1VQK3

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vqk300
1VQ93 3I553 3CME3 3CC23 3CCL3 1YIT3 1Q7Y4 1K8A4 1VQN3 1S723 3CCV3 1Q824 1VQ83 1YIJ3 1NJI4 1VQ43 1VQ63 3CCU3 3OW22 3CC43 1KD14 3CD63 1M904 3CPW2 1VQL3 3CCQ3 1KC84 1W2B2 1Q864 3I563 1QVF2 3G4S3 3CCS3 1YI23 2QA43 1QVG2 2QEX3 2OTL3 3CMA3 1VQ73 1KQS2 2OTJ3 3G6E3 3CCE3 1Q814 3G713 3CXC2 3CCJ3 1YJN3 1VQP3 1K734 3CC73 3CCM3 1VQM3 1YJ93 1YHQ3 1N8R4 1YJW3 1VQO3 1VQK3 3CCR3 1JJ22 1M1K4 1K9M4 1VQ53
chains in the Genus database with same CATH superfamily
1DMQA 4FMDA 1RGAA 3F7SA 1Q40B 3SLUA 1T3BA 2F56A 2H0IA 3CU3A 5IEOA 5AYSC 3LT9A 4HZBB 2WOFA 1LOVA 1IQYA 1OACA 1ROAA 1W6YA 4J5GA 3FG4A 4DKIA 3CPW2 4H61A 1BSCA 1FUSA 4NREA 1FUWA 1BNSA 4GL6A 3ZG5A 3HIIA 4MMXB 1BRNL 3EE1A 3DGMA 3PCRA 1NU3A 5STDA 1GOUA 1DMMA 3D5IA 2FGTA 4OK0A 3CCJ3 3DXOA 1IDPA 3LTCA 4X2HA 1W7CA 1IV9A 2YFJB 1R4YA 2F5MA 1BOXA 3GAXA 1OHPA 1YJ93 1JRQA 1YJW3 1RNTA 3SOAA 3RGAA 1NO3A 4N6OB 1I3IA 3F9SA 1VQ93 3UL5A 3CCL3 5D83A 1CYUA 1GSPA 1JBRA 1AQZA 3PCSA 1A90A 2Z77A 4FMAA 2CWTA 3CCU3 1ROVA 1IQXA 1UCLA 5CF2A 2K0MA 3CCS3 3HIGA 1JB5A 2RSXA 4HM8B 4CCVA 1UUGB 3DM8A 4RNTA 2C10A 4J5KA 1PYLA 4WFOA 2OTJ3 4K1VA 1Z1SA 3AHWA 3BLZA 9RNTA 1JV2B 3GZXB 2XSHB 5A0OB 3L0RA 3G8ZA 2AAEA 3JVCA 1V58A 2IMJA 5G1LA 1G0TA 1O7WB 3EN1B 1SARA 1LNIA 5AIHA 3EF8A 3DGLA 1LXEA 2YX9A 4N3VA 1BNFA 1NWWA 3PS8A 1B2SA 1U5OA 3EJVA 4BTXA 3NQZA 1RGLA 1ULIB 1JBSA 2W9QA 3V92A 2XRXB 1B2XA 5ELUA 1ULJB 2UX0A 4R9LA 1M9GA 1EG9B 1YNVX 1BSEA 1K734 1AVLA 1W4NA 5IG0A 1STDA 1LOWA 3A5EA 2Z6BA 1WMNA 1OGXA 2CFLA 6STDA 3I0YA 3RNTA 3G0KA 1RTUA 1M1XB 3IJEB 1HZ1A 3NBJA 1BAOA 1BRSA 1FA3A 1PFPA 2L4VA 2XFSA 1GYBA 3K9MC 4OUQA 1VQN3 3SOYA 3B4OA 4LZIA 1F8NA 4LGQA 5G2GA 1EUIC 3GZYB 1MWTA 2CHCA 8CHOA 1LQMB 1IVUA 3X40A 5AEWB 1W01A 1T5YA 2FXTA 3STDA 2IA7A 5ELJA 1BNGA 4R80A 4JF8A 1WQLB 1B20A 3FG1A 3VGNA 3K7CA 3V99A 3DUKA 2JDIH 3CXC2 1YJN3 1N5HA 1TRPA 1GD4A 2CIUA 2XEPA 4GHOA 5IG3A 3AGNA 3F8HA 1N8R4 2SARA 3FSDA 5AEUB 3LZAA 1JJ22 3QK9A 2SBLA 1RGHA 4TX4A 1T2HA 1IVVA 3KFQC 5IERA 1VQQA 1FGQA 3AMOA 1JZOA 7STDA 1WMPA 1R4CA 4XB5A 4MJDA 1TTOA 1GOYA 1US1A 3PXMA 4IPBA 5BU4A 5JPPA 4XDWA 1GD3A 2ML6A 1AVKA 2ZDJA 3WOFB 5JBSA 4WHAA 4HM5B 4STDA 4AKZA 2OOVA 1GY5A 1OH0A 3F8XA 3NBBA 1KQS2 3KSPA 5KP4A 1BRIA 3LTBA 5AYRB 3DY5A 3G16A 3SXXA 2O9UX 2E2VA 4WYKB 4CDLA 1LVNA 4Q53A 2L1SA 3FZWA 6RNTA 2IYJA 4K61A 2CG1A 4J8TA 4I5QA 1UDII 2F98A 2HOHA 2XH9A 1VQ53 3I553 4FMCA 3EQQB 1OHSA 2Y74A 2H0HA 3BNDA 3FLJA 4LSOA 3CME3 1IVWA 1EEJA 1BUJA 2RCDA 1I8VA 3X41A 3Q90A 3UL6A 3SEDA 1RCKA 2FNQA 3D3LA 1BNJA 4N6TA 1NB5I 2F99A 3BU4A 3U97A 2GEYA 3MKIA 2OQEA 1IVXA 4KFEA 1MWSA 2IUKA 4EBGA 1SJWA 4HM4B 4RZMA 4EXRA 2CFWA 1JZDA 3G6E3 3CCE3 1N9JA 7RNTA 1UCKA 1MWRA 1SIHA 2KF6A 4U13A 1UGIA 1L5GB 1RN7A 3CC73 2BU4A 1JBTA 1YGEA 1RGKA 5KP3A 2F5WA 3AMOB 1PY3A 1FGRA 2LYXA 1ZGXA 3S29A 2W0QA 2XFTA 8RNTA 3HX8A 2CFGA 2D42A 2ML5A 1BANA 2YFIB 4H3UA 1JNQA 1ZS7A 3JUMA 3SX1A 4L8PA 4CPKA 3O8YA 4N6UA 4HJLB 1OHOA 3CNMA 4FCMA 4GSPA 4OVMA 4RNZA 3WDGB 1VQ63 3EC9A 3RGRA 2QIYA 4R1KA 1W6CA 2HMMB 4AEQA 1KC84 3NV0A 1YVSA 2BT3A 2HMJB 5BVBA 3B4PA 4ILFA 5CXOA 3X42A 1IT8A 3ROBA 3A76A 1T2IA 3N9HA 3ECFA 3LMLA 1RKYA 3DGNA 2OCTA 3LTDA 1JN5A 1C54A 1STFI 3GRDA 1K28A 3CCM3 2HMOB 2CG0A 3ZFZA 1A2KA 1E3VA 1JB4A 2ZHXB 4BTYA 1VQO3 1TIJA 5EEOA 4R4KA 4MEIA 2KF5A 2JQ5A 1DETA 3EBYA 3LH4A 1LRAA 2INXA 3CC23 4HZ9B 4BL2A 3EB8A 1J2BA 1B2UA 1I70A 3HOHA 5HGRA 3JUQA 1VQ43 1BSDA 3LT8A 4EV5A 1BSAA 5GSPA 3WMDA 3F7XA 1DVCA 1OGZA 4JRFA 5BXQA 2P05A 2WO0A 1V57A 2W9PA 3KZTA 3G4S3 2OTL3 1RN1A 1LOXA 2KCDA 3U1WA 4EYCA 1VQ73 1IV7A 1AV4A 1O7NB 3F40A 1NDOB 3GSPA 4N6NB 2PNCA 1QJGA 3HZPA 2UUGC 1DMNA 3GWRA 3MYTA 1SPUA 1UUWB 2CX0A 3FG3A 5IEPA 2BMRB 1RNBA 1B2MA 5RNTA 1G96A 1HYFA 2B24B 2F4YA 3MPHA 4HM0B 1M1K4 3AGOA 1RHLA 3AHSA 1DYUA 3GZBA 3MG3A 1Q9EA 4LYLB 1Q7Y4 2Z76A 1MOLA 2P0MA 3D5GA 3FCSB 4L8OA 4NHFA 1PU4A 3CCV3 3KSED 2P09A 3MSOA 4N6LA 1NJI4 2PZVA 3Q2PA 1UW1A 5CF1A 1W2B2 2BNGA 3DGYA 5D81A 4MMYB 1GY6A 1O7HB 1QAFA 1V74A 3KE7A 3WA2X 4N6V0 3WODG 1ASKA 3H3HA 4N6MA 2CC3A 3SVAA 1UI7A 1UGHI 2GBXB 3QRDA 4R9KA 4O02B 3NX0A 3VF1A 4G1MB 1OF5A 1CYVA 4KT3B 4BU4A 1TFKA 1VQM3 5IW9A 3K0ZA 1BNEA 2K3DA 4XBYA 1WNHA 3EX9A 3WR2A 1VZZA 7GSPA 2IUJA 2CWUA 1FGMA 1BNRA 3OV4A 3T8NA 2GXFA 2W56A 4XDVA 5M19A 3B7CA 1Q824 1WTHA 1Q40A 3IPTA 3OXAA 4HM2B 4ORLA 1FW7A 2C4BA 5EQLA 3NQYA 1OUNA 1YVBI 3MWZA 1KD14 4RBNA 5TGNA 5DRVA 2CX1A 3LTAA 1GY7A 1KWIA 1N5PA 2R41A 1W5ZA 1ZX2A 2QEX3 4HOHA 1SIIA 3LXUX 4BTWA 3X3YA 3J7Yd 1FYSA 4AKYA 1N9EA 4O2HA 3Q1CA 1TUHA 2R4IA 1RLSA 3FKAA 3PYJA 3M8CA 1B21A 2KAAA 3S67A 2GU3A 4KFFA 6GSPA 1EQKA 1HKXA 2Q07A 4IT7A 3KN4A 3VSYA 2XGNA 1RGFA 1FGOA 2I9WA 3KKGA 2A15A 1E97A 1GMRA 4O8SA 4HM7B 1YIT3 1CH0A 4QWTA 1TP6A 3MHEA 2WOHA 3OWYA 4PEJA 1I0VA 1ISKA 4HM1B 2BIRA 5LC7A 2CWVA 2WGQA 1CQSA 2XR8B 3FF2A 5AIGA 1I0XA 1HU9A 2Y73A 5AIFA 1IYYA 1WMOA 1GMPA 1DE3A 1E3RA 2RNTA 5CK6A 2E2UA 2W2CA 1OF5B 3BNCA 3ER7A 3LYGA 1W2ZA 2GEXA 2LQVA 5AI1A 4CJNA 1GMQA 1MGWA 4O3VA 1I2EA 4MMZB 3WHOA 1RCLA 3HK4A 2CH9A 1RGGA 4WP5A 2MF7A 3EHCA 5M18A 2W56B 1X1YA 2W03A 1KSIA 1JB2A 1A2PA 1TJDA 3BNBA 5IG4A 4ZM8A 5KP1A 1NNVA 1D6ZA 3LOYA 3X3ZA 2B1XB 1BIRA 2CW9A 2GU1A 4HYZA 3NBRA 4EV2A 3NUVA 4LEHA 5HOHA 4BL3A 5G1KA 1RDSA 3CD63 1RJOA 1YGWA 4L7KA 2MC8A 1IK3A 3DMCA 3HI7A 1B3SA 4KFDA 3FH1A 5CLKA 2WGOA 1C7HA 1MWUA 1QALA 4FR9A 1GS3A 1Q814 3D9RA 4XBXA 3G713 1Y4KA 2KXGA 3S5CA 1QMAA 3TDGA 1MGRA 3OWSA 3X3XA 1TRQA 2C11A 2KF3A 5FW5A 3NM7A 3CCR3 1SQWA 1TU5A 2RGQA 3UJMA 2HMKB 4I4KA 1K41A 1Q7HA 3GZRA 3ALAA 1BRKA 4HBRA 1B27A 3PGBA 1LOYA 3OW22 1N8QA 4NPBA 5DREA 3H51A 4LMIA 1D6YA 3URPA 1I2GA 1W00A 3DH2A 2QA43 2O3OA 3T8UA 1NB3I 3DGOA 2KF4A 2ZL8A 3UNLA 1JKGA 1BRHA 3SYUA 2HMLB 2CFKA 3BNEA 3Q3FA 1YHQ3 3RDEA 1DVDA 1LNHA 1FUTA 3ZG0A 1UCIA 3EN8A 3NHXA 3F14A 4WWUC 1K8A4 1IU7A 3N54B 2BMOB 2YFLB 3BIRA 1BGSA 4K1UA 1YIJ3 3K63A 4XBTA 3NM2A 4FMBA 3CC43 1M904 3NV0B 1VQL3 1Q864 2RBIA 1TFOA 5JPUA 1QVF2 3S27A 4EC6A 1YI23 1QAKA 1FGTA 2UGIA 3JUOA 1UI8A 1JN5B 3N8BA 3UB1A 1X1UA 3IMAB 5IF6A 3OWUA 2BMQB 4BIRA 4GB5A 4WYKA 1UUVB 3CNXA 1BRGA 2XGLA 3NXJA 2GBWB 2H0GA 2AADA 3JUPA 1I3FA 1OPYA 3OX9A 1W6GA 4X2OA 4FCZA 2F86B 1EA2A 2M7OA 1BUQA 4HVNA 4KZ1A 1O7GB 1AR0A 4XM4A 1FZUA 3CPOA 1BVIA 1X1WA 3KCHA 3CCQ3 1EKMA 3DZLA 1BU4A 3D79A 3KIIA 2P38A 1IQ8A 3T0UA 1ZO2A 2V1LA 1JKGB 3CMA3 2XSOB 2ZA4A 3S28A 1BSBA 2RFRA 1LQGC 4J9AA 1A67A 1G02A 2W6JH 1VQP3 2J8XB 2CK3H 4HM3B 2HMNB 1W02A 2OOVC 3FGYA 1RGCA 1B2ZA 5LC6A 3PZWA 4IIAA 2P0XA 1IT7A 1UCJA 1X1XA 3WOEB 4HM6B 1BNIA 1Q42A 3E99A 1RSNA 2CFDA 1U8CB 1S723 1O7PB 3MG2A 1CEWI 2BHMA 2D1WA 3JUNA 1MNLA 4RNYA 4FCJA 1AY7A 1S5AA 3EBTA 2IY2A 2BO9B 2E2TA 5FGOA 4HKVB 5IG5A 3D4AA 5BIRA 1D6UA 3I563 2STDA 1RGEA 2QGUA 1QVG2 1I2FA 4K90B 1RRLA 1RN4A 2XF3A 1BRJA 3BB9A 2KRTA 3V98A 5I97A 3WA3A 3FF0A 1OCVA 2GSPA 3K5TA 4HAAA 1O7MB 2OWPA 5AIIA 2W04A 2OQEC 1RMSA 2K54A 2Z7AA 5M1AA 4EW5A 4KVHA 1A2VA 3B8LA 5EVHA 2CKFB 1VQK3 5IENA 1GOVA 1VQ83 1RRHA 3MG1A 1K9M4 5D82A
chains in the Genus database with same CATH topology
1DMQA 4FMDA 3F7SA 1Q40B 3SLUA 3CU3A 5IEOA 5AYSC 3LT9A 4HZBB 2WOFA 1IQYA 1OACA 1ROAA 1W6YA 3FG4A 3CPW2 4H61A 4NREA 1FUWA 4GL6A 3HIIA 4MMXB 3EE1A 3DGMA 3PCRA 1NU3A 5STDA 4OK0A 1DMMA 2FGTA 3CCJ3 3DXOA 1IDPA 3LTCA 4X2HA 1W7CA 1IV9A 2YFJB 3GAXA 1YJ93 1OHPA 1YJW3 1JRQA 3SOAA 3RGAA 1NO3A 4N6OB 3F9SA 1VQ93 3UL5A 3CCL3 5D83A 1CYUA 3PCSA 1A90A 2Z77A 4FMAA 2CWTA 3CCU3 1ROVA 1IQXA 5CF2A 2K0MA 3CCS3 3HIGA 1JB5A 2RSXA 4HM8B 4CCVA 3DM8A 2C10A 4WFOA 2OTJ3 4K1VA 1Z1SA 3BLZA 1JV2B 3GZXB 2XSHB 5A0OB 3L0RA 3G8ZA 3JVCA 2IMJA 1O7WB 3EN1B 5AIHA 3EF8A 3DGLA 1LXEA 2YX9A 4N3VA 3PS8A 1NWWA 1U5OA 3EJVA 4BTXA 3NQZA 1ULIB 2W9QA 3V92A 2XRXB 5ELUA 1ULJB 2UX0A 4R9LA 1M9GA 1EG9B 1K734 1AVLA 1W4NA 5IG0A 1STDA 2Z6BA 1WMNA 1OGXA 2CFLA 6STDA 3I0YA 3G0KA 1M1XB 3IJEB 3NBJA 1FA3A 1PFPA 2L4VA 2XFSA 1GYBA 3K9MC 4OUQA 1VQN3 3SOYA 3B4OA 4LZIA 1F8NA 4LGQA 5G2GA 3GZYB 2CHCA 8CHOA 1IVUA 3X40A 5AEWB 1W01A 1T5YA 2FXTA 3STDA 2IA7A 5ELJA 4R80A 4JF8A 1WQLB 3FG1A 3VGNA 3K7CA 3V99A 3DUKA 2JDIH 3CXC2 1YJN3 1N5HA 1GD4A 2CIUA 2XEPA 5IG3A 3F8HA 1N8R4 3FSDA 5AEUB 3LZAA 1JJ22 3QK9A 2SBLA 4TX4A 5IERA 3KFQC 1IVVA 1FGQA 3AMOA 7STDA 1WMPA 1R4CA 4XB5A 4MJDA 4IPBA 3PXMA 1US1A 5JPPA 4XDWA 1GD3A 2ML6A 1AVKA 2ZDJA 3WOFB 5JBSA 4WHAA 4HM5B 4STDA 4AKZA 2OOVA 1GY5A 1OH0A 3F8XA 3NBBA 1KQS2 3KSPA 5KP4A 3LTBA 5AYRB 3DY5A 3G16A 3SXXA 2O9UX 2E2VA 4WYKB 4CDLA 1LVNA 4Q53A 3FZWA 4K61A 2CG1A 4J8TA 2F98A 2XH9A 1VQ53 3I553 4FMCA 3EQQB 1OHSA 2Y74A 3FLJA 3BNDA 4LSOA 3CME3 1IVWA 2RCDA 3X41A 3Q90A 3UL6A 3SEDA 2FNQA 3D3LA 4N6TA 1NB5I 2F99A 3U97A 2GEYA 3MKIA 2OQEA 1IVXA 4KFEA 2IUKA 4EBGA 1SJWA 4HM4B 4RZMA 4EXRA 2CFWA 3G6E3 3CCE3 1N9JA 1L5GB 4U13A 1SIHA 1RN7A 3CC73 1YGEA 5KP3A 3AMOB 1FGRA 2LYXA 3S29A 2W0QA 2XFTA 3HX8A 2CFGA 2D42A 2ML5A 2YFIB 4H3UA 1JNQA 3JUMA 3SX1A 4L8PA 3O8YA 4N6UA 4HJLB 1OHOA 3CNMA 4FCMA 4OVMA 4RNZA 1VQ63 3WDGB 3EC9A 3RGRA 2QIYA 4R1KA 1W6CA 2HMMB 4AEQA 1KC84 3NV0A 2BT3A 2HMJB 5BVBA 3B4PA 5CXOA 3X42A 1IT8A 3ROBA 3A76A 3N9HA 3ECFA 3LMLA 1RKYA 3DGNA 2OCTA 3LTDA 1JN5A 1STFI 3GRDA 1K28A 3CCM3 2HMOB 2CG0A 1A2KA 1E3VA 1JB4A 4BTYA 1VQO3 1TIJA 5EEOA 4R4KA 4MEIA 2JQ5A 3EBYA 3LH4A 2INXA 3CC23 4HZ9B 3EB8A 1J2BA 5HGRA 3JUQA 1VQ43 3LT8A 4EV5A 3WMDA 3F7XA 1DVCA 1OGZA 4JRFA 5BXQA 2P05A 2WO0A 2W9PA 3KZTA 3G4S3 2OTL3 3U1WA 1LOXA 2KCDA 4EYCA 1VQ73 1IV7A 1AV4A 1O7NB 3F40A 1NDOB 4N6NB 2PNCA 1QJGA 3HZPA 1DMNA 3GWRA 3MYTA 1SPUA 1UUWB 3FG3A 5IEPA 2BMRB 1G96A 3MPHA 2B24B 4HM0B 1M1K4 1DYUA 3GZBA 3MG3A 1Q7Y4 2Z76A 1MOLA 2P0MA 3FCSB 4L8OA 1PU4A 4NHFA 3CCV3 3KSED 2P09A 3MSOA 4N6LA 1NJI4 2PZVA 3Q2PA 1UW1A 5CF1A 1W2B2 2BNGA 5D81A 4MMYB 1GY6A 1O7HB 1QAFA 1V74A 3KE7A 3WA2X 4N6V0 3WODG 1ASKA 3H3HA 4N6MA 2CC3A 3SVAA 1UI7A 3QRDA 2GBXB 4R9KA 4O02B 3NX0A 3VF1A 4G1MB 1OF5A 1CYVA 1VQM3 1TFKA 5IW9A 3K0ZA 4XBYA 1WNHA 3EX9A 1VZZA 2IUJA 2CWUA 1FGMA 3OV4A 3T8NA 2GXFA 2W56A 4XDVA 3B7CA 1Q824 1WTHA 1Q40A 3IPTA 3OXAA 4HM2B 4ORLA 5EQLA 3NQYA 1OUNA 1YVBI 3MWZA 1KD14 4RBNA 5TGNA 5DRVA 3LTAA 1GY7A 1KWIA 1N5PA 2QEX3 1W5ZA 1ZX2A 1SIIA 3LXUX 4BTWA 3X3YA 3J7Yd 4AKYA 1N9EA 4O2HA 3Q1CA 1TUHA 2R4IA 3FKAA 3PYJA 3M8CA 1EQKA 3S67A 2GU3A 4KFFA 1HKXA 2Q07A 4IT7A 3KN4A 3VSYA 2XGNA 1FGOA 2I9WA 3KKGA 2A15A 1E97A 4O8SA 1YIT3 4HM7B 4QWTA 1TP6A 3MHEA 2WOHA 3OWYA 4PEJA 1ISKA 4HM1B 5LC7A 2CWVA 2WGQA 1CQSA 2XR8B 3FF2A 5AIGA 1HU9A 2Y73A 5AIFA 1WMOA 1E3RA 5CK6A 2E2UA 2W2CA 1OF5B 3BNCA 3ER7A 3LYGA 1W2ZA 2GEXA 2LQVA 5AI1A 4O3VA 4MMZB 3HK4A 2CH9A 4WP5A 2MF7A 3EHCA 2W56B 2W03A 1KSIA 1JB2A 3BNBA 5IG4A 4ZM8A 5KP1A 3LOYA 1D6ZA 3X3ZA 2B1XB 2CW9A 2GU1A 4HYZA 3NBRA 4EV2A 3NUVA 4LEHA 3CD63 1RJOA 4L7KA 2MC8A 1IK3A 3DMCA 3HI7A 4KFDA 3FH1A 5CLKA 2WGOA 1C7HA 1QALA 4FR9A 1GS3A 1Q814 3D9RA 4XBXA 3G713 1Y4KA 2KXGA 3S5CA 1QMAA 3TDGA 3OWSA 3X3XA 2C11A 5FW5A 3NM7A 3CCR3 1SQWA 1TU5A 2RGQA 3UJMA 2HMKB 4I4KA 1K41A 3GZRA 3ALAA 4HBRA 3PGBA 3OW22 1N8QA 5DREA 3H51A 4LMIA 1D6YA 2QA43 1W00A 2O3OA 3T8UA 1NB3I 3DGOA 2ZL8A 3UNLA 1JKGA 2HMLB 2CFKA 3BNEA 1YHQ3 3RDEA 1DVDA 1LNHA 3EN8A 3NHXA 3F14A 4WWUC 1K8A4 1IU7A 3N54B 2BMOB 2YFLB 4K1UA 1YIJ3 3K63A 4XBTA 3NM2A 4FMBA 3CC43 1M904 3NV0B 1VQL3 1Q864 1TFOA 5JPUA 1QVF2 3S27A 4EC6A 1YI23 1QAKA 1FGTA 3JUOA 1UI8A 1JN5B 3N8BA 3UB1A 5IF6A 3IMAB 3OWUA 2BMQB 4GB5A 4WYKA 1UUVB 3CNXA 2XGLA 3NXJA 2GBWB 3JUPA 1OPYA 3OX9A 1W6GA 4X2OA 4FCZA 2F86B 1EA2A 2M7OA 1BUQA 4HVNA 4KZ1A 1O7GB 1AR0A 4XM4A 3CPOA 3CCQ3 1EKMA 3DZLA 3T0UA 3KIIA 2P38A 1IQ8A 1ZO2A 2V1LA 1JKGB 3CMA3 2XSOB 3S28A 2RFRA 1A67A 4J9AA 2W6JH 1VQP3 2CK3H 4HM3B 2HMNB 1W02A 2OOVC 3FGYA 5LC6A 3PZWA 4IIAA 2P0XA 1IT7A 3WOEB 4HM6B 1Q42A 3E99A 2CFDA 1U8CB 1S723 1O7PB 3MG2A 1CEWI 2BHMA 2D1WA 3JUNA 1MNLA 4RNYA 4FCJA 1S5AA 3EBTA 2BO9B 2E2TA 5FGOA 4HKVB 5IG5A 1D6UA 3I563 2STDA 1QVG2 2QGUA 4K90B 1RRLA 2XF3A 3BB9A 3V98A 2KRTA 5I97A 3WA3A 3FF0A 1OCVA 3K5TA 5AIIA 1O7MB 2OWPA 2W04A 2OQEC 2Z7AA 2K54A 4KVHA 1A2VA 3B8LA 5EVHA 2CKFB 1VQK3 5IENA 1VQ83 1RRHA 3MG1A 1K9M4 5D82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 3;  3I55 3;  3CME 3;  3CC2 3;  3CCL 3;  1YIT 3;  1Q7Y 4;  1K8A 4;  1VQN 3;  1S72 3;  3CCV 3;  1Q82 4;  1VQ8 3;  1YIJ 3;  1NJI 4;  1VQ4 3;  1VQ6 3;  3CCU 3;  3OW2 2;  3CC4 3;  1KD1 4;  3CD6 3;  1M90 4;  3CPW 2;  1VQL 3;  3CCQ 3;  1KC8 4;  1W2B 2;  1Q86 4;  3I56 3;  1QVF 2;  3G4S 3;  3CCS 3;  1YI2 3;  2QA4 3;  1QVG 2;  2QEX 3;  2OTL 3;  3CMA 3;  1VQ7 3;  1KQS 2;  2OTJ 3;  3G6E 3;  3CCE 3;  1Q81 4;  3G71 3;  3CXC 2;  3CCJ 3;  1YJN 3;  1VQP 3;  1K73 4;  3CC7 3;  3CCM 3;  1VQM 3;  1YJ9 3;  1YHQ 3;  1N8R 4;  1YJW 3;  1VQO 3;  1VQK 3;  3CCR 3;  1JJ2 2;  1M1K 4;  1K9M 4;  1VQ5 3; 
#chains in the Genus database with same CATH topology
 1DMQ A;  4FMD A;  1RGA A;  3F7S A;  1Q40 B;  3SLU A;  1T3B A;  2F56 A;  2H0I A;  3CU3 A;  5IEO A;  5AYS C;  3LT9 A;  4HZB B;  2WOF A;  1LOV A;  1IQY A;  1OAC A;  1ROA A;  1W6Y A;  4J5G A;  3FG4 A;  4DKI A;  3CPW 2;  4H61 A;  1BSC A;  1FUS A;  4NRE A;  1FUW A;  1BNS A;  4GL6 A;  3ZG5 A;  3HII A;  4MMX B;  1BRN L;  3EE1 A;  3DGM A;  3PCR A;  1NU3 A;  5STD A;  1GOU A;  1DMM A;  3D5I A;  2FGT A;  4OK0 A;  3CCJ 3;  3DXO A;  1IDP A;  3LTC A;  4X2H A;  1W7C A;  1IV9 A;  2YFJ B;  1R4Y A;  2F5M A;  1BOX A;  3GAX A;  1OHP A;  1YJ9 3;  1JRQ A;  1YJW 3;  1RNT A;  3SOA A;  3RGA A;  1NO3 A;  4N6O B;  1I3I A;  3F9S A;  1VQ9 3;  3UL5 A;  3CCL 3;  5D83 A;  1CYU A;  1GSP A;  1JBR A;  1AQZ A;  3PCS A;  1A90 A;  2Z77 A;  4FMA A;  2CWT A;  3CCU 3;  1ROV A;  1IQX A;  1UCL A;  5CF2 A;  2K0M A;  3CCS 3;  3HIG A;  1JB5 A;  2RSX A;  4HM8 B;  4CCV A;  1UUG B;  3DM8 A;  4RNT A;  2C10 A;  4J5K A;  1PYL A;  4WFO A;  2OTJ 3;  4K1V A;  1Z1S A;  3AHW A;  3BLZ A;  9RNT A;  1JV2 B;  3GZX B;  2XSH B;  5A0O B;  3L0R A;  3G8Z A;  2AAE A;  3JVC A;  1V58 A;  2IMJ A;  5G1L A;  1G0T A;  1O7W B;  3EN1 B;  1SAR A;  1LNI A;  5AIH A;  3EF8 A;  3DGL A;  1LXE A;  2YX9 A;  4N3V A;  1BNF A;  1NWW A;  3PS8 A;  1B2S A;  1U5O A;  3EJV A;  4BTX A;  3NQZ A;  1RGL A;  1ULI B;  1JBS A;  2W9Q A;  3V92 A;  2XRX B;  1B2X A;  5ELU A;  1ULJ B;  2UX0 A;  4R9L A;  1M9G A;  1EG9 B;  1YNV X;  1BSE A;  1K73 4;  1AVL A;  1W4N A;  5IG0 A;  1STD A;  1LOW A;  3A5E A;  2Z6B A;  1WMN A;  1OGX A;  2CFL A;  6STD A;  3I0Y A;  3RNT A;  3G0K A;  1RTU A;  1M1X B;  3IJE B;  1HZ1 A;  3NBJ A;  1BAO A;  1BRS A;  1FA3 A;  1PFP A;  2L4V A;  2XFS A;  1GYB A;  3K9M C;  4OUQ A;  1VQN 3;  3SOY A;  3B4O A;  4LZI A;  1F8N A;  4LGQ A;  5G2G A;  1EUI C;  3GZY B;  1MWT A;  2CHC A;  8CHO A;  1LQM B;  1IVU A;  3X40 A;  5AEW B;  1W01 A;  1T5Y A;  2FXT A;  3STD A;  2IA7 A;  5ELJ A;  1BNG A;  4R80 A;  4JF8 A;  1WQL B;  1B20 A;  3FG1 A;  3VGN A;  3K7C A;  3V99 A;  3DUK A;  2JDI H;  3CXC 2;  1YJN 3;  1N5H A;  1TRP A;  1GD4 A;  2CIU A;  2XEP A;  4GHO A;  5IG3 A;  3AGN A;  3F8H A;  1N8R 4;  2SAR A;  3FSD A;  5AEU B;  3LZA A;  1JJ2 2;  3QK9 A;  2SBL A;  1RGH A;  4TX4 A;  1T2H A;  1IVV A;  3KFQ C;  5IER A;  1VQQ A;  1FGQ A;  3AMO A;  1JZO A;  7STD A;  1WMP A;  1R4C A;  4XB5 A;  4MJD A;  1TTO A;  1GOY A;  1US1 A;  3PXM A;  4IPB A;  5BU4 A;  5JPP A;  4XDW A;  1GD3 A;  2ML6 A;  1AVK A;  2ZDJ A;  3WOF B;  5JBS A;  4WHA A;  4HM5 B;  4STD A;  4AKZ A;  2OOV A;  1GY5 A;  1OH0 A;  3F8X A;  3NBB A;  1KQS 2;  3KSP A;  5KP4 A;  1BRI A;  3LTB A;  5AYR B;  3DY5 A;  3G16 A;  3SXX A;  2O9U X;  2E2V A;  4WYK B;  4CDL A;  1LVN A;  4Q53 A;  2L1S A;  3FZW A;  6RNT A;  2IYJ A;  4K61 A;  2CG1 A;  4J8T A;  4I5Q A;  1UDI I;  2F98 A;  2HOH A;  2XH9 A;  1VQ5 3;  3I55 3;  4FMC A;  3EQQ B;  1OHS A;  2Y74 A;  2H0H A;  3BND A;  3FLJ A;  4LSO A;  3CME 3;  1IVW A;  1EEJ A;  1BUJ A;  2RCD A;  1I8V A;  3X41 A;  3Q90 A;  3UL6 A;  3SED A;  1RCK A;  2FNQ A;  3D3L A;  1BNJ A;  4N6T A;  1NB5 I;  2F99 A;  3BU4 A;  3U97 A;  2GEY A;  3MKI A;  2OQE A;  1IVX A;  4KFE A;  1MWS A;  2IUK A;  4EBG A;  1SJW A;  4HM4 B;  4RZM A;  4EXR A;  2CFW A;  1JZD A;  3G6E 3;  3CCE 3;  1N9J A;  7RNT A;  1UCK A;  1MWR A;  1SIH A;  2KF6 A;  4U13 A;  1UGI A;  1L5G B;  1RN7 A;  3CC7 3;  2BU4 A;  1JBT A;  1YGE A;  1RGK A;  5KP3 A;  2F5W A;  3AMO B;  1PY3 A;  1FGR A;  2LYX A;  1ZGX A;  3S29 A;  2W0Q A;  2XFT A;  8RNT A;  3HX8 A;  2CFG A;  2D42 A;  2ML5 A;  1BAN A;  2YFI B;  4H3U A;  1JNQ A;  1ZS7 A;  3JUM A;  3SX1 A;  4L8P A;  4CPK A;  3O8Y A;  4N6U A;  4HJL B;  1OHO A;  3CNM A;  4FCM A;  4GSP A;  4OVM A;  4RNZ A;  3WDG B;  1VQ6 3;  3EC9 A;  3RGR A;  2QIY A;  4R1K A;  1W6C A;  2HMM B;  4AEQ A;  1KC8 4;  3NV0 A;  1YVS A;  2BT3 A;  2HMJ B;  5BVB A;  3B4P A;  4ILF A;  5CXO A;  3X42 A;  1IT8 A;  3ROB A;  3A76 A;  1T2I A;  3N9H A;  3ECF A;  3LML A;  1RKY A;  3DGN A;  2OCT A;  3LTD A;  1JN5 A;  1C54 A;  1STF I;  3GRD A;  1K28 A;  3CCM 3;  2HMO B;  2CG0 A;  3ZFZ A;  1A2K A;  1E3V A;  1JB4 A;  2ZHX B;  4BTY A;  1VQO 3;  1TIJ A;  5EEO A;  4R4K A;  4MEI A;  2KF5 A;  2JQ5 A;  1DET A;  3EBY A;  3LH4 A;  1LRA A;  2INX A;  3CC2 3;  4HZ9 B;  4BL2 A;  3EB8 A;  1J2B A;  1B2U A;  1I70 A;  3HOH A;  5HGR A;  3JUQ A;  1VQ4 3;  1BSD A;  3LT8 A;  4EV5 A;  1BSA A;  5GSP A;  3WMD A;  3F7X A;  1DVC A;  1OGZ A;  4JRF A;  5BXQ A;  2P05 A;  2WO0 A;  1V57 A;  2W9P A;  3KZT A;  3G4S 3;  2OTL 3;  1RN1 A;  1LOX A;  2KCD A;  3U1W A;  4EYC A;  1VQ7 3;  1IV7 A;  1AV4 A;  1O7N B;  3F40 A;  1NDO B;  3GSP A;  4N6N B;  2PNC A;  1QJG A;  3HZP A;  2UUG C;  1DMN A;  3GWR A;  3MYT A;  1SPU A;  1UUW B;  2CX0 A;  3FG3 A;  5IEP A;  2BMR B;  1RNB A;  1B2M A;  5RNT A;  1G96 A;  1HYF A;  2B24 B;  2F4Y A;  3MPH A;  4HM0 B;  1M1K 4;  3AGO A;  1RHL A;  3AHS A;  1DYU A;  3GZB A;  3MG3 A;  1Q9E A;  4LYL B;  1Q7Y 4;  2Z76 A;  1MOL A;  2P0M A;  3D5G A;  3FCS B;  4L8O A;  4NHF A;  1PU4 A;  3CCV 3;  3KSE D;  2P09 A;  3MSO A;  4N6L A;  1NJI 4;  2PZV A;  3Q2P A;  1UW1 A;  5CF1 A;  1W2B 2;  2BNG A;  3DGY A;  5D81 A;  4MMY B;  1GY6 A;  1O7H B;  1QAF A;  1V74 A;  3KE7 A;  3WA2 X;  4N6V 0;  3WOD G;  1ASK A;  3H3H A;  4N6M A;  2CC3 A;  3SVA A;  1UI7 A;  1UGH I;  2GBX B;  3QRD A;  4R9K A;  4O02 B;  3NX0 A;  3VF1 A;  4G1M B;  1OF5 A;  1CYV A;  4KT3 B;  4BU4 A;  1TFK A;  1VQM 3;  5IW9 A;  3K0Z A;  1BNE A;  2K3D A;  4XBY A;  1WNH A;  3EX9 A;  3WR2 A;  1VZZ A;  7GSP A;  2IUJ A;  2CWU A;  1FGM A;  1BNR A;  3OV4 A;  3T8N A;  2GXF A;  2W56 A;  4XDV A;  5M19 A;  3B7C A;  1Q82 4;  1WTH A;  1Q40 A;  3IPT A;  3OXA A;  4HM2 B;  4ORL A;  1FW7 A;  2C4B A;  5EQL A;  3NQY A;  1OUN A;  1YVB I;  3MWZ A;  1KD1 4;  4RBN A;  5TGN A;  5DRV A;  2CX1 A;  3LTA A;  1GY7 A;  1KWI A;  1N5P A;  2R41 A;  1W5Z A;  1ZX2 A;  2QEX 3;  4HOH A;  1SII A;  3LXU X;  4BTW A;  3X3Y A;  3J7Y d;  1FYS A;  4AKY A;  1N9E A;  4O2H A;  3Q1C A;  1TUH A;  2R4I A;  1RLS A;  3FKA A;  3PYJ A;  3M8C A;  1B21 A;  2KAA A;  3S67 A;  2GU3 A;  4KFF A;  6GSP A;  1EQK A;  1HKX A;  2Q07 A;  4IT7 A;  3KN4 A;  3VSY A;  2XGN A;  1RGF A;  1FGO A;  2I9W A;  3KKG A;  2A15 A;  1E97 A;  1GMR A;  4O8S A;  4HM7 B;  1YIT 3;  1CH0 A;  4QWT A;  1TP6 A;  3MHE A;  2WOH A;  3OWY A;  4PEJ A;  1I0V A;  1ISK A;  4HM1 B;  2BIR A;  5LC7 A;  2CWV A;  2WGQ A;  1CQS A;  2XR8 B;  3FF2 A;  5AIG A;  1I0X A;  1HU9 A;  2Y73 A;  5AIF A;  1IYY A;  1WMO A;  1GMP A;  1DE3 A;  1E3R A;  2RNT A;  5CK6 A;  2E2U A;  2W2C A;  1OF5 B;  3BNC A;  3ER7 A;  3LYG A;  1W2Z A;  2GEX A;  2LQV A;  5AI1 A;  4CJN A;  1GMQ A;  1MGW A;  4O3V A;  1I2E A;  4MMZ B;  3WHO A;  1RCL A;  3HK4 A;  2CH9 A;  1RGG A;  4WP5 A;  2MF7 A;  3EHC A;  5M18 A;  2W56 B;  1X1Y A;  2W03 A;  1KSI A;  1JB2 A;  1A2P A;  1TJD A;  3BNB A;  5IG4 A;  4ZM8 A;  5KP1 A;  1NNV A;  1D6Z A;  3LOY A;  3X3Z A;  2B1X B;  1BIR A;  2CW9 A;  2GU1 A;  4HYZ A;  3NBR A;  4EV2 A;  3NUV A;  4LEH A;  5HOH A;  4BL3 A;  5G1K A;  1RDS A;  3CD6 3;  1RJO A;  1YGW A;  4L7K A;  2MC8 A;  1IK3 A;  3DMC A;  3HI7 A;  1B3S A;  4KFD A;  3FH1 A;  5CLK A;  2WGO A;  1C7H A;  1MWU A;  1QAL A;  4FR9 A;  1GS3 A;  1Q81 4;  3D9R A;  4XBX A;  3G71 3;  1Y4K A;  2KXG A;  3S5C A;  1QMA A;  3TDG A;  1MGR A;  3OWS A;  3X3X A;  1TRQ A;  2C11 A;  2KF3 A;  5FW5 A;  3NM7 A;  3CCR 3;  1SQW A;  1TU5 A;  2RGQ A;  3UJM A;  2HMK B;  4I4K A;  1K41 A;  1Q7H A;  3GZR A;  3ALA A;  1BRK A;  4HBR A;  1B27 A;  3PGB A;  1LOY A;  3OW2 2;  1N8Q A;  4NPB A;  5DRE A;  3H51 A;  4LMI A;  1D6Y A;  3URP A;  1I2G A;  1W00 A;  3DH2 A;  2QA4 3;  2O3O A;  3T8U A;  1NB3 I;  3DGO A;  2KF4 A;  2ZL8 A;  3UNL A;  1JKG A;  1BRH A;  3SYU A;  2HML B;  2CFK A;  3BNE A;  3Q3F A;  1YHQ 3;  3RDE A;  1DVD A;  1LNH A;  1FUT A;  3ZG0 A;  1UCI A;  3EN8 A;  3NHX A;  3F14 A;  4WWU C;  1K8A 4;  1IU7 A;  3N54 B;  2BMO B;  2YFL B;  3BIR A;  1BGS A;  4K1U A;  1YIJ 3;  3K63 A;  4XBT A;  3NM2 A;  4FMB A;  3CC4 3;  1M90 4;  3NV0 B;  1VQL 3;  1Q86 4;  2RBI A;  1TFO A;  5JPU A;  1QVF 2;  3S27 A;  4EC6 A;  1YI2 3;  1QAK A;  1FGT A;  2UGI A;  3JUO A;  1UI8 A;  1JN5 B;  3N8B A;  3UB1 A;  1X1U A;  3IMA B;  5IF6 A;  3OWU A;  2BMQ B;  4BIR A;  4GB5 A;  4WYK A;  1UUV B;  3CNX A;  1BRG A;  2XGL A;  3NXJ A;  2GBW B;  2H0G A;  2AAD A;  3JUP A;  1I3F A;  1OPY A;  3OX9 A;  1W6G A;  4X2O A;  4FCZ A;  2F86 B;  1EA2 A;  2M7O A;  1BUQ A;  4HVN A;  4KZ1 A;  1O7G B;  1AR0 A;  4XM4 A;  1FZU A;  3CPO A;  1BVI A;  1X1W A;  3KCH A;  3CCQ 3;  1EKM A;  3DZL A;  1BU4 A;  3D79 A;  3KII A;  2P38 A;  1IQ8 A;  3T0U A;  1ZO2 A;  2V1L A;  1JKG B;  3CMA 3;  2XSO B;  2ZA4 A;  3S28 A;  1BSB A;  2RFR A;  1LQG C;  4J9A A;  1A67 A;  1G02 A;  2W6J H;  1VQP 3;  2J8X B;  2CK3 H;  4HM3 B;  2HMN B;  1W02 A;  2OOV C;  3FGY A;  1RGC A;  1B2Z A;  5LC6 A;  3PZW A;  4IIA A;  2P0X A;  1IT7 A;  1UCJ A;  1X1X A;  3WOE B;  4HM6 B;  1BNI A;  1Q42 A;  3E99 A;  1RSN A;  2CFD A;  1U8C B;  1S72 3;  1O7P B;  3MG2 A;  1CEW I;  2BHM A;  2D1W A;  3JUN A;  1MNL A;  4RNY A;  4FCJ A;  1AY7 A;  1S5A A;  3EBT A;  2IY2 A;  2BO9 B;  2E2T A;  5FGO A;  4HKV B;  5IG5 A;  3D4A A;  5BIR A;  1D6U A;  3I56 3;  2STD A;  1RGE A;  2QGU A;  1QVG 2;  1I2F A;  4K90 B;  1RRL A;  1RN4 A;  2XF3 A;  1BRJ A;  3BB9 A;  2KRT A;  3V98 A;  5I97 A;  3WA3 A;  3FF0 A;  1OCV A;  2GSP A;  3K5T A;  4HAA A;  1O7M B;  2OWP A;  5AII A;  2W04 A;  2OQE C;  1RMS A;  2K54 A;  2Z7A A;  5M1A A;  4EW5 A;  4KVH A;  1A2V A;  3B8L A;  5EVH A;  2CKF B;  1VQK 3;  5IEN A;  1GOV A;  1VQ8 3;  1RRH A;  3MG1 A;  1K9M 4;  5D82 A; 
#chains in the Genus database with same CATH homology
 1DMQ A;  4FMD A;  3F7S A;  1Q40 B;  3SLU A;  3CU3 A;  5IEO A;  5AYS C;  3LT9 A;  4HZB B;  2WOF A;  1IQY A;  1OAC A;  1ROA A;  1W6Y A;  3FG4 A;  3CPW 2;  4H61 A;  4NRE A;  1FUW A;  4GL6 A;  3HII A;  4MMX B;  3EE1 A;  3DGM A;  3PCR A;  1NU3 A;  5STD A;  4OK0 A;  1DMM A;  2FGT A;  3CCJ 3;  3DXO A;  1IDP A;  3LTC A;  4X2H A;  1W7C A;  1IV9 A;  2YFJ B;  3GAX A;  1YJ9 3;  1OHP A;  1YJW 3;  1JRQ A;  3SOA A;  3RGA A;  1NO3 A;  4N6O B;  3F9S A;  1VQ9 3;  3UL5 A;  3CCL 3;  5D83 A;  1CYU A;  3PCS A;  1A90 A;  2Z77 A;  4FMA A;  2CWT A;  3CCU 3;  1ROV A;  1IQX A;  5CF2 A;  2K0M A;  3CCS 3;  3HIG A;  1JB5 A;  2RSX A;  4HM8 B;  4CCV A;  3DM8 A;  2C10 A;  4WFO A;  2OTJ 3;  4K1V A;  1Z1S A;  3BLZ A;  1JV2 B;  3GZX B;  2XSH B;  5A0O B;  3L0R A;  3G8Z A;  3JVC A;  2IMJ A;  1O7W B;  3EN1 B;  5AIH A;  3EF8 A;  3DGL A;  1LXE A;  2YX9 A;  4N3V A;  3PS8 A;  1NWW A;  1U5O A;  3EJV A;  4BTX A;  3NQZ A;  1ULI B;  2W9Q A;  3V92 A;  2XRX B;  5ELU A;  1ULJ B;  2UX0 A;  4R9L A;  1M9G A;  1EG9 B;  1K73 4;  1AVL A;  1W4N A;  5IG0 A;  1STD A;  2Z6B A;  1WMN A;  1OGX A;  2CFL A;  6STD A;  3I0Y A;  3G0K A;  1M1X B;  3IJE B;  3NBJ A;  1FA3 A;  1PFP A;  2L4V A;  2XFS A;  1GYB A;  3K9M C;  4OUQ A;  1VQN 3;  3SOY A;  3B4O A;  4LZI A;  1F8N A;  4LGQ A;  5G2G A;  3GZY B;  2CHC A;  8CHO A;  1IVU A;  3X40 A;  5AEW B;  1W01 A;  1T5Y A;  2FXT A;  3STD A;  2IA7 A;  5ELJ A;  4R80 A;  4JF8 A;  1WQL B;  3FG1 A;  3VGN A;  3K7C A;  3V99 A;  3DUK A;  2JDI H;  3CXC 2;  1YJN 3;  1N5H A;  1GD4 A;  2CIU A;  2XEP A;  5IG3 A;  3F8H A;  1N8R 4;  3FSD A;  5AEU B;  3LZA A;  1JJ2 2;  3QK9 A;  2SBL A;  4TX4 A;  5IER A;  3KFQ C;  1IVV A;  1FGQ A;  3AMO A;  7STD A;  1WMP A;  1R4C A;  4XB5 A;  4MJD A;  4IPB A;  3PXM A;  1US1 A;  5JPP A;  4XDW A;  1GD3 A;  2ML6 A;  1AVK A;  2ZDJ A;  3WOF B;  5JBS A;  4WHA A;  4HM5 B;  4STD A;  4AKZ A;  2OOV A;  1GY5 A;  1OH0 A;  3F8X A;  3NBB A;  1KQS 2;  3KSP A;  5KP4 A;  3LTB A;  5AYR B;  3DY5 A;  3G16 A;  3SXX A;  2O9U X;  2E2V A;  4WYK B;  4CDL A;  1LVN A;  4Q53 A;  3FZW A;  4K61 A;  2CG1 A;  4J8T A;  2F98 A;  2XH9 A;  1VQ5 3;  3I55 3;  4FMC A;  3EQQ B;  1OHS A;  2Y74 A;  3FLJ A;  3BND A;  4LSO A;  3CME 3;  1IVW A;  2RCD A;  3X41 A;  3Q90 A;  3UL6 A;  3SED A;  2FNQ A;  3D3L A;  4N6T A;  1NB5 I;  2F99 A;  3U97 A;  2GEY A;  3MKI A;  2OQE A;  1IVX A;  4KFE A;  2IUK A;  4EBG A;  1SJW A;  4HM4 B;  4RZM A;  4EXR A;  2CFW A;  3G6E 3;  3CCE 3;  1N9J A;  1L5G B;  4U13 A;  1SIH A;  1RN7 A;  3CC7 3;  1YGE A;  5KP3 A;  3AMO B;  1FGR A;  2LYX A;  3S29 A;  2W0Q A;  2XFT A;  3HX8 A;  2CFG A;  2D42 A;  2ML5 A;  2YFI B;  4H3U A;  1JNQ A;  3JUM A;  3SX1 A;  4L8P A;  3O8Y A;  4N6U A;  4HJL B;  1OHO A;  3CNM A;  4FCM A;  4OVM A;  4RNZ A;  1VQ6 3;  3WDG B;  3EC9 A;  3RGR A;  2QIY A;  4R1K A;  1W6C A;  2HMM B;  4AEQ A;  1KC8 4;  3NV0 A;  2BT3 A;  2HMJ B;  5BVB A;  3B4P A;  5CXO A;  3X42 A;  1IT8 A;  3ROB A;  3A76 A;  3N9H A;  3ECF A;  3LML A;  1RKY A;  3DGN A;  2OCT A;  3LTD A;  1JN5 A;  1STF I;  3GRD A;  1K28 A;  3CCM 3;  2HMO B;  2CG0 A;  1A2K A;  1E3V A;  1JB4 A;  4BTY A;  1VQO 3;  1TIJ A;  5EEO A;  4R4K A;  4MEI A;  2JQ5 A;  3EBY A;  3LH4 A;  2INX A;  3CC2 3;  4HZ9 B;  3EB8 A;  1J2B A;  5HGR A;  3JUQ A;  1VQ4 3;  3LT8 A;  4EV5 A;  3WMD A;  3F7X A;  1DVC A;  1OGZ A;  4JRF A;  5BXQ A;  2P05 A;  2WO0 A;  2W9P A;  3KZT A;  3G4S 3;  2OTL 3;  3U1W A;  1LOX A;  2KCD A;  4EYC A;  1VQ7 3;  1IV7 A;  1AV4 A;  1O7N B;  3F40 A;  1NDO B;  4N6N B;  2PNC A;  1QJG A;  3HZP A;  1DMN A;  3GWR A;  3MYT A;  1SPU A;  1UUW B;  3FG3 A;  5IEP A;  2BMR B;  1G96 A;  3MPH A;  2B24 B;  4HM0 B;  1M1K 4;  1DYU A;  3GZB A;  3MG3 A;  1Q7Y 4;  2Z76 A;  1MOL A;  2P0M A;  3FCS B;  4L8O A;  1PU4 A;  4NHF A;  3CCV 3;  3KSE D;  2P09 A;  3MSO A;  4N6L A;  1NJI 4;  2PZV A;  3Q2P A;  1UW1 A;  5CF1 A;  1W2B 2;  2BNG A;  5D81 A;  4MMY B;  1GY6 A;  1O7H B;  1QAF A;  1V74 A;  3KE7 A;  3WA2 X;  4N6V 0;  3WOD G;  1ASK A;  3H3H A;  4N6M A;  2CC3 A;  3SVA A;  1UI7 A;  3QRD A;  2GBX B;  4R9K A;  4O02 B;  3NX0 A;  3VF1 A;  4G1M B;  1OF5 A;  1CYV A;  1VQM 3;  1TFK A;  5IW9 A;  3K0Z A;  4XBY A;  1WNH A;  3EX9 A;  1VZZ A;  2IUJ A;  2CWU A;  1FGM A;  3OV4 A;  3T8N A;  2GXF A;  2W56 A;  4XDV A;  3B7C A;  1Q82 4;  1WTH A;  1Q40 A;  3IPT A;  3OXA A;  4HM2 B;  4ORL A;  5EQL A;  3NQY A;  1OUN A;  1YVB I;  3MWZ A;  1KD1 4;  4RBN A;  5TGN A;  5DRV A;  3LTA A;  1GY7 A;  1KWI A;  1N5P A;  2QEX 3;  1W5Z A;  1ZX2 A;  1SII A;  3LXU X;  4BTW A;  3X3Y A;  3J7Y d;  4AKY A;  1N9E A;  4O2H A;  3Q1C A;  1TUH A;  2R4I A;  3FKA A;  3PYJ A;  3M8C A;  1EQK A;  3S67 A;  2GU3 A;  4KFF A;  1HKX A;  2Q07 A;  4IT7 A;  3KN4 A;  3VSY A;  2XGN A;  1FGO A;  2I9W A;  3KKG A;  2A15 A;  1E97 A;  4O8S A;  1YIT 3;  4HM7 B;  4QWT A;  1TP6 A;  3MHE A;  2WOH A;  3OWY A;  4PEJ A;  1ISK A;  4HM1 B;  5LC7 A;  2CWV A;  2WGQ A;  1CQS A;  2XR8 B;  3FF2 A;  5AIG A;  1HU9 A;  2Y73 A;  5AIF A;  1WMO A;  1E3R A;  5CK6 A;  2E2U A;  2W2C A;  1OF5 B;  3BNC A;  3ER7 A;  3LYG A;  1W2Z A;  2GEX A;  2LQV A;  5AI1 A;  4O3V A;  4MMZ B;  3HK4 A;  2CH9 A;  4WP5 A;  2MF7 A;  3EHC A;  2W56 B;  2W03 A;  1KSI A;  1JB2 A;  3BNB A;  5IG4 A;  4ZM8 A;  5KP1 A;  3LOY A;  1D6Z A;  3X3Z A;  2B1X B;  2CW9 A;  2GU1 A;  4HYZ A;  3NBR A;  4EV2 A;  3NUV A;  4LEH A;  3CD6 3;  1RJO A;  4L7K A;  2MC8 A;  1IK3 A;  3DMC A;  3HI7 A;  4KFD A;  3FH1 A;  5CLK A;  2WGO A;  1C7H A;  1QAL A;  4FR9 A;  1GS3 A;  1Q81 4;  3D9R A;  4XBX A;  3G71 3;  1Y4K A;  2KXG A;  3S5C A;  1QMA A;  3TDG A;  3OWS A;  3X3X A;  2C11 A;  5FW5 A;  3NM7 A;  3CCR 3;  1SQW A;  1TU5 A;  2RGQ A;  3UJM A;  2HMK B;  4I4K A;  1K41 A;  3GZR A;  3ALA A;  4HBR A;  3PGB A;  3OW2 2;  1N8Q A;  5DRE A;  3H51 A;  4LMI A;  1D6Y A;  2QA4 3;  1W00 A;  2O3O A;  3T8U A;  1NB3 I;  3DGO A;  2ZL8 A;  3UNL A;  1JKG A;  2HML B;  2CFK A;  3BNE A;  1YHQ 3;  3RDE A;  1DVD A;  1LNH A;  3EN8 A;  3NHX A;  3F14 A;  4WWU C;  1K8A 4;  1IU7 A;  3N54 B;  2BMO B;  2YFL B;  4K1U A;  1YIJ 3;  3K63 A;  4XBT A;  3NM2 A;  4FMB A;  3CC4 3;  1M90 4;  3NV0 B;  1VQL 3;  1Q86 4;  1TFO A;  5JPU A;  1QVF 2;  3S27 A;  4EC6 A;  1YI2 3;  1QAK A;  1FGT A;  3JUO A;  1UI8 A;  1JN5 B;  3N8B A;  3UB1 A;  5IF6 A;  3IMA B;  3OWU A;  2BMQ B;  4GB5 A;  4WYK A;  1UUV B;  3CNX A;  2XGL A;  3NXJ A;  2GBW B;  3JUP A;  1OPY A;  3OX9 A;  1W6G A;  4X2O A;  4FCZ A;  2F86 B;  1EA2 A;  2M7O A;  1BUQ A;  4HVN A;  4KZ1 A;  1O7G B;  1AR0 A;  4XM4 A;  3CPO A;  3CCQ 3;  1EKM A;  3DZL A;  3T0U A;  3KII A;  2P38 A;  1IQ8 A;  1ZO2 A;  2V1L A;  1JKG B;  3CMA 3;  2XSO B;  3S28 A;  2RFR A;  1A67 A;  4J9A A;  2W6J H;  1VQP 3;  2CK3 H;  4HM3 B;  2HMN B;  1W02 A;  2OOV C;  3FGY A;  5LC6 A;  3PZW A;  4IIA A;  2P0X A;  1IT7 A;  3WOE B;  4HM6 B;  1Q42 A;  3E99 A;  2CFD A;  1U8C B;  1S72 3;  1O7P B;  3MG2 A;  1CEW I;  2BHM A;  2D1W A;  3JUN A;  1MNL A;  4RNY A;  4FCJ A;  1S5A A;  3EBT A;  2BO9 B;  2E2T A;  5FGO A;  4HKV B;  5IG5 A;  1D6U A;  3I56 3;  2STD A;  1QVG 2;  2QGU A;  4K90 B;  1RRL A;  2XF3 A;  3BB9 A;  3V98 A;  2KRT A;  5I97 A;  3WA3 A;  3FF0 A;  1OCV A;  3K5T A;  5AII A;  1O7M B;  2OWP A;  2W04 A;  2OQE C;  2Z7A A;  2K54 A;  4KVH A;  1A2V A;  3B8L A;  5EVH A;  2CKF B;  1VQK 3;  5IEN A;  1VQ8 3;  1RRH A;  3MG1 A;  1K9M 4;  5D82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...