1VQKF

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqkF00
1PXWA 2WALA 4NUTA 3VMFB 1GZ0A 3CC4F 2I6DA 3NK7A 1W42A 5G4UC 2VGNA 4TZZA 1ZWZA 1CK2A 3CC7F 1VQ6F 3J80M 2CZWA 3PAFA 4BW0B 1S72F 5EWRA 3HJWC 1X7OA 2QI2A 4C4WC 5GIOC 3LWQC 1YJNF 1K73H 1W2BF 2OZBA 3NVKE 1Q81H 3G71F 5A2QM 2LBWA 1Q82H 2VGMA 3PLAC 1M1KH 1VQKF 3I56F 1VQOF 1KQSF 2AIFA 1Q7YH 3WXMB 1YHQF 2HVYD 1E7KA 3OW2F 1K9MH 2FC3A 3G4SF 1YITF 3FFMA 3LWPC 3CG6A 3MCAB 1VQNF 3LWVC 1YJ9F 1YI2F 3CCVF 1YIJF 3CCLF 1KC8H 1VQMF 1GO1A 2BO1A 1QVFF 3JAMM 1YJWF 3RA5A 2OTJF 1VQ9F 3N4YA 3CCQF 5GANK 5GINC 3SIUA 3OBWA 3CCUF 1X52A 3CMEF 1NMUB 3N4ZA 3NK6A 1VQLF 1W40A 3CPQA 3E20B 1CN7A 3JCMM 3SIVA 5IT9M 3NVIB 4LCKA 1DT9A 1XBIA 3RA6A 3LWOC 1IPAA 1K8AH 1RA4A 3IR9A 2QEXF 2OHWA 1VQ4F 1T0KB 3AGKA 3GYQA 5GIPC 2OTLF 4X3MA 3E1YA 1VQPF 1M90H 3CC2F 1VQ7F 1KD1H 3CCSF 2ALEA 1GO0A 3VI6A 2QA4F 2KG4A 5DCVA 1QVGF 3ON1A 1RLGA 3I55F 1VQ5F 1SDSA 2JNBA 2KTVA 3CCJF 3O85A 5G4VC 4X3LA 3HAXD 1NJIH 3NMUC 3CCEF 3J7AR 1VQ8F 3G6EF 5GAPK 3CD6F 1H7MA 3CMAF 3V7QA 3J81M 5FJ4C 3CPWF 2LBXA 5FLXM 3V7EA 1W3EX 1N8RH 3OBYA 1X7PA 3CXCF 3LWRC 1JJ2F 1Q86H 3LFOA 4BY9D 2KTUA 3CCMF 5EO3A 3CCRF 1W41A
chains in the Genus database with same CATH superfamily
5J2TB 2H8EA 2WALA 1GZ0A 1W5FA 3CC4F 2HX0A 3JATB 1SA0B 5LOVA 4TV9A 3K0TA 5EWRA 5HY4A 4ZHWA 2HS4A 4YJ2B 1X7OA 2Q1XA 3CYPB 4C4WC 3IMPA 1TVKB 1YJNF 2HS0A 1Q81H 3V3TA 3ZO8A 4B5CA 5A2QM 5KX5A 1QAHA 2ZVZA 3KIZA 4G4WA 2HRYA 1RQ7A 4IHJA 1Q7YH 3WXMB 1YHQF 1TUBB 2HVYD 3OW2F 4G4XA 3G4SF 4X1YA 1YQNA 4DRXA 3MCAB 3LWVC 4DXDA 5EB1B 5C8YB 3I7TA 5J2UB 3CCVF 1YIJF 4WBNA 2G9IA 2UYNA 5CB4B 3N2GB 4G4YA 5IJ0A 2OTJF 1VQ9F 4B62A 4I55B 5GINC 2Z01A 3CCUF 4O4HB 1KNKA 2UYJA 3C9RA 3VIUA 1W581 1VQLF 4R40B 5EZYB 3CPQA 1CN7A 4NQ3A 3NVIB 1DT9A 1XBIA 4RQOA 2BTOA 3HKCB 3QTYA 5LOVB 3HKBA 4XCQA 2UZHA 3C9SA 2VAWA 4YJ3A 3FD6A 1U3LA 2PHNA 2KGWA 3GYQA 3S02A 1KNJA 4ZI7A 4X3MA 1VQPF 4KWEA 4X20A 1VQ7F 3JATA 1FFXA 1SA0A 3BYQA 1GO0A 3MCQA 3P4EA 4IHJB 4BT6A 5DCVA 4YJ2A 1VQ5F 4F6RB 1TVKA 3F6MA 4X1YB 5G4VC 3HKEB 4ZHVA 4X3LA 4DRXB 3HAXD 3CCEF 3J7AR 2OTMA 3LMEA 2YYEA 5EAZA 3V7QA 5FJ4C 3CPWF 1W5EA 2EWCA 5HP8A 3JAKA 4O2AA 4WBNB 2K1SA 3LDTA 1N8RH 1TUBA 1X7PA 3LWRC 1U43A 3Q8HA 1Q86H 2Q1YA 5IJ0B 4BY9D 3VTIC 3ZP4A 5EO3A 3VCZA 1YGYA 1W55A 5C8YA 5J2UA 4BT4A 3F0EA 2I6DA 1W42A 4TZZA 3CC7F 4TUYB 3N2GA 4C82A 1S72F 3D54A 4I55A 5HY1A 2QI2A 1K73H 4IIJA 3PLAC 1JD1A 5EZYA 4YJ3B 1KQSF 3L7QA 1E7KA 4TV8A 2Z1TA 4ZI7B 3HKCA 3FFMA 3IKFA 1UFYA 1VQNF 4X20B 5IYZB 1FFXB 2YXZA 4ZK7A 2H6LA 3KJKA 3KHNA 3TD4A 2H8CA 1UI9A 2P6YA 2VAPA 4EI8A 3RYHB 3SIUA 3M4SA 1X52A 2GZLA 3JAKB 3N4ZA 4O2AB 4O4JA 4LNUB 2F9ZC 3NK6A 4RHAA 3M1XA 4I4TA 3S0HA 4F6RA 2V9YA 5MN4A 3HKEA 3P10A 3RA6A 3VOBA 5CA0B 5HXUA 3LWOC 4U3JA 4ZHYB 1RA4A 3IR9A 3MDOA 5MN6A 2QEXF 2OHWA 2ZODA 4BT7A 5ITZB 5GIPC 1FNJA 5FNVB 2OTLF 1DBFA 3OONA 3D01A 5JQGB 4IIJB 3CC2F 3ZP7A 2HP0B 1X25A 5MN5A 4TUYA 3F0DA 3JVHA 3JARB 2RHHA 4TV8B 1Z5WA 2JNBA 3CCJF 3F0GA 4I50A 1NJIH 5LP6C 1VQ8F 3VOAA 1SZQA 3P0ZA 3J81M 3K2XA 3V7EA 3RYFB 1VQVA 5KMGA 1W3EX 3OBYA 3CXCF 3ERNA 4BT2A 3C9UA 1JJ2F 2BTUA 1U40A 3JAWA 3LFOA 4BT3A 2KTUA 3CCMF 2I6RA 3E22A 4G4ZA 5IYZA 3CCRF 3JASA 3C8LA 1VQ4F 1PXWA 3VMFB 2BTQB 3D00A 3NK7A 4O4JB 2VGNA 1ZWZA 3S0WA 3MBMA 5JCOA 1RQ2A 3J80M 3FD5A 3PAFA 4I4TB 4B45A 2ZVYA 3ZOPA 5GIOC 3QUWA 3LWQC 3RYHA 1W2BF 2OZBA 1Z5VA 4BVTA 4U3JB 1H47A 4LNUA 2LBWA 3S06A 1Q82H 2RB9A 1VK3A 3I56F 3KJJA 1VQOF 2AIFA 3DC2A 2LCAA 3JALA 3HTNA 3B6NA 2AMTA 5CA0A 5LP6B 1K9MH 1YITF 2DT4A 2AIZP 4O4LA 1VH8A 1QD9A 2PMPA 2UYKA 4HNAB 4EI9A 1YJ9F 1W5AA 4ZOLB 4ERHA 3QHDA 5AVMA 1IV2A 2RHLA 1VQMF 1KC8H 5ITZA 3I3FA 5FNVA 2RHOA 2BO1A 2HQSC 3RA5A 5JQGA 4NWOB 4I50B 3UT5A 2HP3A 1GX1A 3CCQF 5GANK 2HP0A 2LBTA 3WGKA 2R6R1 3JARA 3EORA 3WPXA 5KMGB 2VXYA 2CHSA 5GONA 3FPIA 3CYQA 1IV4A 2GLZA 3JCMM 3SIVA 1T0AA 2GVIA 3RYIB 5IT9M 5HXZA 3JAWB 3V4DA 3WGJA 4LCKA 1RLUA 3E22B 3JASB 5LYJB 1K8AH 3RYFA 3M84A 2CVLA 4X1KA 5EIBD 4M8IA 1T0KB 3AGKA 4B46A 5HY2A 2N48A 3VYSC 5IJ9B 5CA1A 3E1YA 4G88A 1M90H 1OFUA 3CCSF 4O2BB 2ALEA 3K14A 3VI6A 2KG4A 1FNKA 4G4VA 4C8GA 2IAFA 1RLGA 3JALB 3I55F 5EYPA 1SDSA 3TD3A 3IEWA 2KTVA 2MQEA 4ZHQB 4O4LB 1XV2A 3G6EF 3F0FA 5GAPK 3WJRA 1COMA 3CMAF 2IG8A 1JFFA 4EB6A 4BVQA 3ESJA 1H48A 5LP6A 3WJPA 4BT5A 2CSLA 1R1MA 3N2KB 1CLIA 3IEQA 3UT5B 1W41A 4HNAA 4NUTA 4ZOLA 3VO8A 3T80A 5G4UC 1J7HA 1CK2A 5JVDA 4BVSA 3GTZA 1VQ6F 5GONB 2CZWA 4BW0B 3RE3A 3FBAA 2VAMA 1ONIA 3HJWC 3C9TA 5LA6B 3WJQA 5HP7A 5JH7A 3S0YA 3NVKE 4O4IA 3WPWA 3G71F 4E6EA 4X1KB 2VGMA 5EIBC 1M1KH 5BMVA 1VQKF 3HKDB 3U0OA 3RYIA 2RHJA 5LXTB 2NMUA 2FC3A 4X1IB 5CA1B 2FGYA 5LYJA 3R0PA 3LWPC 3CG6A 1JN1A 5B8FA 2B33A 3VYUC 2CHTA 1YI2F 3CCLF 3KE1A 1GO1A 2HRUA 1NQ3A 5EYPB 5IJ9A 4TV9B 2CW4A 1QVFF 1W57A 3WGLA 3JAMM 4FFBA 1FSZA 1YJWF 1OAPA 1ODEA 3GHZA 3N4YA 3RYCA 1JY8A 4O2BA 5J2TA 2CWJA 3OBWA 1W59A 3CMEF 3TD5A 1NMUB 4BVRA 1JFFB 4EB6B 5KX5B 4PWTA 1W40A 1VHAA 3E20B 3S03A 1IV1A 4ZHQA 1IV3A 5EB0A 1IPAA 3ELCA 1Q8RA 2ZF8A 3K12A 2QTPA 2UYPA 2Z1EA 5JVDB 1PF5A 3HWUA 2UYNB 1XRGA 3N2KA 2ZOVA 1W5BA 5HY0A 5JH7B 2W8BC 2IQQA 1KD1H 4O4IB 4U39A 5JCOC 4C81A 5HWEA 2R751 2HS3A 2QA4F 5BMVB 4C8IA 1QVGF 3ON1A 5CB4A 2DYYA 5LA6A 1QU9A 1U3PA 3O85A 3IKEA 3WGMA 4EI7A 3NMUC 3VYTC 4C8EA 3CD6F 1H7MA 1XHOA 3CB2A 3DDNA 3HKDA 2LBXA 4O4HA 5FLXM 2L26A 5LXTA 3HKBB 3MQWA 4X1IA 2ZAUA 2Z1UA 3LYBA 4FFBB 3WGNA 2Z1FA 3RYCB
chains in the Genus database with same CATH topology
1PXWA 2WALA 4NUTA 3VMFB 1GZ0A 3D00A 3CC4F 2I6DA 3NK7A 1W42A 5G4UC 2VGNA 4TZZA 1ZWZA 1CK2A 3CC7F 4BVSA 1VQ6F 3J80M 2CZWA 3PAFA 4BW0B 1S72F 5EWRA 5HY4A 3HJWC 1X7OA 5HY1A 2QI2A 4C4WC 5GIOC 3LWQC 1YJNF 1K73H 1W2BF 2OZBA 4BVTA 3NVKE 1Q81H 3G71F 3V3TA 5A2QM 2LBWA 1Q82H 2VGMA 3PLAC 1M1KH 1VQKF 3I56F 1VQOF 1KQSF 2AIFA 1Q7YH 3WXMB 1YHQF 2HVYD 1E7KA 3OW2F 1K9MH 2FC3A 3G4SF 1YITF 3FFMA 2FGYA 3LWPC 3CG6A 3MCAB 1VQNF 3LWVC 4EI9A 1YJ9F 1YI2F 3CCVF 1YIJF 3CCLF 1KC8H 1VQMF 1GO1A 2BO1A 1QVFF 3JAMM 1YJWF 3RA5A 2OTJF 1VQ9F 3N4YA 3CCQF 5GANK 4EI8A 5GINC 3SIUA 3OBWA 3CCUF 1X52A 3CMEF 1NMUB 3N4ZA 4BVRA 2F9ZC 3NK6A 1VQLF 1W40A 3CPQA 3E20B 1CN7A 4NQ3A 2GLZA 3JCMM 3SIVA 5IT9M 5HXZA 3NVIB 4LCKA 1DT9A 1XBIA 3RA6A 3LWOC 5HXUA 1IPAA 1K8AH 1RA4A 3IR9A 2QEXF 4XCQA 2OHWA 1VQ4F 1T0KB 3AGKA 5HY2A 3GYQA 5GIPC 2OTLF 4X3MA 3E1YA 5HY0A 1VQPF 1M90H 3CC2F 1VQ7F 1KD1H 3CCSF 2ALEA 5HWEA 1GO0A 3VI6A 2QA4F 2KG4A 5DCVA 1QVGF 3ON1A 1RLGA 3I55F 1VQ5F 1SDSA 2JNBA 2KTVA 3CCJF 3O85A 4EI7A 5G4VC 4X3LA 3HAXD 1NJIH 3NMUC 3CCEF 3J7AR 1VQ8F 3G6EF 5GAPK 3CD6F 1H7MA 3CMAF 3V7QA 3J81M 5FJ4C 3CPWF 2LBXA 5FLXM 3V7EA 4BVQA 1W3EX 1N8RH 3OBYA 1X7PA 3CXCF 3LWRC 1JJ2F 1Q86H 3LFOA 4BY9D 2KTUA 3CCMF 5EO3A 3CCRF 1W41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PXW A;  2WAL A;  4NUT A;  3VMF B;  1GZ0 A;  3CC4 F;  2I6D A;  3NK7 A;  1W42 A;  5G4U C;  2VGN A;  4TZZ A;  1ZWZ A;  1CK2 A;  3CC7 F;  1VQ6 F;  3J80 M;  2CZW A;  3PAF A;  4BW0 B;  1S72 F;  5EWR A;  3HJW C;  1X7O A;  2QI2 A;  4C4W C;  5GIO C;  3LWQ C;  1YJN F;  1K73 H;  1W2B F;  2OZB A;  3NVK E;  1Q81 H;  3G71 F;  5A2Q M;  2LBW A;  1Q82 H;  2VGM A;  3PLA C;  1M1K H;  1VQK F;  3I56 F;  1VQO F;  1KQS F;  2AIF A;  1Q7Y H;  3WXM B;  1YHQ F;  2HVY D;  1E7K A;  3OW2 F;  1K9M H;  2FC3 A;  3G4S F;  1YIT F;  3FFM A;  3LWP C;  3CG6 A;  3MCA B;  1VQN F;  3LWV C;  1YJ9 F;  1YI2 F;  3CCV F;  1YIJ F;  3CCL F;  1KC8 H;  1VQM F;  1GO1 A;  2BO1 A;  1QVF F;  3JAM M;  1YJW F;  3RA5 A;  2OTJ F;  1VQ9 F;  3N4Y A;  3CCQ F;  5GAN K;  5GIN C;  3SIU A;  3OBW A;  3CCU F;  1X52 A;  3CME F;  1NMU B;  3N4Z A;  3NK6 A;  1VQL F;  1W40 A;  3CPQ A;  3E20 B;  1CN7 A;  3JCM M;  3SIV A;  5IT9 M;  3NVI B;  4LCK A;  1DT9 A;  1XBI A;  3RA6 A;  3LWO C;  1IPA A;  1K8A H;  1RA4 A;  3IR9 A;  2QEX F;  2OHW A;  1VQ4 F;  1T0K B;  3AGK A;  3GYQ A;  5GIP C;  2OTL F;  4X3M A;  3E1Y A;  1VQP F;  1M90 H;  3CC2 F;  1VQ7 F;  1KD1 H;  3CCS F;  2ALE A;  1GO0 A;  3VI6 A;  2QA4 F;  2KG4 A;  5DCV A;  1QVG F;  3ON1 A;  1RLG A;  3I55 F;  1VQ5 F;  1SDS A;  2JNB A;  2KTV A;  3CCJ F;  3O85 A;  5G4V C;  4X3L A;  3HAX D;  1NJI H;  3NMU C;  3CCE F;  3J7A R;  1VQ8 F;  3G6E F;  5GAP K;  3CD6 F;  1H7M A;  3CMA F;  3V7Q A;  3J81 M;  5FJ4 C;  3CPW F;  2LBX A;  5FLX M;  3V7E A;  1W3E X;  1N8R H;  3OBY A;  1X7P A;  3CXC F;  3LWR C;  1JJ2 F;  1Q86 H;  3LFO A;  4BY9 D;  2KTU A;  3CCM F;  5EO3 A;  3CCR F;  1W41 A; 
#chains in the Genus database with same CATH topology
 5J2T B;  2H8E A;  2WAL A;  1GZ0 A;  1W5F A;  3CC4 F;  2HX0 A;  3JAT B;  1SA0 B;  5LOV A;  4TV9 A;  3K0T A;  5EWR A;  5HY4 A;  4ZHW A;  2HS4 A;  4YJ2 B;  1X7O A;  2Q1X A;  3CYP B;  4C4W C;  3IMP A;  1TVK B;  1YJN F;  2HS0 A;  1Q81 H;  3V3T A;  3ZO8 A;  4B5C A;  5A2Q M;  5KX5 A;  1QAH A;  2ZVZ A;  3KIZ A;  4G4W A;  2HRY A;  1RQ7 A;  4IHJ A;  1Q7Y H;  3WXM B;  1YHQ F;  1TUB B;  2HVY D;  3OW2 F;  4G4X A;  3G4S F;  4X1Y A;  1YQN A;  4DRX A;  3MCA B;  3LWV C;  4DXD A;  5EB1 B;  5C8Y B;  3I7T A;  5J2U B;  3CCV F;  1YIJ F;  4WBN A;  2G9I A;  2UYN A;  5CB4 B;  3N2G B;  4G4Y A;  5IJ0 A;  2OTJ F;  1VQ9 F;  4B62 A;  4I55 B;  5GIN C;  2Z01 A;  3CCU F;  4O4H B;  1KNK A;  2UYJ A;  3C9R A;  3VIU A;  1W58 1;  1VQL F;  4R40 B;  5EZY B;  3CPQ A;  1CN7 A;  4NQ3 A;  3NVI B;  1DT9 A;  1XBI A;  4RQO A;  2BTO A;  3HKC B;  3QTY A;  5LOV B;  3HKB A;  4XCQ A;  2UZH A;  3C9S A;  2VAW A;  4YJ3 A;  3FD6 A;  1U3L A;  2PHN A;  2KGW A;  3GYQ A;  3S02 A;  1KNJ A;  4ZI7 A;  4X3M A;  1VQP F;  4KWE A;  4X20 A;  1VQ7 F;  3JAT A;  1FFX A;  1SA0 A;  3BYQ A;  1GO0 A;  3MCQ A;  3P4E A;  4IHJ B;  4BT6 A;  5DCV A;  4YJ2 A;  1VQ5 F;  4F6R B;  1TVK A;  3F6M A;  4X1Y B;  5G4V C;  3HKE B;  4ZHV A;  4X3L A;  4DRX B;  3HAX D;  3CCE F;  3J7A R;  2OTM A;  3LME A;  2YYE A;  5EAZ A;  3V7Q A;  5FJ4 C;  3CPW F;  1W5E A;  2EWC A;  5HP8 A;  3JAK A;  4O2A A;  4WBN B;  2K1S A;  3LDT A;  1N8R H;  1TUB A;  1X7P A;  3LWR C;  1U43 A;  3Q8H A;  1Q86 H;  2Q1Y A;  5IJ0 B;  4BY9 D;  3VTI C;  3ZP4 A;  5EO3 A;  3VCZ A;  1YGY A;  1W55 A;  5C8Y A;  5J2U A;  4BT4 A;  3F0E A;  2I6D A;  1W42 A;  4TZZ A;  3CC7 F;  4TUY B;  3N2G A;  4C82 A;  1S72 F;  3D54 A;  4I55 A;  5HY1 A;  2QI2 A;  1K73 H;  4IIJ A;  3PLA C;  1JD1 A;  5EZY A;  4YJ3 B;  1KQS F;  3L7Q A;  1E7K A;  4TV8 A;  2Z1T A;  4ZI7 B;  3HKC A;  3FFM A;  3IKF A;  1UFY A;  1VQN F;  4X20 B;  5IYZ B;  1FFX B;  2YXZ A;  4ZK7 A;  2H6L A;  3KJK A;  3KHN A;  3TD4 A;  2H8C A;  1UI9 A;  2P6Y A;  2VAP A;  4EI8 A;  3RYH B;  3SIU A;  3M4S A;  1X52 A;  2GZL A;  3JAK B;  3N4Z A;  4O2A B;  4O4J A;  4LNU B;  2F9Z C;  3NK6 A;  4RHA A;  3M1X A;  4I4T A;  3S0H A;  4F6R A;  2V9Y A;  5MN4 A;  3HKE A;  3P10 A;  3RA6 A;  3VOB A;  5CA0 B;  5HXU A;  3LWO C;  4U3J A;  4ZHY B;  1RA4 A;  3IR9 A;  3MDO A;  5MN6 A;  2QEX F;  2OHW A;  2ZOD A;  4BT7 A;  5ITZ B;  5GIP C;  1FNJ A;  5FNV B;  2OTL F;  1DBF A;  3OON A;  3D01 A;  5JQG B;  4IIJ B;  3CC2 F;  3ZP7 A;  2HP0 B;  1X25 A;  5MN5 A;  4TUY A;  3F0D A;  3JVH A;  3JAR B;  2RHH A;  4TV8 B;  1Z5W A;  2JNB A;  3CCJ F;  3F0G A;  4I50 A;  1NJI H;  5LP6 C;  1VQ8 F;  3VOA A;  1SZQ A;  3P0Z A;  3J81 M;  3K2X A;  3V7E A;  3RYF B;  1VQV A;  5KMG A;  1W3E X;  3OBY A;  3CXC F;  3ERN A;  4BT2 A;  3C9U A;  1JJ2 F;  2BTU A;  1U40 A;  3JAW A;  3LFO A;  4BT3 A;  2KTU A;  3CCM F;  2I6R A;  3E22 A;  4G4Z A;  5IYZ A;  3CCR F;  3JAS A;  3C8L A;  1VQ4 F;  1PXW A;  3VMF B;  2BTQ B;  3D00 A;  3NK7 A;  4O4J B;  2VGN A;  1ZWZ A;  3S0W A;  3MBM A;  5JCO A;  1RQ2 A;  3J80 M;  3FD5 A;  3PAF A;  4I4T B;  4B45 A;  2ZVY A;  3ZOP A;  5GIO C;  3QUW A;  3LWQ C;  3RYH A;  1W2B F;  2OZB A;  1Z5V A;  4BVT A;  4U3J B;  1H47 A;  4LNU A;  2LBW A;  3S06 A;  1Q82 H;  2RB9 A;  1VK3 A;  3I56 F;  3KJJ A;  1VQO F;  2AIF A;  3DC2 A;  2LCA A;  3JAL A;  3HTN A;  3B6N A;  2AMT A;  5CA0 A;  5LP6 B;  1K9M H;  1YIT F;  2DT4 A;  2AIZ P;  4O4L A;  1VH8 A;  1QD9 A;  2PMP A;  2UYK A;  4HNA B;  4EI9 A;  1YJ9 F;  1W5A A;  4ZOL B;  4ERH A;  3QHD A;  5AVM A;  1IV2 A;  2RHL A;  1VQM F;  1KC8 H;  5ITZ A;  3I3F A;  5FNV A;  2RHO A;  2BO1 A;  2HQS C;  3RA5 A;  5JQG A;  4NWO B;  4I50 B;  3UT5 A;  2HP3 A;  1GX1 A;  3CCQ F;  5GAN K;  2HP0 A;  2LBT A;  3WGK A;  2R6R 1;  3JAR A;  3EOR A;  3WPX A;  5KMG B;  2VXY A;  2CHS A;  5GON A;  3FPI A;  3CYQ A;  1IV4 A;  2GLZ A;  3JCM M;  3SIV A;  1T0A A;  2GVI A;  3RYI B;  5IT9 M;  5HXZ A;  3JAW B;  3V4D A;  3WGJ A;  4LCK A;  1RLU A;  3E22 B;  3JAS B;  5LYJ B;  1K8A H;  3RYF A;  3M84 A;  2CVL A;  4X1K A;  5EIB D;  4M8I A;  1T0K B;  3AGK A;  4B46 A;  5HY2 A;  2N48 A;  3VYS C;  5IJ9 B;  5CA1 A;  3E1Y A;  4G88 A;  1M90 H;  1OFU A;  3CCS F;  4O2B B;  2ALE A;  3K14 A;  3VI6 A;  2KG4 A;  1FNK A;  4G4V A;  4C8G A;  2IAF A;  1RLG A;  3JAL B;  3I55 F;  5EYP A;  1SDS A;  3TD3 A;  3IEW A;  2KTV A;  2MQE A;  4ZHQ B;  4O4L B;  1XV2 A;  3G6E F;  3F0F A;  5GAP K;  3WJR A;  1COM A;  3CMA F;  2IG8 A;  1JFF A;  4EB6 A;  4BVQ A;  3ESJ A;  1H48 A;  5LP6 A;  3WJP A;  4BT5 A;  2CSL A;  1R1M A;  3N2K B;  1CLI A;  3IEQ A;  3UT5 B;  1W41 A;  4HNA A;  4NUT A;  4ZOL A;  3VO8 A;  3T80 A;  5G4U C;  1J7H A;  1CK2 A;  5JVD A;  4BVS A;  3GTZ A;  1VQ6 F;  5GON B;  2CZW A;  4BW0 B;  3RE3 A;  3FBA A;  2VAM A;  1ONI A;  3HJW C;  3C9T A;  5LA6 B;  3WJQ A;  5HP7 A;  5JH7 A;  3S0Y A;  3NVK E;  4O4I A;  3WPW A;  3G71 F;  4E6E A;  4X1K B;  2VGM A;  5EIB C;  1M1K H;  5BMV A;  1VQK F;  3HKD B;  3U0O A;  3RYI A;  2RHJ A;  5LXT B;  2NMU A;  2FC3 A;  4X1I B;  5CA1 B;  2FGY A;  5LYJ A;  3R0P A;  3LWP C;  3CG6 A;  1JN1 A;  5B8F A;  2B33 A;  3VYU C;  2CHT A;  1YI2 F;  3CCL F;  3KE1 A;  1GO1 A;  2HRU A;  1NQ3 A;  5EYP B;  5IJ9 A;  4TV9 B;  2CW4 A;  1QVF F;  1W57 A;  3WGL A;  3JAM M;  4FFB A;  1FSZ A;  1YJW F;  1OAP A;  1ODE A;  3GHZ A;  3N4Y A;  3RYC A;  1JY8 A;  4O2B A;  5J2T A;  2CWJ A;  3OBW A;  1W59 A;  3CME F;  3TD5 A;  1NMU B;  4BVR A;  1JFF B;  4EB6 B;  5KX5 B;  4PWT A;  1W40 A;  1VHA A;  3E20 B;  3S03 A;  1IV1 A;  4ZHQ A;  1IV3 A;  5EB0 A;  1IPA A;  3ELC A;  1Q8R A;  2ZF8 A;  3K12 A;  2QTP A;  2UYP A;  2Z1E A;  5JVD B;  1PF5 A;  3HWU A;  2UYN B;  1XRG A;  3N2K A;  2ZOV A;  1W5B A;  5HY0 A;  5JH7 B;  2W8B C;  2IQQ A;  1KD1 H;  4O4I B;  4U39 A;  5JCO C;  4C81 A;  5HWE A;  2R75 1;  2HS3 A;  2QA4 F;  5BMV B;  4C8I A;  1QVG F;  3ON1 A;  5CB4 A;  2DYY A;  5LA6 A;  1QU9 A;  1U3P A;  3O85 A;  3IKE A;  3WGM A;  4EI7 A;  3NMU C;  3VYT C;  4C8E A;  3CD6 F;  1H7M A;  1XHO A;  3CB2 A;  3DDN A;  3HKD A;  2LBX A;  4O4H A;  5FLX M;  2L26 A;  5LXT A;  3HKB B;  3MQW A;  4X1I A;  2ZAU A;  2Z1U A;  3LYB A;  4FFB B;  3WGN A;  2Z1F A;  3RYC B; 
#chains in the Genus database with same CATH homology
 1PXW A;  2WAL A;  4NUT A;  3VMF B;  1GZ0 A;  3D00 A;  3CC4 F;  2I6D A;  3NK7 A;  1W42 A;  5G4U C;  2VGN A;  4TZZ A;  1ZWZ A;  1CK2 A;  3CC7 F;  4BVS A;  1VQ6 F;  3J80 M;  2CZW A;  3PAF A;  4BW0 B;  1S72 F;  5EWR A;  5HY4 A;  3HJW C;  1X7O A;  5HY1 A;  2QI2 A;  4C4W C;  5GIO C;  3LWQ C;  1YJN F;  1K73 H;  1W2B F;  2OZB A;  4BVT A;  3NVK E;  1Q81 H;  3G71 F;  3V3T A;  5A2Q M;  2LBW A;  1Q82 H;  2VGM A;  3PLA C;  1M1K H;  1VQK F;  3I56 F;  1VQO F;  1KQS F;  2AIF A;  1Q7Y H;  3WXM B;  1YHQ F;  2HVY D;  1E7K A;  3OW2 F;  1K9M H;  2FC3 A;  3G4S F;  1YIT F;  3FFM A;  2FGY A;  3LWP C;  3CG6 A;  3MCA B;  1VQN F;  3LWV C;  4EI9 A;  1YJ9 F;  1YI2 F;  3CCV F;  1YIJ F;  3CCL F;  1KC8 H;  1VQM F;  1GO1 A;  2BO1 A;  1QVF F;  3JAM M;  1YJW F;  3RA5 A;  2OTJ F;  1VQ9 F;  3N4Y A;  3CCQ F;  5GAN K;  4EI8 A;  5GIN C;  3SIU A;  3OBW A;  3CCU F;  1X52 A;  3CME F;  1NMU B;  3N4Z A;  4BVR A;  2F9Z C;  3NK6 A;  1VQL F;  1W40 A;  3CPQ A;  3E20 B;  1CN7 A;  4NQ3 A;  2GLZ A;  3JCM M;  3SIV A;  5IT9 M;  5HXZ A;  3NVI B;  4LCK A;  1DT9 A;  1XBI A;  3RA6 A;  3LWO C;  5HXU A;  1IPA A;  1K8A H;  1RA4 A;  3IR9 A;  2QEX F;  4XCQ A;  2OHW A;  1VQ4 F;  1T0K B;  3AGK A;  5HY2 A;  3GYQ A;  5GIP C;  2OTL F;  4X3M A;  3E1Y A;  5HY0 A;  1VQP F;  1M90 H;  3CC2 F;  1VQ7 F;  1KD1 H;  3CCS F;  2ALE A;  5HWE A;  1GO0 A;  3VI6 A;  2QA4 F;  2KG4 A;  5DCV A;  1QVG F;  3ON1 A;  1RLG A;  3I55 F;  1VQ5 F;  1SDS A;  2JNB A;  2KTV A;  3CCJ F;  3O85 A;  4EI7 A;  5G4V C;  4X3L A;  3HAX D;  1NJI H;  3NMU C;  3CCE F;  3J7A R;  1VQ8 F;  3G6E F;  5GAP K;  3CD6 F;  1H7M A;  3CMA F;  3V7Q A;  3J81 M;  5FJ4 C;  3CPW F;  2LBX A;  5FLX M;  3V7E A;  4BVQ A;  1W3E X;  1N8R H;  3OBY A;  1X7P A;  3CXC F;  3LWR C;  1JJ2 F;  1Q86 H;  3LFO A;  4BY9 D;  2KTU A;  3CCM F;  5EO3 A;  3CCR F;  1W41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...