1VQK3

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
b'MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vqk300
3CCE3 1VQ83 3OW22 1KC84 1M904 2QEX3 1YHQ3 3I553 1YIJ3 3CCV3 3CCQ3 1KD14 3CC73 3CPW2 1VQ93 1S723 1VQN3 1NJI4 1W2B2 1YIT3 1QVF2 1VQP3 3CCM3 1VQ73 1YJ93 1K9M4 1VQO3 3CMA3 1YJW3 1Q814 1VQ63 1KQS2 3G4S3 3I563 3G6E3 1Q824 1VQ53 3CXC2 1VQ43 3CC23 1M1K4 3CCR3 1VQK3 2QA43 3CCS3 1YJN3 1VQL3 2OTJ3 3CCL3 2OTL3 3CD63 1YI23 1VQM3 1K8A4 3CC43 3CCU3 3CCJ3 1QVG2 3G713 1Q864 1Q7Y4 1K734 1JJ22 3CME3 1N8R4
chains in the Genus database with same CATH superfamily
3OXAA 3BU4A 3OW22 3GZYB 3UB1A 1GY6A 4RNZA 1BNFA 1IQXA 1G02A 1RCLA 3JUMA 1Y4KA 4AEQA 4CPKA 2Z7AA 1LNHA 1NJI4 1Z1SA 2H0GA 1TP6A 3LMLA 5KP1A 4FCJA 1VQP3 2O3OA 4R9LA 1LNIA 2K3DA 5BXQA 1BIRA 5HOHA 3G0KA 5TGNA 3A76A 3LXUX 3K7CA 4GSPA 4J5GA 1YNVX 2P38A 3F40A 1JV2B 3N54B 1WTHA 3KZTA 3F7XA 4KFDA 3SX1A 3NV0B 1S5AA 2A15A 1DETA 2HMLB 1IQ8A 5GSPA 4U13A 2OCTA 1Q7Y4 1CYVA 3AGNA 4FMDA 3KN4A 1A2KA 1ZX2A 2OOVC 5LC7A 4CDLA 4O3VA 1TRQA 1BNSA 2RNTA 3DY5A 3T8NA 2QEX3 5IW9A 4HYZA 3VSYA 4Q53A 1FUWA 3PCRA 2L1SA 3S67A 1IV9A 3LTCA 1JRQA 4HM8B 1JN5B 1G0TA 2CX1A 4FMCA 4HZBB 5CXOA 5M19A 2XGNA 3CMA3 1GMPA 4HM4B 1RGFA 2HMOB 3EE1A 2W56A 3IJEB 3RGRA 2CIUA 1M1K4 3Q1CA 2QA43 2OTJ3 1DVCA 3L0RA 2CG1A 2KXGA 3HZPA 2BT3A 3H3HA 1EQKA 2IA7A 3VF1A 1FGRA 3MYTA 1FGTA 1OUNA 2OOVA 1GSPA 3MSOA 7STDA 4X2HA 3N8BA 3CPOA 2W03A 4FCZA 4OVMA 1O7NB 1N5HA 3FGYA 1TRPA 5CK6A 2HMKB 2OWPA 2M7OA 2IY2A 1T5YA 4HOHA 1SQWA 4X2OA 3FSDA 1B2UA 3VGNA 1FW7A 1NNVA 5D81A 1RNTA 1W4NA 3AGOA 1K9M4 2H0IA 1RMSA 3EX9A 3T8UA 1IYYA 2CHCA 3CCR3 4MJDA 1I2EA 3PCSA 1GS3A 2KAAA 4HM7B 1B20A 1MWSA 3FZWA 4IPBA 9RNTA 1RNBA 2XGLA 1IVXA 4WFOA 3FG1A 1QVG2 3D4AA 2CC3A 3Q90A 1RN1A 1QAKA 1RGGA 3S5CA 4NPBA 5ELJA 3PZWA 5KP4A 5IENA 1I70A 3MHEA 3WHOA 4CJNA 3I553 4XDWA 1B2SA 1UUGB 2R41A 4J9AA 2GEXA 4G1MB 3G8ZA 3N9HA 1IU7A 3F9SA 2XEPA 2ZA4A 3BNBA 5CF2A 4R4KA 1YIT3 4HKVB 1BRIA 2IMJA 3BNEA 3NM7A 1ZGXA 5I97A 3CXC2 2ZL8A 1A2PA 2CFDA 2FXTA 3GRDA 1TU5A 5EVHA 4H61A 3UNLA 1DVDA 1MGRA 2WOFA 3FCSB 1BGSA 3I0YA 1BANA 2CFLA 2K54A 3PS8A 1GY5A 4HM0B 3EN8A 3ZFZA 2O9UX 5JBSA 1BSDA 2Y74A 3DH2A 1BSBA 1JKGB 4J8TA 3CCQ3 2MC8A 4JRFA 3U97A 1GMQA 3JUOA 1RJOA 1RRHA 5EEOA 3X3ZA 4RZMA 1ISKA 1K28A 5G1KA 2XSOB 1BRSA 1DE3A 1VQO3 2FGTA 4EYCA 4LEHA 4N6UA 4ORLA 1RDSA 3D5IA 2OQEA 5HGRA 1AY7A 1UCJA 3CCS3 1YI23 2YFIB 4N6LA 3NXJA 4EXRA 5D83A 1IT8A 1F8NA 3F7SA 3MG2A 4RNTA 4AKYA 1FA3A 2C4BA 1N8R4 3GZXB 4NREA 2HMJB 1US1A 1Q9EA 3Q2PA 1EEJA 1Q40B 1U5OA 1JN5A 4HM6B 2L4VA 4I4KA 3B7CA 3MKIA 3JVCA 5IEPA 1TFOA 3M8CA 2XH9A 3EB8A 3EBYA 3SOAA 4XB5A 5IG5A 1YJ93 5JPPA 1LQMB 1WMNA 1BNGA 1EA2A 1PY3A 2Y73A 3AMOA 4XBXA 5RNTA 1UW1A 1WNHA 1ULIB 1ASKA 3STDA 1BNJA 1ROAA 1N5PA 1W01A 2P0XA 3EN1B 1JZOA 4K61A 1W6YA 2KF6A 3H51A 3HI7A 4PEJA 4LYLB 1BRHA 1BAOA 1LOVA 1N8QA 4WHAA 2W6JH 3LT8A 3JUPA 3JUQA 2P05A 1YGWA 5CF1A 4FR9A 2KCDA 2UX0A 3BLZA 4K90B 1E3RA 2W0QA 2PZVA 3SXXA 1UI7A 2XF3A 2ML5A 1STFI 5JPUA 1UUVB 1X1UA 4EBGA 3G4S3 1TUHA 1JB5A 2GSPA 2B24B 1W6CA 3FH1A 3HK4A 3KE7A 4FCMA 1X1WA 1NWWA 4MMYB 1TTOA 2RCDA 4HAAA 1RGAA 1O7PB 5AIFA 4DKIA 3V99A 1PU4A 1B2XA 2Z76A 4RNYA 1RLSA 4O02B 2GEYA 2E2VA 4CCVA 1K41A 2WOHA 5FW5A 4HBRA 4QWTA 2YFJB 2CWUA 1UGHI 3ZG0A 3B8LA 3PXMA 3TDGA 1BSAA 1KD14 4NHFA 2W9PA 1M9GA 1NO3A 1OHSA 3WMDA 1RN7A 2KF5A 5AEUB 1YVBI 5IG3A 1BNRA 2XRXB 3CU3A 4I5QA 4ZM8A 1HKXA 1QVF2 1BNEA 2RBIA 2W56B 3SVAA 1JB2A 2HOHA 4JF8A 1J2BA 3WOEB 3DMCA 4O2HA 3A5EA 2GBXB 3G6E3 1SIIA 1OACA 2INXA 5BU4A 1BUQA 2RFRA 1OGZA 1DYUA 1RGLA 3WDGB 1GOUA 2GXFA 4FMBA 3CC23 1VQL3 3JUNA 2SARA 3ECFA 3FG4A 1RRLA 1BRJA 3G713 1AQZA 1PFPA 1GYBA 3D5GA 3HIIA 4EC6A 3FF0A 1K734 1JJ22 1A90A 1BUJA 4GHOA 3KSED 1E3VA 4XDVA 3K5TA 2I9WA 1I2FA 4N3VA 3NV0A 1YHQ3 2XFTA 1JZDA 8RNTA 3ROBA 3URPA 1QJGA 3S29A 2WGOA 1CYUA 1B3SA 2W2CA 1A67A 3BNDA 1OH0A 1IV7A 1RCKA 1EG9B 1MNLA 3MG3A 2CWVA 3QK9A 3EBTA 3MG1A 1LXEA 1N9JA 1ZO2A 1OGXA 2YX9A 2ZDJA 3AHSA 1VQ73 1BNIA 3DGLA 5IG4A 1HZ1A 3U1WA 1Q814 2F99A 5BIRA 3DM8A 1AVKA 1NDOB 2KF3A 1ULJB 3O8YA 2BMQB 1O7MB 3LTDA 3KCHA 1OHPA 1UCKA 3D9RA 5AYRB 1BSCA 1QAFA 3MPHA 2RGQA 1I2GA 1V58A 1LOWA 2IUKA 3OX9A 3OWUA 1NB3I 2IYJA 1AVLA 2CX0A 2CH9A 3DGOA 3E99A 1KC84 1SARA 3NQYA 1V57A 1X1YA 3IMAB 1W5ZA 1G96A 3PGBA 3OWSA 1Q42A 2QGUA 2PNCA 3LTAA 1OF5B 3PYJA 5AIGA 2XR8B 3V92A 1CQSA 3NUVA 3X40A 3CNXA 4N6MA 1QMAA 1WMOA 1IVVA 1LRAA 2Z77A 3CNMA 3EJVA 3KFQC 4R80A 1KQS2 2BO9B 3F8XA 4N6V0 2W04A 1PYLA 5DRVA 3KIIA 2F5MA 3FF2A 4ILFA 1KSIA 3CCL3 1W02A 5G1LA 1VQM3 3KKGA 4MMZB 2E2UA 2UGIA 2JQ5A 2QIYA 1N9EA 4K1VA 6RNTA 1WMPA 1R4YA 1DMMA 3Q3FA 4WP5A 5AEWB 1B21A 3DXOA 1JBSA 1IVWA 2F4YA 5AI1A 3ER7A 1R4CA 3RNTA 1T2HA 4EW5A 4BU4A 4BTWA 1L5GB 1VQN3 4EV5A 2GBWB 7GSPA 3B4OA 5ELUA 1VZZA 3X41A 4L8PA 2P09A 1GOYA 5FGOA 5STDA 4R9KA 3X3YA 5CLKA 4OK0A 1DMQA 4WYKB 2MF7A 1TJDA 1QALA 4XM4A 1STDA 2OQEC 1FGQA 1T3BA 4FMAA 2RSXA 2OTL3 1IVUA 1IDPA 2Z6BA 3DUKA 4HZ9B 1SPUA 3BIRA 4KZ1A 3SEDA 4AKZA 4STDA 2WO0A 2ZHXB 5AIHA 2BMOB 7RNTA 1JBTA 1GOVA 1FUSA 3UL5A 3SOYA 3KSPA 1I0VA 1VQ83 1OCVA 3DGYA 3GWRA 1A2VA 2ML6A 4GL6A 3V98A 1SJWA 3RDEA 4WWUC 4IT7A 3ZG5A 3NQZA 5DREA 3OV4A 1O7HB 1GD4A 1RGEA 4OUQA 1IT7A 3AMOB 3GSPA 2H0HA 1YGEA 1YVSA 4R1KA 3EQQB 5IEOA 1B27A 3FG3A 1DMNA 3I563 1B2ZA 1JB4A 3EC9A 1JBRA 1EKMA 1UUWB 1BSEA 3EF8A 1YJN3 1W7CA 2F98A 3QRDA 3WA3A 2W9QA 3T0UA 5M18A 3CC43 1K8A4 3CCU3 1FZUA 5EQLA 2XFSA 4BL2A 1Q864 1GMRA 1I8VA 3CME3 3NHXA 3DGNA 4HVNA 3CCE3 3LH4A 1T2IA 3GAXA 2F86B 5AIIA 3EHCA 3G16A 4TX4A 1MOLA 2KRTA 3RGAA 3X42A 1YIJ3 2UUGC 3D79A 3J7Yd 4BTXA 3CPW2 2WGQA 3WR2A 4LZIA 2CG0A 4KFFA 5A0OB 1W2B2 5IF6A 1Q40A 1MGWA 1ZS7A 2BMRB 2V1LA 4BIRA 1OHOA 3F8HA 1VQ53 4LGQA 1JNQA 2F56A 1FGMA 3K9MC 1VQK3 3UL6A 4XBYA 1JKGA 3NBBA 1D6ZA 3S28A 1BRKA 2D42A 4WYKA 3WA2X 1VQQA 3CCJ3 3S27A 1SIHA 4H3UA 1C54A 1Q7HA 4XBTA 4L8OA 6GSPA 1VQ93 1OF5A 3WOFB 4HM5B 3LZAA 1RN4A 4MMXB 3WODG 3NBRA 5KP3A 2LQVA 3DGMA 3LTBA 2BNGA 1BRNL 1KWIA 1W2ZA 3BNCA 3CC73 2GU1A 2HMNB 3UJMA 2CWTA 4BL3A 5IG0A 4HM3B 1UCLA 1RGKA 1RSNA 2HMMB 3FKAA 1C7HA 2P0MA 1OPYA 5M1AA 5IERA 4KFEA 1TFKA 1LOXA 1I3FA 1BOXA 4LSOA 1VQ63 1BVIA 1GY7A 4N6NB 2C11A 1VQ43 1BU4A 1LOYA 2CKFB 4L7KA 1CEWI 2YFLB 1NB5I 4BTYA 3K63A 2BIRA 1UI8A 2JDIH 1UGIA 1X1XA 4HM2B 1U8CB 3AHWA 1E97A 2D1WA 3GZRA 8CHOA 4HM1B 5G2GA 1LVNA 1I3IA 1BRGA 1TIJA 2BU4A 2FNQA 1W00A 6STDA 2LYXA 4N6OB 1ROVA 3LOYA 3CCV3 3IPTA 1M1XB 2STDA 2CW9A 2E2TA 3HIGA 4GB5A 2F5WA 4HJLB 2IUJA 3SYUA 1S723 5LC6A 2AADA 1D6UA 2SBLA 1W6GA 1FGOA 1D6YA 4LMIA 3LT9A 3BB9A 1MWUA 4K1UA 2J8XB 2K0MA 2C10A 1RHLA 3K0ZA 3SLUA 3LYGA 3NM2A 1FUTA 1HYFA 3DZLA 1I0XA 3NX0A 3HX8A 3ALAA 1RGHA 1AR0A 1EUIC 2Q07A 2AAEA 3OWYA 3NBJA 4KVHA 3CD63 1RKYA 1UDII 1WQLB 3D3LA 2KF4A 5BVBA 2CK3H 1M904 3F14A 3FLJA 1IK3A 1UCIA 3HOHA 4J5KA 1MWTA 3GZBA 3MWZA 1HU9A 5D82A 1RGCA 4MEIA 1NU3A 1AV4A 1LQGC 1GD3A 1FYSA 4O8SA 3CCM3 1IQYA 1RTUA 2CFWA 1O7GB 2CFGA 4KT3B 4RBNA 1YJW3 4N6TA 2GU3A 1V74A 1Q824 3X3XA 1B2MA 1MWRA 2BHMA 2XSHB 3B4PA 2CFKA 2R4IA 4IIAA 5AYSC 4EV2A 1CH0A 2B1XB 1O7WB
chains in the Genus database with same CATH topology
3OXAA 3OW22 3GZYB 3UB1A 1GY6A 4RNZA 1IQXA 3JUMA 4AEQA 1Y4KA 2Z7AA 1LNHA 1NJI4 1Z1SA 1TP6A 3LMLA 5KP1A 4FCJA 1VQP3 2O3OA 4R9LA 5BXQA 3G0KA 5TGNA 3A76A 3LXUX 3K7CA 2P38A 3F40A 1JV2B 3N54B 1WTHA 3KZTA 3F7XA 4KFDA 3SX1A 3NV0B 1S5AA 2A15A 2HMLB 1IQ8A 4U13A 2OCTA 1Q7Y4 1CYVA 4FMDA 3KN4A 1A2KA 1ZX2A 2OOVC 5LC7A 4CDLA 4O3VA 3DY5A 3T8NA 2QEX3 5IW9A 4HYZA 3VSYA 4Q53A 1FUWA 3PCRA 3S67A 1IV9A 3LTCA 1JRQA 4HM8B 1JN5B 4FMCA 4HZBB 5CXOA 2XGNA 3CMA3 4HM4B 2HMOB 3EE1A 2W56A 3IJEB 3RGRA 2CIUA 1M1K4 3Q1CA 2QA43 2OTJ3 1DVCA 3L0RA 2CG1A 2KXGA 3HZPA 2BT3A 3H3HA 1EQKA 2IA7A 3VF1A 1FGRA 3MYTA 1FGTA 1OUNA 2OOVA 3MSOA 7STDA 4X2HA 3N8BA 3CPOA 2W03A 4FCZA 4OVMA 1O7NB 1N5HA 3FGYA 5CK6A 2HMKB 2OWPA 2M7OA 1T5YA 1SQWA 4X2OA 3FSDA 3VGNA 5D81A 1W4NA 1K9M4 3EX9A 3T8UA 2CHCA 3CCR3 4MJDA 3PCSA 1GS3A 4HM7B 4IPBA 3FZWA 2XGLA 1IVXA 4WFOA 3FG1A 1QVG2 2CC3A 3Q90A 1QAKA 3S5CA 5ELJA 3PZWA 5KP4A 5IENA 3MHEA 3I553 4XDWA 4J9AA 2GEXA 4G1MB 3G8ZA 3N9HA 1IU7A 3F9SA 2XEPA 3BNBA 5CF2A 4R4KA 1YIT3 4HKVB 2IMJA 3BNEA 3NM7A 5I97A 3CXC2 2ZL8A 2CFDA 2FXTA 3GRDA 1TU5A 5EVHA 4H61A 3UNLA 1DVDA 2WOFA 3FCSB 3I0YA 2K54A 2CFLA 3PS8A 1GY5A 4HM0B 3EN8A 2O9UX 5JBSA 2Y74A 1JKGB 4J8TA 3CCQ3 2MC8A 4JRFA 3U97A 3JUOA 1RJOA 1RRHA 5EEOA 3X3ZA 4RZMA 1ISKA 1K28A 2XSOB 1VQO3 2FGTA 4EYCA 4LEHA 4N6UA 4ORLA 2OQEA 5HGRA 3CCS3 1YI23 2YFIB 4N6LA 3NXJA 4EXRA 5D83A 1IT8A 1F8NA 3F7SA 3MG2A 4AKYA 1FA3A 1N8R4 3GZXB 4NREA 2HMJB 1US1A 3Q2PA 1Q40B 1U5OA 1JN5A 4HM6B 2L4VA 4I4KA 3B7CA 3MKIA 3JVCA 5IEPA 1TFOA 3M8CA 2XH9A 3EB8A 3EBYA 3SOAA 4XB5A 5IG5A 1YJ93 5JPPA 1WMNA 1EA2A 3AMOA 2Y73A 4XBXA 1UW1A 1WNHA 1ULIB 1ASKA 3STDA 1ROAA 1N5PA 1W01A 2P0XA 3EN1B 4K61A 1W6YA 3H51A 3HI7A 4PEJA 1N8QA 4WHAA 2W6JH 3LT8A 3JUPA 3JUQA 2P05A 5CF1A 4FR9A 2KCDA 2UX0A 3BLZA 4K90B 1E3RA 2W0QA 2PZVA 3SXXA 1UI7A 2XF3A 2ML5A 1STFI 5JPUA 1UUVB 4EBGA 3G4S3 1TUHA 1JB5A 2B24B 1W6CA 3FH1A 3HK4A 3KE7A 4FCMA 1NWWA 4MMYB 2RCDA 1O7PB 5AIFA 3V99A 1PU4A 2Z76A 4RNYA 4O02B 2GEYA 2E2VA 4CCVA 1K41A 2WOHA 5FW5A 4HBRA 4QWTA 2YFJB 2CWUA 3B8LA 3PXMA 3TDGA 1KD14 4NHFA 2W9PA 1M9GA 1NO3A 1OHSA 3WMDA 1RN7A 5AEUB 5IG3A 1YVBI 3CU3A 2XRXB 4ZM8A 1HKXA 1QVF2 2W56B 3SVAA 1JB2A 4JF8A 1J2BA 3WOEB 3DMCA 4O2HA 2GBXB 3G6E3 1SIIA 1OACA 2INXA 1BUQA 2RFRA 1OGZA 1DYUA 3WDGB 3CC23 1VQL3 2GXFA 4FMBA 3JUNA 3ECFA 3FG4A 1RRLA 3G713 1PFPA 1GYBA 3HIIA 4EC6A 1K734 3FF0A 1JJ22 1A90A 3KSED 1E3VA 4XDVA 3K5TA 2I9WA 4N3VA 3NV0A 1YHQ3 2XFTA 3ROBA 1CYUA 1QJGA 3S29A 2WGOA 2W2CA 1A67A 3BNDA 1OH0A 1IV7A 3QK9A 1EG9B 1MNLA 3MG3A 2CWVA 3EBTA 3MG1A 1LXEA 1N9JA 1ZO2A 1OGXA 2YX9A 2ZDJA 1VQ73 3DGLA 5IG4A 1Q814 3U1WA 2F99A 3DM8A 1AVKA 1NDOB 1ULJB 3O8YA 2BMQB 1O7MB 3LTDA 1OHPA 3D9RA 5AYRB 1QAFA 3MPHA 2RGQA 3OX9A 2IUKA 3OWUA 1NB3I 1AVLA 2CH9A 3DGOA 3E99A 1KC84 3NQYA 3IMAB 1W5ZA 1G96A 3PGBA 3OWSA 1Q42A 2QGUA 2PNCA 3LTAA 1OF5B 3PYJA 5AIGA 2XR8B 3V92A 1CQSA 3NUVA 3X40A 3CNXA 4N6MA 3EJVA 1QMAA 1IVVA 1WMOA 2Z77A 3CNMA 3KFQC 4R80A 8CHOA 1KQS2 2BO9B 3F8XA 4N6V0 2W04A 5DRVA 3KIIA 3FF2A 1KSIA 3CCL3 1W02A 1VQM3 3KKGA 4MMZB 2E2UA 2JQ5A 2QIYA 1N9EA 4K1VA 1WMPA 1DMMA 4WP5A 5AEWB 3DXOA 1IVWA 5AI1A 3ER7A 1R4CA 4BTWA 1L5GB 1VQN3 4EV5A 2GBWB 3B4OA 5ELUA 1VZZA 3X41A 4L8PA 2P09A 5FGOA 5STDA 4R9KA 3X3YA 5CLKA 4OK0A 1DMQA 4WYKB 2MF7A 1QALA 4XM4A 1STDA 2OQEC 1FGQA 4FMAA 2OTL3 2RSXA 1IVUA 1IDPA 2Z6BA 3DUKA 4HZ9B 1SPUA 4KZ1A 3SEDA 4AKZA 4STDA 2WO0A 5AIHA 2BMOB 3UL5A 3SOYA 3KSPA 1VQ83 1OCVA 3GWRA 1A2VA 2ML6A 4GL6A 3V98A 1SJWA 3RDEA 4WWUC 4IT7A 3NQZA 5DREA 3OV4A 1O7HB 1GD4A 4OUQA 1IT7A 3AMOB 1YGEA 4R1KA 3EQQB 5IEOA 3FG3A 1DMNA 3I563 1JB4A 3EC9A 1EKMA 1UUWB 3EF8A 1YJN3 1W7CA 2F98A 3QRDA 3WA3A 2W9QA 3T0UA 3CC43 1K8A4 3CCU3 5EQLA 2XFSA 1Q864 3CME3 3NHXA 3DGNA 4HVNA 3CCE3 3LH4A 3GAXA 2F86B 5AIIA 3EHCA 3G16A 4TX4A 1MOLA 2KRTA 3RGAA 3X42A 1YIJ3 3J7Yd 4BTXA 3CPW2 2WGQA 4LZIA 2CG0A 4KFFA 5A0OB 1W2B2 5IF6A 1Q40A 2BMRB 2V1LA 1VQ53 1OHOA 3F8HA 4LGQA 1JNQA 3K9MC 1FGMA 1VQK3 3UL6A 4XBYA 1JKGA 3NBBA 1D6ZA 3S28A 3WA2X 2D42A 4WYKA 3CCJ3 3S27A 1SIHA 4H3UA 4XBTA 4L8OA 1VQ93 1OF5A 3WOFB 4HM5B 3LZAA 4MMXB 3WODG 3NBRA 5KP3A 2LQVA 3DGMA 3LTBA 2BNGA 1KWIA 1W2ZA 3BNCA 3CC73 2GU1A 2HMNB 3UJMA 2CWTA 5IG0A 4HM3B 2HMMB 3FKAA 1C7HA 2P0MA 1OPYA 5IERA 4KFEA 1TFKA 1LOXA 1VQ63 4LSOA 1GY7A 4N6NB 2C11A 1VQ43 2CKFB 4L7KA 1CEWI 2YFLB 1NB5I 4BTYA 3K63A 2JDIH 1UI8A 4HM2B 1U8CB 3GZRA 1E97A 2D1WA 4HM1B 5G2GA 1LVNA 1TIJA 2FNQA 1W00A 6STDA 2LYXA 4N6OB 1ROVA 3LOYA 3CCV3 3IPTA 1M1XB 2STDA 2CW9A 2E2TA 3HIGA 4GB5A 4HJLB 2IUJA 1S723 5LC6A 1D6UA 2SBLA 1W6GA 1FGOA 1D6YA 4LMIA 3LT9A 3BB9A 4K1UA 2K0MA 2C10A 3K0ZA 3SLUA 3LYGA 3NM2A 3DZLA 3NX0A 3ALAA 1AR0A 2Q07A 3OWYA 3NBJA 4KVHA 3CD63 1RKYA 1WQLB 3D3LA 5BVBA 2CK3H 1M904 3F14A 3FLJA 1IK3A 3GZBA 3MWZA 1HU9A 5D82A 4MEIA 1NU3A 1AV4A 1GD3A 4O8SA 3CCM3 1IQYA 2CFWA 1O7GB 2CFGA 1YJW3 4RBNA 4N6TA 2GU3A 1V74A 1Q824 3X3XA 2BHMA 2XSHB 3B4PA 2CFKA 2R4IA 4IIAA 5AYSC 4EV2A 3HX8A 2B1XB 1O7WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE 3;  1VQ8 3;  3OW2 2;  1KC8 4;  1M90 4;  2QEX 3;  1YHQ 3;  3I55 3;  1YIJ 3;  3CCV 3;  3CCQ 3;  1KD1 4;  3CC7 3;  3CPW 2;  1VQ9 3;  1S72 3;  1VQN 3;  1NJI 4;  1W2B 2;  1YIT 3;  1QVF 2;  1VQP 3;  3CCM 3;  1VQ7 3;  1YJ9 3;  1K9M 4;  1VQO 3;  3CMA 3;  1YJW 3;  1Q81 4;  1VQ6 3;  1KQS 2;  3G4S 3;  3I56 3;  3G6E 3;  1Q82 4;  1VQ5 3;  3CXC 2;  1VQ4 3;  3CC2 3;  1M1K 4;  3CCR 3;  1VQK 3;  2QA4 3;  3CCS 3;  1YJN 3;  1VQL 3;  2OTJ 3;  3CCL 3;  2OTL 3;  3CD6 3;  1YI2 3;  1VQM 3;  1K8A 4;  3CC4 3;  3CCU 3;  3CCJ 3;  1QVG 2;  3G71 3;  1Q86 4;  1Q7Y 4;  1K73 4;  1JJ2 2;  3CME 3;  1N8R 4; 
#chains in the Genus database with same CATH topology
 3OXA A;  3BU4 A;  3OW2 2;  3GZY B;  3UB1 A;  1GY6 A;  4RNZ A;  1BNF A;  1IQX A;  1G02 A;  1RCL A;  3JUM A;  1Y4K A;  4AEQ A;  4CPK A;  2Z7A A;  1LNH A;  1NJI 4;  1Z1S A;  2H0G A;  1TP6 A;  3LML A;  5KP1 A;  4FCJ A;  1VQP 3;  2O3O A;  4R9L A;  1LNI A;  2K3D A;  5BXQ A;  1BIR A;  5HOH A;  3G0K A;  5TGN A;  3A76 A;  3LXU X;  3K7C A;  4GSP A;  4J5G A;  1YNV X;  2P38 A;  3F40 A;  1JV2 B;  3N54 B;  1WTH A;  3KZT A;  3F7X A;  4KFD A;  3SX1 A;  3NV0 B;  1S5A A;  2A15 A;  1DET A;  2HML B;  1IQ8 A;  5GSP A;  4U13 A;  2OCT A;  1Q7Y 4;  1CYV A;  3AGN A;  4FMD A;  3KN4 A;  1A2K A;  1ZX2 A;  2OOV C;  5LC7 A;  4CDL A;  4O3V A;  1TRQ A;  1BNS A;  2RNT A;  3DY5 A;  3T8N A;  2QEX 3;  5IW9 A;  4HYZ A;  3VSY A;  4Q53 A;  1FUW A;  3PCR A;  2L1S A;  3S67 A;  1IV9 A;  3LTC A;  1JRQ A;  4HM8 B;  1JN5 B;  1G0T A;  2CX1 A;  4FMC A;  4HZB B;  5CXO A;  5M19 A;  2XGN A;  3CMA 3;  1GMP A;  4HM4 B;  1RGF A;  2HMO B;  3EE1 A;  2W56 A;  3IJE B;  3RGR A;  2CIU A;  1M1K 4;  3Q1C A;  2QA4 3;  2OTJ 3;  1DVC A;  3L0R A;  2CG1 A;  2KXG A;  3HZP A;  2BT3 A;  3H3H A;  1EQK A;  2IA7 A;  3VF1 A;  1FGR A;  3MYT A;  1FGT A;  1OUN A;  2OOV A;  1GSP A;  3MSO A;  7STD A;  4X2H A;  3N8B A;  3CPO A;  2W03 A;  4FCZ A;  4OVM A;  1O7N B;  1N5H A;  3FGY A;  1TRP A;  5CK6 A;  2HMK B;  2OWP A;  2M7O A;  2IY2 A;  1T5Y A;  4HOH A;  1SQW A;  4X2O A;  3FSD A;  1B2U A;  3VGN A;  1FW7 A;  1NNV A;  5D81 A;  1RNT A;  1W4N A;  3AGO A;  1K9M 4;  2H0I A;  1RMS A;  3EX9 A;  3T8U A;  1IYY A;  2CHC A;  3CCR 3;  4MJD A;  1I2E A;  3PCS A;  1GS3 A;  2KAA A;  4HM7 B;  1B20 A;  1MWS A;  3FZW A;  4IPB A;  9RNT A;  1RNB A;  2XGL A;  1IVX A;  4WFO A;  3FG1 A;  1QVG 2;  3D4A A;  2CC3 A;  3Q90 A;  1RN1 A;  1QAK A;  1RGG A;  3S5C A;  4NPB A;  5ELJ A;  3PZW A;  5KP4 A;  5IEN A;  1I70 A;  3MHE A;  3WHO A;  4CJN A;  3I55 3;  4XDW A;  1B2S A;  1UUG B;  2R41 A;  4J9A A;  2GEX A;  4G1M B;  3G8Z A;  3N9H A;  1IU7 A;  3F9S A;  2XEP A;  2ZA4 A;  3BNB A;  5CF2 A;  4R4K A;  1YIT 3;  4HKV B;  1BRI A;  2IMJ A;  3BNE A;  3NM7 A;  1ZGX A;  5I97 A;  3CXC 2;  2ZL8 A;  1A2P A;  2CFD A;  2FXT A;  3GRD A;  1TU5 A;  5EVH A;  4H61 A;  3UNL A;  1DVD A;  1MGR A;  2WOF A;  3FCS B;  1BGS A;  3I0Y A;  1BAN A;  2CFL A;  2K54 A;  3PS8 A;  1GY5 A;  4HM0 B;  3EN8 A;  3ZFZ A;  2O9U X;  5JBS A;  1BSD A;  2Y74 A;  3DH2 A;  1BSB A;  1JKG B;  4J8T A;  3CCQ 3;  2MC8 A;  4JRF A;  3U97 A;  1GMQ A;  3JUO A;  1RJO A;  1RRH A;  5EEO A;  3X3Z A;  4RZM A;  1ISK A;  1K28 A;  5G1K A;  2XSO B;  1BRS A;  1DE3 A;  1VQO 3;  2FGT A;  4EYC A;  4LEH A;  4N6U A;  4ORL A;  1RDS A;  3D5I A;  2OQE A;  5HGR A;  1AY7 A;  1UCJ A;  3CCS 3;  1YI2 3;  2YFI B;  4N6L A;  3NXJ A;  4EXR A;  5D83 A;  1IT8 A;  1F8N A;  3F7S A;  3MG2 A;  4RNT A;  4AKY A;  1FA3 A;  2C4B A;  1N8R 4;  3GZX B;  4NRE A;  2HMJ B;  1US1 A;  1Q9E A;  3Q2P A;  1EEJ A;  1Q40 B;  1U5O A;  1JN5 A;  4HM6 B;  2L4V A;  4I4K A;  3B7C A;  3MKI A;  3JVC A;  5IEP A;  1TFO A;  3M8C A;  2XH9 A;  3EB8 A;  3EBY A;  3SOA A;  4XB5 A;  5IG5 A;  1YJ9 3;  5JPP A;  1LQM B;  1WMN A;  1BNG A;  1EA2 A;  1PY3 A;  2Y73 A;  3AMO A;  4XBX A;  5RNT A;  1UW1 A;  1WNH A;  1ULI B;  1ASK A;  3STD A;  1BNJ A;  1ROA A;  1N5P A;  1W01 A;  2P0X A;  3EN1 B;  1JZO A;  4K61 A;  1W6Y A;  2KF6 A;  3H51 A;  3HI7 A;  4PEJ A;  4LYL B;  1BRH A;  1BAO A;  1LOV A;  1N8Q A;  4WHA A;  2W6J H;  3LT8 A;  3JUP A;  3JUQ A;  2P05 A;  1YGW A;  5CF1 A;  4FR9 A;  2KCD A;  2UX0 A;  3BLZ A;  4K90 B;  1E3R A;  2W0Q A;  2PZV A;  3SXX A;  1UI7 A;  2XF3 A;  2ML5 A;  1STF I;  5JPU A;  1UUV B;  1X1U A;  4EBG A;  3G4S 3;  1TUH A;  1JB5 A;  2GSP A;  2B24 B;  1W6C A;  3FH1 A;  3HK4 A;  3KE7 A;  4FCM A;  1X1W A;  1NWW A;  4MMY B;  1TTO A;  2RCD A;  4HAA A;  1RGA A;  1O7P B;  5AIF A;  4DKI A;  3V99 A;  1PU4 A;  1B2X A;  2Z76 A;  4RNY A;  1RLS A;  4O02 B;  2GEY A;  2E2V A;  4CCV A;  1K41 A;  2WOH A;  5FW5 A;  4HBR A;  4QWT A;  2YFJ B;  2CWU A;  1UGH I;  3ZG0 A;  3B8L A;  3PXM A;  3TDG A;  1BSA A;  1KD1 4;  4NHF A;  2W9P A;  1M9G A;  1NO3 A;  1OHS A;  3WMD A;  1RN7 A;  2KF5 A;  5AEU B;  1YVB I;  5IG3 A;  1BNR A;  2XRX B;  3CU3 A;  4I5Q A;  4ZM8 A;  1HKX A;  1QVF 2;  1BNE A;  2RBI A;  2W56 B;  3SVA A;  1JB2 A;  2HOH A;  4JF8 A;  1J2B A;  3WOE B;  3DMC A;  4O2H A;  3A5E A;  2GBX B;  3G6E 3;  1SII A;  1OAC A;  2INX A;  5BU4 A;  1BUQ A;  2RFR A;  1OGZ A;  1DYU A;  1RGL A;  3WDG B;  1GOU A;  2GXF A;  4FMB A;  3CC2 3;  1VQL 3;  3JUN A;  2SAR A;  3ECF A;  3FG4 A;  1RRL A;  1BRJ A;  3G71 3;  1AQZ A;  1PFP A;  1GYB A;  3D5G A;  3HII A;  4EC6 A;  3FF0 A;  1K73 4;  1JJ2 2;  1A90 A;  1BUJ A;  4GHO A;  3KSE D;  1E3V A;  4XDV A;  3K5T A;  2I9W A;  1I2F A;  4N3V A;  3NV0 A;  1YHQ 3;  2XFT A;  1JZD A;  8RNT A;  3ROB A;  3URP A;  1QJG A;  3S29 A;  2WGO A;  1CYU A;  1B3S A;  2W2C A;  1A67 A;  3BND A;  1OH0 A;  1IV7 A;  1RCK A;  1EG9 B;  1MNL A;  3MG3 A;  2CWV A;  3QK9 A;  3EBT A;  3MG1 A;  1LXE A;  1N9J A;  1ZO2 A;  1OGX A;  2YX9 A;  2ZDJ A;  3AHS A;  1VQ7 3;  1BNI A;  3DGL A;  5IG4 A;  1HZ1 A;  3U1W A;  1Q81 4;  2F99 A;  5BIR A;  3DM8 A;  1AVK A;  1NDO B;  2KF3 A;  1ULJ B;  3O8Y A;  2BMQ B;  1O7M B;  3LTD A;  3KCH A;  1OHP A;  1UCK A;  3D9R A;  5AYR B;  1BSC A;  1QAF A;  3MPH A;  2RGQ A;  1I2G A;  1V58 A;  1LOW A;  2IUK A;  3OX9 A;  3OWU A;  1NB3 I;  2IYJ A;  1AVL A;  2CX0 A;  2CH9 A;  3DGO A;  3E99 A;  1KC8 4;  1SAR A;  3NQY A;  1V57 A;  1X1Y A;  3IMA B;  1W5Z A;  1G96 A;  3PGB A;  3OWS A;  1Q42 A;  2QGU A;  2PNC A;  3LTA A;  1OF5 B;  3PYJ A;  5AIG A;  2XR8 B;  3V92 A;  1CQS A;  3NUV A;  3X40 A;  3CNX A;  4N6M A;  1QMA A;  1WMO A;  1IVV A;  1LRA A;  2Z77 A;  3CNM A;  3EJV A;  3KFQ C;  4R80 A;  1KQS 2;  2BO9 B;  3F8X A;  4N6V 0;  2W04 A;  1PYL A;  5DRV A;  3KII A;  2F5M A;  3FF2 A;  4ILF A;  1KSI A;  3CCL 3;  1W02 A;  5G1L A;  1VQM 3;  3KKG A;  4MMZ B;  2E2U A;  2UGI A;  2JQ5 A;  2QIY A;  1N9E A;  4K1V A;  6RNT A;  1WMP A;  1R4Y A;  1DMM A;  3Q3F A;  4WP5 A;  5AEW B;  1B21 A;  3DXO A;  1JBS A;  1IVW A;  2F4Y A;  5AI1 A;  3ER7 A;  1R4C A;  3RNT A;  1T2H A;  4EW5 A;  4BU4 A;  4BTW A;  1L5G B;  1VQN 3;  4EV5 A;  2GBW B;  7GSP A;  3B4O A;  5ELU A;  1VZZ A;  3X41 A;  4L8P A;  2P09 A;  1GOY A;  5FGO A;  5STD A;  4R9K A;  3X3Y A;  5CLK A;  4OK0 A;  1DMQ A;  4WYK B;  2MF7 A;  1TJD A;  1QAL A;  4XM4 A;  1STD A;  2OQE C;  1FGQ A;  1T3B A;  4FMA A;  2RSX A;  2OTL 3;  1IVU A;  1IDP A;  2Z6B A;  3DUK A;  4HZ9 B;  1SPU A;  3BIR A;  4KZ1 A;  3SED A;  4AKZ A;  4STD A;  2WO0 A;  2ZHX B;  5AIH A;  2BMO B;  7RNT A;  1JBT A;  1GOV A;  1FUS A;  3UL5 A;  3SOY A;  3KSP A;  1I0V A;  1VQ8 3;  1OCV A;  3DGY A;  3GWR A;  1A2V A;  2ML6 A;  4GL6 A;  3V98 A;  1SJW A;  3RDE A;  4WWU C;  4IT7 A;  3ZG5 A;  3NQZ A;  5DRE A;  3OV4 A;  1O7H B;  1GD4 A;  1RGE A;  4OUQ A;  1IT7 A;  3AMO B;  3GSP A;  2H0H A;  1YGE A;  1YVS A;  4R1K A;  3EQQ B;  5IEO A;  1B27 A;  3FG3 A;  1DMN A;  3I56 3;  1B2Z A;  1JB4 A;  3EC9 A;  1JBR A;  1EKM A;  1UUW B;  1BSE A;  3EF8 A;  1YJN 3;  1W7C A;  2F98 A;  3QRD A;  3WA3 A;  2W9Q A;  3T0U A;  5M18 A;  3CC4 3;  1K8A 4;  3CCU 3;  1FZU A;  5EQL A;  2XFS A;  4BL2 A;  1Q86 4;  1GMR A;  1I8V A;  3CME 3;  3NHX A;  3DGN A;  4HVN A;  3CCE 3;  3LH4 A;  1T2I A;  3GAX A;  2F86 B;  5AII A;  3EHC A;  3G16 A;  4TX4 A;  1MOL A;  2KRT A;  3RGA A;  3X42 A;  1YIJ 3;  2UUG C;  3D79 A;  3J7Y d;  4BTX A;  3CPW 2;  2WGQ A;  3WR2 A;  4LZI A;  2CG0 A;  4KFF A;  5A0O B;  1W2B 2;  5IF6 A;  1Q40 A;  1MGW A;  1ZS7 A;  2BMR B;  2V1L A;  4BIR A;  1OHO A;  3F8H A;  1VQ5 3;  4LGQ A;  1JNQ A;  2F56 A;  1FGM A;  3K9M C;  1VQK 3;  3UL6 A;  4XBY A;  1JKG A;  3NBB A;  1D6Z A;  3S28 A;  1BRK A;  2D42 A;  4WYK A;  3WA2 X;  1VQQ A;  3CCJ 3;  3S27 A;  1SIH A;  4H3U A;  1C54 A;  1Q7H A;  4XBT A;  4L8O A;  6GSP A;  1VQ9 3;  1OF5 A;  3WOF B;  4HM5 B;  3LZA A;  1RN4 A;  4MMX B;  3WOD G;  3NBR A;  5KP3 A;  2LQV A;  3DGM A;  3LTB A;  2BNG A;  1BRN L;  1KWI A;  1W2Z A;  3BNC A;  3CC7 3;  2GU1 A;  2HMN B;  3UJM A;  2CWT A;  4BL3 A;  5IG0 A;  4HM3 B;  1UCL A;  1RGK A;  1RSN A;  2HMM B;  3FKA A;  1C7H A;  2P0M A;  1OPY A;  5M1A A;  5IER A;  4KFE A;  1TFK A;  1LOX A;  1I3F A;  1BOX A;  4LSO A;  1VQ6 3;  1BVI A;  1GY7 A;  4N6N B;  2C11 A;  1VQ4 3;  1BU4 A;  1LOY A;  2CKF B;  4L7K A;  1CEW I;  2YFL B;  1NB5 I;  4BTY A;  3K63 A;  2BIR A;  1UI8 A;  2JDI H;  1UGI A;  1X1X A;  4HM2 B;  1U8C B;  3AHW A;  1E97 A;  2D1W A;  3GZR A;  8CHO A;  4HM1 B;  5G2G A;  1LVN A;  1I3I A;  1BRG A;  1TIJ A;  2BU4 A;  2FNQ A;  1W00 A;  6STD A;  2LYX A;  4N6O B;  1ROV A;  3LOY A;  3CCV 3;  3IPT A;  1M1X B;  2STD A;  2CW9 A;  2E2T A;  3HIG A;  4GB5 A;  2F5W A;  4HJL B;  2IUJ A;  3SYU A;  1S72 3;  5LC6 A;  2AAD A;  1D6U A;  2SBL A;  1W6G A;  1FGO A;  1D6Y A;  4LMI A;  3LT9 A;  3BB9 A;  1MWU A;  4K1U A;  2J8X B;  2K0M A;  2C10 A;  1RHL A;  3K0Z A;  3SLU A;  3LYG A;  3NM2 A;  1FUT A;  1HYF A;  3DZL A;  1I0X A;  3NX0 A;  3HX8 A;  3ALA A;  1RGH A;  1AR0 A;  1EUI C;  2Q07 A;  2AAE A;  3OWY A;  3NBJ A;  4KVH A;  3CD6 3;  1RKY A;  1UDI I;  1WQL B;  3D3L A;  2KF4 A;  5BVB A;  2CK3 H;  1M90 4;  3F14 A;  3FLJ A;  1IK3 A;  1UCI A;  3HOH A;  4J5K A;  1MWT A;  3GZB A;  3MWZ A;  1HU9 A;  5D82 A;  1RGC A;  4MEI A;  1NU3 A;  1AV4 A;  1LQG C;  1GD3 A;  1FYS A;  4O8S A;  3CCM 3;  1IQY A;  1RTU A;  2CFW A;  1O7G B;  2CFG A;  4KT3 B;  4RBN A;  1YJW 3;  4N6T A;  2GU3 A;  1V74 A;  1Q82 4;  3X3X A;  1B2M A;  1MWR A;  2BHM A;  2XSH B;  3B4P A;  2CFK A;  2R4I A;  4IIA A;  5AYS C;  4EV2 A;  1CH0 A;  2B1X B;  1O7W B; 
#chains in the Genus database with same CATH homology
 3OXA A;  3OW2 2;  3GZY B;  3UB1 A;  1GY6 A;  4RNZ A;  1IQX A;  3JUM A;  4AEQ A;  1Y4K A;  2Z7A A;  1LNH A;  1NJI 4;  1Z1S A;  1TP6 A;  3LML A;  5KP1 A;  4FCJ A;  1VQP 3;  2O3O A;  4R9L A;  5BXQ A;  3G0K A;  5TGN A;  3A76 A;  3LXU X;  3K7C A;  2P38 A;  3F40 A;  1JV2 B;  3N54 B;  1WTH A;  3KZT A;  3F7X A;  4KFD A;  3SX1 A;  3NV0 B;  1S5A A;  2A15 A;  2HML B;  1IQ8 A;  4U13 A;  2OCT A;  1Q7Y 4;  1CYV A;  4FMD A;  3KN4 A;  1A2K A;  1ZX2 A;  2OOV C;  5LC7 A;  4CDL A;  4O3V A;  3DY5 A;  3T8N A;  2QEX 3;  5IW9 A;  4HYZ A;  3VSY A;  4Q53 A;  1FUW A;  3PCR A;  3S67 A;  1IV9 A;  3LTC A;  1JRQ A;  4HM8 B;  1JN5 B;  4FMC A;  4HZB B;  5CXO A;  2XGN A;  3CMA 3;  4HM4 B;  2HMO B;  3EE1 A;  2W56 A;  3IJE B;  3RGR A;  2CIU A;  1M1K 4;  3Q1C A;  2QA4 3;  2OTJ 3;  1DVC A;  3L0R A;  2CG1 A;  2KXG A;  3HZP A;  2BT3 A;  3H3H A;  1EQK A;  2IA7 A;  3VF1 A;  1FGR A;  3MYT A;  1FGT A;  1OUN A;  2OOV A;  3MSO A;  7STD A;  4X2H A;  3N8B A;  3CPO A;  2W03 A;  4FCZ A;  4OVM A;  1O7N B;  1N5H A;  3FGY A;  5CK6 A;  2HMK B;  2OWP A;  2M7O A;  1T5Y A;  1SQW A;  4X2O A;  3FSD A;  3VGN A;  5D81 A;  1W4N A;  1K9M 4;  3EX9 A;  3T8U A;  2CHC A;  3CCR 3;  4MJD A;  3PCS A;  1GS3 A;  4HM7 B;  4IPB A;  3FZW A;  2XGL A;  1IVX A;  4WFO A;  3FG1 A;  1QVG 2;  2CC3 A;  3Q90 A;  1QAK A;  3S5C A;  5ELJ A;  3PZW A;  5KP4 A;  5IEN A;  3MHE A;  3I55 3;  4XDW A;  4J9A A;  2GEX A;  4G1M B;  3G8Z A;  3N9H A;  1IU7 A;  3F9S A;  2XEP A;  3BNB A;  5CF2 A;  4R4K A;  1YIT 3;  4HKV B;  2IMJ A;  3BNE A;  3NM7 A;  5I97 A;  3CXC 2;  2ZL8 A;  2CFD A;  2FXT A;  3GRD A;  1TU5 A;  5EVH A;  4H61 A;  3UNL A;  1DVD A;  2WOF A;  3FCS B;  3I0Y A;  2K54 A;  2CFL A;  3PS8 A;  1GY5 A;  4HM0 B;  3EN8 A;  2O9U X;  5JBS A;  2Y74 A;  1JKG B;  4J8T A;  3CCQ 3;  2MC8 A;  4JRF A;  3U97 A;  3JUO A;  1RJO A;  1RRH A;  5EEO A;  3X3Z A;  4RZM A;  1ISK A;  1K28 A;  2XSO B;  1VQO 3;  2FGT A;  4EYC A;  4LEH A;  4N6U A;  4ORL A;  2OQE A;  5HGR A;  3CCS 3;  1YI2 3;  2YFI B;  4N6L A;  3NXJ A;  4EXR A;  5D83 A;  1IT8 A;  1F8N A;  3F7S A;  3MG2 A;  4AKY A;  1FA3 A;  1N8R 4;  3GZX B;  4NRE A;  2HMJ B;  1US1 A;  3Q2P A;  1Q40 B;  1U5O A;  1JN5 A;  4HM6 B;  2L4V A;  4I4K A;  3B7C A;  3MKI A;  3JVC A;  5IEP A;  1TFO A;  3M8C A;  2XH9 A;  3EB8 A;  3EBY A;  3SOA A;  4XB5 A;  5IG5 A;  1YJ9 3;  5JPP A;  1WMN A;  1EA2 A;  3AMO A;  2Y73 A;  4XBX A;  1UW1 A;  1WNH A;  1ULI B;  1ASK A;  3STD A;  1ROA A;  1N5P A;  1W01 A;  2P0X A;  3EN1 B;  4K61 A;  1W6Y A;  3H51 A;  3HI7 A;  4PEJ A;  1N8Q A;  4WHA A;  2W6J H;  3LT8 A;  3JUP A;  3JUQ A;  2P05 A;  5CF1 A;  4FR9 A;  2KCD A;  2UX0 A;  3BLZ A;  4K90 B;  1E3R A;  2W0Q A;  2PZV A;  3SXX A;  1UI7 A;  2XF3 A;  2ML5 A;  1STF I;  5JPU A;  1UUV B;  4EBG A;  3G4S 3;  1TUH A;  1JB5 A;  2B24 B;  1W6C A;  3FH1 A;  3HK4 A;  3KE7 A;  4FCM A;  1NWW A;  4MMY B;  2RCD A;  1O7P B;  5AIF A;  3V99 A;  1PU4 A;  2Z76 A;  4RNY A;  4O02 B;  2GEY A;  2E2V A;  4CCV A;  1K41 A;  2WOH A;  5FW5 A;  4HBR A;  4QWT A;  2YFJ B;  2CWU A;  3B8L A;  3PXM A;  3TDG A;  1KD1 4;  4NHF A;  2W9P A;  1M9G A;  1NO3 A;  1OHS A;  3WMD A;  1RN7 A;  5AEU B;  5IG3 A;  1YVB I;  3CU3 A;  2XRX B;  4ZM8 A;  1HKX A;  1QVF 2;  2W56 B;  3SVA A;  1JB2 A;  4JF8 A;  1J2B A;  3WOE B;  3DMC A;  4O2H A;  2GBX B;  3G6E 3;  1SII A;  1OAC A;  2INX A;  1BUQ A;  2RFR A;  1OGZ A;  1DYU A;  3WDG B;  3CC2 3;  1VQL 3;  2GXF A;  4FMB A;  3JUN A;  3ECF A;  3FG4 A;  1RRL A;  3G71 3;  1PFP A;  1GYB A;  3HII A;  4EC6 A;  1K73 4;  3FF0 A;  1JJ2 2;  1A90 A;  3KSE D;  1E3V A;  4XDV A;  3K5T A;  2I9W A;  4N3V A;  3NV0 A;  1YHQ 3;  2XFT A;  3ROB A;  1CYU A;  1QJG A;  3S29 A;  2WGO A;  2W2C A;  1A67 A;  3BND A;  1OH0 A;  1IV7 A;  3QK9 A;  1EG9 B;  1MNL A;  3MG3 A;  2CWV A;  3EBT A;  3MG1 A;  1LXE A;  1N9J A;  1ZO2 A;  1OGX A;  2YX9 A;  2ZDJ A;  1VQ7 3;  3DGL A;  5IG4 A;  1Q81 4;  3U1W A;  2F99 A;  3DM8 A;  1AVK A;  1NDO B;  1ULJ B;  3O8Y A;  2BMQ B;  1O7M B;  3LTD A;  1OHP A;  3D9R A;  5AYR B;  1QAF A;  3MPH A;  2RGQ A;  3OX9 A;  2IUK A;  3OWU A;  1NB3 I;  1AVL A;  2CH9 A;  3DGO A;  3E99 A;  1KC8 4;  3NQY A;  3IMA B;  1W5Z A;  1G96 A;  3PGB A;  3OWS A;  1Q42 A;  2QGU A;  2PNC A;  3LTA A;  1OF5 B;  3PYJ A;  5AIG A;  2XR8 B;  3V92 A;  1CQS A;  3NUV A;  3X40 A;  3CNX A;  4N6M A;  3EJV A;  1QMA A;  1IVV A;  1WMO A;  2Z77 A;  3CNM A;  3KFQ C;  4R80 A;  8CHO A;  1KQS 2;  2BO9 B;  3F8X A;  4N6V 0;  2W04 A;  5DRV A;  3KII A;  3FF2 A;  1KSI A;  3CCL 3;  1W02 A;  1VQM 3;  3KKG A;  4MMZ B;  2E2U A;  2JQ5 A;  2QIY A;  1N9E A;  4K1V A;  1WMP A;  1DMM A;  4WP5 A;  5AEW B;  3DXO A;  1IVW A;  5AI1 A;  3ER7 A;  1R4C A;  4BTW A;  1L5G B;  1VQN 3;  4EV5 A;  2GBW B;  3B4O A;  5ELU A;  1VZZ A;  3X41 A;  4L8P A;  2P09 A;  5FGO A;  5STD A;  4R9K A;  3X3Y A;  5CLK A;  4OK0 A;  1DMQ A;  4WYK B;  2MF7 A;  1QAL A;  4XM4 A;  1STD A;  2OQE C;  1FGQ A;  4FMA A;  2OTL 3;  2RSX A;  1IVU A;  1IDP A;  2Z6B A;  3DUK A;  4HZ9 B;  1SPU A;  4KZ1 A;  3SED A;  4AKZ A;  4STD A;  2WO0 A;  5AIH A;  2BMO B;  3UL5 A;  3SOY A;  3KSP A;  1VQ8 3;  1OCV A;  3GWR A;  1A2V A;  2ML6 A;  4GL6 A;  3V98 A;  1SJW A;  3RDE A;  4WWU C;  4IT7 A;  3NQZ A;  5DRE A;  3OV4 A;  1O7H B;  1GD4 A;  4OUQ A;  1IT7 A;  3AMO B;  1YGE A;  4R1K A;  3EQQ B;  5IEO A;  3FG3 A;  1DMN A;  3I56 3;  1JB4 A;  3EC9 A;  1EKM A;  1UUW B;  3EF8 A;  1YJN 3;  1W7C A;  2F98 A;  3QRD A;  3WA3 A;  2W9Q A;  3T0U A;  3CC4 3;  1K8A 4;  3CCU 3;  5EQL A;  2XFS A;  1Q86 4;  3CME 3;  3NHX A;  3DGN A;  4HVN A;  3CCE 3;  3LH4 A;  3GAX A;  2F86 B;  5AII A;  3EHC A;  3G16 A;  4TX4 A;  1MOL A;  2KRT A;  3RGA A;  3X42 A;  1YIJ 3;  3J7Y d;  4BTX A;  3CPW 2;  2WGQ A;  4LZI A;  2CG0 A;  4KFF A;  5A0O B;  1W2B 2;  5IF6 A;  1Q40 A;  2BMR B;  2V1L A;  1VQ5 3;  1OHO A;  3F8H A;  4LGQ A;  1JNQ A;  3K9M C;  1FGM A;  1VQK 3;  3UL6 A;  4XBY A;  1JKG A;  3NBB A;  1D6Z A;  3S28 A;  3WA2 X;  2D42 A;  4WYK A;  3CCJ 3;  3S27 A;  1SIH A;  4H3U A;  4XBT A;  4L8O A;  1VQ9 3;  1OF5 A;  3WOF B;  4HM5 B;  3LZA A;  4MMX B;  3WOD G;  3NBR A;  5KP3 A;  2LQV A;  3DGM A;  3LTB A;  2BNG A;  1KWI A;  1W2Z A;  3BNC A;  3CC7 3;  2GU1 A;  2HMN B;  3UJM A;  2CWT A;  5IG0 A;  4HM3 B;  2HMM B;  3FKA A;  1C7H A;  2P0M A;  1OPY A;  5IER A;  4KFE A;  1TFK A;  1LOX A;  1VQ6 3;  4LSO A;  1GY7 A;  4N6N B;  2C11 A;  1VQ4 3;  2CKF B;  4L7K A;  1CEW I;  2YFL B;  1NB5 I;  4BTY A;  3K63 A;  2JDI H;  1UI8 A;  4HM2 B;  1U8C B;  3GZR A;  1E97 A;  2D1W A;  4HM1 B;  5G2G A;  1LVN A;  1TIJ A;  2FNQ A;  1W00 A;  6STD A;  2LYX A;  4N6O B;  1ROV A;  3LOY A;  3CCV 3;  3IPT A;  1M1X B;  2STD A;  2CW9 A;  2E2T A;  3HIG A;  4GB5 A;  4HJL B;  2IUJ A;  1S72 3;  5LC6 A;  1D6U A;  2SBL A;  1W6G A;  1FGO A;  1D6Y A;  4LMI A;  3LT9 A;  3BB9 A;  4K1U A;  2K0M A;  2C10 A;  3K0Z A;  3SLU A;  3LYG A;  3NM2 A;  3DZL A;  3NX0 A;  3ALA A;  1AR0 A;  2Q07 A;  3OWY A;  3NBJ A;  4KVH A;  3CD6 3;  1RKY A;  1WQL B;  3D3L A;  5BVB A;  2CK3 H;  1M90 4;  3F14 A;  3FLJ A;  1IK3 A;  3GZB A;  3MWZ A;  1HU9 A;  5D82 A;  4MEI A;  1NU3 A;  1AV4 A;  1GD3 A;  4O8S A;  3CCM 3;  1IQY A;  2CFW A;  1O7G B;  2CFG A;  1YJW 3;  4RBN A;  4N6T A;  2GU3 A;  1V74 A;  1Q82 4;  3X3X A;  2BHM A;  2XSH B;  3B4P A;  2CFK A;  2R4I A;  4IIA A;  5AYS C;  4EV2 A;  3HX8 A;  2B1X B;  1O7W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...