4OWWB 1CKMA 3VYTA 2UXCL 4A3GG 2O5JC 3E0EA 3CAMA 1I3QB 1Y8OB 3J81L 3CD6A 3PIP3 1Y14B 2HIXA 3VR3A 1LABA 3CHBD 1Q86C 4QQBX 3PO2H 1RF2D 3L0OA 3PUWA 4LF4Q 2SEBD 3KFUA 1L0YB 4JBJA 3GDEA 3U9SA 4Y52H 3D31A 3QWNA 3BYTB 2QF7A 3GO5A 3MXNA 5K5PA 3HKSA 2F3WA 1FVIA 1A63A 1BNZA 4FP5D 2B63H 2B8GA 1TVXA 3CCQA 1EIYB 2YTVA 4DV0L 3F2CA 5GQOA 4K2KA 3S16H 4LW1A 4CKEA 3M4YA 3RD4A 3CXCA 4YCVA 2K5NA 1CK1A 2C9OA 1STBA 5EQ0A 2H4OA 4A3EB 2JA8H 4F87A 2PI2E 3OPOA 1N8RC 2EIFA 2EOTA 4XYQA 1RHPA 3H3VH 3J80c 4U673 2RKSA 5M3FB 1BF4A 5C44B 3STBD 2VUMG 1WYDA 3A0JA 4HSVA 2B2WC 3L7ZC 1H95A 2Y0SE 4GNXB 2IT1A 3HOWB 2KCCA 1VQ6A 5C5MA 3GTGB 2KCMA 4JI0L 4K5VA 2RA4A 1AW7A 4YWKA 2R7ZB 1EEFD 4ME5A 1STGA 3STBC 1VQEA 4NXNQ 3CCUA 3SDZA 3UDFA 2RF4A 5M5XH 3HOZB 3F2BA 2WKDA 1IBLQ 1GUNA 1U4RA 1VQKA 3H6MA 1X32A 1JB3A 1HPCA 2QKIC 2RVLA 1YHQA 1SE3A 1XXGA 1B44D 3NENA 5LL6X 4DK0A 5C4ZA 3MXUA 4N8X1 1XJVA 1KLUD 2EY5A 3U58A 4RGTA 4DV6Q 2RCNA 1CSPA 2IHEA 3GV6A 2ES2A 4P75A 2K28A 2WFWA 5T1IA 5CBEE 1LYLA 1IYVA 4JVZA 1VQ7A 1ICFB 3K7AH 4OHJA 2R61A 1LTRD 1SNPA 3Q24A 3QR8A 1E1TA 1KDCA 5HGTA 3HOWG 5CV7A 4DAMA 4KN7C 3M9BA 4H02A 3JC66 4L8JA 2L5TA 1T5XD 2ZJPA 4JI0Q 1Z7TA 5IYCH 2R92B 1I6HB 3GV3A 1A2UA 3HOZG 2CFMA 4GOPB 4CDFC 5DLQE 4L5QA 1OXSC 2VNUD 1Q46A 1P8LA 2E2IB 1YNJD 3T1HL 2NN6H 1VS0A 1X65A 1Q1EA 3KDFB 4B3RL 4PQXA 1AFPA 4IN3A 4ZLTF 3ND9A 4RHRA 1PYSB 2E76C 4L5TA 1F9SA 2KHIA 4A3IG 1VMPA 3NBHA 1X9NA 4RG1A 1YNJC 2PZWA 4A3GH 3K0YA 2VW9A 1ET6A 4IZ8A 1HHVA 5J39A 4ALPA 2OQ0A 2H5XA 3CCSA 1ENCA 5IGEA 5C6AA 1NMFA 3EFXD 4IUVA 4JBKA 4R4IA 3H94A 1T5EA 4OELB 1S72A 5BN5A 1HA5A 1F2ZA 3VYUA 3JAMi 5D3DA 1SYCA 2CH4A 4LUVA 2RSNA 4GN3B 2JA6G 1OXTA 3SXHA 1I94Q 1JE4A 5FLXE 2R92G 1BVSA 1O7IA 1LM0A 3TSSA 1SFOH 3MVVA 3S24A 3DWPA 4ZAIA 1I6VC 4DV2L 2CQOA 4MNOA 4YIJA 2ZTDA 3VR5A 4FVMA 2Q2UA 1EQVA 3DHQA 1BXTA 3E0JA 4LF8Q 4QUFA 3EJIA 3FPPA 2L55A 1C0AA 2NYZD 3T1HQ 1B3QA 3I4NG 1J6QA 1KDAA 3MZ5A 2PPBC 2V4DA 2A69D 1O80A 2DJGC 1ESRA 1QNKA 4RGMA 1FYCA 3F2UA 1TWCH 2VUMH 1LT3D 1SXTA 1TQOA 1RL2A 2K5HA 4HIDA 2CQAA 3NWSA 1I3QH 2AQ1B 3CC7A 3CF5A 5AJ3L 1AP0A 3I70A 5H1SE 2IX0A 2A69C 3CPFA 1SNCA 3CRLC 3HOYB 5KIXA 4ME3A 2XWJB 2N78A 3EQLC 1ICWA 4JYAL 3WOFA 2LSSA 4A3JB 2I5LX 4JI1Q 2RSOA 1A2TA 2B2UA 5G3LF 3MEFA 3FPUB 1EWCA 1SJHD 1WCMG 1ENFA 3P75A 3H3VC 4IFDJ 2L15A 3OMGA 3SHLA 4C3HG 2O2LD 4R9WA 1HNZL 1ZXTA 1C8CA 3MC0B 2MGSA 4ZKCB 2RHQB 3C1FA 5FO8B 2OF1A 1EQQA 3GTKH 3CCLA 1GUOA 1WTPA 1TY0A 4OX9L 3UE1A 3SE0A 5C44H 3J7AF 4DNTB 2J4XA 3J80E 1H9KA 1RCVD 4UDUC 4IPCA 1TS2A 2YTXA 3HOWH 3T56B 4EQPA 3EIVA 3GTGH 5TSSA 3KYHC 2G9HD 5COYA 1QILA 4HJ5A 2D5DA 2MHVA 3W1BA 1F2LA 2R7ZH 3TS2A 4DV3L 1JC7A 4G7HC 3HRZC 4LAAA 5KNDA 1XNQQ 3HOZH 4O1NA 1X55A 4A3JG 2WIIB 1SRUA 1GHJA 1G6PA 1YHAA 4KY5A 3R8BA 1O78A 3SK8A 1EY0A 1PDQA 4HAEA 4B08A 1SNOA 1DOKA 2UUAQ 1ASYA 2LKVA 5M5YB 2VY3A 2F0VA 1S5BD 4CKCA 1WTHA 2X6LA 1LTGD 2ZM6L 4BWGB 2AQ2B 4Q5VA 4A3IH 1CFMA 1F2MA 1PFMA 1PTOF 5ELCA 1M90C 1PH4A 4JPBW 1WTRA 1VQLA 1LT6D 1O7YA 4DR3Q 4YY3Q 3V2TA 4B9XA 3SK4A 5CBAE 1ENAA 2EY2A 2E2HH 2DUDA 4G57A 4GOPA 1N34Q 3RMHA 4OX9Q 2EY6A 2D0PA 2K32A 4FO2A 3HOXG 1PTOH 5C4HA 4CJ2C 4A3DB 4J15A 2EVBA 4JCVE 1EY5A 2I0QA 4CKBA 2BH2A 5M9OA 3K7UC 3HOUB 3GTMH 3KDFA 3CQZB 4DN4M 2R92H 1PH1A 3J7AV 3H09A 1PZID 3I73A 1EZ8A 3MHBA 1KLGD 1NTGA 1K3BC 1KAAA 1UNSA 4HTHA 2XIWA 2K6AA 3TDQA 1PH6A 3MTSA 2CH4W 4UAIA 1K8GA 4LFBQ 5KYLA 1G6ZA 4XDXA 4JI4Q 1NY4A 3VYSA 1IYJB 3DWQA 3FP9A 3CCVA 1TS5A 2NVYB 1CSQA 2UUBQ 1Q90A 2L9HA 2IL8A 1X3PA 1SDFA 4HMJA 3CMEA 4C56C 1WTXA 1FL0A 3OSOA 5C4XB 3RLOA 4RKBA 2SNSA 3NHHA 3KF6A 3JAMc 1BOSA 1TWHB 4QMGA 4BY1G 1L0XB 3TRZA 2PW5A 2RDFA 4RCOA 5IOCA 3V05A 3PUZA 5E3FA 1V1QA 2WB1E 1A0IA 1UUPA 2F0IA 3HOUG 1PV4A 2Y0SG 1FNWA 4A93B 4HMIA 1S3OA 1UWVA 2MP1A 1HTPA 5HURA 2KJXA 2P5ZX 1DZ1A 1E7ZA 4ODGA 4IPDA 1I4HA 4BA1I 1AE2A 2F0QA 3HKZG 4GLVB 2UXBL 3PV0A 4G7OC 3UI2A 2HD3A 1NCVA 5A35A 4KV6A 1CKOA 1PFNA 1V8QA 2CW0C 4R8IA 4R1JA 1VQJA 1XMQQ 1L1OA 1X3GA 3P1HA 1BKBA 4NXML 3UE0A 2B2VA 5I6YA 3D4DA 3BVGA 4IFDI 1RD9D 2BDOA 3PO2G 2YTYA 1BCPB 2PZUA 3QG1A 2JSOA 1YJ9A 3TZUA 1NUCA 5I2YA 5EBCA 1MGSA 3GTQB 5EAYA 4OO1I 2AQ3B 2B2UC 5KEEA 2K5QA 4FXGC 1EWIA 1KABA 4A3JH 3CC4A 4R4QA 2B63G 4DR7L 3I4MB 1HRJA 5C0XI 5LL6S 2ZXPA 2SOBA 2KA7A 2WKCA 2SNMA 1DJRD 1K9MC 5LMNW 1CQFA 1GO3E 2R7FA 3P20A 2E5LQ 4HJ7A 2DGYA 1R9TB 3F1ZA 3ERSX 1PRTB 2JA8G 1UE5A 3G7LA 3NTKA 1U4PA 5IP9G 3FVQA 2ZJRA 1XX8A 5C3EB 3UDIA 5ELDA 4DV5L 4KHPL 2UXBQ 1UEBA 4B3TQ 3CW2C 1PVOA 1VQIA 2PNHA 2OEOA 5KRUA 1UE1A 4CHTB 3C3LA 3OHXC 1S5FD 1NNXA 4H13C 1B9MA 4LF7L 3J80L 4RWSC 1WI5A 2X69A 3HOXH 4XQQA 4QUCA 3K8AA 2JA7G 2A19A 2MUYA 2R7DA 4YWLA 3A74A 3MXGA 1BBUA 4K0KQ 1H9SB 1LT4D 3AMUA 3LNNA 4A4IA 1PTOD 4V0BA 1YITA 1Y1VB 3PF4A 1U0LA 5FO9B 1N32Q 1PLFA 4DV1L 1EIHA 3BYYB 5GAEC 1IYUA 4X66Q 1RKNA 5M5YH 5CR3A 3F2DA 3BZKA 4XXEA 1B2TA 1V43A 2PI2A 1KRTA 1PTOC 1E2WA 5EPJA 1J5EL 2R3ZA 4AIMA 1TWGB 5C3EG 1Z9FA 4JI3L 4J1MA 4LF6Q 2Q8TA 2MO1A 3ULPA 5CYUA 4B9WA 1NBWA 3GTLH 3OIPA 4GOPC 1Y1WG 1STHA 5JEAG 3FMCA 3SVMA 4Z9CB 3W3AA 4MIUA 1FJGQ 3I2ZA 2NZ1D 1HFNA 1ET9A 3KBXA 2XWBB 2LXKA 2A5HA 3NK9A 3HOUH 3CQZH 1GUTA 4CDDC 3GTPH 2B2YA 5DNFA 1C48A 4NMZA 1W6JA 1XNRQ 2VXWA 2JA5B 2A6ED 2NN6G 1Y1VG 4JI7Q 1B53A 3NELA 4OWXB 3AFPA 3I4OA 5ISRA 4DV1Q 1YI2A 2Z9HA 1DONA 4A3KB 4CDCC 4GKJL 2KECA 3CC2A 2NVYH 3HOVG 2A6EC 1EQTA 3TZDA 1J5EQ 4GS3A 1FGBD 3T51B 1PA6A 5IWAQ 3TP5A 5C4XH 2N55A 2E8GA 4XQNA 4NXNL 4JI3Q 4NP5A 3G4SA 1TWHH 2F0UA 3I90A 3CMAA 1IBLL 2IX1A 4UP8A 1SJED 3K5LA 1M1KC 5NUCA 3JAME 1CA6A 2F0GA 2ZT9C 1SE4A 1EFID 1A15A 1A6XA 4R8NA 4N9TA 3P7JA 2WINB 4A93H 1LTID 2Q2HA 4DV6L 1EZ6A 4HJAA 4C3IG 1KAWA 2FJ2A 3J7YW 4I7ZC 4JI8Q 4HCEA 5D14A 3PUVA 1VQAA 5IP9H 2Q8RE 4F7XA 5IP7G 2MNAA 4PG3A 3ULJA 2ZTCA 1L1OC 1SE8A 2EXZA 1J8IA 4GLXA 2AUJD 4OL7A 2B2VC 4WJ4A 1MJCA 3K80C 4OIJA 4QF4A 1TU2B 3C2PA 3NUCA 4DV4Q 4GKJQ 2N3SA 1DCZA 2CWPA 2ID0A 2K5VA 2RCFA 5IGCA 1SYGA 1SROA 1OXXK 2LMCB 3K5OA 4LUOA 5C5LA 2JA7H 3MXPA 4K6DA 4C1NI 4LF5L 1FR3A 3FKIB 2A68D 4JV5L 3MWYW 3GTQH 4HIKA 4F8MA 3R2IA 1TWAB 1PRTF 2QGQA 4NPSA 3ULLA 3I4MH 1QVGA
chains in the Genus database with same CATH topology
3I4NH 4HJ9A 1Q12A 5H1SE 5IWAL 2IX0A 3CPFA 4QL5A 1KXLA 1IBML 1VQDA 4ME3A 4FDBA 1VQPA 2N78A 3E9IA 4HIMA 4PZ8A 2VQEL 4JYAL 2ZM6Q 1BBWA 2A8VA 4GKKL 3WWVA 2LSSA 4EQ5A 2I5LX 4P74A 4JI1Q 1HR0W 4LFAQ 3MEFA 1R9TH 3S1NH 1XMOQ 1EQRA 1WCMG 4DK3C 4A3EG 1PH8A 3AEVA 1X56A 1PHJA 4IFDJ 2L15A 4MZ9A 3AQQA 5LMNQ 2WAQE 3DM3A 5C3EH 3BZCA 2N8NA 4A3DH 4IJLA 1HNZL 4OXPA 1PH2A 1YVCA 3RLFA 5M3FG 2KHJA 2ATWA 4QGUA 1HJPA 5C44G 4RMFA 2Z6KA 3S15H 2NZHA 2RHQB 3PIOA 1Y1WH 1UE7A 1QUQA 1WCMH 1EQQA 3BU2A 1MIUA 4JI8L 2RHSB 3GTKH 3RR5A 2B3GA 3CCLA 3BJUA 1KQSA 2F4VL 1I94L 4BXXG 4C3HH 4POGA 2OWOA 4PZ7A 3HFZB 2R7ZG 3MXNB 5FLMH 3PSIA 3UE1A 4OX9L 5C44H 1NE3A 2GVAA 3FKIG 4B3SL 3G48A 4LF5Q 5IYBH 4IPCA 4UP7A 5LMUL 2YTXA 2GN5A 3HOWH 2HHHL 4DUYQ 4KLKA 1SMXA 3EIVA 4YWMA 3GTGH 4JV5Q 3KYHC 1NMGA 4DV4L 3T1YQ 4LNQA 3H3VI 4LF8L 1V9PA 1D7QA 1VQFA 2D0OA 4HJ5A 4DNIA 1JB7A 3W1BA 1Q82C 2AMCB 2WAQG 1Y1VH 5C4JH 3ER0A 3M3YH 2VNUD 1MKHA 2R7ZH 3TS2A 1KC8C 4DV3L 3B6YA 3J80i 1XNQQ 2WB1G 4A76A 3HOZH 4UP9A 2PQAA 1X55A 4A3JG 3M4OH 4LF9L 1SRUA 2VQEQ 1G6PA 1YHAA 4X64Q 2VZAA 1HZBA 4JOIA 4GKKQ 3GTOH 1I50H 3HOVH 1VQMA 1IXRA 2E2JH 4NB3A 1YNXA 1TWGH 2UUAQ 1XPOA 1S40A 1ASYA 1VQNA 2LXJA 2VY3A 5FJ8G 4AQYQ 1QZGA 1YEZA 1QVCA 2QEXA 3CCMA 2ZM6L 4A3MG 2Q2IA 1WOCA 4A3IH 4JI1L 3RLNA 1PH9A 3ICEA 1M90C 1K83H 3SGIA 1PH4A 1KHIA 1TXYA 3I7FA 4OWTB 4XTCS 4DR3Q 1VQLA 2JA5G 3TEHB 3S2HH 4YY3Q 5LMNL 1GD7A 4QIWE 4DR5L 3I4MH 4LFCL 1L0WA 2E2HH 2DUDA 1N34Q 4GOPA 3K81C 1RIPA 4OX9Q 2D0PA 1HNXQ 1E1OA 4OONA 4A3KG 3HOXG 1B70B 1HZAA 5LMUQ 4J15A 4C3IH 1VCIA 4JCVE 1G291 3J7ZC 2I0QA 2BH2A 1PYBA 4KHZA 3W1GA 4BBRG 3K7UC 2D62A 3GTMH 3KDFA 5GADC 4BBSG 3M7NA 2R92H 4DR6Q 5IY0A 1PH1A 4L5SA 1IL2A 1SR3A 2CWAA 3Q8DA 5IP7H 3DLLA 2R6GA 4NXMQ 4A3KH 4LUZA 1NTGA 3H0GG 4JG2A 3OTOL 3CPWA 3A5UA 2R93H 4YCWA 4LF9Q 1OXVA 1K0RA 1C7YA 1K8GA 3LGJA 4P73A 1PH6A 1GM5A 3KJOA 4LFBQ 1PH7A 4A3FH 3J81j 1FGUA 4JI4Q 5M5WH 1N9WA 2PMZE 4TVAB 1NY4A 4A3LG 1VQGA 4JI2Q 1JMCA 1IYJB 3FP9A 2UXCQ 3CCVA 4B3ML 1XNQL 1CSQA 5IYDG 2UUBQ 3H15A 1W3SA 1LTLA 3GTJH 5GAGC 1HNWL 4DR7Q 1YBYA 2NN6I 4R4CA 1ASZA 4X64L 4HIOA 3CMEA 2OTJA 2VL6A 1E22A 2JJQA 3HKZE 5E7NA 1FL0A 1SLJA 4KI0A 3RLOA 3S1RH 4QJFA 1GKHA 2JK8A 2UUAL 3RN5A 3F8TA 2CCZA 3KF6A 3JAMc 1VQHA 5GROA 4JI5L 4AQYL 4BY1G 2YV5A 1HZCA 1N33Q 4DK6C 3TRZA 4DR5Q 3PF5A 5IT9c 3J81i 3TS0A 1YIJA 4LFCQ 3PUZA 1V1QA 4DPGA 3PUYA 2WB1E 4DV0Q 1A0IA 2MFIA 2JA9A 1PH5A 1CKNB 4LF4L 2V1CC 1A8VA 4GNXA 3AYHB 2F3IA 4A3EH 4DV5Q 1VQ9A 3HOUG 1PV4A 4KHPQ 2Y0SG 4DR3L 3OW2A 1KD1C 4QY7A 1EFWA 3PO3G 1S3OA 4YY3L 2K4KA 3GTLH 1HR0L 1UWVA 3NBHB 4BY1H 2AHOB 3ZJYC 2QA4A 1N34L 5M3FH 1E7ZA 5FLXc 4JBWA 1HNXL 4LF7Q 4IPDA 3I55A 2I5MX 2K52A 3D0FA 1AE2A 4BA1I 3PIPA 5IYCG 2ZTEA 3HKZG 3OTOQ 1I5FA 4GLVB 2UXBL 3I56A 4GLAC 1WJJA 1L2FA 2A1AA 3PV0A 5J3BA 3EN2A 2HT1A 4BXXH 1CKOA 4GN5A 4DR6L 1OXUA 2KCTA 3K0XA 4JC0A 4R1JA 3U50C 1VQJA 1XMQQ 4DAYB 1Q1BA 5HGQA 1L1OA 1X3GA 2GVBA 3HOYG 3FKIH 1BKBA 4BA2I 4NXML 3UE0A 1NJIC 1HH2P 1E3PA 4B3MQ 2VQFQ 1JJCB 4IFDI 1KIXA 2KBNA 4IO9A 1HNWQ 3AFQA 2K75A 2NZOA 4AYBG 3PO2G 4R4TA 1TWAH 2JQOA 2YTYA 4LFBL 3CP0A 2UU9Q 4DUZL 4IOAA 1WFQA 1YJ9A 4JBMA 4UY8C 1VQBA 4A3CG 3U4VA 3RNUA 1VQOA 2CKZB 4X62L 5GAHC 1AE3A 5IE8A 1YJWA 2NVXH 4JI4L 4OWWB 4JI2L 3IRBA 1CKMA 5EAYA 2Q2TA 2UXCL 4A3GG 4JI5Q 4OO1I 3CCRA 2BH8A 3UDGA 3E0EA 2UUBL 1TWFH 2B29A 3CAMA 2WP8J 3CD6A 1EWIA 4A3JH 3CC4A 2B63G 4R4QA 4DR7L 1Y14B 2HIXA 4QQBX 1Q86C 2HIVA 3PO2H 2OCEA 5C0XI 3J81c 3PUWA 3L0OA 3KFUA 3KOJA 4LF4Q 4A3BG 3FHWA 4JBJA 3GDEA 1K9MC 2JEBI 4Y52H 1A62A 5LMNW 3D31A 5JJIA 1EUJA 1P16A 4DV7Q 1EOVA 3G71A 1GO3E 3KLWA 1OTCA 2UXDQ 2R7FA 3GO5A 2Z6KC 2E5LQ 2YU9H 2AWOA 3HKSA 1FVIA 1GVPA 4AH6A 5FJ8H 4HJ7A 2DGYA 4DR2L 1HR0Q 1N33L 4DR4Q 3F1ZA 1A63A 3ERSX 2B63H 2JA8G 1UE5A 1XTDA 1HZ9A 2HQLA 3TQYA 4P71A 3CCQA 4A3MH 5IP9G 2YTVA 4DV0L 1JJ2A 1EYGA 1EIYB 2ZJRA 1JJGA 3F2CA 5GQOA 4YHHQ 3S16H 1KRSA 3UDIA 1VQCA 4DV5L 4KHPL 1X3EA 2UXBQ 4BY7G 1UEBA 2IHFA 2KENA 4LW1A 4B3TQ 3CW2C 2BA0A 1PVOA 1VQIA 3CXCA 2JA5H 2PNHA 3S14H 3S17H 1DGSA 4YCVA 2K5NA 2F52A 3CCJA 1UE1A 1I6HH 2JA8H 5M3MG 2PI2E 4LF7L 2AKWB 1N8RC 2EIFA 1WI5A 4JI6Q 3KF6B 3HOXH 3RN2A 1G51A 3H3VH 3J80c 3K8AA 2AWNA 2JA7G 2A19A 1PH3A 2R7DA 4YWLA 2E2IH 4BBRH 3A74A 4PZ6A 1Q81C 1BBUA 3STBD 1N36Q 2VUMG 3S2DH 1WYDA 3A0JA 4DUZQ 4BBSH 4K0KQ 3L7ZC 1H95A 2Y0SE 2ALYB 2IT1A 3NEMA 1QUQB 4GNXB 4OO1G 4X62Q 1VQ6A 1XMQL 2KCMA 2ZJQA 4A4IA 4JOIC 5ELNA 4JI0L 1VQ5A 2VQFL 4IPGA 2JEAI 3H0GH 5C0XG 4HJ8A 1YITA 4YWKA 1VQ4A 3PF4A 1C9OA 2VS1A 1U0LA 3GD7A 3S1QH 1Q8KA 4B3RQ 1N32Q 1B8AA 2OQKA 4DV1L 4NXNQ 3STBC 1VQEA 2UU9L 5GAEC 3CCUA 3UDFA 2RF4A 5M5XH 4L5RC 4X66Q 5M5YH 3F2BA 2NVTH 3F2DA 2EQSA 1QZHA 3BZKA 4MTNA 1IBLQ 4A3LH 5BR8L 1V43A 2PI2A 1KRTA 1J5EL 1VQKA 1IBKQ 3PCOB 1YHBA 4DR2Q 1YHQA 5IYDH 4AIMA 3NENA 5C3EG 1Z9FA 1AH9A 4JI3L 4LF6Q 4A3DG 1L1OB 1XJVA 2MO1A 3ULPA 1QVFA 2FXQA 4AYBE 1NBWA 2N49A 1CUKA 2PQAB 1B7YB 4LWCA 3U58A 4DV7L 4GOPC 2OTLA 1Y1WG 4DV6Q 2UXDL 2RCNA 1CSPA 5JEAG 2E5LL 4DR1L 3E9HA 4DR4L 2IHEA 4O0AA 1FJGQ 3I2ZA 4APVA 2ES2A 1PFSA 5ELOA 4P75A 4UPAA 1Z47A 2WFWA 4C2MH 1LYLA 3KJPA 4YHHL 1T9HA 2LXKA 5FLMG 1VQ7A 3U4ZA 3K7AH 3W5OA 1KL9A 4B3TL 3HOUH 4XIGS 4DV2Q 3CQZH 3S1MH 1E1TA 5IYBG 4O2DA 1YZ6A 1YJNA 3GTPH 3HOWG 3PO3H 4DAMA 4C3JH 3M9BA 4H02A 1XNRQ 3JC66 2ZJPA 4JI6L 3PUXA 2NN6G 5C0XJ 1Y1VG 2K14A 3A5ZB 4JI0Q 4JI7Q 5IYCH 3NELA 3G6EA 4OWXB 3AFPA 3I4OA 1VQ8A 5C4XG 3HOZG 2CFMA 3PGZA 4GOPB 4DV1Q 1YI2A 5DLQE 1N36L 2K50A 1Q7YC 2XGTA 4L5QA 4X65L 4K0KL 4GKJL 3CC2A 1K73C 1D8LA 1OXSC 4A75A 2NVYH 1Q46A 4YCUA 4IOCA 3HOVG 1P8LA 1X3FA 2MO0A 5BR8Q 3HOYH 3RZOH 3T1HL 1UE6A 1VS0A 1X54A 5AJ3Q 1J5EQ 4X6AH 3EBEA 4GS3A 1X65A 1Q1EA 1E24A 3KDFB 1CKNA 1JE5A 4B3RL 1PA6A 5IWAQ 3M4PA 1N32L 2UUCL 2Z0SA 4IJHA 3VDYA 1XPRA 5C4XH 1IBMQ 2E8GA 4JI3Q 4NXNL 4R4OA 3M4QA 3CCEA 1PYSB 4L5TA 4X66L 4JYAQ 2KHIA 4A3IG 4A3CH 4A93G 3G4SA 1EIFA 1TWHH 5JJLA 5JEAJ 3CMAA 1X9NA 1IBLL 2IX1A 4UP8A 4RG1A 1M1KC 1X6OA 4A3GH 4DR1Q 2VW9A 4GNXC 1IBKL 4ALPA 2OQ0A 2H5XA 3CCSA 2C35B 4LF6L 1NMFA 4TQUS 4A3BH 4JBKA 1HNZQ 4R4IA 4A93H 4P72A 1S72A 2Q2HA 4LFAL 2BA1A 4DV6L 5JJKA 3M85A 1XMOL 4HJAA 3JAMi 1KAWA 4PMWA 3TREA 1W2BA 3OYYA 4JI8Q 1FJGL 4LUVA 1IZ6A 4GN3B 2JA6G 1OXTA 3PUVA 2ASBA 4IFDG 2F4VQ 1VQAA 1I94Q 5IP9H 2R92G 4GN4B 1BVSA 1O7IA 2YYZA 1LM0A 2IY5B 1SFOH 3S24A 5IP7G 3RZDH 2JE6I 2MNAA 2XTIA 4B3SQ 4PG3A 3ULJA 2ZTCA 4BY7H 3UDXA 4DV2L 2CQOA 4MNOA 2ZTDA 1L1OC 1SE8A 1SN8A 3J7A5 2R93G 4GLXA 5HY6A 2Q2UA 4WJ4A 2HHHQ 1MJCA 2MQHA 3K80C 4X65Q 4GKJQ 4DV4Q 5K36G 2N3SA 1XNRL 4LF8Q 2JA6H 1U5KA 2CWPA 2ID0A 2K5VA 5M3MH 1C0AA 1SROA 4A3FG 1K3RA 3T1HQ 4JI7L 3I4MG 1OXXK 1LUZA 1MJEA 4LUOA 4IPHA 1J6QA 4DV3Q 3I4NG 4Y7NH 2JA7H 2UUCQ 4LF5L 2I5HA 4POFA 1XPUA 1TWCH 4DUYL 2VUMH 2EXDA 4JV5L 3L2PA 1RL2A 3T1YL 1K8AC 3GTQH 4WJ3M 2K5HA 4HIKA 4HIDA 1JT8A 1I3QH 3CC7A 3CF5A 3ULLA 4DKAC 5AJ3L 2QGQA 4NPSA 4EX5A 2NVQH 3KF8B 1QVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N H;  4HJ9 A;  1Q12 A;  5H1S E;  5IWA L;  2IX0 A;  3CPF A;  4QL5 A;  1KXL A;  1IBM L;  1VQD A;  4ME3 A;  4FDB A;  1VQP A;  2N78 A;  3E9I A;  4HIM A;  4PZ8 A;  2VQE L;  4JYA L;  2ZM6 Q;  1BBW A;  2A8V A;  4GKK L;  3WWV A;  2LSS A;  4EQ5 A;  2I5L X;  4P74 A;  4JI1 Q;  1HR0 W;  4LFA Q;  3MEF A;  1R9T H;  3S1N H;  1XMO Q;  1EQR A;  1WCM G;  4DK3 C;  4A3E G;  1PH8 A;  3AEV A;  1X56 A;  1PHJ A;  4IFD J;  2L15 A;  4MZ9 A;  3AQQ A;  5LMN Q;  2WAQ E;  3DM3 A;  5C3E H;  3BZC A;  2N8N A;  4A3D H;  4IJL A;  1HNZ L;  4OXP A;  1PH2 A;  1YVC A;  3RLF A;  5M3F G;  2KHJ A;  2ATW A;  4QGU A;  1HJP A;  5C44 G;  4RMF A;  2Z6K A;  3S15 H;  2NZH A;  2RHQ B;  3PIO A;  1Y1W H;  1UE7 A;  1QUQ A;  1WCM H;  1EQQ A;  3BU2 A;  1MIU A;  4JI8 L;  2RHS B;  3GTK H;  3RR5 A;  2B3G A;  3CCL A;  3BJU A;  1KQS A;  2F4V L;  1I94 L;  4BXX G;  4C3H H;  4POG A;  2OWO A;  4PZ7 A;  3HFZ B;  2R7Z G;  3MXN B;  5FLM H;  3PSI A;  3UE1 A;  4OX9 L;  5C44 H;  1NE3 A;  2GVA A;  3FKI G;  4B3S L;  3G48 A;  4LF5 Q;  5IYB H;  4IPC A;  4UP7 A;  5LMU L;  2YTX A;  2GN5 A;  3HOW H;  2HHH L;  4DUY Q;  4KLK A;  1SMX A;  3EIV A;  4YWM A;  3GTG H;  4JV5 Q;  3KYH C;  1NMG A;  4DV4 L;  3T1Y Q;  4LNQ A;  3H3V I;  4LF8 L;  1V9P A;  1D7Q A;  1VQF A;  2D0O A;  4HJ5 A;  4DNI A;  1JB7 A;  3W1B A;  1Q82 C;  2AMC B;  2WAQ G;  1Y1V H;  5C4J H;  3ER0 A;  3M3Y H;  2VNU D;  1MKH A;  2R7Z H;  3TS2 A;  1KC8 C;  4DV3 L;  3B6Y A;  3J80 i;  1XNQ Q;  2WB1 G;  4A76 A;  3HOZ H;  4UP9 A;  2PQA A;  1X55 A;  4A3J G;  3M4O H;  4LF9 L;  1SRU A;  2VQE Q;  1G6P A;  1YHA A;  4X64 Q;  2VZA A;  1HZB A;  4JOI A;  4GKK Q;  3GTO H;  1I50 H;  3HOV H;  1VQM A;  1IXR A;  2E2J H;  4NB3 A;  1YNX A;  1TWG H;  2UUA Q;  1XPO A;  1S40 A;  1ASY A;  1VQN A;  2LXJ A;  2VY3 A;  5FJ8 G;  4AQY Q;  1QZG A;  1YEZ A;  1QVC A;  2QEX A;  3CCM A;  2ZM6 L;  4A3M G;  2Q2I A;  1WOC A;  4A3I H;  4JI1 L;  3RLN A;  1PH9 A;  3ICE A;  1M90 C;  1K83 H;  3SGI A;  1PH4 A;  1KHI A;  1TXY A;  3I7F A;  4OWT B;  4XTC S;  4DR3 Q;  1VQL A;  2JA5 G;  3TEH B;  3S2H H;  4YY3 Q;  5LMN L;  1GD7 A;  4QIW E;  4DR5 L;  3I4M H;  4LFC L;  1L0W A;  2E2H H;  2DUD A;  1N34 Q;  4GOP A;  3K81 C;  1RIP A;  4OX9 Q;  2D0P A;  1HNX Q;  1E1O A;  4OON A;  4A3K G;  3HOX G;  1B70 B;  1HZA A;  5LMU Q;  4J15 A;  4C3I H;  1VCI A;  4JCV E;  1G29 1;  3J7Z C;  2I0Q A;  2BH2 A;  1PYB A;  4KHZ A;  3W1G A;  4BBR G;  3K7U C;  2D62 A;  3GTM H;  3KDF A;  5GAD C;  4BBS G;  3M7N A;  2R92 H;  4DR6 Q;  5IY0 A;  1PH1 A;  4L5S A;  1IL2 A;  1SR3 A;  2CWA A;  3Q8D A;  5IP7 H;  3DLL A;  2R6G A;  4NXM Q;  4A3K H;  4LUZ A;  1NTG A;  3H0G G;  4JG2 A;  3OTO L;  3CPW A;  3A5U A;  2R93 H;  4YCW A;  4LF9 Q;  1OXV A;  1K0R A;  1C7Y A;  1K8G A;  3LGJ A;  4P73 A;  1PH6 A;  1GM5 A;  3KJO A;  4LFB Q;  1PH7 A;  4A3F H;  3J81 j;  1FGU A;  4JI4 Q;  5M5W H;  1N9W A;  2PMZ E;  4TVA B;  1NY4 A;  4A3L G;  1VQG A;  4JI2 Q;  1JMC A;  1IYJ B;  3FP9 A;  2UXC Q;  3CCV A;  4B3M L;  1XNQ L;  1CSQ A;  5IYD G;  2UUB Q;  3H15 A;  1W3S A;  1LTL A;  3GTJ H;  5GAG C;  1HNW L;  4DR7 Q;  1YBY A;  2NN6 I;  4R4C A;  1ASZ A;  4X64 L;  4HIO A;  3CME A;  2OTJ A;  2VL6 A;  1E22 A;  2JJQ A;  3HKZ E;  5E7N A;  1FL0 A;  1SLJ A;  4KI0 A;  3RLO A;  3S1R H;  4QJF A;  1GKH A;  2JK8 A;  2UUA L;  3RN5 A;  3F8T A;  2CCZ A;  3KF6 A;  3JAM c;  1VQH A;  5GRO A;  4JI5 L;  4AQY L;  4BY1 G;  2YV5 A;  1HZC A;  1N33 Q;  4DK6 C;  3TRZ A;  4DR5 Q;  3PF5 A;  5IT9 c;  3J81 i;  3TS0 A;  1YIJ A;  4LFC Q;  3PUZ A;  1V1Q A;  4DPG A;  3PUY A;  2WB1 E;  4DV0 Q;  1A0I A;  2MFI A;  2JA9 A;  1PH5 A;  1CKN B;  4LF4 L;  2V1C C;  1A8V A;  4GNX A;  3AYH B;  2F3I A;  4A3E H;  4DV5 Q;  1VQ9 A;  3HOU G;  1PV4 A;  4KHP Q;  2Y0S G;  4DR3 L;  3OW2 A;  1KD1 C;  4QY7 A;  1EFW A;  3PO3 G;  1S3O A;  4YY3 L;  2K4K A;  3GTL H;  1HR0 L;  1UWV A;  3NBH B;  4BY1 H;  2AHO B;  3ZJY C;  2QA4 A;  1N34 L;  5M3F H;  1E7Z A;  5FLX c;  4JBW A;  1HNX L;  4LF7 Q;  4IPD A;  3I55 A;  2I5M X;  2K52 A;  3D0F A;  1AE2 A;  4BA1 I;  3PIP A;  5IYC G;  2ZTE A;  3HKZ G;  3OTO Q;  1I5F A;  4GLV B;  2UXB L;  3I56 A;  4GLA C;  1WJJ A;  1L2F A;  2A1A A;  3PV0 A;  5J3B A;  3EN2 A;  2HT1 A;  4BXX H;  1CKO A;  4GN5 A;  4DR6 L;  1OXU A;  2KCT A;  3K0X A;  4JC0 A;  4R1J A;  3U50 C;  1VQJ A;  1XMQ Q;  4DAY B;  1Q1B A;  5HGQ A;  1L1O A;  1X3G A;  2GVB A;  3HOY G;  3FKI H;  1BKB A;  4BA2 I;  4NXM L;  3UE0 A;  1NJI C;  1HH2 P;  1E3P A;  4B3M Q;  2VQF Q;  1JJC B;  4IFD I;  1KIX A;  2KBN A;  4IO9 A;  1HNW Q;  3AFQ A;  2K75 A;  2NZO A;  4AYB G;  3PO2 G;  4R4T A;  1TWA H;  2JQO A;  2YTY A;  4LFB L;  3CP0 A;  2UU9 Q;  4DUZ L;  4IOA A;  1WFQ A;  1YJ9 A;  4JBM A;  4UY8 C;  1VQB A;  4A3C G;  3U4V A;  3RNU A;  1VQO A;  2CKZ B;  4X62 L;  5GAH C;  1AE3 A;  5IE8 A;  1YJW A;  2NVX H;  4JI4 L;  4OWW B;  4JI2 L;  3IRB A;  1CKM A;  5EAY A;  2Q2T A;  2UXC L;  4A3G G;  4JI5 Q;  4OO1 I;  3CCR A;  2BH8 A;  3UDG A;  3E0E A;  2UUB L;  1TWF H;  2B29 A;  3CAM A;  2WP8 J;  3CD6 A;  1EWI A;  4A3J H;  3CC4 A;  2B63 G;  4R4Q A;  4DR7 L;  1Y14 B;  2HIX A;  4QQB X;  1Q86 C;  2HIV A;  3PO2 H;  2OCE A;  5C0X I;  3J81 c;  3PUW A;  3L0O A;  3KFU A;  3KOJ A;  4LF4 Q;  4A3B G;  3FHW A;  4JBJ A;  3GDE A;  1K9M C;  2JEB I;  4Y52 H;  1A62 A;  5LMN W;  3D31 A;  5JJI A;  1EUJ A;  1P16 A;  4DV7 Q;  1EOV A;  3G71 A;  1GO3 E;  3KLW A;  1OTC A;  2UXD Q;  2R7F A;  3GO5 A;  2Z6K C;  2E5L Q;  2YU9 H;  2AWO A;  3HKS A;  1FVI A;  1GVP A;  4AH6 A;  5FJ8 H;  4HJ7 A;  2DGY A;  4DR2 L;  1HR0 Q;  1N33 L;  4DR4 Q;  3F1Z A;  1A63 A;  3ERS X;  2B63 H;  2JA8 G;  1UE5 A;  1XTD A;  1HZ9 A;  2HQL A;  3TQY A;  4P71 A;  3CCQ A;  4A3M H;  5IP9 G;  2YTV A;  4DV0 L;  1JJ2 A;  1EYG A;  1EIY B;  2ZJR A;  1JJG A;  3F2C A;  5GQO A;  4YHH Q;  3S16 H;  1KRS A;  3UDI A;  1VQC A;  4DV5 L;  4KHP L;  1X3E A;  2UXB Q;  4BY7 G;  1UEB A;  2IHF A;  2KEN A;  4LW1 A;  4B3T Q;  3CW2 C;  2BA0 A;  1PVO A;  1VQI A;  3CXC A;  2JA5 H;  2PNH A;  3S14 H;  3S17 H;  1DGS A;  4YCV A;  2K5N A;  2F52 A;  3CCJ A;  1UE1 A;  1I6H H;  2JA8 H;  5M3M G;  2PI2 E;  4LF7 L;  2AKW B;  1N8R C;  2EIF A;  1WI5 A;  4JI6 Q;  3KF6 B;  3HOX H;  3RN2 A;  1G51 A;  3H3V H;  3J80 c;  3K8A A;  2AWN A;  2JA7 G;  2A19 A;  1PH3 A;  2R7D A;  4YWL A;  2E2I H;  4BBR H;  3A74 A;  4PZ6 A;  1Q81 C;  1BBU A;  3STB D;  1N36 Q;  2VUM G;  3S2D H;  1WYD A;  3A0J A;  4DUZ Q;  4BBS H;  4K0K Q;  3L7Z C;  1H95 A;  2Y0S E;  2ALY B;  2IT1 A;  3NEM A;  1QUQ B;  4GNX B;  4OO1 G;  4X62 Q;  1VQ6 A;  1XMQ L;  2KCM A;  2ZJQ A;  4A4I A;  4JOI C;  5ELN A;  4JI0 L;  1VQ5 A;  2VQF L;  4IPG A;  2JEA I;  3H0G H;  5C0X G;  4HJ8 A;  1YIT A;  4YWK A;  1VQ4 A;  3PF4 A;  1C9O A;  2VS1 A;  1U0L A;  3GD7 A;  3S1Q H;  1Q8K A;  4B3R Q;  1N32 Q;  1B8A A;  2OQK A;  4DV1 L;  4NXN Q;  3STB C;  1VQE A;  2UU9 L;  5GAE C;  3CCU A;  3UDF A;  2RF4 A;  5M5X H;  4L5R C;  4X66 Q;  5M5Y H;  3F2B A;  2NVT H;  3F2D A;  2EQS A;  1QZH A;  3BZK A;  4MTN A;  1IBL Q;  4A3L H;  5BR8 L;  1V43 A;  2PI2 A;  1KRT A;  1J5E L;  1VQK A;  1IBK Q;  3PCO B;  1YHB A;  4DR2 Q;  1YHQ A;  5IYD H;  4AIM A;  3NEN A;  5C3E G;  1Z9F A;  1AH9 A;  4JI3 L;  4LF6 Q;  4A3D G;  1L1O B;  1XJV A;  2MO1 A;  3ULP A;  1QVF A;  2FXQ A;  4AYB E;  1NBW A;  2N49 A;  1CUK A;  2PQA B;  1B7Y B;  4LWC A;  3U58 A;  4DV7 L;  4GOP C;  2OTL A;  1Y1W G;  4DV6 Q;  2UXD L;  2RCN A;  1CSP A;  5JEA G;  2E5L L;  4DR1 L;  3E9H A;  4DR4 L;  2IHE A;  4O0A A;  1FJG Q;  3I2Z A;  4APV A;  2ES2 A;  1PFS A;  5ELO A;  4P75 A;  4UPA A;  1Z47 A;  2WFW A;  4C2M H;  1LYL A;  3KJP A;  4YHH L;  1T9H A;  2LXK A;  5FLM G;  1VQ7 A;  3U4Z A;  3K7A H;  3W5O A;  1KL9 A;  4B3T L;  3HOU H;  4XIG S;  4DV2 Q;  3CQZ H;  3S1M H;  1E1T A;  5IYB G;  4O2D A;  1YZ6 A;  1YJN A;  3GTP H;  3HOW G;  3PO3 H;  4DAM A;  4C3J H;  3M9B A;  4H02 A;  1XNR Q;  3JC6 6;  2ZJP A;  4JI6 L;  3PUX A;  2NN6 G;  5C0X J;  1Y1V G;  2K14 A;  3A5Z B;  4JI0 Q;  4JI7 Q;  5IYC H;  3NEL A;  3G6E A;  4OWX B;  3AFP A;  3I4O A;  1VQ8 A;  5C4X G;  3HOZ G;  2CFM A;  3PGZ A;  4GOP B;  4DV1 Q;  1YI2 A;  5DLQ E;  1N36 L;  2K50 A;  1Q7Y C;  2XGT A;  4L5Q A;  4X65 L;  4K0K L;  4GKJ L;  3CC2 A;  1K73 C;  1D8L A;  1OXS C;  4A75 A;  2NVY H;  1Q46 A;  4YCU A;  4IOC A;  3HOV G;  1P8L A;  1X3F A;  2MO0 A;  5BR8 Q;  3HOY H;  3RZO H;  3T1H L;  1UE6 A;  1VS0 A;  1X54 A;  5AJ3 Q;  1J5E Q;  4X6A H;  3EBE A;  4GS3 A;  1X65 A;  1Q1E A;  1E24 A;  3KDF B;  1CKN A;  1JE5 A;  4B3R L;  1PA6 A;  5IWA Q;  3M4P A;  1N32 L;  2UUC L;  2Z0S A;  4IJH A;  3VDY A;  1XPR A;  5C4X H;  1IBM Q;  2E8G A;  4JI3 Q;  4NXN L;  4R4O A;  3M4Q A;  3CCE A;  1PYS B;  4L5T A;  4X66 L;  4JYA Q;  2KHI A;  4A3I G;  4A3C H;  4A93 G;  3G4S A;  1EIF A;  1TWH H;  5JJL A;  5JEA J;  3CMA A;  1X9N A;  1IBL L;  2IX1 A;  4UP8 A;  4RG1 A;  1M1K C;  1X6O A;  4A3G H;  4DR1 Q;  2VW9 A;  4GNX C;  1IBK L;  4ALP A;  2OQ0 A;  2H5X A;  3CCS A;  2C35 B;  4LF6 L;  1NMF A;  4TQU S;  4A3B H;  4JBK A;  1HNZ Q;  4R4I A;  4A93 H;  4P72 A;  1S72 A;  2Q2H A;  4LFA L;  2BA1 A;  4DV6 L;  5JJK A;  3M85 A;  1XMO L;  4HJA A;  3JAM i;  1KAW A;  4PMW A;  3TRE A;  1W2B A;  3OYY A;  4JI8 Q;  1FJG L;  4LUV A;  1IZ6 A;  4GN3 B;  2JA6 G;  1OXT A;  3PUV A;  2ASB A;  4IFD G;  2F4V Q;  1VQA A;  1I94 Q;  5IP9 H;  2R92 G;  4GN4 B;  1BVS A;  1O7I A;  2YYZ A;  1LM0 A;  2IY5 B;  1SFO H;  3S24 A;  5IP7 G;  3RZD H;  2JE6 I;  2MNA A;  2XTI A;  4B3S Q;  4PG3 A;  3ULJ A;  2ZTC A;  4BY7 H;  3UDX A;  4DV2 L;  2CQO A;  4MNO A;  2ZTD A;  1L1O C;  1SE8 A;  1SN8 A;  3J7A 5;  2R93 G;  4GLX A;  5HY6 A;  2Q2U A;  4WJ4 A;  2HHH Q;  1MJC A;  2MQH A;  3K80 C;  4X65 Q;  4GKJ Q;  4DV4 Q;  5K36 G;  2N3S A;  1XNR L;  4LF8 Q;  2JA6 H;  1U5K A;  2CWP A;  2ID0 A;  2K5V A;  5M3M H;  1C0A A;  1SRO A;  4A3F G;  1K3R A;  3T1H Q;  4JI7 L;  3I4M G;  1OXX K;  1LUZ A;  1MJE A;  4LUO A;  4IPH A;  1J6Q A;  4DV3 Q;  3I4N G;  4Y7N H;  2JA7 H;  2UUC Q;  4LF5 L;  2I5H A;  4POF A;  1XPU A;  1TWC H;  4DUY L;  2VUM H;  2EXD A;  4JV5 L;  3L2P A;  1RL2 A;  3T1Y L;  1K8A C;  3GTQ H;  4WJ3 M;  2K5H A;  4HIK A;  4HID A;  1JT8 A;  1I3Q H;  3CC7 A;  3CF5 A;  3ULL A;  4DKA C;  5AJ3 L;  2QGQ A;  4NPS A;  4EX5 A;  2NVQ H;  3KF8 B;  1QVG A; 
#chains in the Genus database with same CATH topology
 4HCS A;  1K0S A;  1K28 A;  5EKI A;  1VQD A;  4WRD A;  1VQP A;  2VQE L;  2A68 C;  2F3V A;  2WB1 B;  1TWF B;  4GKK L;  3WWV A;  5EPL A;  4P74 A;  1U4L A;  5BN3 A;  1KNA A;  3HS0 C;  2EYM A;  1R9T H;  1EQR A;  4LK1 C;  4DK3 C;  4A3E G;  3AEV A;  5EKK A;  3ZYY X;  5IT9 L;  3AQQ A;  5LMN Q;  2WAQ E;  3DM3 A;  1SNQ A;  5C3E H;  3BZC A;  1B4O A;  4IJL A;  1YVC A;  3RLF A;  5M3F G;  3ND8 A;  4QGU A;  5C44 G;  3K59 A;  4RMF A;  2J0T D;  3S15 H;  3NE5 B;  4A3M B;  4OGQ C;  3PIO A;  1Y1W H;  5I4D A;  4XYO A;  5JEA H;  1DXM A;  1LTS D;  1YNN D;  4GZY C;  4QB4 A;  2B3G A;  3BJU A;  1I94 L;  1QJO A;  3S14 B;  1STE A;  2KED A;  3Q0A A;  2R7Z G;  4J8Q A;  5ELB A;  2EE1 A;  2GVA A;  3FKI G;  2NTS A;  3G48 A;  3HP3 A;  1HUN A;  1EY8 A;  4LF5 Q;  5LMU L;  2GN5 A;  2O4X A;  1SMX A;  4JV5 Q;  1YNN C;  1NMG A;  2I46 A;  4LF8 L;  1V9P A;  1D7Q A;  3IFT A;  1VQF A;  2Z4H A;  4DFA A;  4DNI A;  4BBR B;  1EY4 A;  2AMC B;  3E3X A;  1Y1V H;  3K57 A;  3S2D B;  4BBS B;  2DNC A;  1IW7 D;  3B6Y A;  3PMF A;  1LTA D;  5M3M B;  2WB1 G;  1MHW C;  4WJW A;  2O5I C;  4UP9 A;  5C3X A;  5EPK A;  2VQE Q;  4X64 Q;  2VZA A;  1HZB A;  4JOI A;  1PMR A;  4GKK Q;  3S1Q B;  2DN8 A;  3HOV H;  1IXR A;  1AZP A;  1YNX A;  1TWG H;  1GXD C;  1I4R A;  1RTN A;  1XPO A;  1LV9 A;  3KLR A;  2E75 C;  3OMC A;  1IW7 C;  4LJZ C;  5EBD A;  5FJ8 G;  1QZG A;  3VR6 A;  4KK7 A;  1QVC A;  2QEX A;  3TP7 A;  4A3M G;  3DUZ A;  1WOC A;  4JI1 L;  3RLN A;  1JR0 D;  1PH9 A;  3ICE A;  4M1U B;  4MTK A;  2OXP A;  3KLS A;  1SYF A;  1II3 A;  3D4R A;  1EU4 A;  2B2Y C;  2QEJ C;  4KD3 A;  4MN3 A;  2DJF C;  3K81 C;  4Q0F A;  4V19 0;  1EY6 A;  1E1O A;  2QDB A;  1A3U A;  4J6H A;  1B70 B;  1HZA A;  1H9J A;  2E2D C;  1RJT A;  4XT1 B;  5LMU Q;  4C3I H;  1G29 1;  2L0C A;  3J7Z C;  4FF1 A;  4BBR G;  3W1G A;  2BE5 D;  3K5M A;  3CU7 A;  1SEB D;  1CTM A;  3S1M B;  4BBS G;  2Z1C A;  4DR6 Q;  4DNR B;  4L5S A;  2CWA A;  5IP7 H;  4K8J A;  4C3J B;  2CHB D;  1DM0 B;  3E5S A;  4A3K H;  4JG2 A;  3OTO L;  3CPW A;  2JP1 A;  4K14 A;  1OXV A;  2MJ8 A;  2BE5 C;  3LGJ A;  1GM5 A;  5CC4 A;  1FD7 D;  2K03 A;  2ZXO A;  4ULL A;  2PMZ E;  4A3L G;  4JI2 Q;  1XNQ L;  1W3S A;  3T53 B;  2EYO A;  3RZO B;  1STY A;  1HNW L;  4HIO A;  5JPN C;  2K05 A;  1Q3L A;  5F2D A;  3JAM L;  1KNE A;  4QJF A;  2UUA L;  1BCP D;  2CCZ A;  4QCL A;  4JI5 L;  1D1I A;  3IKJ A;  1N33 Q;  1NSN S;  5IT9 c;  1YIJ A;  1IKM A;  2ICE C;  1VMC A;  5KNC A;  2MFI A;  2JA9 A;  3NBI A;  1CKN B;  1Y8P B;  1PH5 A;  2VB3 X;  4GNX A;  1MSG A;  1KDB A;  2E74 C;  2NTT A;  5T1G A;  4A3E H;  4EQN A;  2QW7 A;  4DR3 L;  3OW2 A;  2B8F A;  1KD1 C;  1BCP C;  5BN4 A;  4YY3 L;  2K4K A;  4K8I A;  1SBB B;  4FXK C;  5JPM C;  4C3J G;  5FO7 B;  1AN8 A;  2AHO B;  4X3K A;  2QA4 A;  1N34 L;  5M3F H;  3I55 A;  3PIP A;  3OTO Q;  1PRT D;  4WOR A;  1IKL A;  3DM1 A;  4GLA C;  4N8F A;  2A1A A;  2K01 A;  2NBF A;  5DAU A;  2IWH A;  3EN2 A;  2HT1 A;  4GN5 A;  2DNE A;  1DOL A;  1OXU A;  2KCT A;  2PW7 A;  3U50 C;  4DAY B;  5HGQ A;  1I4Q A;  3HOY G;  3FKI H;  1E3P A;  1S4Z A;  3BG3 A;  1HA6 A;  5D3I B;  2VQF Q;  1PRT C;  3BDC A;  1KIX A;  1HNW Q;  3AFQ A;  1TWA H;  2TMP A;  4Y7N B;  4LFB L;  2UU9 Q;  2LS0 1;  5DM7 3;  1LAC A;  2CKZ B;  4X62 L;  1V1P B;  5GAH C;  1YJW A;  4JI4 L;  2KHS A;  5I6W A;  3IRB A;  4JW0 A;  3CRK C;  4JI5 Q;  2K7V A;  3CCR A;  3UDG A;  2UUB L;  1TWF H;  2B29 A;  1SYD A;  2HIV A;  4DXG A;  1A3T A;  2L12 A;  4G4K A;  3FHW A;  2JEB I;  1O7Z A;  5JJI A;  1P16 A;  4DV7 Q;  1EOV A;  3G71 A;  3KLW A;  1OTC A;  2UXD Q;  5E4W C;  5FJ8 H;  1GVP A;  4AH6 A;  4DR2 L;  1DD2 A;  4DR4 Q;  1GUS A;  2SDF A;  1HZ9 A;  2HDM A;  2HQL A;  4P71 A;  3TQY A;  4A3M H;  1H9R A;  4ZQ3 A;  1WTV A;  4YHH Q;  3QOL A;  5AFW A;  2L1B A;  1VQC A;  1X3E A;  2IHF A;  2BA0 A;  3S14 H;  3NQI A;  3OOC A;  1I6H H;  1MI2 A;  1Q8I A;  1UAP A;  2AKW B;  4JI6 Q;  2PO4 A;  1G51 A;  3KBG A;  4NW2 A;  1PFB A;  3TP8 A;  1PH3 A;  2E2I H;  4BBR H;  4PZ6 A;  1N36 Q;  3S2D H;  2XVS A;  4BBS H;  1M4V A;  3NEM A;  4OO1 G;  1QUQ B;  2KQ3 A;  4X62 Q;  5ELE A;  1XMQ L;  1BUV T;  4HN7 A;  4KKS A;  4TRD A;  4JOI C;  5ELN A;  1VQ5 A;  1XYI A;  2FIN B;  4IPG A;  4X3S A;  5C0X G;  2JEA I;  3M3Y B;  5KYI A;  5C4J B;  2VS1 A;  1VQ4 A;  3S1Q H;  4CBV A;  5LHY 1;  1JOK A;  2F0E A;  4L5R C;  3C46 A;  2F0H A;  2EQS A;  4RCN A;  4MTN A;  1E2V A;  4A3L H;  5BR8 L;  3FEW X;  3OWE B;  1IBK Q;  3PCO B;  4DR2 Q;  1I50 B;  3HEJ A;  2EYL A;  2EJG C;  2WAQ B;  2EY1 A;  1HUM A;  3E6Z X;  4A3D G;  4UHV A;  4HSP A;  1QVF A;  1D2B A;  3MA2 B;  2N49 A;  2MPM A;  2OTL A;  2E5L L;  4DR1 L;  1LO5 D;  1CZG A;  1Z47 A;  3A54 A;  2N88 A;  3X3M A;  3KJP A;  4HED A;  4HR7 B;  5FLM G;  4IUN A;  3U4Z A;  2A6H D;  1CT1 D;  3W5O A;  4B3T L;  1MBY A;  1JWM D;  4XIG S;  5FOB B;  3A7L A;  4RFB A;  3S1M H;  5IYB G;  4O2D A;  1YZ6 A;  3IL8 A;  3S9W A;  4C3J H;  3AB9 A;  3Q6S A;  3I3C A;  3PUX A;  3A5Z B;  5EGT A;  3G6E A;  2A6H C;  2FMC A;  5JOB A;  1VQ8 A;  3IAY A;  5C4X G;  3PGZ A;  4EQO A;  2K50 A;  4KKU A;  4X65 L;  4K0K L;  2C5C A;  2R93 B;  1K73 C;  2QDL A;  3NWT A;  4A75 A;  4YCU A;  5DM6 3;  1X3F A;  3HOY H;  5BR8 Q;  2NB0 A;  3RZO H;  4H7B A;  2EYJ A;  3EBE A;  1E24 A;  1CKN A;  1JE5 A;  4A3F B;  4IAL A;  2EYF A;  1N32 L;  2UUC L;  4IJH A;  1XPR A;  1IBM Q;  1ML0 D;  3M4Q A;  3CCE A;  4X66 L;  5E4X A;  4A93 G;  3GTJ B;  5JEA J;  3LWU A;  1GHK A;  3OWF A;  1JWS D;  5JVH 3;  1TII D;  4DR1 Q;  4GNX C;  3W2D A;  3L3O C;  5IT9 E;  2C35 B;  4LF6 L;  2NUC A;  2JN4 A;  1D5Z C;  3NTI A;  3BZD B;  4P72 A;  4FYD A;  4LFA L;  2BA1 A;  2PQE A;  5IGF A;  5JJK A;  5D65 A;  2M9V A;  4DAY A;  2B39 A;  3OYY A;  1FJG L;  1IZ6 A;  1NR4 A;  2ASB A;  2F4V Q;  3NPP A;  2J7Z A;  3M7G A;  2YYZ A;  3DEO A;  3EVQ A;  2HCI A;  1SYE A;  4B3S Q;  2XSC A;  2R93 G;  5JJZ A;  1V1P A;  5HY6 A;  2HHH Q;  2MQH A;  4WFN 3;  4X65 Q;  1MSH A;  1G2S A;  1WTO A;  1XNR L;  2K5W A;  1U5K A;  4IFD H;  4JI7 L;  4A3F G;  2PMZ B;  3I4M G;  1LUZ A;  1MJE A;  4IPH A;  4Y7N H;  1R4Q B;  1H9M A;  2UUC Q;  3I72 A;  2I5H A;  5IGG A;  4IUT A;  1BO0 A;  3L2P A;  3T1Y L;  1K8A C;  4OO1 H;  1JT8 A;  1VF7 A;  5EJW A;  1BDO A;  4I65 A;  1ROD A;  4DKA C;  4ZUI A;  1ONL A;  5C0X H;  4HJ9 A;  5IWA L;  4QL5 A;  2F0J A;  3E9I A;  4HIM A;  4PZ8 A;  2A8V A;  4FF3 A;  1HR0 W;  4LFA Q;  3DEP A;  1C4Q A;  1CZW A;  2D2C C;  3VYR A;  1X56 A;  1NR2 A;  1F2Y A;  1ESF A;  4A3D H;  1QWY A;  2YU9 B;  4OXP A;  2KHJ A;  2K5D A;  1HJP A;  2Z6K A;  5COR A;  3N52 A;  3H91 A;  3BVM A;  1QUQ A;  3BU2 A;  1MIU A;  4S3S A;  4JI8 L;  3RR5 A;  3D8G A;  4BXX G;  1KQS A;  4X3T A;  4POG A;  3S17 B;  4CJ1 B;  2OWO A;  4PZ7 A;  2F0W A;  3HFZ B;  5FLM H;  3PSI A;  4EX5 A;  2F1M A;  3I91 A;  5IYB H;  4K6L A;  1AEX A;  4DV4 L;  3T1Y Q;  3H3V I;  1KTK A;  2EJM A;  2IPK D;  4ILW A;  2D0O A;  1JB7 A;  3M3Y H;  1AH9 A;  5C4J H;  3ER0 A;  1KC8 C;  2RDH A;  2F0D A;  4A76 A;  1B50 A;  5KGU A;  3H0G B;  1EEI D;  4CGY B;  3R2T A;  1I50 H;  1VQM A;  1TWC B;  1S40 A;  3OW7 A;  2LXJ A;  3TME A;  2NVT B;  1B1Z A;  4AQY Q;  3L9A X;  2ZXR A;  2K1B A;  3CCM A;  1G8Z D;  2Q2I A;  3ITP A;  3EA6 A;  1GUG A;  1PZK D;  1EL0 A;  1HQR D;  5JVG 3;  2F0T A;  1KHI A;  1TXY A;  4OWT B;  1EWH A;  2ICI A;  2JA5 G;  3WOE A;  4ZUJ A;  3TEH B;  1M8A A;  4PMB A;  2L4N A;  5LMN L;  1GD7 A;  4QIW E;  4EGV A;  4DR5 L;  3VR4 A;  4LFC L;  1L0W A;  1HNX Q;  1JIC A;  1BCP F;  2EYP A;  4EVO A;  4A3K G;  1ZKO A;  1PZJ D;  2F0K A;  4L63 B;  4C2M B;  1VCI A;  1GUW A;  3T13 A;  3SEB A;  1PYB A;  4KHZ A;  1JOO A;  1ZEQ X;  2AUK A;  4DA2 A;  4NDX A;  4CJ0 B;  5GAD C;  1LTT D;  3M7N A;  5IY0 A;  3PO3 B;  2Z6B A;  1SR3 A;  2IJ0 A;  3SR1 A;  5L37 A;  2K33 A;  3GTK B;  2R6G A;  3H0G G;  2R93 H;  3A5U A;  4IUR A;  3D6C A;  4L6T B;  3A7A B;  3D6W A;  1EY9 A;  3KJO A;  2QIL A;  4P2C B;  4A3F H;  3J81 j;  1FGU A;  1LLR D;  5I2X A;  1N9W A;  4TVA B;  3T16 A;  2UXC Q;  2TSS A;  1TR5 A;  4B3M L;  2BCO A;  2DY7 A;  5IYD G;  2F4I A;  2HUG A;  3H15 A;  3GTJ H;  5GAG C;  3HG9 A;  2NN6 I;  3T4A C;  1ASZ A;  4X64 L;  4KMU C;  1OO9 B;  2OT2 A;  2OTJ A;  2VL6 A;  1E22 A;  3HKZ E;  3NTH A;  5E7N A;  2BDN A;  3HGB A;  1SLJ A;  4KI0 A;  4IUU A;  2KVM A;  1TY2 A;  2JK8 A;  3RN5 A;  1PYW D;  2A73 B;  1TS3 A;  4FXD A;  1D5M C;  5GRO A;  4RGN A;  2YV5 A;  4KKT A;  4DR5 Q;  3PF5 A;  3TS0 A;  4LFC Q;  4DPG A;  3PUY A;  4DV0 Q;  4IUP A;  1H9S A;  2FFK B;  3AYH B;  4A3B B;  1VQ9 A;  4QY7 A;  1EFW A;  4A3I B;  3PO3 G;  1HR0 L;  1HXY D;  4JK1 C;  1EYA A;  3QIA A;  4H0L C;  4JBW A;  5CV9 A;  1Y8N B;  2H1E A;  2K52 A;  4ID6 A;  3VA5 A;  1I5F A;  3GQB A;  3I56 A;  2E2H B;  3RZD B;  5J3B A;  4KTA A;  4BXX H;  4BY7 B;  1PTO B;  1HQM C;  2PNR C;  4DR6 L;  3K0X A;  4JC0 A;  4BA2 I;  2GVB A;  2JA6 B;  1CM9 A;  4B3M Q;  3GTM B;  1S5C D;  2KBN A;  4IO9 A;  2LY7 A;  3BVZ A;  2K75 A;  2NZO A;  1WD1 A;  2JQO A;  3CP0 A;  4DUZ L;  3X3N A;  4JBM A;  4UY8 C;  4A3C G;  1AE3 A;  4JI2 L;  5I9O A;  2Q2T A;  2BH8 A;  3HZX A;  2WP8 J;  3ERQ A;  2NVQ B;  1HTL D;  5IGB A;  3I4N B;  2OCE A;  3J81 c;  4A3B G;  3R3O A;  3KOJ A;  1F9P A;  1BR9 A;  1WVL A;  1A62 A;  5EKL A;  1F9R A;  1JOR A;  1EUJ A;  1K8O A;  1S5D D;  2Z6K C;  2YU9 H;  2AWO A;  1VF5 C;  4KJN A;  1HR0 Q;  1N33 L;  2F0N A;  4CDE C;  3S1N B;  1XTD A;  1JJ2 A;  1EYG A;  3Q23 A;  1JJG A;  3QOJ A;  1KRS A;  4X3U A;  1JWU D;  3URY A;  3Q22 A;  4BY7 G;  2KEN A;  5J1Z A;  2JA5 H;  4OEM B;  3S17 H;  3WDN A;  3BS1 A;  1DGS A;  3CCJ A;  2F52 A;  1WTW A;  2EZV A;  1F77 A;  1U9R A;  4DAV A;  1WCM B;  5M3M G;  1TS4 A;  2XRQ D;  1E0B A;  3KF6 B;  3RN2 A;  3DXJ C;  4C3H B;  1F9Q A;  3SK5 A;  1EYD A;  4OIK A;  2AWN A;  2KOL A;  1Q81 C;  3K5N A;  3QB3 A;  4DUZ Q;  1GJX A;  3DMU A;  2ALY B;  4O42 A;  4KY6 A;  1ILQ A;  2ZJQ A;  2KCN A;  1RTO A;  2PZT A;  1X3Q A;  2VQF L;  2M00 A;  3H0G H;  4HJ8 A;  1LTB D;  2K04 A;  4B3R Q;  1C9O A;  3I4L A;  2FHT A;  3GD7 A;  1Q8K A;  2RQX A;  3KUP A;  1B8A A;  2OQK A;  2UU9 L;  1JQY D;  3DWA A;  3NP8 A;  3VA7 A;  2NVT H;  3M4O B;  1QZH A;  5CGK A;  4LMQ D;  1QOH A;  2GA4 B;  3TN2 A;  3GTO B;  2X6G A;  1YHB A;  5IYD H;  2E2J B;  2I07 B;  3TP6 A;  1DYQ A;  2NWG A;  5J22 A;  1L1O B;  2EYH A;  1SE2 A;  3TBI B;  4G7Z C;  2FXQ A;  4AYB E;  4ZKB B;  2PQA B;  1CUK A;  1B7Y B;  4LWC A;  5CV8 A;  4DV7 L;  2UXD L;  1A3V A;  5JAV A;  1EIG A;  1SNM A;  2WAC A;  3E9H A;  4M8A A;  1CHP D;  5ELF A;  4DR4 L;  1K83 B;  4O0A A;  4APV A;  1PFS A;  5ELO A;  4UPA A;  1QG7 A;  5A2Q E;  4ZCK A;  4C2M H;  3S2H B;  4YHH L;  1EYC A;  1T9H A;  2EPB A;  3NSW A;  4K5W A;  1KL9 A;  4DV2 Q;  3PO3 H;  1YJN A;  1Z6H A;  3MEH A;  2ENB A;  4FF4 A;  2XNA C;  3I8Z A;  2Z4I A;  2FMM A;  4IQZ A;  4JI6 L;  5C0X J;  2K14 A;  1DOM A;  2IX3 A;  4XQJ A;  1G2T A;  1N36 L;  3A8I E;  3HOX B;  1Q7Y C;  1QE6 A;  2XGT A;  1B9N A;  3KLS X;  1TKW B;  1EU3 A;  1D8L A;  5IGD A;  3NQT A;  1I4X A;  4IOC A;  2MO0 A;  2F0L A;  1UE6 A;  5AJ3 Q;  1X54 A;  4X6A H;  2DY8 A;  3M4P A;  5M5W B;  2Z0S A;  3VDY A;  2F03 A;  3ERO A;  2WV6 D;  5CV4 A;  5IIF A;  4R4O A;  4JYA Q;  5KNB A;  5FKA C;  3VR2 A;  4A3C H;  5JJL A;  1EIF A;  1X6O A;  1IBK L;  4N9P A;  3S1R B;  3SK6 A;  1CQV A;  2Q8I B;  4QIW B;  4XT3 B;  4TQU S;  4A3B H;  1ILP A;  1NAP A;  1HNZ Q;  3OIQ A;  3K6O A;  2Z8L A;  1JCK B;  3MFG A;  3M85 A;  1FNV A;  1XMO L;  1Y69 U;  4RGO S;  1AZQ A;  4F88 A;  4PMW A;  3TRE A;  1W2B A;  1I4G A;  3GTL B;  4IFD G;  1GOZ A;  1XTC D;  3LX0 A;  4GN4 B;  4FNF A;  2IY5 B;  1SAP A;  3RZD H;  2JE6 I;  4BY1 B;  2XTI A;  1S5E D;  2F0P A;  4KHV A;  3UDX A;  4BY7 H;  1SN8 A;  3J7A 5;  2B2T A;  4DXF A;  1VDZ A;  4KN4 C;  5K36 G;  2JA6 H;  5M3M H;  4RH6 A;  2Y0S B;  4H44 C;  3V96 A;  1K3R A;  1V1O A;  3GTP B;  3A55 A;  1PXU A;  2HCC A;  4DV3 Q;  3K58 A;  3A8K E;  3LWE A;  4POF A;  1XPU A;  4DUY L;  4ZYS A;  2EXD A;  3HKZ B;  1LT5 D;  4KY7 A;  4WJ3 M;  1WD0 A;  3ONA B;  4DGZ A;  4FF2 A;  2NVQ H;  4C1N K;  1HCZ A;  3KF8 B;  2F0O A;  2ATW A;  3I4N H;  1Q12 A;  1ZYR D;  2M2L A;  1SSO A;  4RHS A;  1IBM L;  2NVX B;  5CMD A;  1KXL A;  4FDB A;  3J81 E;  4TKO B;  1U4M A;  3KK7 A;  2ZM6 Q;  1BBW A;  4EQ5 A;  5C3W A;  3PO2 B;  1W6K A;  3S1N H;  1XMO Q;  1PH8 A;  1PHJ A;  1I4P A;  2RDG A;  2LFN A;  1ZYR C;  4MZ9 A;  4K5X A;  4RKL A;  2N8N A;  2KEE A;  1PH2 A;  2B63 B;  1MD2 D;  2NZH A;  1UE7 A;  4DAP A;  1WCM H;  3S16 B;  2RHS B;  1RDP D;  1XWE A;  2D9U A;  2IW3 A;  5IOD A;  5FLX L;  2F4V L;  1EY7 A;  4C3H H;  2CVR A;  4PV1 C;  2CW0 D;  2XRS D;  3MXN B;  3MFY A;  3RUZ A;  5DEH A;  4B3S L;  1NE3 A;  3FDT A;  4DK1 A;  4KJO A;  2JA8 B;  4ZRZ A;  4UP7 A;  2EJF C;  1SYB A;  3N6R A;  2HHH L;  4DUY Q;  4KLK A;  4YWM A;  3FRP B;  3PQI A;  4LNQ A;  3NXW A;  1Q82 C;  3G6J B;  2WAQ G;  4DU9 A;  4ABN A;  1MKH A;  5G3L D;  3J80 i;  2B2W A;  2PQA A;  1IHZ A;  3PIO 3;  1SMY D;  4LF9 L;  3M4O H;  4RAU C;  1QCB D;  2JXM B;  3GTO H;  2JA7 B;  2E2J H;  4U68 A;  4NB3 A;  1G91 A;  1CI3 M;  5M5X B;  1VQN A;  2A74 C;  2F0F A;  3GP7 A;  2VB2 X;  1YEZ A;  2EDG A;  1SMY C;  4K2L A;  2HQE A;  1D6E C;  1K83 H;  3SGI A;  4XTC S;  3I7F A;  3S2H H;  2F0S A;  1CHQ D;  5A2Q L;  4ZK9 B;  1JOQ A;  1RIP A;  4OON A;  4PNY A;  3D3R A;  4TSS A;  5I9P A;  3K7A B;  3BDL A;  1QB5 D;  2L11 A;  2D62 A;  3S15 B;  1Y1W B;  3AU7 A;  2HDL A;  1IL2 A;  1E2Z A;  3Q8D A;  1TT2 A;  3DLL A;  4NXM Q;  4LUZ A;  4YCW A;  4LF9 Q;  1C7Y A;  1K0R A;  4DF7 A;  1SND A;  5K36 H;  4P73 A;  2QCP X;  1PH7 A;  4BS9 A;  3O13 A;  5M5W H;  2JYO A;  1VQG A;  1BBX C;  1JMC A;  1LTL A;  4IUQ A;  1CA5 A;  4DR7 Q;  1YBY A;  4R4C A;  5CV6 A;  2RBM A;  2JJQ A;  4AYB B;  3S1R H;  1J9O A;  2G9D A;  1GKH A;  3A56 A;  3F8T A;  1IL8 A;  1VQH A;  4AQY L;  1BQQ T;  3QJY A;  1HZC A;  3HOV B;  1FNU A;  4DK6 C;  4NKL A;  4I7A A;  3BDO A;  3J81 i;  4A3G B;  1EOT A;  5FK9 C;  4LF4 L;  2G5D A;  2V1C C;  1A8V A;  2F3I A;  4DV5 Q;  4KHP Q;  2XN9 C;  5E1F A;  4KD4 A;  2PCF B;  3R93 A;  3NBH B;  4BY1 H;  1D5X C;  3MAQ A;  3ZJY C;  2B2T C;  5FLX c;  1HNX L;  4LF7 Q;  1STA A;  2I5M X;  3D4W A;  3D0F A;  2F0M A;  5IYC G;  2ZTE A;  1QNU A;  3C1E A;  1SFO B;  1WJJ A;  1L2F A;  2KUM A;  1O7L A;  1UEA B;  3KF8 A;  1B3A A;  1WTQ A;  1K8M A;  1R4P B;  4C3I B;  5CV5 A;  1Q1B A;  4E6I A;  3A8J E;  1HH2 P;  1NJI C;  1JJC B;  4MHE A;  3U9O A;  2PYK A;  1HFG A;  3QO2 A;  4PMC A;  4AYB G;  3CKI B;  4R4T A;  3IFD A;  2BOS A;  4IOA A;  1WFQ A;  4RA8 A;  1VQB A;  3U4V A;  3RNU A;  1VQO A;  2VUM B;  1D1K A;  1STN A;  5IE8 A;  2NVX H;  4OWW B;  1CKM A;  3VYT A;  2UXC L;  4A3G G;  2O5J C;  3E0E A;  3CAM A;  1I3Q B;  1Y8O B;  3J81 L;  3CD6 A;  3PIP 3;  1Y14 B;  2HIX A;  3VR3 A;  1LAB A;  3CHB D;  1Q86 C;  4QQB X;  3PO2 H;  1RF2 D;  3L0O A;  3PUW A;  4LF4 Q;  2SEB D;  3KFU A;  1L0Y B;  4JBJ A;  3GDE A;  3U9S A;  4Y52 H;  3D31 A;  3QWN A;  3BYT B;  2QF7 A;  3GO5 A;  3MXN A;  5K5P A;  3HKS A;  2F3W A;  1FVI A;  1A63 A;  1BNZ A;  4FP5 D;  2B63 H;  2B8G A;  1TVX A;  3CCQ A;  1EIY B;  2YTV A;  4DV0 L;  3F2C A;  5GQO A;  4K2K A;  3S16 H;  4LW1 A;  4CKE A;  3M4Y A;  3RD4 A;  3CXC A;  4YCV A;  2K5N A;  1CK1 A;  2C9O A;  1STB A;  5EQ0 A;  2H4O A;  4A3E B;  2JA8 H;  4F87 A;  2PI2 E;  3OPO A;  1N8R C;  2EIF A;  2EOT A;  4XYQ A;  1RHP A;  3H3V H;  3J80 c;  4U67 3;  2RKS A;  5M3F B;  1BF4 A;  5C44 B;  3STB D;  2VUM G;  1WYD A;  3A0J A;  4HSV A;  2B2W C;  3L7Z C;  1H95 A;  2Y0S E;  4GNX B;  2IT1 A;  3HOW B;  2KCC A;  1VQ6 A;  5C5M A;  3GTG B;  2KCM A;  4JI0 L;  4K5V A;  2RA4 A;  1AW7 A;  4YWK A;  2R7Z B;  1EEF D;  4ME5 A;  1STG A;  3STB C;  1VQE A;  4NXN Q;  3CCU A;  3SDZ A;  3UDF A;  2RF4 A;  5M5X H;  3HOZ B;  3F2B A;  2WKD A;  1IBL Q;  1GUN A;  1U4R A;  1VQK A;  3H6M A;  1X32 A;  1JB3 A;  1HPC A;  2QKI C;  2RVL A;  1YHQ A;  1SE3 A;  1XXG A;  1B44 D;  3NEN A;  5LL6 X;  4DK0 A;  5C4Z A;  3MXU A;  4N8X 1;  1XJV A;  1KLU D;  2EY5 A;  3U58 A;  4RGT A;  4DV6 Q;  2RCN A;  1CSP A;  2IHE A;  3GV6 A;  2ES2 A;  4P75 A;  2K28 A;  2WFW A;  5T1I A;  5CBE E;  1LYL A;  1IYV A;  4JVZ A;  1VQ7 A;  1ICF B;  3K7A H;  4OHJ A;  2R61 A;  1LTR D;  1SNP A;  3Q24 A;  3QR8 A;  1E1T A;  1KDC A;  5HGT A;  3HOW G;  5CV7 A;  4DAM A;  4KN7 C;  3M9B A;  4H02 A;  3JC6 6;  4L8J A;  2L5T A;  1T5X D;  2ZJP A;  4JI0 Q;  1Z7T A;  5IYC H;  2R92 B;  1I6H B;  3GV3 A;  1A2U A;  3HOZ G;  2CFM A;  4GOP B;  4CDF C;  5DLQ E;  4L5Q A;  1OXS C;  2VNU D;  1Q46 A;  1P8L A;  2E2I B;  1YNJ D;  3T1H L;  2NN6 H;  1VS0 A;  1X65 A;  1Q1E A;  3KDF B;  4B3R L;  4PQX A;  1AFP A;  4IN3 A;  4ZLT F;  3ND9 A;  4RHR A;  1PYS B;  2E76 C;  4L5T A;  1F9S A;  2KHI A;  4A3I G;  1VMP A;  3NBH A;  1X9N A;  4RG1 A;  1YNJ C;  2PZW A;  4A3G H;  3K0Y A;  2VW9 A;  1ET6 A;  4IZ8 A;  1HHV A;  5J39 A;  4ALP A;  2OQ0 A;  2H5X A;  3CCS A;  1ENC A;  5IGE A;  5C6A A;  1NMF A;  3EFX D;  4IUV A;  4JBK A;  4R4I A;  3H94 A;  1T5E A;  4OEL B;  1S72 A;  5BN5 A;  1HA5 A;  1F2Z A;  3VYU A;  3JAM i;  5D3D A;  1SYC A;  2CH4 A;  4LUV A;  2RSN A;  4GN3 B;  2JA6 G;  1OXT A;  3SXH A;  1I94 Q;  1JE4 A;  5FLX E;  2R92 G;  1BVS A;  1O7I A;  1LM0 A;  3TSS A;  1SFO H;  3MVV A;  3S24 A;  3DWP A;  4ZAI A;  1I6V C;  4DV2 L;  2CQO A;  4MNO A;  4YIJ A;  2ZTD A;  3VR5 A;  4FVM A;  2Q2U A;  1EQV A;  3DHQ A;  1BXT A;  3E0J A;  4LF8 Q;  4QUF A;  3EJI A;  3FPP A;  2L55 A;  1C0A A;  2NYZ D;  3T1H Q;  1B3Q A;  3I4N G;  1J6Q A;  1KDA A;  3MZ5 A;  2PPB C;  2V4D A;  2A69 D;  1O80 A;  2DJG C;  1ESR A;  1QNK A;  4RGM A;  1FYC A;  3F2U A;  1TWC H;  2VUM H;  1LT3 D;  1SXT A;  1TQO A;  1RL2 A;  2K5H A;  4HID A;  2CQA A;  3NWS A;  1I3Q H;  2AQ1 B;  3CC7 A;  3CF5 A;  5AJ3 L;  1AP0 A;  3I70 A;  5H1S E;  2IX0 A;  2A69 C;  3CPF A;  1SNC A;  3CRL C;  3HOY B;  5KIX A;  4ME3 A;  2XWJ B;  2N78 A;  3EQL C;  1ICW A;  4JYA L;  3WOF A;  2LSS A;  4A3J B;  2I5L X;  4JI1 Q;  2RSO A;  1A2T A;  2B2U A;  5G3L F;  3MEF A;  3FPU B;  1EWC A;  1SJH D;  1WCM G;  1ENF A;  3P75 A;  3H3V C;  4IFD J;  2L15 A;  3OMG A;  3SHL A;  4C3H G;  2O2L D;  4R9W A;  1HNZ L;  1ZXT A;  1C8C A;  3MC0 B;  2MGS A;  4ZKC B;  2RHQ B;  3C1F A;  5FO8 B;  2OF1 A;  1EQQ A;  3GTK H;  3CCL A;  1GUO A;  1WTP A;  1TY0 A;  4OX9 L;  3UE1 A;  3SE0 A;  5C44 H;  3J7A F;  4DNT B;  2J4X A;  3J80 E;  1H9K A;  1RCV D;  4UDU C;  4IPC A;  1TS2 A;  2YTX A;  3HOW H;  3T56 B;  4EQP A;  3EIV A;  3GTG H;  5TSS A;  3KYH C;  2G9H D;  5COY A;  1QIL A;  4HJ5 A;  2D5D A;  2MHV A;  3W1B A;  1F2L A;  2R7Z H;  3TS2 A;  4DV3 L;  1JC7 A;  4G7H C;  3HRZ C;  4LAA A;  5KND A;  1XNQ Q;  3HOZ H;  4O1N A;  1X55 A;  4A3J G;  2WII B;  1SRU A;  1GHJ A;  1G6P A;  1YHA A;  4KY5 A;  3R8B A;  1O78 A;  3SK8 A;  1EY0 A;  1PDQ A;  4HAE A;  4B08 A;  1SNO A;  1DOK A;  2UUA Q;  1ASY A;  2LKV A;  5M5Y B;  2VY3 A;  2F0V A;  1S5B D;  4CKC A;  1WTH A;  2X6L A;  1LTG D;  2ZM6 L;  4BWG B;  2AQ2 B;  4Q5V A;  4A3I H;  1CFM A;  1F2M A;  1PFM A;  1PTO F;  5ELC A;  1M90 C;  1PH4 A;  4JPB W;  1WTR A;  1VQL A;  1LT6 D;  1O7Y A;  4DR3 Q;  4YY3 Q;  3V2T A;  4B9X A;  3SK4 A;  5CBA E;  1ENA A;  2EY2 A;  2E2H H;  2DUD A;  4G57 A;  4GOP A;  1N34 Q;  3RMH A;  4OX9 Q;  2EY6 A;  2D0P A;  2K32 A;  4FO2 A;  3HOX G;  1PTO H;  5C4H A;  4CJ2 C;  4A3D B;  4J15 A;  2EVB A;  4JCV E;  1EY5 A;  2I0Q A;  4CKB A;  2BH2 A;  5M9O A;  3K7U C;  3HOU B;  3GTM H;  3KDF A;  3CQZ B;  4DN4 M;  2R92 H;  1PH1 A;  3J7A V;  3H09 A;  1PZI D;  3I73 A;  1EZ8 A;  3MHB A;  1KLG D;  1NTG A;  1K3B C;  1KAA A;  1UNS A;  4HTH A;  2XIW A;  2K6A A;  3TDQ A;  1PH6 A;  3MTS A;  2CH4 W;  4UAI A;  1K8G A;  4LFB Q;  5KYL A;  1G6Z A;  4XDX A;  4JI4 Q;  1NY4 A;  3VYS A;  1IYJ B;  3DWQ A;  3FP9 A;  3CCV A;  1TS5 A;  2NVY B;  1CSQ A;  2UUB Q;  1Q90 A;  2L9H A;  2IL8 A;  1X3P A;  1SDF A;  4HMJ A;  3CME A;  4C56 C;  1WTX A;  1FL0 A;  3OSO A;  5C4X B;  3RLO A;  4RKB A;  2SNS A;  3NHH A;  3KF6 A;  3JAM c;  1BOS A;  1TWH B;  4QMG A;  4BY1 G;  1L0X B;  3TRZ A;  2PW5 A;  2RDF A;  4RCO A;  5IOC A;  3V05 A;  3PUZ A;  5E3F A;  1V1Q A;  2WB1 E;  1A0I A;  1UUP A;  2F0I A;  3HOU G;  1PV4 A;  2Y0S G;  1FNW A;  4A93 B;  4HMI A;  1S3O A;  1UWV A;  2MP1 A;  1HTP A;  5HUR A;  2KJX A;  2P5Z X;  1DZ1 A;  1E7Z A;  4ODG A;  4IPD A;  1I4H A;  4BA1 I;  1AE2 A;  2F0Q A;  3HKZ G;  4GLV B;  2UXB L;  3PV0 A;  4G7O C;  3UI2 A;  2HD3 A;  1NCV A;  5A35 A;  4KV6 A;  1CKO A;  1PFN A;  1V8Q A;  2CW0 C;  4R8I A;  4R1J A;  1VQJ A;  1XMQ Q;  1L1O A;  1X3G A;  3P1H A;  1BKB A;  4NXM L;  3UE0 A;  2B2V A;  5I6Y A;  3D4D A;  3BVG A;  4IFD I;  1RD9 D;  2BDO A;  3PO2 G;  2YTY A;  1BCP B;  2PZU A;  3QG1 A;  2JSO A;  1YJ9 A;  3TZU A;  1NUC A;  5I2Y A;  5EBC A;  1MGS A;  3GTQ B;  5EAY A;  4OO1 I;  2AQ3 B;  2B2U C;  5KEE A;  2K5Q A;  4FXG C;  1EWI A;  1KAB A;  4A3J H;  3CC4 A;  4R4Q A;  2B63 G;  4DR7 L;  3I4M B;  1HRJ A;  5C0X I;  5LL6 S;  2ZXP A;  2SOB A;  2KA7 A;  2WKC A;  2SNM A;  1DJR D;  1K9M C;  5LMN W;  1CQF A;  1GO3 E;  2R7F A;  3P20 A;  2E5L Q;  4HJ7 A;  2DGY A;  1R9T B;  3F1Z A;  3ERS X;  1PRT B;  2JA8 G;  1UE5 A;  3G7L A;  3NTK A;  1U4P A;  5IP9 G;  3FVQ A;  2ZJR A;  1XX8 A;  5C3E B;  3UDI A;  5ELD A;  4DV5 L;  4KHP L;  2UXB Q;  1UEB A;  4B3T Q;  3CW2 C;  1PVO A;  1VQI A;  2PNH A;  2OEO A;  5KRU A;  1UE1 A;  4CHT B;  3C3L A;  3OHX C;  1S5F D;  1NNX A;  4H13 C;  1B9M A;  4LF7 L;  3J80 L;  4RWS C;  1WI5 A;  2X69 A;  3HOX H;  4XQQ A;  4QUC A;  3K8A A;  2JA7 G;  2A19 A;  2MUY A;  2R7D A;  4YWL A;  3A74 A;  3MXG A;  1BBU A;  4K0K Q;  1H9S B;  1LT4 D;  3AMU A;  3LNN A;  4A4I A;  1PTO D;  4V0B A;  1YIT A;  1Y1V B;  3PF4 A;  1U0L A;  5FO9 B;  1N32 Q;  1PLF A;  4DV1 L;  1EIH A;  3BYY B;  5GAE C;  1IYU A;  4X66 Q;  1RKN A;  5M5Y H;  5CR3 A;  3F2D A;  3BZK A;  4XXE A;  1B2T A;  1V43 A;  2PI2 A;  1KRT A;  1PTO C;  1E2W A;  5EPJ A;  1J5E L;  2R3Z A;  4AIM A;  1TWG B;  5C3E G;  1Z9F A;  4JI3 L;  4J1M A;  4LF6 Q;  2Q8T A;  2MO1 A;  3ULP A;  5CYU A;  4B9W A;  1NBW A;  3GTL H;  3OIP A;  4GOP C;  1Y1W G;  1STH A;  5JEA G;  3FMC A;  3SVM A;  4Z9C B;  3W3A A;  4MIU A;  1FJG Q;  3I2Z A;  2NZ1 D;  1HFN A;  1ET9 A;  3KBX A;  2XWB B;  2LXK A;  2A5H A;  3NK9 A;  3HOU H;  3CQZ H;  1GUT A;  4CDD C;  3GTP H;  2B2Y A;  5DNF A;  1C48 A;  4NMZ A;  1W6J A;  1XNR Q;  2VXW A;  2JA5 B;  2A6E D;  2NN6 G;  1Y1V G;  4JI7 Q;  1B53 A;  3NEL A;  4OWX B;  3AFP A;  3I4O A;  5ISR A;  4DV1 Q;  1YI2 A;  2Z9H A;  1DON A;  4A3K B;  4CDC C;  4GKJ L;  2KEC A;  3CC2 A;  2NVY H;  3HOV G;  2A6E C;  1EQT A;  3TZD A;  1J5E Q;  4GS3 A;  1FGB D;  3T51 B;  1PA6 A;  5IWA Q;  3TP5 A;  5C4X H;  2N55 A;  2E8G A;  4XQN A;  4NXN L;  4JI3 Q;  4NP5 A;  3G4S A;  1TWH H;  2F0U A;  3I90 A;  3CMA A;  1IBL L;  2IX1 A;  4UP8 A;  1SJE D;  3K5L A;  1M1K C;  5NUC A;  3JAM E;  1CA6 A;  2F0G A;  2ZT9 C;  1SE4 A;  1EFI D;  1A15 A;  1A6X A;  4R8N A;  4N9T A;  3P7J A;  2WIN B;  4A93 H;  1LTI D;  2Q2H A;  4DV6 L;  1EZ6 A;  4HJA A;  4C3I G;  1KAW A;  2FJ2 A;  3J7Y W;  4I7Z C;  4JI8 Q;  4HCE A;  5D14 A;  3PUV A;  1VQA A;  5IP9 H;  2Q8R E;  4F7X A;  5IP7 G;  2MNA A;  4PG3 A;  3ULJ A;  2ZTC A;  1L1O C;  1SE8 A;  2EXZ A;  1J8I A;  4GLX A;  2AUJ D;  4OL7 A;  2B2V C;  4WJ4 A;  1MJC A;  3K80 C;  4OIJ A;  4QF4 A;  1TU2 B;  3C2P A;  3NUC A;  4DV4 Q;  4GKJ Q;  2N3S A;  1DCZ A;  2CWP A;  2ID0 A;  2K5V A;  2RCF A;  5IGC A;  1SYG A;  1SRO A;  1OXX K;  2LMC B;  3K5O A;  4LUO A;  5C5L A;  2JA7 H;  3MXP A;  4K6D A;  4C1N I;  4LF5 L;  1FR3 A;  3FKI B;  2A68 D;  4JV5 L;  3MWY W;  3GTQ H;  4HIK A;  4F8M A;  3R2I A;  1TWA B;  1PRT F;  2QGQ A;  4NPS A;  3ULL A;  3I4M H;  1QVG A; 
#chains in the Genus database with same CATH homology
 3I4N H;  4HJ9 A;  1Q12 A;  5H1S E;  5IWA L;  2IX0 A;  3CPF A;  4QL5 A;  1KXL A;  1IBM L;  1VQD A;  4ME3 A;  4FDB A;  1VQP A;  2N78 A;  3E9I A;  4HIM A;  4PZ8 A;  2VQE L;  4JYA L;  2ZM6 Q;  1BBW A;  2A8V A;  4GKK L;  3WWV A;  2LSS A;  4EQ5 A;  2I5L X;  4P74 A;  4JI1 Q;  1HR0 W;  4LFA Q;  3MEF A;  1R9T H;  3S1N H;  1XMO Q;  1EQR A;  1WCM G;  4DK3 C;  4A3E G;  1PH8 A;  3AEV A;  1X56 A;  1PHJ A;  4IFD J;  2L15 A;  4MZ9 A;  3AQQ A;  5LMN Q;  2WAQ E;  3DM3 A;  5C3E H;  3BZC A;  2N8N A;  4A3D H;  4IJL A;  1HNZ L;  4OXP A;  1PH2 A;  1YVC A;  3RLF A;  5M3F G;  2KHJ A;  2ATW A;  4QGU A;  1HJP A;  5C44 G;  4RMF A;  2Z6K A;  3S15 H;  2NZH A;  2RHQ B;  3PIO A;  1Y1W H;  1UE7 A;  1QUQ A;  1WCM H;  1EQQ A;  3BU2 A;  1MIU A;  4JI8 L;  2RHS B;  3GTK H;  3RR5 A;  2B3G A;  3CCL A;  3BJU A;  1KQS A;  2F4V L;  1I94 L;  4BXX G;  4C3H H;  4POG A;  2OWO A;  4PZ7 A;  3HFZ B;  2R7Z G;  3MXN B;  5FLM H;  3PSI A;  3UE1 A;  4OX9 L;  5C44 H;  1NE3 A;  2GVA A;  3FKI G;  4B3S L;  3G48 A;  4LF5 Q;  5IYB H;  4IPC A;  4UP7 A;  5LMU L;  2YTX A;  2GN5 A;  3HOW H;  2HHH L;  4DUY Q;  4KLK A;  1SMX A;  3EIV A;  4YWM A;  3GTG H;  4JV5 Q;  3KYH C;  1NMG A;  4DV4 L;  3T1Y Q;  4LNQ A;  3H3V I;  4LF8 L;  1V9P A;  1D7Q A;  1VQF A;  2D0O A;  4HJ5 A;  4DNI A;  1JB7 A;  3W1B A;  1Q82 C;  2AMC B;  2WAQ G;  1Y1V H;  5C4J H;  3ER0 A;  3M3Y H;  2VNU D;  1MKH A;  2R7Z H;  3TS2 A;  1KC8 C;  4DV3 L;  3B6Y A;  3J80 i;  1XNQ Q;  2WB1 G;  4A76 A;  3HOZ H;  4UP9 A;  2PQA A;  1X55 A;  4A3J G;  3M4O H;  4LF9 L;  1SRU A;  2VQE Q;  1G6P A;  1YHA A;  4X64 Q;  2VZA A;  1HZB A;  4JOI A;  4GKK Q;  3GTO H;  1I50 H;  3HOV H;  1VQM A;  1IXR A;  2E2J H;  4NB3 A;  1YNX A;  1TWG H;  2UUA Q;  1XPO A;  1S40 A;  1ASY A;  1VQN A;  2LXJ A;  2VY3 A;  5FJ8 G;  4AQY Q;  1QZG A;  1YEZ A;  1QVC A;  2QEX A;  3CCM A;  2ZM6 L;  4A3M G;  2Q2I A;  1WOC A;  4A3I H;  4JI1 L;  3RLN A;  1PH9 A;  3ICE A;  1M90 C;  1K83 H;  3SGI A;  1PH4 A;  1KHI A;  1TXY A;  3I7F A;  4OWT B;  4XTC S;  4DR3 Q;  1VQL A;  2JA5 G;  3TEH B;  3S2H H;  4YY3 Q;  5LMN L;  1GD7 A;  4QIW E;  4DR5 L;  3I4M H;  4LFC L;  1L0W A;  2E2H H;  2DUD A;  1N34 Q;  4GOP A;  3K81 C;  1RIP A;  4OX9 Q;  2D0P A;  1HNX Q;  1E1O A;  4OON A;  4A3K G;  3HOX G;  1B70 B;  1HZA A;  5LMU Q;  4J15 A;  4C3I H;  1VCI A;  4JCV E;  1G29 1;  3J7Z C;  2I0Q A;  2BH2 A;  1PYB A;  4KHZ A;  3W1G A;  4BBR G;  3K7U C;  2D62 A;  3GTM H;  3KDF A;  5GAD C;  4BBS G;  3M7N A;  2R92 H;  4DR6 Q;  5IY0 A;  1PH1 A;  4L5S A;  1IL2 A;  1SR3 A;  2CWA A;  3Q8D A;  5IP7 H;  3DLL A;  2R6G A;  4NXM Q;  4A3K H;  4LUZ A;  1NTG A;  3H0G G;  4JG2 A;  3OTO L;  3CPW A;  3A5U A;  2R93 H;  4YCW A;  4LF9 Q;  1OXV A;  1K0R A;  1C7Y A;  1K8G A;  3LGJ A;  4P73 A;  1PH6 A;  1GM5 A;  3KJO A;  4LFB Q;  1PH7 A;  4A3F H;  3J81 j;  1FGU A;  4JI4 Q;  5M5W H;  1N9W A;  2PMZ E;  4TVA B;  1NY4 A;  4A3L G;  1VQG A;  4JI2 Q;  1JMC A;  1IYJ B;  3FP9 A;  2UXC Q;  3CCV A;  4B3M L;  1XNQ L;  1CSQ A;  5IYD G;  2UUB Q;  3H15 A;  1W3S A;  1LTL A;  3GTJ H;  5GAG C;  1HNW L;  4DR7 Q;  1YBY A;  2NN6 I;  4R4C A;  1ASZ A;  4X64 L;  4HIO A;  3CME A;  2OTJ A;  2VL6 A;  1E22 A;  2JJQ A;  3HKZ E;  5E7N A;  1FL0 A;  1SLJ A;  4KI0 A;  3RLO A;  3S1R H;  4QJF A;  1GKH A;  2JK8 A;  2UUA L;  3RN5 A;  3F8T A;  2CCZ A;  3KF6 A;  3JAM c;  1VQH A;  5GRO A;  4JI5 L;  4AQY L;  4BY1 G;  2YV5 A;  1HZC A;  1N33 Q;  4DK6 C;  3TRZ A;  4DR5 Q;  3PF5 A;  5IT9 c;  3J81 i;  3TS0 A;  1YIJ A;  4LFC Q;  3PUZ A;  1V1Q A;  4DPG A;  3PUY A;  2WB1 E;  4DV0 Q;  1A0I A;  2MFI A;  2JA9 A;  1PH5 A;  1CKN B;  4LF4 L;  2V1C C;  1A8V A;  4GNX A;  3AYH B;  2F3I A;  4A3E H;  4DV5 Q;  1VQ9 A;  3HOU G;  1PV4 A;  4KHP Q;  2Y0S G;  4DR3 L;  3OW2 A;  1KD1 C;  4QY7 A;  1EFW A;  3PO3 G;  1S3O A;  4YY3 L;  2K4K A;  3GTL H;  1HR0 L;  1UWV A;  3NBH B;  4BY1 H;  2AHO B;  3ZJY C;  2QA4 A;  1N34 L;  5M3F H;  1E7Z A;  5FLX c;  4JBW A;  1HNX L;  4LF7 Q;  4IPD A;  3I55 A;  2I5M X;  2K52 A;  3D0F A;  1AE2 A;  4BA1 I;  3PIP A;  5IYC G;  2ZTE A;  3HKZ G;  3OTO Q;  1I5F A;  4GLV B;  2UXB L;  3I56 A;  4GLA C;  1WJJ A;  1L2F A;  2A1A A;  3PV0 A;  5J3B A;  3EN2 A;  2HT1 A;  4BXX H;  1CKO A;  4GN5 A;  4DR6 L;  1OXU A;  2KCT A;  3K0X A;  4JC0 A;  4R1J A;  3U50 C;  1VQJ A;  1XMQ Q;  4DAY B;  1Q1B A;  5HGQ A;  1L1O A;  1X3G A;  2GVB A;  3HOY G;  3FKI H;  1BKB A;  4BA2 I;  4NXM L;  3UE0 A;  1NJI C;  1HH2 P;  1E3P A;  4B3M Q;  2VQF Q;  1JJC B;  4IFD I;  1KIX A;  2KBN A;  4IO9 A;  1HNW Q;  3AFQ A;  2K75 A;  2NZO A;  4AYB G;  3PO2 G;  4R4T A;  1TWA H;  2JQO A;  2YTY A;  4LFB L;  3CP0 A;  2UU9 Q;  4DUZ L;  4IOA A;  1WFQ A;  1YJ9 A;  4JBM A;  4UY8 C;  1VQB A;  4A3C G;  3U4V A;  3RNU A;  1VQO A;  2CKZ B;  4X62 L;  5GAH C;  1AE3 A;  5IE8 A;  1YJW A;  2NVX H;  4JI4 L;  4OWW B;  4JI2 L;  3IRB A;  1CKM A;  5EAY A;  2Q2T A;  2UXC L;  4A3G G;  4JI5 Q;  4OO1 I;  3CCR A;  2BH8 A;  3UDG A;  3E0E A;  2UUB L;  1TWF H;  2B29 A;  3CAM A;  2WP8 J;  3CD6 A;  1EWI A;  4A3J H;  3CC4 A;  2B63 G;  4R4Q A;  4DR7 L;  1Y14 B;  2HIX A;  4QQB X;  1Q86 C;  2HIV A;  3PO2 H;  2OCE A;  5C0X I;  3J81 c;  3PUW A;  3L0O A;  3KFU A;  3KOJ A;  4LF4 Q;  4A3B G;  3FHW A;  4JBJ A;  3GDE A;  1K9M C;  2JEB I;  4Y52 H;  1A62 A;  5LMN W;  3D31 A;  5JJI A;  1EUJ A;  1P16 A;  4DV7 Q;  1EOV A;  3G71 A;  1GO3 E;  3KLW A;  1OTC A;  2UXD Q;  2R7F A;  3GO5 A;  2Z6K C;  2E5L Q;  2YU9 H;  2AWO A;  3HKS A;  1FVI A;  1GVP A;  4AH6 A;  5FJ8 H;  4HJ7 A;  2DGY A;  4DR2 L;  1HR0 Q;  1N33 L;  4DR4 Q;  3F1Z A;  1A63 A;  3ERS X;  2B63 H;  2JA8 G;  1UE5 A;  1XTD A;  1HZ9 A;  2HQL A;  3TQY A;  4P71 A;  3CCQ A;  4A3M H;  5IP9 G;  2YTV A;  4DV0 L;  1JJ2 A;  1EYG A;  1EIY B;  2ZJR A;  1JJG A;  3F2C A;  5GQO A;  4YHH Q;  3S16 H;  1KRS A;  3UDI A;  1VQC A;  4DV5 L;  4KHP L;  1X3E A;  2UXB Q;  4BY7 G;  1UEB A;  2IHF A;  2KEN A;  4LW1 A;  4B3T Q;  3CW2 C;  2BA0 A;  1PVO A;  1VQI A;  3CXC A;  2JA5 H;  2PNH A;  3S14 H;  3S17 H;  1DGS A;  4YCV A;  2K5N A;  2F52 A;  3CCJ A;  1UE1 A;  1I6H H;  2JA8 H;  5M3M G;  2PI2 E;  4LF7 L;  2AKW B;  1N8R C;  2EIF A;  1WI5 A;  4JI6 Q;  3KF6 B;  3HOX H;  3RN2 A;  1G51 A;  3H3V H;  3J80 c;  3K8A A;  2AWN A;  2JA7 G;  2A19 A;  1PH3 A;  2R7D A;  4YWL A;  2E2I H;  4BBR H;  3A74 A;  4PZ6 A;  1Q81 C;  1BBU A;  3STB D;  1N36 Q;  2VUM G;  3S2D H;  1WYD A;  3A0J A;  4DUZ Q;  4BBS H;  4K0K Q;  3L7Z C;  1H95 A;  2Y0S E;  2ALY B;  2IT1 A;  3NEM A;  1QUQ B;  4GNX B;  4OO1 G;  4X62 Q;  1VQ6 A;  1XMQ L;  2KCM A;  2ZJQ A;  4A4I A;  4JOI C;  5ELN A;  4JI0 L;  1VQ5 A;  2VQF L;  4IPG A;  2JEA I;  3H0G H;  5C0X G;  4HJ8 A;  1YIT A;  4YWK A;  1VQ4 A;  3PF4 A;  1C9O A;  2VS1 A;  1U0L A;  3GD7 A;  3S1Q H;  1Q8K A;  4B3R Q;  1N32 Q;  1B8A A;  2OQK A;  4DV1 L;  4NXN Q;  3STB C;  1VQE A;  2UU9 L;  5GAE C;  3CCU A;  3UDF A;  2RF4 A;  5M5X H;  4L5R C;  4X66 Q;  5M5Y H;  3F2B A;  2NVT H;  3F2D A;  2EQS A;  1QZH A;  3BZK A;  4MTN A;  1IBL Q;  4A3L H;  5BR8 L;  1V43 A;  2PI2 A;  1KRT A;  1J5E L;  1VQK A;  1IBK Q;  3PCO B;  1YHB A;  4DR2 Q;  1YHQ A;  5IYD H;  4AIM A;  3NEN A;  5C3E G;  1Z9F A;  1AH9 A;  4JI3 L;  4LF6 Q;  4A3D G;  1L1O B;  1XJV A;  2MO1 A;  3ULP A;  1QVF A;  2FXQ A;  4AYB E;  1NBW A;  2N49 A;  1CUK A;  2PQA B;  1B7Y B;  4LWC A;  3U58 A;  4DV7 L;  4GOP C;  2OTL A;  1Y1W G;  4DV6 Q;  2UXD L;  2RCN A;  1CSP A;  5JEA G;  2E5L L;  4DR1 L;  3E9H A;  4DR4 L;  2IHE A;  4O0A A;  1FJG Q;  3I2Z A;  4APV A;  2ES2 A;  1PFS A;  5ELO A;  4P75 A;  4UPA A;  1Z47 A;  2WFW A;  4C2M H;  1LYL A;  3KJP A;  4YHH L;  1T9H A;  2LXK A;  5FLM G;  1VQ7 A;  3U4Z A;  3K7A H;  3W5O A;  1KL9 A;  4B3T L;  3HOU H;  4XIG S;  4DV2 Q;  3CQZ H;  3S1M H;  1E1T A;  5IYB G;  4O2D A;  1YZ6 A;  1YJN A;  3GTP H;  3HOW G;  3PO3 H;  4DAM A;  4C3J H;  3M9B A;  4H02 A;  1XNR Q;  3JC6 6;  2ZJP A;  4JI6 L;  3PUX A;  2NN6 G;  5C0X J;  1Y1V G;  2K14 A;  3A5Z B;  4JI0 Q;  4JI7 Q;  5IYC H;  3NEL A;  3G6E A;  4OWX B;  3AFP A;  3I4O A;  1VQ8 A;  5C4X G;  3HOZ G;  2CFM A;  3PGZ A;  4GOP B;  4DV1 Q;  1YI2 A;  5DLQ E;  1N36 L;  2K50 A;  1Q7Y C;  2XGT A;  4L5Q A;  4X65 L;  4K0K L;  4GKJ L;  3CC2 A;  1K73 C;  1D8L A;  1OXS C;  4A75 A;  2NVY H;  1Q46 A;  4YCU A;  4IOC A;  3HOV G;  1P8L A;  1X3F A;  2MO0 A;  5BR8 Q;  3HOY H;  3RZO H;  3T1H L;  1UE6 A;  1VS0 A;  1X54 A;  5AJ3 Q;  1J5E Q;  4X6A H;  3EBE A;  4GS3 A;  1X65 A;  1Q1E A;  1E24 A;  3KDF B;  1CKN A;  1JE5 A;  4B3R L;  1PA6 A;  5IWA Q;  3M4P A;  1N32 L;  2UUC L;  2Z0S A;  4IJH A;  3VDY A;  1XPR A;  5C4X H;  1IBM Q;  2E8G A;  4JI3 Q;  4NXN L;  4R4O A;  3M4Q A;  3CCE A;  1PYS B;  4L5T A;  4X66 L;  4JYA Q;  2KHI A;  4A3I G;  4A3C H;  4A93 G;  3G4S A;  1EIF A;  1TWH H;  5JJL A;  5JEA J;  3CMA A;  1X9N A;  1IBL L;  2IX1 A;  4UP8 A;  4RG1 A;  1M1K C;  1X6O A;  4A3G H;  4DR1 Q;  2VW9 A;  4GNX C;  1IBK L;  4ALP A;  2OQ0 A;  2H5X A;  3CCS A;  2C35 B;  4LF6 L;  1NMF A;  4TQU S;  4A3B H;  4JBK A;  1HNZ Q;  4R4I A;  4A93 H;  4P72 A;  1S72 A;  2Q2H A;  4LFA L;  2BA1 A;  4DV6 L;  5JJK A;  3M85 A;  1XMO L;  4HJA A;  3JAM i;  1KAW A;  4PMW A;  3TRE A;  1W2B A;  3OYY A;  4JI8 Q;  1FJG L;  4LUV A;  1IZ6 A;  4GN3 B;  2JA6 G;  1OXT A;  3PUV A;  2ASB A;  4IFD G;  2F4V Q;  1VQA A;  1I94 Q;  5IP9 H;  2R92 G;  4GN4 B;  1BVS A;  1O7I A;  2YYZ A;  1LM0 A;  2IY5 B;  1SFO H;  3S24 A;  5IP7 G;  3RZD H;  2JE6 I;  2MNA A;  2XTI A;  4B3S Q;  4PG3 A;  3ULJ A;  2ZTC A;  4BY7 H;  3UDX A;  4DV2 L;  2CQO A;  4MNO A;  2ZTD A;  1L1O C;  1SE8 A;  1SN8 A;  3J7A 5;  2R93 G;  4GLX A;  5HY6 A;  2Q2U A;  4WJ4 A;  2HHH Q;  1MJC A;  2MQH A;  3K80 C;  4X65 Q;  4GKJ Q;  4DV4 Q;  5K36 G;  2N3S A;  1XNR L;  4LF8 Q;  2JA6 H;  1U5K A;  2CWP A;  2ID0 A;  2K5V A;  5M3M H;  1C0A A;  1SRO A;  4A3F G;  1K3R A;  3T1H Q;  4JI7 L;  3I4M G;  1OXX K;  1LUZ A;  1MJE A;  4LUO A;  4IPH A;  1J6Q A;  4DV3 Q;  3I4N G;  4Y7N H;  2JA7 H;  2UUC Q;  4LF5 L;  2I5H A;  4POF A;  1XPU A;  1TWC H;  4DUY L;  2VUM H;  2EXD A;  4JV5 L;  3L2P A;  1RL2 A;  3T1Y L;  1K8A C;  3GTQ H;  4WJ3 M;  2K5H A;  4HIK A;  4HID A;  1JT8 A;  1I3Q H;  3CC7 A;  3CF5 A;  3ULL A;  4DKA C;  5AJ3 L;  2QGQ A;  4NPS A;  4EX5 A;  2NVQ H;  3KF8 B;  1QVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...