1VQKF

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqkF00
1VQMF 1YITF 2KTUA 3CCLF 1N8RH 1S72F 3OBYA 1CN7A 1RLGA 3CCVF 3HJWC 1M90H 3HAXD 3WXMB 1H7MA 1W3EX 1XBIA 2QA4F 1JJ2F 2LBWA 1VQPF 2BO1A 1NMUB 4NUTA 3CCSF 3AGKA 1K9MH 3CPQA 5EWRA 2AIFA 3PAFA 3LWRC 2OTJF 3I56F 1VQ9F 3IR9A 3G71F 3CC4F 3SIVA 3VMFB 1VQNF 1YJNF 3PLAC 3J81M 3V7EA 3CPWF 1RA4A 2OHWA 1YIJF 2OZBA 2HVYD 3J80M 1W41A 3E1YA 3VI6A 3NK7A 3I55F 2QI2A 1PXWA 5IT9M 3CCMF 3CD6F 3ON1A 5GIPC 1GO1A 1ZWZA 5GANK 1GO0A 1YHQF 3CCJF 4C4WC 3LWVC 3CCUF 1W40A 2CZWA 1QVGF 3N4ZA 1VQ8F 2OTLF 4X3LA 2QEXF 1X7PA 3CC7F 2JNBA 1VQKF 3GYQA 1VQLF 3OBWA 4BW0B 1KD1H 1KQSF 3NVIB 5GINC 5A2QM 1W2BF 5EO3A 1DT9A 3CMEF 1K73H 2ALEA 1VQ7F 1K8AH 3FFMA 3LWQC 1E7KA 1VQOF 2I6DA 1CK2A 3O85A 3LWPC 3MCAB 3CG6A 3CXCF 2WALA 3SIUA 3CMAF 5DCVA 1YJ9F 5GAPK 3CC2F 1X7OA 3CCQF 1Q7YH 1Q86H 3JAMM 3CCEF 2VGMA 3CCRF 1GZ0A 1NJIH 3RA5A 1VQ5F 1X52A 4TZZA 4BY9D 1IPAA 2KTVA 1KC8H 1T0KB 3J7AR 3NVKE 1YJWF 4X3MA 3JCMM 3LFOA 3OW2F 3G6EF 1YI2F 2FC3A 2LBXA 1Q82H 2VGNA 3LWOC 1W42A 3RA6A 1Q81H 3N4YA 4LCKA 5G4VC 3E20B 3V7QA 1QVFF 3NMUC 3NK6A 5FLXM 1VQ4F 5G4UC 1VQ6F 3G4SF 5FJ4C 1SDSA 5GIOC 2KG4A 1M1KH
chains in the Genus database with same CATH superfamily
3ZOPA 1VQMF 1YITF 2HRUA 2IAFA 3N2GA 3VYTC 5LXTA 1NQ3A 3FPIA 4FFBA 3TD3A 1IV1A 1S72F 2RB9A 2ZODA 5J2TB 1RLGA 5HWEA 3CCVF 3RYFA 4BT6A 2ZF8A 1W3EX 2HS4A 2LBWA 4TV8A 4YJ3A 1NMUB 4C8EA 1CLIA 4X20B 1GX1A 3JARA 5BMVA 2AIZP 5EIBC 3LMEA 3IR9A 5GONA 3SIVA 4B46A 1W59A 3J81M 3V7EA 3C9SA 4BT3A 5J2UB 1JFFA 1YIJF 3JATB 3J80M 5JVDB 1TUBA 3E1YA 3VI6A 3V4DA 5IT9M 3CD6F 3WPWA 3M1XA 4BT5A 5GANK 5IJ0B 3HTNA 1TVKA 3UT5B 1YHQF 3QHDA 2RHJA 2NMUA 2CW4A 3LWVC 3CCUF 3JAKA 4YJ2A 1VQ8F 4LNUB 5C8YA 4O4LB 1X7PA 2GZLA 2JNBA 1JN1A 1VQKF 3HKCA 3JAWA 3KIZA 1KQSF 2UYJA 1U43A 1W2BF 2DYYA 1DT9A 3GTZA 3JALA 5HY2A 2F9ZC 1E7KA 1CK2A 1RQ7A 3D01A 3O85A 5JCOA 2AMTA 2WALA 2Z1TA 5HY0A 1KNJA 3CCQF 3N2GB 3KJJA 5LXTB 4FFBB 4XCQA 3IKEA 3FD5A 1Q86H 2FGYA 4O4JB 3P4EA 3RA5A 5HP8A 1W57A 5HY1A 4TZZA 3HKBA 4F6RA 1IPAA 2IG8A 4BVSA 1W581 2PMPA 5JCOC 5BMVB 3ELCA 5GONB 2YYEA 4BVRA 2H6LA 4X3MA 2CSLA 3OW2F 4U3JA 1UFYA 3G6EF 2GVIA 1Q82H 2VGNA 4X1KA 4ZOLA 3KJKA 1U3PA 1W42A 1VK3A 3JASA 4ZK7A 3E22A 1TUBB 3F0FA 4BT7A 2HX0A 1JD1A 3NMUC 3VO8A 1H47A 2Q1YA 1TVKB 1J7HA 5LYJA 1M1KH 5MN6A 4DRXA 3JAKB 3OBYA 4YJ2B 3N2KA 4EI8A 5FJ4C 4O4IA 5HXZA 3C8LA 3HJWC 3HAXD 2ZAUA 4I55B 3WXMB 3HKCB 3JAWB 1JJ2F 3ZP4A 5EB0A 2BO1A 4O2AA 1DBFA 4C8GA 1K9MH 5EWRA 2OTJF 3LWRC 3IMPA 3I56F 3S0YA 1Q8RA 2GLZA 2RHHA 1XRGA 1UI9A 5LOVA 3D00A 3MDOA 2OHWA 2V9YA 1W41A 4G4XA 4O4HB 4TUYA 5LA6A 3VCZA 1VHAA 1XHOA 1FFXB 1GO1A 4ZI7B 4O2BA 1GO0A 5JQGB 5KMGA 2Z01A 4C4WC 3MCQA 1W40A 1VQVA 2CZWA 1SA0A 1QVGF 2OTLF 4X3LA 5MN4A 3HKBB 3D54A 1W5EA 4R40B 1KD1H 5HXUA 3KE1A 1OFUA 2UYNA 2B33A 3EORA 5LP6A 1QD9A 1W55A 4U3JB 4C8IA 3F0DA 4B5CA 4X1KB 4TV9B 4ZOLB 3RYIA 3JASB 3E22B 4ZHWA 2N48A 2VAPA 3S03A 2LCAA 3CMAF 5DCVA 4I4TA 5LYJB 4M8IA 4DRXB 1Q7YH 3HKEB 3N2KB 4RHAA 2Z1UA 3CCEF 2VGMA 5LP6C 4O4IB 3ZP7A 3KHNA 3U0OA 1PF5A 1OAPA 3VYSC 1VQ5F 1X25A 4EB6A 3DDNA 5CA1A 4PWTA 5CA0B 1T0KB 3J7AR 5FNVA 1YQNA 3CYPB 5EB1B 5EYPB 3JCMM 4G4WA 3K0TA 3TD5A 2FC3A 5ITZA 3DC2A 2QTPA 4ZHYB 4X1YA 1FNKA 3S0WA 3N4YA 4TUYB 5G4VC 1KNKA 5B8FA 3VOBA 2RHLA 4E6EA 1QVFF 2HS0A 4IHJA 4O2BB 5KMGB 3RYFB 1SDSA 4NQ3A 2KG4A 4BVTA 1SA0B 4TV8B 4YJ3B 2IQQA 1Z5WA 3JARB 1ODEA 4ERHA 3BYQA 1H7MA 2QA4F 2UYNB 1VQPF 3CCSF 2VXYA 3CPQA 5LP6B 2AIFA 3PAFA 1JFFB 1R1MA 3G71F 3CC4F 5EZYA 1VQNF 3WGMA 3CPWF 1RA4A 3K2XA 4WBNA 2HVYD 2HS3A 2ZOVA 2QI2A 4I4TB 4I50A 3CCMF 5C8YB 3ON1A 4B45A 5GIPC 1RLUA 5J2UA 4G88A 3CCJF 3RYCA 5JVDA 2R751 2R6R1 3IKFA 2CWJA 4G4ZA 3RE3A 1FSZA 3WJPA 2QEXF 4G4YA 4EB6B 1IV4A 5IJ0A 2UYKA 4C82A 3CYQA 3F0EA 1VQLF 4BW0B 4B62A 3JALB 5CA1B 3NVIB 5HY4A 3HKDA 1QAHA 3QUWA 5FNVB 5GINC 4LNUA 5EO3A 4IIJA 3WJQA 1K73H 1FNJA 2W8BC 3K12A 5ITZB 3B6NA 1VQ7F 3VIUA 2L26A 3FFMA 1XV2A 1VQOF 2BTQB 3I3FA 3LWPC 1IV3A 3CXCF 3TD4A 4IHJB 4ZHQA 1COMA 5IJ9A 1YJ9F 5GAPK 1X7OA 3WGNA 2LBTA 3T80A 4F6RB 3K14A 2ZVZA 2I6RA 5HP7A 2KGWA 1GZ0A 3M4SA 4NWOB 1RQ2A 1X52A 2Z1FA 2H8EA 4BY9D 3P0ZA 3JVHA 2DT4A 5KX5A 3QTYA 4O4JA 2KTVA 4EI7A 5CB4A 3NVKE 1U40A 5EZYB 3Q8HA 3WGLA 5MN5A 1YJWF 3F0GA 3L7QA 4KWEA 2LBXA 4WBNB 3RYHA 2H8CA 3LWOC 2EWCA 5AVMA 2MQEA 3RA6A 3WJRA 4I50B 3WPXA 3V7QA 3M84A 2ZVYA 5FLXM 1VQ4F 3RYCB 5GIOC 3VYUC 2KTUA 3MBMA 5EAZA 3CCLF 5IYZA 4HNAA 1N8RH 2UYPA 4O2AB 3ESJA 1CN7A 2HP3A 1M90H 2RHOA 1SZQA 3S02A 1XBIA 3HKDB 3MQWA 4G4VA 4NUTA 3AGKA 4IIJB 1VH8A 5LOVB 1VQ9F 2CVLA 4I55A 4X1IA 3VMFB 3GHZA 1YJNF 2Z1EA 5JH7A 2BTUA 2HP0A 3PLAC 5LA6B 3C9UA 3C9RA 2OZBA 1U3LA 3I55F 3NK7A 4ZHQB 2OTMA 5IJ9B 4EI9A 1PXWA 1YGYA 4BT2A 3WGJA 1ZWZA 3IEWA 3VTIC 2YXZA 2PHNA 2G9IA 4O4HA 3N4ZA 3F6MA 1FFXA 3ERNA 5J2TA 4ZI7A 3CC7F 5JQGA 5KX5B 3GYQA 1JY8A 3OBWA 1ONIA 5CB4B 4U39A 3OONA 3RYIB 5A2QM 2CHSA 2Q1XA 3HWUA 3CMEF 4X20A 2K1SA 3CB2A 3C9TA 2ALEA 3RYHB 4BVQA 1K8AH 3LWQC 2I6DA 3R0PA 1T0AA 3WGKA 3FD6A 3JATA 3MCAB 3CG6A 3S0HA 4ZHVA 3SIUA 4TV9A 3CC2F 5IYZB 4HNAB 3V3TA 3UT5A 3FBAA 3S06A 3JAMM 3CCRF 1QU9A 2CHTA 2VAWA 1NJIH 4O4LA 3HKEA 3LYBA 3P10A 1H48A 5EIBD 1Z5VA 4BT4A 1KC8H 4X1YB 4X1IB 1IV2A 2P6YA 4DXDA 4C81A 5JH7B 2HP0B 3LFOA 3ZO8A 1YI2F 3VOAA 5CA0A 1W5AA 1W5BA 3LDTA 1W5FA 5EYPA 1Q81H 2VAMA 4RQOA 4LCKA 2BTOA 2HQSC 2UZHA 3E20B 2HRYA 3NK6A 3IEQA 5G4UC 1VQ6F 3G4SF 3I7TA
chains in the Genus database with same CATH topology
4BVTA 1VQMF 1YITF 2KTUA 3CCLF 1N8RH 1S72F 3OBYA 4EI8A 1CN7A 5GIOC 1RLGA 5HWEA 3CCVF 5HXZA 3HJWC 1M90H 3HAXD 3WXMB 1H7MA 1W3EX 1XBIA 2QA4F 1JJ2F 2LBWA 1VQPF 2BO1A 1NMUB 4NUTA 3CCSF 3AGKA 1K9MH 3CPQA 5EWRA 2AIFA 3PAFA 3LWRC 2OTJF 3I56F 1VQ9F 3IR9A 3G71F 3CC4F 3SIVA 3VMFB 1VQNF 1YJNF 2GLZA 3PLAC 3J81M 3V7EA 3CPWF 1RA4A 3D00A 2OHWA 1YIJF 2OZBA 2HVYD 3J80M 1W41A 3E1YA 3VI6A 3NK7A 3I55F 2QI2A 4EI9A 1PXWA 5IT9M 3CCMF 3CD6F 3ON1A 5GIPC 1GO1A 1ZWZA 5GANK 1GO0A 1YHQF 3CCJF 4C4WC 3LWVC 3CCUF 1W40A 2CZWA 1QVGF 3N4ZA 1VQ8F 2OTLF 4X3LA 2QEXF 1X7PA 3CC7F 2JNBA 1VQKF 3GYQA 1VQLF 3OBWA 4BW0B 1KD1H 5HXUA 1KQSF 3NVIB 5HY4A 5GINC 5A2QM 1W2BF 5EO3A 1DT9A 3CMEF 1K73H 2ALEA 5HY2A 1VQ7F 4BVQA 1K8AH 3FFMA 2F9ZC 3LWQC 1E7KA 1VQOF 2I6DA 1CK2A 3O85A 3LWPC 3MCAB 3CG6A 3CXCF 2WALA 3SIUA 3CMAF 5DCVA 1YJ9F 5GAPK 5HY0A 3CC2F 1X7OA 3CCQF 1Q7YH 4XCQA 3V3TA 1Q86H 2FGYA 3JAMM 3CCEF 2VGMA 3CCRF 1GZ0A 1NJIH 3RA5A 1VQ5F 1X52A 5HY1A 4TZZA 4BY9D 1IPAA 4BVSA 2KTVA 4EI7A 1KC8H 1T0KB 3J7AR 3NVKE 4BVRA 1YJWF 4X3MA 3JCMM 3LFOA 3OW2F 3G6EF 1YI2F 2FC3A 2LBXA 1Q82H 2VGNA 3LWOC 1W42A 3RA6A 1Q81H 3N4YA 4LCKA 5G4VC 3E20B 3V7QA 1QVFF 3NMUC 3NK6A 5FLXM 1VQ4F 5G4UC 1VQ6F 3G4SF 5FJ4C 1SDSA 4NQ3A 2KG4A 1M1KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM F;  1YIT F;  2KTU A;  3CCL F;  1N8R H;  1S72 F;  3OBY A;  1CN7 A;  1RLG A;  3CCV F;  3HJW C;  1M90 H;  3HAX D;  3WXM B;  1H7M A;  1W3E X;  1XBI A;  2QA4 F;  1JJ2 F;  2LBW A;  1VQP F;  2BO1 A;  1NMU B;  4NUT A;  3CCS F;  3AGK A;  1K9M H;  3CPQ A;  5EWR A;  2AIF A;  3PAF A;  3LWR C;  2OTJ F;  3I56 F;  1VQ9 F;  3IR9 A;  3G71 F;  3CC4 F;  3SIV A;  3VMF B;  1VQN F;  1YJN F;  3PLA C;  3J81 M;  3V7E A;  3CPW F;  1RA4 A;  2OHW A;  1YIJ F;  2OZB A;  2HVY D;  3J80 M;  1W41 A;  3E1Y A;  3VI6 A;  3NK7 A;  3I55 F;  2QI2 A;  1PXW A;  5IT9 M;  3CCM F;  3CD6 F;  3ON1 A;  5GIP C;  1GO1 A;  1ZWZ A;  5GAN K;  1GO0 A;  1YHQ F;  3CCJ F;  4C4W C;  3LWV C;  3CCU F;  1W40 A;  2CZW A;  1QVG F;  3N4Z A;  1VQ8 F;  2OTL F;  4X3L A;  2QEX F;  1X7P A;  3CC7 F;  2JNB A;  1VQK F;  3GYQ A;  1VQL F;  3OBW A;  4BW0 B;  1KD1 H;  1KQS F;  3NVI B;  5GIN C;  5A2Q M;  1W2B F;  5EO3 A;  1DT9 A;  3CME F;  1K73 H;  2ALE A;  1VQ7 F;  1K8A H;  3FFM A;  3LWQ C;  1E7K A;  1VQO F;  2I6D A;  1CK2 A;  3O85 A;  3LWP C;  3MCA B;  3CG6 A;  3CXC F;  2WAL A;  3SIU A;  3CMA F;  5DCV A;  1YJ9 F;  5GAP K;  3CC2 F;  1X7O A;  3CCQ F;  1Q7Y H;  1Q86 H;  3JAM M;  3CCE F;  2VGM A;  3CCR F;  1GZ0 A;  1NJI H;  3RA5 A;  1VQ5 F;  1X52 A;  4TZZ A;  4BY9 D;  1IPA A;  2KTV A;  1KC8 H;  1T0K B;  3J7A R;  3NVK E;  1YJW F;  4X3M A;  3JCM M;  3LFO A;  3OW2 F;  3G6E F;  1YI2 F;  2FC3 A;  2LBX A;  1Q82 H;  2VGN A;  3LWO C;  1W42 A;  3RA6 A;  1Q81 H;  3N4Y A;  4LCK A;  5G4V C;  3E20 B;  3V7Q A;  1QVF F;  3NMU C;  3NK6 A;  5FLX M;  1VQ4 F;  5G4U C;  1VQ6 F;  3G4S F;  5FJ4 C;  1SDS A;  5GIO C;  2KG4 A;  1M1K H; 
#chains in the Genus database with same CATH topology
 3ZOP A;  1VQM F;  1YIT F;  2HRU A;  2IAF A;  3N2G A;  3VYT C;  5LXT A;  1NQ3 A;  3FPI A;  4FFB A;  3TD3 A;  1IV1 A;  1S72 F;  2RB9 A;  2ZOD A;  5J2T B;  1RLG A;  5HWE A;  3CCV F;  3RYF A;  4BT6 A;  2ZF8 A;  1W3E X;  2HS4 A;  2LBW A;  4TV8 A;  4YJ3 A;  1NMU B;  4C8E A;  1CLI A;  4X20 B;  1GX1 A;  3JAR A;  5BMV A;  2AIZ P;  5EIB C;  3LME A;  3IR9 A;  5GON A;  3SIV A;  4B46 A;  1W59 A;  3J81 M;  3V7E A;  3C9S A;  4BT3 A;  5J2U B;  1JFF A;  1YIJ F;  3JAT B;  3J80 M;  5JVD B;  1TUB A;  3E1Y A;  3VI6 A;  3V4D A;  5IT9 M;  3CD6 F;  3WPW A;  3M1X A;  4BT5 A;  5GAN K;  5IJ0 B;  3HTN A;  1TVK A;  3UT5 B;  1YHQ F;  3QHD A;  2RHJ A;  2NMU A;  2CW4 A;  3LWV C;  3CCU F;  3JAK A;  4YJ2 A;  1VQ8 F;  4LNU B;  5C8Y A;  4O4L B;  1X7P A;  2GZL A;  2JNB A;  1JN1 A;  1VQK F;  3HKC A;  3JAW A;  3KIZ A;  1KQS F;  2UYJ A;  1U43 A;  1W2B F;  2DYY A;  1DT9 A;  3GTZ A;  3JAL A;  5HY2 A;  2F9Z C;  1E7K A;  1CK2 A;  1RQ7 A;  3D01 A;  3O85 A;  5JCO A;  2AMT A;  2WAL A;  2Z1T A;  5HY0 A;  1KNJ A;  3CCQ F;  3N2G B;  3KJJ A;  5LXT B;  4FFB B;  4XCQ A;  3IKE A;  3FD5 A;  1Q86 H;  2FGY A;  4O4J B;  3P4E A;  3RA5 A;  5HP8 A;  1W57 A;  5HY1 A;  4TZZ A;  3HKB A;  4F6R A;  1IPA A;  2IG8 A;  4BVS A;  1W58 1;  2PMP A;  5JCO C;  5BMV B;  3ELC A;  5GON B;  2YYE A;  4BVR A;  2H6L A;  4X3M A;  2CSL A;  3OW2 F;  4U3J A;  1UFY A;  3G6E F;  2GVI A;  1Q82 H;  2VGN A;  4X1K A;  4ZOL A;  3KJK A;  1U3P A;  1W42 A;  1VK3 A;  3JAS A;  4ZK7 A;  3E22 A;  1TUB B;  3F0F A;  4BT7 A;  2HX0 A;  1JD1 A;  3NMU C;  3VO8 A;  1H47 A;  2Q1Y A;  1TVK B;  1J7H A;  5LYJ A;  1M1K H;  5MN6 A;  4DRX A;  3JAK B;  3OBY A;  4YJ2 B;  3N2K A;  4EI8 A;  5FJ4 C;  4O4I A;  5HXZ A;  3C8L A;  3HJW C;  3HAX D;  2ZAU A;  4I55 B;  3WXM B;  3HKC B;  3JAW B;  1JJ2 F;  3ZP4 A;  5EB0 A;  2BO1 A;  4O2A A;  1DBF A;  4C8G A;  1K9M H;  5EWR A;  2OTJ F;  3LWR C;  3IMP A;  3I56 F;  3S0Y A;  1Q8R A;  2GLZ A;  2RHH A;  1XRG A;  1UI9 A;  5LOV A;  3D00 A;  3MDO A;  2OHW A;  2V9Y A;  1W41 A;  4G4X A;  4O4H B;  4TUY A;  5LA6 A;  3VCZ A;  1VHA A;  1XHO A;  1FFX B;  1GO1 A;  4ZI7 B;  4O2B A;  1GO0 A;  5JQG B;  5KMG A;  2Z01 A;  4C4W C;  3MCQ A;  1W40 A;  1VQV A;  2CZW A;  1SA0 A;  1QVG F;  2OTL F;  4X3L A;  5MN4 A;  3HKB B;  3D54 A;  1W5E A;  4R40 B;  1KD1 H;  5HXU A;  3KE1 A;  1OFU A;  2UYN A;  2B33 A;  3EOR A;  5LP6 A;  1QD9 A;  1W55 A;  4U3J B;  4C8I A;  3F0D A;  4B5C A;  4X1K B;  4TV9 B;  4ZOL B;  3RYI A;  3JAS B;  3E22 B;  4ZHW A;  2N48 A;  2VAP A;  3S03 A;  2LCA A;  3CMA F;  5DCV A;  4I4T A;  5LYJ B;  4M8I A;  4DRX B;  1Q7Y H;  3HKE B;  3N2K B;  4RHA A;  2Z1U A;  3CCE F;  2VGM A;  5LP6 C;  4O4I B;  3ZP7 A;  3KHN A;  3U0O A;  1PF5 A;  1OAP A;  3VYS C;  1VQ5 F;  1X25 A;  4EB6 A;  3DDN A;  5CA1 A;  4PWT A;  5CA0 B;  1T0K B;  3J7A R;  5FNV A;  1YQN A;  3CYP B;  5EB1 B;  5EYP B;  3JCM M;  4G4W A;  3K0T A;  3TD5 A;  2FC3 A;  5ITZ A;  3DC2 A;  2QTP A;  4ZHY B;  4X1Y A;  1FNK A;  3S0W A;  3N4Y A;  4TUY B;  5G4V C;  1KNK A;  5B8F A;  3VOB A;  2RHL A;  4E6E A;  1QVF F;  2HS0 A;  4IHJ A;  4O2B B;  5KMG B;  3RYF B;  1SDS A;  4NQ3 A;  2KG4 A;  4BVT A;  1SA0 B;  4TV8 B;  4YJ3 B;  2IQQ A;  1Z5W A;  3JAR B;  1ODE A;  4ERH A;  3BYQ A;  1H7M A;  2QA4 F;  2UYN B;  1VQP F;  3CCS F;  2VXY A;  3CPQ A;  5LP6 B;  2AIF A;  3PAF A;  1JFF B;  1R1M A;  3G71 F;  3CC4 F;  5EZY A;  1VQN F;  3WGM A;  3CPW F;  1RA4 A;  3K2X A;  4WBN A;  2HVY D;  2HS3 A;  2ZOV A;  2QI2 A;  4I4T B;  4I50 A;  3CCM F;  5C8Y B;  3ON1 A;  4B45 A;  5GIP C;  1RLU A;  5J2U A;  4G88 A;  3CCJ F;  3RYC A;  5JVD A;  2R75 1;  2R6R 1;  3IKF A;  2CWJ A;  4G4Z A;  3RE3 A;  1FSZ A;  3WJP A;  2QEX F;  4G4Y A;  4EB6 B;  1IV4 A;  5IJ0 A;  2UYK A;  4C82 A;  3CYQ A;  3F0E A;  1VQL F;  4BW0 B;  4B62 A;  3JAL B;  5CA1 B;  3NVI B;  5HY4 A;  3HKD A;  1QAH A;  3QUW A;  5FNV B;  5GIN C;  4LNU A;  5EO3 A;  4IIJ A;  3WJQ A;  1K73 H;  1FNJ A;  2W8B C;  3K12 A;  5ITZ B;  3B6N A;  1VQ7 F;  3VIU A;  2L26 A;  3FFM A;  1XV2 A;  1VQO F;  2BTQ B;  3I3F A;  3LWP C;  1IV3 A;  3CXC F;  3TD4 A;  4IHJ B;  4ZHQ A;  1COM A;  5IJ9 A;  1YJ9 F;  5GAP K;  1X7O A;  3WGN A;  2LBT A;  3T80 A;  4F6R B;  3K14 A;  2ZVZ A;  2I6R A;  5HP7 A;  2KGW A;  1GZ0 A;  3M4S A;  4NWO B;  1RQ2 A;  1X52 A;  2Z1F A;  2H8E A;  4BY9 D;  3P0Z A;  3JVH A;  2DT4 A;  5KX5 A;  3QTY A;  4O4J A;  2KTV A;  4EI7 A;  5CB4 A;  3NVK E;  1U40 A;  5EZY B;  3Q8H A;  3WGL A;  5MN5 A;  1YJW F;  3F0G A;  3L7Q A;  4KWE A;  2LBX A;  4WBN B;  3RYH A;  2H8C A;  3LWO C;  2EWC A;  5AVM A;  2MQE A;  3RA6 A;  3WJR A;  4I50 B;  3WPX A;  3V7Q A;  3M84 A;  2ZVY A;  5FLX M;  1VQ4 F;  3RYC B;  5GIO C;  3VYU C;  2KTU A;  3MBM A;  5EAZ A;  3CCL F;  5IYZ A;  4HNA A;  1N8R H;  2UYP A;  4O2A B;  3ESJ A;  1CN7 A;  2HP3 A;  1M90 H;  2RHO A;  1SZQ A;  3S02 A;  1XBI A;  3HKD B;  3MQW A;  4G4V A;  4NUT A;  3AGK A;  4IIJ B;  1VH8 A;  5LOV B;  1VQ9 F;  2CVL A;  4I55 A;  4X1I A;  3VMF B;  3GHZ A;  1YJN F;  2Z1E A;  5JH7 A;  2BTU A;  2HP0 A;  3PLA C;  5LA6 B;  3C9U A;  3C9R A;  2OZB A;  1U3L A;  3I55 F;  3NK7 A;  4ZHQ B;  2OTM A;  5IJ9 B;  4EI9 A;  1PXW A;  1YGY A;  4BT2 A;  3WGJ A;  1ZWZ A;  3IEW A;  3VTI C;  2YXZ A;  2PHN A;  2G9I A;  4O4H A;  3N4Z A;  3F6M A;  1FFX A;  3ERN A;  5J2T A;  4ZI7 A;  3CC7 F;  5JQG A;  5KX5 B;  3GYQ A;  1JY8 A;  3OBW A;  1ONI A;  5CB4 B;  4U39 A;  3OON A;  3RYI B;  5A2Q M;  2CHS A;  2Q1X A;  3HWU A;  3CME F;  4X20 A;  2K1S A;  3CB2 A;  3C9T A;  2ALE A;  3RYH B;  4BVQ A;  1K8A H;  3LWQ C;  2I6D A;  3R0P A;  1T0A A;  3WGK A;  3FD6 A;  3JAT A;  3MCA B;  3CG6 A;  3S0H A;  4ZHV A;  3SIU A;  4TV9 A;  3CC2 F;  5IYZ B;  4HNA B;  3V3T A;  3UT5 A;  3FBA A;  3S06 A;  3JAM M;  3CCR F;  1QU9 A;  2CHT A;  2VAW A;  1NJI H;  4O4L A;  3HKE A;  3LYB A;  3P10 A;  1H48 A;  5EIB D;  1Z5V A;  4BT4 A;  1KC8 H;  4X1Y B;  4X1I B;  1IV2 A;  2P6Y A;  4DXD A;  4C81 A;  5JH7 B;  2HP0 B;  3LFO A;  3ZO8 A;  1YI2 F;  3VOA A;  5CA0 A;  1W5A A;  1W5B A;  3LDT A;  1W5F A;  5EYP A;  1Q81 H;  2VAM A;  4RQO A;  4LCK A;  2BTO A;  2HQS C;  2UZH A;  3E20 B;  2HRY A;  3NK6 A;  3IEQ A;  5G4U C;  1VQ6 F;  3G4S F;  3I7T A; 
#chains in the Genus database with same CATH homology
 4BVT A;  1VQM F;  1YIT F;  2KTU A;  3CCL F;  1N8R H;  1S72 F;  3OBY A;  4EI8 A;  1CN7 A;  5GIO C;  1RLG A;  5HWE A;  3CCV F;  5HXZ A;  3HJW C;  1M90 H;  3HAX D;  3WXM B;  1H7M A;  1W3E X;  1XBI A;  2QA4 F;  1JJ2 F;  2LBW A;  1VQP F;  2BO1 A;  1NMU B;  4NUT A;  3CCS F;  3AGK A;  1K9M H;  3CPQ A;  5EWR A;  2AIF A;  3PAF A;  3LWR C;  2OTJ F;  3I56 F;  1VQ9 F;  3IR9 A;  3G71 F;  3CC4 F;  3SIV A;  3VMF B;  1VQN F;  1YJN F;  2GLZ A;  3PLA C;  3J81 M;  3V7E A;  3CPW F;  1RA4 A;  3D00 A;  2OHW A;  1YIJ F;  2OZB A;  2HVY D;  3J80 M;  1W41 A;  3E1Y A;  3VI6 A;  3NK7 A;  3I55 F;  2QI2 A;  4EI9 A;  1PXW A;  5IT9 M;  3CCM F;  3CD6 F;  3ON1 A;  5GIP C;  1GO1 A;  1ZWZ A;  5GAN K;  1GO0 A;  1YHQ F;  3CCJ F;  4C4W C;  3LWV C;  3CCU F;  1W40 A;  2CZW A;  1QVG F;  3N4Z A;  1VQ8 F;  2OTL F;  4X3L A;  2QEX F;  1X7P A;  3CC7 F;  2JNB A;  1VQK F;  3GYQ A;  1VQL F;  3OBW A;  4BW0 B;  1KD1 H;  5HXU A;  1KQS F;  3NVI B;  5HY4 A;  5GIN C;  5A2Q M;  1W2B F;  5EO3 A;  1DT9 A;  3CME F;  1K73 H;  2ALE A;  5HY2 A;  1VQ7 F;  4BVQ A;  1K8A H;  3FFM A;  2F9Z C;  3LWQ C;  1E7K A;  1VQO F;  2I6D A;  1CK2 A;  3O85 A;  3LWP C;  3MCA B;  3CG6 A;  3CXC F;  2WAL A;  3SIU A;  3CMA F;  5DCV A;  1YJ9 F;  5GAP K;  5HY0 A;  3CC2 F;  1X7O A;  3CCQ F;  1Q7Y H;  4XCQ A;  3V3T A;  1Q86 H;  2FGY A;  3JAM M;  3CCE F;  2VGM A;  3CCR F;  1GZ0 A;  1NJI H;  3RA5 A;  1VQ5 F;  1X52 A;  5HY1 A;  4TZZ A;  4BY9 D;  1IPA A;  4BVS A;  2KTV A;  4EI7 A;  1KC8 H;  1T0K B;  3J7A R;  3NVK E;  4BVR A;  1YJW F;  4X3M A;  3JCM M;  3LFO A;  3OW2 F;  3G6E F;  1YI2 F;  2FC3 A;  2LBX A;  1Q82 H;  2VGN A;  3LWO C;  1W42 A;  3RA6 A;  1Q81 H;  3N4Y A;  4LCK A;  5G4V C;  3E20 B;  3V7Q A;  1QVF F;  3NMU C;  3NK6 A;  5FLX M;  1VQ4 F;  5G4U C;  1VQ6 F;  3G4S F;  5FJ4 C;  1SDS A;  4NQ3 A;  2KG4 A;  1M1K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...