1VQKP

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqkP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqkP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqkP02
3CMAP 1KQSO 1YJNP 3CCMP 1K73Q 1KD1Q 1M1KQ 3G4SP 3OW2O 2QA4P 1S72P 1Q82Q 3CCUP 3CCJP 1NJIQ 3CXCO 3CC4P 3CC7P 3CCEP 3G71P 1Q86Q 1VQOP 1N8RQ 1KC8Q 1K8AQ 1YJ9P 3I56P 2OTLP 3CCSP 1VQ7P 1VQLP 3G6EP 3CPWO 2QEXP 1QVFO 1VQPP 1QVGO 1W2BO 1VQNP 1Q7YQ 1YJWP 3CMEP 1VQ5P 1YI2P 3CCQP 3I55P 3CCVP 1VQMP 1YITP 1VQKP 1VQ8P 3CCLP 1VQ4P 1YHQP 1YIJP 1M90Q 1JJ2O 1K9MQ 3CC2P 3CD6P 2OTJP 1VQ9P 1VQ6P 3CCRP 1Q81Q
chains in the Genus database with same CATH superfamily
1SFCB 3VRLC 1GL2D 3RL0B 3VN0A 1VHNA 1FZBA 5CBNA 2BHVA 1H89A 3BRVB 1T2KD 1YBKA 5AVXB 1JEKA 2Z5HA 5AVSB 2FAEA 2J58A 1YTZI 2KOOA 1P84I 1JB0J 2YIUC 5DJUB 3AE8C 2HPCA 2QG4A 1VF5B 3V6IA 3LRYA 2KYVA 1RE4C 3PLNA 5HGNA 3GKLC 3EFGA 2FQ0A 5GTIE 1M57D 1FZAA 2K37A 1VL2A 3KQGA 2JQ4A 3L72G 3WMM0 4XROA 1H0TB 3G26A 1KD1Q 2XXMA 1PIXA 1ZRTD 2XNDH 4XFJA 2GDWA 2CWOA 5L8RJ 1KB9D 4HKZH 2N5HA 4NPEA 1L4AB 2LR2A 5BS2A 4N78E 1FZCB 2K94A 2E5YA 3CI9A 1UIIA 5AVUB 1IO4A 1NTZD 4XA4A 4R0MA 3NFQA 4H13D 1PV3A 1NTMG 1LTJA 2KZIA 2GZFA 3CLQA 3KPEA 2QIWA 3BCCG 3L35A 4ASWA 2EHSA 2QJYB 3TF5A 2IBZD 2N1TC 3SWKA 4XFZA 2KUBA 3MP7B 1HQBA 2N9YB 3L73J 1FAVA 2LIUA 4PV1B 3D70A 3W68A 2Y0CA 1EC5A 1N73A 4H0LD 1JY3P 2WT7B 1EMVA 2CPBA 3E1IA 4Y99C 2K9JB 1URQD 3F5HA 1J2JB 1KB9I 5TISH 4F37A 3G28A 3M9HA 1NTMK 3RK2D 1PPJD 2M5AA 4H2YC 3CX5H 1KILC 1LTSC 2CK3H 1VQ6P 5CBOA 1KYOI 2GDYA 4WB4A 3B5NB 3B71A 1SQVD 1LT9C 4NEOA 3L74J 1GU5A 1LTJC 3E7KA 2OYHA 2M8LA 2IBZI 2WSFH 3A0BH 1QL2A 4HJGH 2JAZA 5HGLA 1AV1A 3KDPB 1SP4A 2AFEA 5TISE 3PJSK 2MJZA 1A8OA 4PJ0H 1FDOA 2M8NA 3GMAA 2ZYAA 2KLUA 3M06A 1N7SD 1LTBC 2YXQB 1OMIA 5AVRB 3CCQP 3KHUA 4H44D 1KTMA 2H43A 1PP9E 2R3SA 3TGUD 2DNWA 3RL0D 3EJBA 2QM7A 1VQLP 2VSQA 3HYBA 5CJ4A 2A45G 1VQPP 4U3FE 3H1HE 5APTA 4N3YB 3T97A 1BCCJ 3N4XA 1CW5A 3HUSB 1HWTC 2M0BA 4PJ0E 2FYZA 1SQXJ 1VF5D 2E74B 1L0LE 1JY3N 2IFMA 4WWIA 2GZEA 1PZQA 2SPZA 2C0XA 2H7HA 1IFNA 1HBWA 3GZMA 4IFDK 4BXLA 2BCCJ 2FY8A 3L75J 1GW3A 3TNUB 2FHSC 3L37A 1OVRA 3CWBD 3MHVA 2Y9ZA 3HZQA 4IZ6A 2OQQA 1L4AD 3TSIA 2ZT9C 1W5CE 1OR5A 3H1JJ 2LL8A 1J1EC 3P32A 1M1JA 3GJNA 2KLVA 3H6PA 2B87A 1SQVK 3TDKA 2E1MA 2L4BA 2V7QH 1BSNA 5AW7B 3L70J 1VQ8P 3WUVA 2WPTA 4K35A 5KP6B 4WBAA 2WPQA 4PD4H 1PGPA 1JY3O 5AVYB 3FGAD 1L0NG 3VMZA 5H2FH 3PP5A 4I2LC 4D6TD 5KLVG 2QEXP 1OW8A 4OWFA 5F2KA 3KYQA 3M0AA 5BU8B 3MGEA 3VP8A 1BGYJ 2HYNA 2FYUG 2WSEJ 2W83C 3B4QA 2EG5A 3JCUE 1KN7A 1BE3E 5JPAA 1NYHA 5TJHA 5APWA 1MZ8A 1FDMA 4U7JA 1RH5B 1NTKD 1K9MQ 3CL3D 4BRYB 2NO8A 4HH2A 1LWUC 3BRTB 2W8ZA 2XZ0D 2BASA 5H2FE 1CI6B 4WY4D 4IL6X 1M1JC 3B5ND 1IJDB 4U0BA 2C9LY 3H1LG 2MF4A 1E79H 1PEMA 1L0NK 2YIUB 2MVVA 5KLVK 1G2CB 2I1KA 3V4QA 4PH0A 3CCVP 2O1JA 3L72J 5C39A 3RK3E 5AW9B 1WRGA 2E76C 3RBZA 2NPSD 1G1JA 1GK6A 1QRJA 3GLMA 3DS4A 1W2BO 1IC2A 1GZLA 2BEQD 2WSFJ 1OVUA 4N78D 2Q9IA 1SQQG 3AEDC 2YXRB 2BCCD 2QA4P 3V2QA 2QE7H 1NTMJ 2YO2A 3I56P 2G3AA 2GDXA 4C7NA 3BCCJ 5B66H 1IK9A 3MIWA 1YITP 4UB6H 1NOHA 3C8VA 1YIJP 1L0HA 1LNQA 4EOTA 1BSHA 2A06E 2K3RA 2WPRA 1LTTC 1HY8A 2D2CC 2EFJA 2KP8A 2P7JA 4DT0A 2KOPA 4LC1A 4A7PA 2HPCB 1EDJA 2W6AA 4LGDE 2RKLA 1Z56A 1SQQK 5EFWB 4IFMA 2O1KA 3L73E 2R32A 1JM0A 1GL2A 5B66E 1U7MA 3AE4C 1EDKA 1X9VA 4O9BA 4OVNF 4U0CA 1OIPA 3OJAB 2XKMA 1PEOA 1M90Q 4OGQD 2Z44A 5KLIB 3EWKA 5CCGD 1VKUA 4IFFA 1J1DB 1IFIA 3Q20A 1HTLC 3OA7A 1GPJA 4L73A 3WUTA 3EJDA 3L71J 2QJKC 3CCSP 3AEEC 1SQBG 1RO2A 2IZ0A 2AEMA 2WZ7A 1U57A 2POHA 5KJ7D 2K9YA 1QX8A 1LTJB 4JQ0D 1NU1G 3L74E 1OWAA 4D6TE 3H1IG 4KT0J 3HTKA 2V7QJ 4DJGA 1MZ9A 1YHQP 1RQUA 2VLNA 1S5LX 1PP9D 2L5GB 4ZKUA 3VYIA 2FXMA 3H32A 4DG9A 2XV5A 3CE7A 2FVFA 1GL2C 5F2OA 1N73B 2FVEA 3AEFC 3CMEP 3KZIH 1HH0A 1SQBK 1T2KC 4U3FD 3I55P 3H1HD 1NKNA 3TK1A 1NTKE 1L0IA 2JJLA 2JDIH 5DJTB 1OX3A 3ABVC 5HGOA 4RO0A 2N1TA 1GTWA 5EJDA 5EW5E 2IDBA 1T3JA 5KKZC 5AVVB 3FWLA 4H2XC 2M5AB 3R2PA 1AYIA 1G1IA 1L0LD 1NU1K 2PNGA 1LTIC 5APUA 2K92A 1EZVE 3IFMA 3HD7D 1FJKA 1BCCE 1JOCA 3O6QA 1FBMA 2LIWA 3AE2C 1FC2C 1TU3F 4GOFA 1Z6MA 4U0FA 2PGDA 3HE4A 1SQXE 2OYHB 1JNMA 2KNCB 3H1KG 1GW4A 2PENA 2ZXEB 1URQA 2WQYC 2PEQA 3AE1C 1M56D 2Q7CA 3B8EB 2K1AA 1KILA 2VRSA 5F2NA 1YQ4C 2BCCE 3CCRP 3L75E 1HGZA 1FZFA 3AE7C 2JWDA 1LT9A 2BUOA 2ZT9B 4JF7A 3USSA 1AA0A 2Q6QA 2PEMA 4IPYA 1J1EB 2B88A 2KW2A 4XFYA 2LKIA 4H13C 3H1JE 3M0DC 3M1MA 2MR7A 4MRTC 1D7MA 2WSEH 2NRGA 3OW2O 1M6NA 5AW4B 3KXDA 4GT1A 1L0NJ 2JEEA 4L74A 3L71D 2N6ZA 3T97B 2N98A 2JR8A 3E1RA 5KLVJ 1NQ4A 3OAKA 2N50A 1S9KE 3L70E 3BASA 2ZAEB 3GZLA 1RF1A 1N7SA 2FYUJ 3II6A 1RQVA 2VLOA 4ZMDA 4DCKA 3MTUE 1BE3D 2AEFA 1GDTA 1N86A 2Y0DA 4H0LC 3U1CA 2QSIA 1RHZB 1AJYA 3DS0A 1PGOA 1URQC 3GHGC 1VQ5P 5APXA 1BGYE 2CQ8A 4PD4D 3RK2C 4EIJA 2GM4A 5AVWB 1AUMA 1RO0A 4PH1A 1JO5A 4CA3A 1NTZG 3H1LJ 2JBGA 2AF8A 2Q5UA 2KOGA 1M1JB 3AE3C 2B87B 1BDDA 2CPSA 3Q5SA 3MZWB 1IZNB 3RK3D 2IBZG 5APYA 4GOEA 2KSJA 3SFEC 1Q82Q 1CZQA 3RK3C 4H2WC 1H0TA 2WPSA 2P9XA 1BDCA 3PRJA 3CX5E 2AFDA 2OYOA 2IYPA 3L72E 1SQQJ 1EIAA 1JJ2O 3M91A 5AVQB 1RF1C 1S3JA 1N7SC 2WMMA 2QJPC 1SFCD 4H44C 2LPKA 5CMZA 3V2PA 1NTZK 1SFCC 2P67A 3GF7A 1A43A 2OYIA 3RL0C 3A0BE 2E5TA 3SFDC 3G9RA 3FX0A 1RNIA 2PAJA 1VQKP 1BAJA 2O01N 1PPJG 1SQPJ 2Z4EA 2L9FA 1RE3A 2K0XA 1GXHA 1GMJA 1A02F 2A06D 1NTME 4N6JA 1SQVG 3VTPC 2KR5A 3VMXA 3G6EP 3BCCE 5K5GB 5HVCA 1VF5C 2LMLA 1X0TA 2E75B 4ZNCA 2D2CB 4KHXA 1HUCA 2Z5IA 4UHPB 3L73D 1KYOH 4JPZB 1JTHA 1AFOA 1VQNP 2LXCB 2FYUD 1MFTA 3WUUA 2YMYA 2MD9A 4COPA 1SLQA 1KV4A 1ACPA 1LWUA 2HODA 2GZIA 1L4AC 4C7RA 1FZCC 3TGUG 4GODA 1NJIQ 2GZGA 1NKZB 2HLOA 4I7ZC 4WY4A 2CG5B 1SQBJ 4HB1A 7CEIA 1JMBA 2OYIC 1PL5A 3D6ZA 2UWJE 4IOIH 1EXIA 1RE3C 1H88A 3PH0A 1KYOE 4C7NB 2QJYC 1NU1J 2Z46A 5DCKA 3L71E 5BS1A 1IUQA 3A3YB 3L74D 4IL6H 3H1IJ 1ZN5A 2NPSA 2J5UA 4M0IA 2A45H 3GW6A 1DEEG 4JYCA 4L75A 4PV1D 2O01H 2JGPA 3H4EA 2N5IA 2W90A 2V4HA 1K73Q 1KQFB 3W67A 2PEIA 3O8ZA 3N7NA 2ZVNB 4W7ZA 2B89A 2M8PA 3K5BA 3CWBG 3CXHH 1FE6A 1LGHB 1YI2P 1PFIA 3SWFA 3A2AA 1HJ0A 4PD4E 2JKVA 2KWLA 3NTEA 2B9BA 5KAIH 1HVVA 4IL6E 5BU5A 2KGAA 5CZDB 1M7LA 2AVAA 3Q3DA 1AQTA 2XDJA 1KILE 4WY4C 2FXPA 1ZP0C 3B5NC 1EZVD 3A0HH 3G1GA 3AEGC 5KKZB 1FOSF 1BCCD 1SQPD 2J59M 1S4XA 3Q5RA 1K05A 4BPGA 3AE6C 3FXEA 3FWNA 1NO4A 3S1KA 1SQXD 1ZW0A 4U0EA 3H1KJ 3CXHE 1N8RQ 5CHXA 1UJZA 1FJPA 2ZJSE 2NPSC 1Q90D 4D6TG 3V5BA 1LP1A 1MFZA 2R5BA 1DD3A 4AYCA 2H89C 2XNXA 5KAIE 2JB0A 1ZR4A 2HR3A 2WTYA 2QNWA 1U7JA 3RBXA 3L75D 1WT6A 5AW0B 3P8MC 3CCJP 3LMOA 3HTKB 5CCGA 2KB7P 3NTNA 5AW2B 3A0HE 2WSCJ 3DS1A 5CCHD 4GKGA 3B4SA 1VQMP 2MVUA 3DS5A 3H32B 3H1JD 2ZFCA 5AW3B 2ZXXA 1NTKG 2XU6A 5KJ7A 2L22A 2LOLA 4PXHB 3V4WA 4DOJA 1DNYA 3P05A 2OTKE 2E74D 1EZVI 1D1DA 2N1TB 1FDIA 2PP6A 3DPHA 1S9KD 3L70D 1QL1A 3I5CA 3C1LA 2E75D 3C9IA 3RGUA 1L0NE 3G21A 5KLVE 1VQOP 3O6QB 3CPWO 1KORA 3D6YA 2KG6A 1H8AA 2O3JA 4UB6E 1Q7YQ 4U0AA 3HE4B 3HE5A 4XE5B 4Y99B 2FYUE 2FFDA 2Q3EA 1BGYD 2HG5D 1DIPA 1NGMB 5APVA 2AXTH 3IAOA 3U43A 2GUVA 1W2EA 2P2UA 3A7OA 1NH4A 4LLHA 1URQB 1VDFA 2BCCG 1K30A 1NTKK 1NTZJ 1S5LH 4OGQC 5CCGC 3M9BA 2KK7A 3SSUA 2OTLP 2RMZA 1KILB 3RK2B 4EDFA 2L6EA 1Q2NA 4JYBA 1YJWP 2KG9A 3PHLA 1LT9B 2FXOA 2YKOA 1M74A 3HD7A 3MGNA 3CMAP 5KJ7C 3DS3A 1XTCC 2WWWA 3H1LE 3G0VA 3CCEP 1K8AQ 1ZXGA 3PTZA 5AW8B 5KP7B 1LTAC 3CX5D 3L72D 5AW1B 5KP8B 1S5LE 5E79H 2R5DA 2QRXA 1SS1A 4U0DA 3EJEA 1NAYA 4NPDA 1FZEA 2FVAA 2BQ1E 1MUUA 2IX7C 1RF1B 1N7SB 2CGQA 4MN4C 1EDIA 2R44A 1SQQE 2MY5A 2ZVOB 4H44B 2DW3A 2O01J 3M0DA 2FFDC 2AEJA 2KSEA 2PY8A 2FYNC 1SQVJ 1IFDA 1LT1A 1NTMD 2E42A 2X2BA 3BCCD 1RY3A 5CJ0A 2WITA 2Y0EA 4TT3H 2FQ1A 1PEQA 1SQPE 3CCLP 4RESB 5E79E 1M8OB 1SVFA 2MR8A 3HD7C 1A02J 1AVYA 5AVTB 3B5IA 2PEJA 1N2DC 4C46A 2QM8A 2JP3A 1YJ9P 1GK4A 3KZIE 2M8RA 3CX5I 4ZKPA 1OFCX 3GHGA 1ZMBA 1GD2E 3LW5J 4BPHA 2EHTA 1QLED 1KQSO 3TGUJ 1PP9G 2KS1A 3VMYA 4PWVB 3QH9A 4NPFX 2ONTA 1JUNA 2W6BA 3E2DA 1DX7A 2K0DX 4I7ZB 1EQ7A 5HGMA 3V2RA 4U3FG 3H1HG 1DH3A 2KI7B 3H25A 3BATA 1YJNP 2OYIB 2KGCA 2XV6A 1KYOD 3CXCO 1ZNVA 2OARA 3H0DA 1SQBE 2YO3A 1UIXA 3L36A 1N7LA 1L0LG 3MD0A 1K04A 2N1TD 3Q5PA 2HFED 2JYGA 4WVZA 2JYLA 1QGKB 1NU1E 1T8ZA 2WPVB 4HKGA 4K3AA 1P84H 1YYCA 3H1IE 4GR2A 3CWBJ 1SFCA 1ZOYC 1QEXA 1EDLA 4BWNA 1KQLA 3Q1MA 1JTHB 3BVHA 2C0WA 1AVOA 4QNBA 1KC8Q 5KLIC 3FXDA 1J1DC 1KILD 2YMKA 2KGEA 1LWUB 2HODB 3M9QA 2K0YA 4L76A 4OH8B 2WVRA 2KZJA 1AF8A 1DEBA 3TYYA 4COCA 1S1CX 2M5RA 1L0LK 4EI2A 3S9OA 1JCCA 1OW6A 4WY4B 1P84E 2H8PD 3AEBC 1HGVA 4W80A 1WMKA 1OXZA 3CXHD 2BEZF 3L71G 1KLPA 4D6TJ 1FR2A 2WSCH 3NY7B 3AECC 4BPFA 2KNCA 2E76B 2KORA 1Y9BA 1L4AA 2NPSB 3H1KE 1GXGA 3GG2A 1FZCA 3EFFK 3G71P 1BE3G 4RKUJ 3P8CE 3RL0g 1JMMA 2KOSA 2L91A 3U1AA 2JO0A 2P1JA 1R8EA 4ASVA 3V2NA 2QVAA 2L0QA 2FKWB 2I8DA 4PD4I 1NTKJ 1N73C 1OVVA 5HV8A 2ITAA 2H88C 1BXIA 2KGDA 2A45I 1IFMA 2KG8A 1CEIA 4GIFA 2LTEA 2GZJA 4GDOA 1KB9H 1ZV8A 2K5XA 2DGYA 2FADA 5GTHH 1ZR2A 1VPCA 4RJTA 2LKMA 1KMIZ 1X79B 1L0ND 2W27A 2GA1A 3CXHI 2KOQA 4UB8H 5KLVD 2Y9YA 2P10A 2WT7A 3RG2A 3Q2YA 2OYHC 2FACA 2K9JA 1USDA 1NHLA 4WYMA 1VQ9P 1JY2P 3NMDA 3MUDA 5I4TG 1ZRTE 1F80D 2R3CA 3WU2H 1LP1B 3EQ2A 3G3ZA 1X3OA 3S4RA 1T3UA 1KB9E 2ZT9D 2Q1KA 1R5LA 5GTHE 2W6JH 3B5NA 1NVOA 2EIAA 2GUSA 4OGQB 2E43A 2MKVA 5APQA 1GU4A 1CSBA 2QJKB 2OGUA 1NTZE 4Z1MH 4UB8E 4W7YA 4GR6A 3RG6C 5BVZA 1R5SA 3IN6A 3JCUH 5AVZB 3H1LD 4I6MC 2A06G 2KXPB 2YKQA 2LXBA 4Y28J 1Y47A 2P58A 2JO1A 3JC22 4DZOA 2IBZE 2YNYA 1KFMA 3AE9C 2OTJP 1USEA 3WU2E 4PV1C 2K88A 2PEOA 2K2QA 2IYOA 3DTJA 2I1JA 1YQ3C 3L73G 2N6YA 1SQQD 4B86A 5APSA 2M3BA 4AUWA 3UIAA 5CCHA 1KZUB 1GL2B 2PRRA 1IK7A 3MUDC 2M3EA 4QKOA 4TLFA 2Z45A 3CC4P 1IMQA 3HE5B 2XZRA 2FFDB 2VLQA 4R4LA 2N9BA 4HYTB 3VMAA 3HUSA 4XRQA 1QVGO 1PPJE 2FYNB 2VLPA 1FZGA 4M3LA 3G1IA 1E5WA 3LW5H 2ERHA 1UNKA 1Q81Q 3AEAC 3IF4A 1M1KQ 1SQVE 2K93A 1Y8AA 3WBHA 1NWQA 1JY2N 2NZ2A 3P7KA 3HD7B 1DD4A 3L74G 1FS0E 1X8YA 3TNUA 4EYYQ 2E76D 3IR9A 1FU1A 2WSSH 1PP9J 2FYUK 1KQGB 1HF9A 3G29A 1E6JP 3CC7P 4KJMA 5KTBA 4YPCA 2YKPA 1QVFO 3ZDMA 2IZ1A 3R4YA 2FBWC 3ITKA 2KIKA 3CC2P 3CD6P 1PEUA 3H1HJ 4U3FJ 5CCHC 2JWAA 2ZYDA 2LF4A 3TGUE 3CCMP 3NXSA 1LJ2A 3G4SP 4H13B 1EXJA 1NAFA 1SQBD 1PGJA 1L0LJ 3HUSC 2FQ2A 3VP9A 1YTZT 3LIEA 4JBZA 1RF0A 4AQRD 2C9NY 2PFXA 3F89A 1EZVG 2E74C 1LTGC 5KAFH 1AQ5A 3A5TA 3U59A 1BCCG 1SQPG 5B5EH 1JCDA 1JY2O 1NU1D 2D2CD 1E0HA 2Q3IA 2E75C 3DS2A 1SQXG 3H1ID 1L2PA 3HRNA 4CPGA 2XT1A 3D71A 2IFNA 1X22A 3SWYA 2RN0A 1VQ4P 4H0LB 4YXDC 1S72P 2G8YA 3GHGB 3L75G 4YTPC 3CWBE 4I1LA 4BRYA 1XTGB 1OW7A 4XFXA 3VOPA 1CI6A 4QMAA 5KAFE 5B5EE 2KS1B 3H1JG 1IFPA 1SQPK 1P84D 1G2CA 2XZ1C 2RH0A 1Q86Q 1RE4A 1VQ7P 1MKMA 3QWOC 4R4MA 1SQXK 1S2EA 3H47A 4YXWH 1ZLLA 2KODA 2AXTE 1RF0C 2ROQA 3RK3B 1ZMEC 1EOQA 1HJBA 1OZHA 3L70G 1M6EX 2JU2A 2IPPA 2JU1A 3GF3A 5AW6B 1IMPA 1T8KA 3H1KD 5M1BA 3AE5C 3CCUP 1BE3J 3LIDA 3L4FA 1PGQA 2ZYGA 3P8CD 1DV5A 1FOSE 2QJPB 1MV8A 1KFNA 2CNRA 2AXCA 1T6AA 2GYKA 1IFJA 2PEKA 3JSVC 5GTIH 1BGYG 5AW5B
chains in the Genus database with same CATH topology
3VRLC 3B5IA 2PEJA 4XFZA 1K30A 2QA4P 1Q82Q 2Z45A 4U0EA 1NJIQ 2BUOA 3CC4P 3DS2A 2BHVA 1N8RQ 4QNBA 1KC8Q 1YJ9P 3I56P 2OTLP 2P9XA 1VQLP 2PEMA 4IPYA 4XRQA 3HYBA 2QEXP 2XT1A 1VQPP 2L6EA 1QVGO 4XFYA 1YJWP 5F2KA 4COCA 1ZMBA 1YITP 1VQ4P 1EIAA 1YHQP 1M74A 3M1MA 4WYMA 1YIJP 1JJ2O 3MGEA 1VQ9P 3G1IA 1Q81Q 3CMAP 2EG5A 1KQSO 5I4TG 3DS3A 1M1KQ 5JPAA 3OW2O 1M6NA 2Z46A 1S72P 5DCKA 3CCJP 3G0VA 3WBHA 5BS1A 3CCEP 1IUQA 3LRYA 1K8AQ 3G28A 1A43A 2ONTA 5F2OA 2EFJA 4XFXA 3DS1A 4M0IA 5HGNA 2EIAA 3CMEP 1RNIA 3E2DA 1VQKP 3I55P 1VQMP 3DS5A 1BAJA 1K9MQ 5HGMA 5HGOA 3H4EA 1VQ6P 4XROA 1YJNP 3G26A 1K73Q 2XXMA 1KD1Q 4GR6A 3RG6C 2XV6A 3G29A 2PEIA 1E6JP 3CXCO 3CC7P 3G71P 1Q86Q 2OARA 4U0BA 4U0DA 3H0DA 2CWOA 3HZQA 3P05A 2BQ1E 1VQ7P 3G6EP 2M8PA 1PEMA 3DS0A 1D1DA 1QVFO 3DPHA 2JO0A 3H47A 2M8LA 5BS2A 4U0CA 2JYGA 1VQ5P 1YI2P 2KODA 4PH0A 3CCVP 2JYLA 1PEOA 3CC2P 1M90Q 1EOQA 3CD6P 1PEUA 2OTJP 2Z44A 5HGLA 2LF4A 1M6EX 4U0FA 3NTEA 1AUMA 2PY8A 3CCMP 3Q20A 1RO0A 3G21A 4PH1A 3G4SP 2PEOA 3CCUP 1A8OA 3DTJA 1VQOP 4GR2A 3CCSP 2PENA 1QRJA 3CPWO 2E1MA 2M8NA 3DS4A 1RO2A 1W2BO 2PEQA 1VQNP 1Q7YQ 4U0AA 2DGYA 3G1GA 1PEQA 3CCQP 3CCLP 1VQ8P 4COPA 5F2NA 2PEKA 3CCRP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA P;  1KQS O;  1YJN P;  3CCM P;  1K73 Q;  1KD1 Q;  1M1K Q;  3G4S P;  3OW2 O;  2QA4 P;  1S72 P;  1Q82 Q;  3CCU P;  3CCJ P;  1NJI Q;  3CXC O;  3CC4 P;  3CC7 P;  3CCE P;  3G71 P;  1Q86 Q;  1VQO P;  1N8R Q;  1KC8 Q;  1K8A Q;  1YJ9 P;  3I56 P;  2OTL P;  3CCS P;  1VQ7 P;  1VQL P;  3G6E P;  3CPW O;  2QEX P;  1QVF O;  1VQP P;  1QVG O;  1W2B O;  1VQN P;  1Q7Y Q;  1YJW P;  3CME P;  1VQ5 P;  1YI2 P;  3CCQ P;  3I55 P;  3CCV P;  1VQM P;  1YIT P;  1VQK P;  1VQ8 P;  3CCL P;  1VQ4 P;  1YHQ P;  1YIJ P;  1M90 Q;  1JJ2 O;  1K9M Q;  3CC2 P;  3CD6 P;  2OTJ P;  1VQ9 P;  1VQ6 P;  3CCR P;  1Q81 Q; 
#chains in the Genus database with same CATH topology
 1SFC B;  3VRL C;  1GL2 D;  3RL0 B;  3VN0 A;  1VHN A;  1FZB A;  5CBN A;  2BHV A;  1H89 A;  3BRV B;  1T2K D;  1YBK A;  5AVX B;  1JEK A;  2Z5H A;  5AVS B;  2FAE A;  2J58 A;  1YTZ I;  2KOO A;  1P84 I;  1JB0 J;  2YIU C;  5DJU B;  3AE8 C;  2HPC A;  2QG4 A;  1VF5 B;  3V6I A;  3LRY A;  2KYV A;  1RE4 C;  3PLN A;  5HGN A;  3GKL C;  3EFG A;  2FQ0 A;  5GTI E;  1M57 D;  1FZA A;  2K37 A;  1VL2 A;  3KQG A;  2JQ4 A;  3L72 G;  3WMM 0;  4XRO A;  1H0T B;  3G26 A;  1KD1 Q;  2XXM A;  1PIX A;  1ZRT D;  2XND H;  4XFJ A;  2GDW A;  2CWO A;  5L8R J;  1KB9 D;  4HKZ H;  2N5H A;  4NPE A;  1L4A B;  2LR2 A;  5BS2 A;  4N78 E;  1FZC B;  2K94 A;  2E5Y A;  3CI9 A;  1UII A;  5AVU B;  1IO4 A;  1NTZ D;  4XA4 A;  4R0M A;  3NFQ A;  4H13 D;  1PV3 A;  1NTM G;  1LTJ A;  2KZI A;  2GZF A;  3CLQ A;  3KPE A;  2QIW A;  3BCC G;  3L35 A;  4ASW A;  2EHS A;  2QJY B;  3TF5 A;  2IBZ D;  2N1T C;  3SWK A;  4XFZ A;  2KUB A;  3MP7 B;  1HQB A;  2N9Y B;  3L73 J;  1FAV A;  2LIU A;  4PV1 B;  3D70 A;  3W68 A;  2Y0C A;  1EC5 A;  1N73 A;  4H0L D;  1JY3 P;  2WT7 B;  1EMV A;  2CPB A;  3E1I A;  4Y99 C;  2K9J B;  1URQ D;  3F5H A;  1J2J B;  1KB9 I;  5TIS H;  4F37 A;  3G28 A;  3M9H A;  1NTM K;  3RK2 D;  1PPJ D;  2M5A A;  4H2Y C;  3CX5 H;  1KIL C;  1LTS C;  2CK3 H;  1VQ6 P;  5CBO A;  1KYO I;  2GDY A;  4WB4 A;  3B5N B;  3B71 A;  1SQV D;  1LT9 C;  4NEO A;  3L74 J;  1GU5 A;  1LTJ C;  3E7K A;  2OYH A;  2M8L A;  2IBZ I;  2WSF H;  3A0B H;  1QL2 A;  4HJG H;  2JAZ A;  5HGL A;  1AV1 A;  3KDP B;  1SP4 A;  2AFE A;  5TIS E;  3PJS K;  2MJZ A;  1A8O A;  4PJ0 H;  1FDO A;  2M8N A;  3GMA A;  2ZYA A;  2KLU A;  3M06 A;  1N7S D;  1LTB C;  2YXQ B;  1OMI A;  5AVR B;  3CCQ P;  3KHU A;  4H44 D;  1KTM A;  2H43 A;  1PP9 E;  2R3S A;  3TGU D;  2DNW A;  3RL0 D;  3EJB A;  2QM7 A;  1VQL P;  2VSQ A;  3HYB A;  5CJ4 A;  2A45 G;  1VQP P;  4U3F E;  3H1H E;  5APT A;  4N3Y B;  3T97 A;  1BCC J;  3N4X A;  1CW5 A;  3HUS B;  1HWT C;  2M0B A;  4PJ0 E;  2FYZ A;  1SQX J;  1VF5 D;  2E74 B;  1L0L E;  1JY3 N;  2IFM A;  4WWI A;  2GZE A;  1PZQ A;  2SPZ A;  2C0X A;  2H7H A;  1IFN A;  1HBW A;  3GZM A;  4IFD K;  4BXL A;  2BCC J;  2FY8 A;  3L75 J;  1GW3 A;  3TNU B;  2FHS C;  3L37 A;  1OVR A;  3CWB D;  3MHV A;  2Y9Z A;  3HZQ A;  4IZ6 A;  2OQQ A;  1L4A D;  3TSI A;  2ZT9 C;  1W5C E;  1OR5 A;  3H1J J;  2LL8 A;  1J1E C;  3P32 A;  1M1J A;  3GJN A;  2KLV A;  3H6P A;  2B87 A;  1SQV K;  3TDK A;  2E1M A;  2L4B A;  2V7Q H;  1BSN A;  5AW7 B;  3L70 J;  1VQ8 P;  3WUV A;  2WPT A;  4K35 A;  5KP6 B;  4WBA A;  2WPQ A;  4PD4 H;  1PGP A;  1JY3 O;  5AVY B;  3FGA D;  1L0N G;  3VMZ A;  5H2F H;  3PP5 A;  4I2L C;  4D6T D;  5KLV G;  2QEX P;  1OW8 A;  4OWF A;  5F2K A;  3KYQ A;  3M0A A;  5BU8 B;  3MGE A;  3VP8 A;  1BGY J;  2HYN A;  2FYU G;  2WSE J;  2W83 C;  3B4Q A;  2EG5 A;  3JCU E;  1KN7 A;  1BE3 E;  5JPA A;  1NYH A;  5TJH A;  5APW A;  1MZ8 A;  1FDM A;  4U7J A;  1RH5 B;  1NTK D;  1K9M Q;  3CL3 D;  4BRY B;  2NO8 A;  4HH2 A;  1LWU C;  3BRT B;  2W8Z A;  2XZ0 D;  2BAS A;  5H2F E;  1CI6 B;  4WY4 D;  4IL6 X;  1M1J C;  3B5N D;  1IJD B;  4U0B A;  2C9L Y;  3H1L G;  2MF4 A;  1E79 H;  1PEM A;  1L0N K;  2YIU B;  2MVV A;  5KLV K;  1G2C B;  2I1K A;  3V4Q A;  4PH0 A;  3CCV P;  2O1J A;  3L72 J;  5C39 A;  3RK3 E;  5AW9 B;  1WRG A;  2E76 C;  3RBZ A;  2NPS D;  1G1J A;  1GK6 A;  1QRJ A;  3GLM A;  3DS4 A;  1W2B O;  1IC2 A;  1GZL A;  2BEQ D;  2WSF J;  1OVU A;  4N78 D;  2Q9I A;  1SQQ G;  3AED C;  2YXR B;  2BCC D;  2QA4 P;  3V2Q A;  2QE7 H;  1NTM J;  2YO2 A;  3I56 P;  2G3A A;  2GDX A;  4C7N A;  3BCC J;  5B66 H;  1IK9 A;  3MIW A;  1YIT P;  4UB6 H;  1NOH A;  3C8V A;  1YIJ P;  1L0H A;  1LNQ A;  4EOT A;  1BSH A;  2A06 E;  2K3R A;  2WPR A;  1LTT C;  1HY8 A;  2D2C C;  2EFJ A;  2KP8 A;  2P7J A;  4DT0 A;  2KOP A;  4LC1 A;  4A7P A;  2HPC B;  1EDJ A;  2W6A A;  4LGD E;  2RKL A;  1Z56 A;  1SQQ K;  5EFW B;  4IFM A;  2O1K A;  3L73 E;  2R32 A;  1JM0 A;  1GL2 A;  5B66 E;  1U7M A;  3AE4 C;  1EDK A;  1X9V A;  4O9B A;  4OVN F;  4U0C A;  1OIP A;  3OJA B;  2XKM A;  1PEO A;  1M90 Q;  4OGQ D;  2Z44 A;  5KLI B;  3EWK A;  5CCG D;  1VKU A;  4IFF A;  1J1D B;  1IFI A;  3Q20 A;  1HTL C;  3OA7 A;  1GPJ A;  4L73 A;  3WUT A;  3EJD A;  3L71 J;  2QJK C;  3CCS P;  3AEE C;  1SQB G;  1RO2 A;  2IZ0 A;  2AEM A;  2WZ7 A;  1U57 A;  2POH A;  5KJ7 D;  2K9Y A;  1QX8 A;  1LTJ B;  4JQ0 D;  1NU1 G;  3L74 E;  1OWA A;  4D6T E;  3H1I G;  4KT0 J;  3HTK A;  2V7Q J;  4DJG A;  1MZ9 A;  1YHQ P;  1RQU A;  2VLN A;  1S5L X;  1PP9 D;  2L5G B;  4ZKU A;  3VYI A;  2FXM A;  3H32 A;  4DG9 A;  2XV5 A;  3CE7 A;  2FVF A;  1GL2 C;  5F2O A;  1N73 B;  2FVE A;  3AEF C;  3CME P;  3KZI H;  1HH0 A;  1SQB K;  1T2K C;  4U3F D;  3I55 P;  3H1H D;  1NKN A;  3TK1 A;  1NTK E;  1L0I A;  2JJL A;  2JDI H;  5DJT B;  1OX3 A;  3ABV C;  5HGO A;  4RO0 A;  2N1T A;  1GTW A;  5EJD A;  5EW5 E;  2IDB A;  1T3J A;  5KKZ C;  5AVV B;  3FWL A;  4H2X C;  2M5A B;  3R2P A;  1AYI A;  1G1I A;  1L0L D;  1NU1 K;  2PNG A;  1LTI C;  5APU A;  2K92 A;  1EZV E;  3IFM A;  3HD7 D;  1FJK A;  1BCC E;  1JOC A;  3O6Q A;  1FBM A;  2LIW A;  3AE2 C;  1FC2 C;  1TU3 F;  4GOF A;  1Z6M A;  4U0F A;  2PGD A;  3HE4 A;  1SQX E;  2OYH B;  1JNM A;  2KNC B;  3H1K G;  1GW4 A;  2PEN A;  2ZXE B;  1URQ A;  2WQY C;  2PEQ A;  3AE1 C;  1M56 D;  2Q7C A;  3B8E B;  2K1A A;  1KIL A;  2VRS A;  5F2N A;  1YQ4 C;  2BCC E;  3CCR P;  3L75 E;  1HGZ A;  1FZF A;  3AE7 C;  2JWD A;  1LT9 A;  2BUO A;  2ZT9 B;  4JF7 A;  3USS A;  1AA0 A;  2Q6Q A;  2PEM A;  4IPY A;  1J1E B;  2B88 A;  2KW2 A;  4XFY A;  2LKI A;  4H13 C;  3H1J E;  3M0D C;  3M1M A;  2MR7 A;  4MRT C;  1D7M A;  2WSE H;  2NRG A;  3OW2 O;  1M6N A;  5AW4 B;  3KXD A;  4GT1 A;  1L0N J;  2JEE A;  4L74 A;  3L71 D;  2N6Z A;  3T97 B;  2N98 A;  2JR8 A;  3E1R A;  5KLV J;  1NQ4 A;  3OAK A;  2N50 A;  1S9K E;  3L70 E;  3BAS A;  2ZAE B;  3GZL A;  1RF1 A;  1N7S A;  2FYU J;  3II6 A;  1RQV A;  2VLO A;  4ZMD A;  4DCK A;  3MTU E;  1BE3 D;  2AEF A;  1GDT A;  1N86 A;  2Y0D A;  4H0L C;  3U1C A;  2QSI A;  1RHZ B;  1AJY A;  3DS0 A;  1PGO A;  1URQ C;  3GHG C;  1VQ5 P;  5APX A;  1BGY E;  2CQ8 A;  4PD4 D;  3RK2 C;  4EIJ A;  2GM4 A;  5AVW B;  1AUM A;  1RO0 A;  4PH1 A;  1JO5 A;  4CA3 A;  1NTZ G;  3H1L J;  2JBG A;  2AF8 A;  2Q5U A;  2KOG A;  1M1J B;  3AE3 C;  2B87 B;  1BDD A;  2CPS A;  3Q5S A;  3MZW B;  1IZN B;  3RK3 D;  2IBZ G;  5APY A;  4GOE A;  2KSJ A;  3SFE C;  1Q82 Q;  1CZQ A;  3RK3 C;  4H2W C;  1H0T A;  2WPS A;  2P9X A;  1BDC A;  3PRJ A;  3CX5 E;  2AFD A;  2OYO A;  2IYP A;  3L72 E;  1SQQ J;  1EIA A;  1JJ2 O;  3M91 A;  5AVQ B;  1RF1 C;  1S3J A;  1N7S C;  2WMM A;  2QJP C;  1SFC D;  4H44 C;  2LPK A;  5CMZ A;  3V2P A;  1NTZ K;  1SFC C;  2P67 A;  3GF7 A;  1A43 A;  2OYI A;  3RL0 C;  3A0B E;  2E5T A;  3SFD C;  3G9R A;  3FX0 A;  1RNI A;  2PAJ A;  1VQK P;  1BAJ A;  2O01 N;  1PPJ G;  1SQP J;  2Z4E A;  2L9F A;  1RE3 A;  2K0X A;  1GXH A;  1GMJ A;  1A02 F;  2A06 D;  1NTM E;  4N6J A;  1SQV G;  3VTP C;  2KR5 A;  3VMX A;  3G6E P;  3BCC E;  5K5G B;  5HVC A;  1VF5 C;  2LML A;  1X0T A;  2E75 B;  4ZNC A;  2D2C B;  4KHX A;  1HUC A;  2Z5I A;  4UHP B;  3L73 D;  1KYO H;  4JPZ B;  1JTH A;  1AFO A;  1VQN P;  2LXC B;  2FYU D;  1MFT A;  3WUU A;  2YMY A;  2MD9 A;  4COP A;  1SLQ A;  1KV4 A;  1ACP A;  1LWU A;  2HOD A;  2GZI A;  1L4A C;  4C7R A;  1FZC C;  3TGU G;  4GOD A;  1NJI Q;  2GZG A;  1NKZ B;  2HLO A;  4I7Z C;  4WY4 A;  2CG5 B;  1SQB J;  4HB1 A;  7CEI A;  1JMB A;  2OYI C;  1PL5 A;  3D6Z A;  2UWJ E;  4IOI H;  1EXI A;  1RE3 C;  1H88 A;  3PH0 A;  1KYO E;  4C7N B;  2QJY C;  1NU1 J;  2Z46 A;  5DCK A;  3L71 E;  5BS1 A;  1IUQ A;  3A3Y B;  3L74 D;  4IL6 H;  3H1I J;  1ZN5 A;  2NPS A;  2J5U A;  4M0I A;  2A45 H;  3GW6 A;  1DEE G;  4JYC A;  4L75 A;  4PV1 D;  2O01 H;  2JGP A;  3H4E A;  2N5I A;  2W90 A;  2V4H A;  1K73 Q;  1KQF B;  3W67 A;  2PEI A;  3O8Z A;  3N7N A;  2ZVN B;  4W7Z A;  2B89 A;  2M8P A;  3K5B A;  3CWB G;  3CXH H;  1FE6 A;  1LGH B;  1YI2 P;  1PFI A;  3SWF A;  3A2A A;  1HJ0 A;  4PD4 E;  2JKV A;  2KWL A;  3NTE A;  2B9B A;  5KAI H;  1HVV A;  4IL6 E;  5BU5 A;  2KGA A;  5CZD B;  1M7L A;  2AVA A;  3Q3D A;  1AQT A;  2XDJ A;  1KIL E;  4WY4 C;  2FXP A;  1ZP0 C;  3B5N C;  1EZV D;  3A0H H;  3G1G A;  3AEG C;  5KKZ B;  1FOS F;  1BCC D;  1SQP D;  2J59 M;  1S4X A;  3Q5R A;  1K05 A;  4BPG A;  3AE6 C;  3FXE A;  3FWN A;  1NO4 A;  3S1K A;  1SQX D;  1ZW0 A;  4U0E A;  3H1K J;  3CXH E;  1N8R Q;  5CHX A;  1UJZ A;  1FJP A;  2ZJS E;  2NPS C;  1Q90 D;  4D6T G;  3V5B A;  1LP1 A;  1MFZ A;  2R5B A;  1DD3 A;  4AYC A;  2H89 C;  2XNX A;  5KAI E;  2JB0 A;  1ZR4 A;  2HR3 A;  2WTY A;  2QNW A;  1U7J A;  3RBX A;  3L75 D;  1WT6 A;  5AW0 B;  3P8M C;  3CCJ P;  3LMO A;  3HTK B;  5CCG A;  2KB7 P;  3NTN A;  5AW2 B;  3A0H E;  2WSC J;  3DS1 A;  5CCH D;  4GKG A;  3B4S A;  1VQM P;  2MVU A;  3DS5 A;  3H32 B;  3H1J D;  2ZFC A;  5AW3 B;  2ZXX A;  1NTK G;  2XU6 A;  5KJ7 A;  2L22 A;  2LOL A;  4PXH B;  3V4W A;  4DOJ A;  1DNY A;  3P05 A;  2OTK E;  2E74 D;  1EZV I;  1D1D A;  2N1T B;  1FDI A;  2PP6 A;  3DPH A;  1S9K D;  3L70 D;  1QL1 A;  3I5C A;  3C1L A;  2E75 D;  3C9I A;  3RGU A;  1L0N E;  3G21 A;  5KLV E;  1VQO P;  3O6Q B;  3CPW O;  1KOR A;  3D6Y A;  2KG6 A;  1H8A A;  2O3J A;  4UB6 E;  1Q7Y Q;  4U0A A;  3HE4 B;  3HE5 A;  4XE5 B;  4Y99 B;  2FYU E;  2FFD A;  2Q3E A;  1BGY D;  2HG5 D;  1DIP A;  1NGM B;  5APV A;  2AXT H;  3IAO A;  3U43 A;  2GUV A;  1W2E A;  2P2U A;  3A7O A;  1NH4 A;  4LLH A;  1URQ B;  1VDF A;  2BCC G;  1K30 A;  1NTK K;  1NTZ J;  1S5L H;  4OGQ C;  5CCG C;  3M9B A;  2KK7 A;  3SSU A;  2OTL P;  2RMZ A;  1KIL B;  3RK2 B;  4EDF A;  2L6E A;  1Q2N A;  4JYB A;  1YJW P;  2KG9 A;  3PHL A;  1LT9 B;  2FXO A;  2YKO A;  1M74 A;  3HD7 A;  3MGN A;  3CMA P;  5KJ7 C;  3DS3 A;  1XTC C;  2WWW A;  3H1L E;  3G0V A;  3CCE P;  1K8A Q;  1ZXG A;  3PTZ A;  5AW8 B;  5KP7 B;  1LTA C;  3CX5 D;  3L72 D;  5AW1 B;  5KP8 B;  1S5L E;  5E79 H;  2R5D A;  2QRX A;  1SS1 A;  4U0D A;  3EJE A;  1NAY A;  4NPD A;  1FZE A;  2FVA A;  2BQ1 E;  1MUU A;  2IX7 C;  1RF1 B;  1N7S B;  2CGQ A;  4MN4 C;  1EDI A;  2R44 A;  1SQQ E;  2MY5 A;  2ZVO B;  4H44 B;  2DW3 A;  2O01 J;  3M0D A;  2FFD C;  2AEJ A;  2KSE A;  2PY8 A;  2FYN C;  1SQV J;  1IFD A;  1LT1 A;  1NTM D;  2E42 A;  2X2B A;  3BCC D;  1RY3 A;  5CJ0 A;  2WIT A;  2Y0E A;  4TT3 H;  2FQ1 A;  1PEQ A;  1SQP E;  3CCL P;  4RES B;  5E79 E;  1M8O B;  1SVF A;  2MR8 A;  3HD7 C;  1A02 J;  1AVY A;  5AVT B;  3B5I A;  2PEJ A;  1N2D C;  4C46 A;  2QM8 A;  2JP3 A;  1YJ9 P;  1GK4 A;  3KZI E;  2M8R A;  3CX5 I;  4ZKP A;  1OFC X;  3GHG A;  1ZMB A;  1GD2 E;  3LW5 J;  4BPH A;  2EHT A;  1QLE D;  1KQS O;  3TGU J;  1PP9 G;  2KS1 A;  3VMY A;  4PWV B;  3QH9 A;  4NPF X;  2ONT A;  1JUN A;  2W6B A;  3E2D A;  1DX7 A;  2K0D X;  4I7Z B;  1EQ7 A;  5HGM A;  3V2R A;  4U3F G;  3H1H G;  1DH3 A;  2KI7 B;  3H25 A;  3BAT A;  1YJN P;  2OYI B;  2KGC A;  2XV6 A;  1KYO D;  3CXC O;  1ZNV A;  2OAR A;  3H0D A;  1SQB E;  2YO3 A;  1UIX A;  3L36 A;  1N7L A;  1L0L G;  3MD0 A;  1K04 A;  2N1T D;  3Q5P A;  2HFE D;  2JYG A;  4WVZ A;  2JYL A;  1QGK B;  1NU1 E;  1T8Z A;  2WPV B;  4HKG A;  4K3A A;  1P84 H;  1YYC A;  3H1I E;  4GR2 A;  3CWB J;  1SFC A;  1ZOY C;  1QEX A;  1EDL A;  4BWN A;  1KQL A;  3Q1M A;  1JTH B;  3BVH A;  2C0W A;  1AVO A;  4QNB A;  1KC8 Q;  5KLI C;  3FXD A;  1J1D C;  1KIL D;  2YMK A;  2KGE A;  1LWU B;  2HOD B;  3M9Q A;  2K0Y A;  4L76 A;  4OH8 B;  2WVR A;  2KZJ A;  1AF8 A;  1DEB A;  3TYY A;  4COC A;  1S1C X;  2M5R A;  1L0L K;  4EI2 A;  3S9O A;  1JCC A;  1OW6 A;  4WY4 B;  1P84 E;  2H8P D;  3AEB C;  1HGV A;  4W80 A;  1WMK A;  1OXZ A;  3CXH D;  2BEZ F;  3L71 G;  1KLP A;  4D6T J;  1FR2 A;  2WSC H;  3NY7 B;  3AEC C;  4BPF A;  2KNC A;  2E76 B;  2KOR A;  1Y9B A;  1L4A A;  2NPS B;  3H1K E;  1GXG A;  3GG2 A;  1FZC A;  3EFF K;  3G71 P;  1BE3 G;  4RKU J;  3P8C E;  3RL0 g;  1JMM A;  2KOS A;  2L91 A;  3U1A A;  2JO0 A;  2P1J A;  1R8E A;  4ASV A;  3V2N A;  2QVA A;  2L0Q A;  2FKW B;  2I8D A;  4PD4 I;  1NTK J;  1N73 C;  1OVV A;  5HV8 A;  2ITA A;  2H88 C;  1BXI A;  2KGD A;  2A45 I;  1IFM A;  2KG8 A;  1CEI A;  4GIF A;  2LTE A;  2GZJ A;  4GDO A;  1KB9 H;  1ZV8 A;  2K5X A;  2DGY A;  2FAD A;  5GTH H;  1ZR2 A;  1VPC A;  4RJT A;  2LKM A;  1KMI Z;  1X79 B;  1L0N D;  2W27 A;  2GA1 A;  3CXH I;  2KOQ A;  4UB8 H;  5KLV D;  2Y9Y A;  2P10 A;  2WT7 A;  3RG2 A;  3Q2Y A;  2OYH C;  2FAC A;  2K9J A;  1USD A;  1NHL A;  4WYM A;  1VQ9 P;  1JY2 P;  3NMD A;  3MUD A;  5I4T G;  1ZRT E;  1F80 D;  2R3C A;  3WU2 H;  1LP1 B;  3EQ2 A;  3G3Z A;  1X3O A;  3S4R A;  1T3U A;  1KB9 E;  2ZT9 D;  2Q1K A;  1R5L A;  5GTH E;  2W6J H;  3B5N A;  1NVO A;  2EIA A;  2GUS A;  4OGQ B;  2E43 A;  2MKV A;  5APQ A;  1GU4 A;  1CSB A;  2QJK B;  2OGU A;  1NTZ E;  4Z1M H;  4UB8 E;  4W7Y A;  4GR6 A;  3RG6 C;  5BVZ A;  1R5S A;  3IN6 A;  3JCU H;  5AVZ B;  3H1L D;  4I6M C;  2A06 G;  2KXP B;  2YKQ A;  2LXB A;  4Y28 J;  1Y47 A;  2P58 A;  2JO1 A;  3JC2 2;  4DZO A;  2IBZ E;  2YNY A;  1KFM A;  3AE9 C;  2OTJ P;  1USE A;  3WU2 E;  4PV1 C;  2K88 A;  2PEO A;  2K2Q A;  2IYO A;  3DTJ A;  2I1J A;  1YQ3 C;  3L73 G;  2N6Y A;  1SQQ D;  4B86 A;  5APS A;  2M3B A;  4AUW A;  3UIA A;  5CCH A;  1KZU B;  1GL2 B;  2PRR A;  1IK7 A;  3MUD C;  2M3E A;  4QKO A;  4TLF A;  2Z45 A;  3CC4 P;  1IMQ A;  3HE5 B;  2XZR A;  2FFD B;  2VLQ A;  4R4L A;  2N9B A;  4HYT B;  3VMA A;  3HUS A;  4XRQ A;  1QVG O;  1PPJ E;  2FYN B;  2VLP A;  1FZG A;  4M3L A;  3G1I A;  1E5W A;  3LW5 H;  2ERH A;  1UNK A;  1Q81 Q;  3AEA C;  3IF4 A;  1M1K Q;  1SQV E;  2K93 A;  1Y8A A;  3WBH A;  1NWQ A;  1JY2 N;  2NZ2 A;  3P7K A;  3HD7 B;  1DD4 A;  3L74 G;  1FS0 E;  1X8Y A;  3TNU A;  4EYY Q;  2E76 D;  3IR9 A;  1FU1 A;  2WSS H;  1PP9 J;  2FYU K;  1KQG B;  1HF9 A;  3G29 A;  1E6J P;  3CC7 P;  4KJM A;  5KTB A;  4YPC A;  2YKP A;  1QVF O;  3ZDM A;  2IZ1 A;  3R4Y A;  2FBW C;  3ITK A;  2KIK A;  3CC2 P;  3CD6 P;  1PEU A;  3H1H J;  4U3F J;  5CCH C;  2JWA A;  2ZYD A;  2LF4 A;  3TGU E;  3CCM P;  3NXS A;  1LJ2 A;  3G4S P;  4H13 B;  1EXJ A;  1NAF A;  1SQB D;  1PGJ A;  1L0L J;  3HUS C;  2FQ2 A;  3VP9 A;  1YTZ T;  3LIE A;  4JBZ A;  1RF0 A;  4AQR D;  2C9N Y;  2PFX A;  3F89 A;  1EZV G;  2E74 C;  1LTG C;  5KAF H;  1AQ5 A;  3A5T A;  3U59 A;  1BCC G;  1SQP G;  5B5E H;  1JCD A;  1JY2 O;  1NU1 D;  2D2C D;  1E0H A;  2Q3I A;  2E75 C;  3DS2 A;  1SQX G;  3H1I D;  1L2P A;  3HRN A;  4CPG A;  2XT1 A;  3D71 A;  2IFN A;  1X22 A;  3SWY A;  2RN0 A;  1VQ4 P;  4H0L B;  4YXD C;  1S72 P;  2G8Y A;  3GHG B;  3L75 G;  4YTP C;  3CWB E;  4I1L A;  4BRY A;  1XTG B;  1OW7 A;  4XFX A;  3VOP A;  1CI6 A;  4QMA A;  5KAF E;  5B5E E;  2KS1 B;  3H1J G;  1IFP A;  1SQP K;  1P84 D;  1G2C A;  2XZ1 C;  2RH0 A;  1Q86 Q;  1RE4 A;  1VQ7 P;  1MKM A;  3QWO C;  4R4M A;  1SQX K;  1S2E A;  3H47 A;  4YXW H;  1ZLL A;  2KOD A;  2AXT E;  1RF0 C;  2ROQ A;  3RK3 B;  1ZME C;  1EOQ A;  1HJB A;  1OZH A;  3L70 G;  1M6E X;  2JU2 A;  2IPP A;  2JU1 A;  3GF3 A;  5AW6 B;  1IMP A;  1T8K A;  3H1K D;  5M1B A;  3AE5 C;  3CCU P;  1BE3 J;  3LID A;  3L4F A;  1PGQ A;  2ZYG A;  3P8C D;  1DV5 A;  1FOS E;  2QJP B;  1MV8 A;  1KFN A;  2CNR A;  2AXC A;  1T6A A;  2GYK A;  1IFJ A;  2PEK A;  3JSV C;  5GTI H;  1BGY G;  5AW5 B; 
#chains in the Genus database with same CATH homology
 3VRL C;  3B5I A;  2PEJ A;  4XFZ A;  1K30 A;  2QA4 P;  1Q82 Q;  2Z45 A;  4U0E A;  1NJI Q;  2BUO A;  3CC4 P;  3DS2 A;  2BHV A;  1N8R Q;  4QNB A;  1KC8 Q;  1YJ9 P;  3I56 P;  2OTL P;  2P9X A;  1VQL P;  2PEM A;  4IPY A;  4XRQ A;  3HYB A;  2QEX P;  2XT1 A;  1VQP P;  2L6E A;  1QVG O;  4XFY A;  1YJW P;  5F2K A;  4COC A;  1ZMB A;  1YIT P;  1VQ4 P;  1EIA A;  1YHQ P;  1M74 A;  3M1M A;  4WYM A;  1YIJ P;  1JJ2 O;  3MGE A;  1VQ9 P;  3G1I A;  1Q81 Q;  3CMA P;  2EG5 A;  1KQS O;  5I4T G;  3DS3 A;  1M1K Q;  5JPA A;  3OW2 O;  1M6N A;  2Z46 A;  1S72 P;  5DCK A;  3CCJ P;  3G0V A;  3WBH A;  5BS1 A;  3CCE P;  1IUQ A;  3LRY A;  1K8A Q;  3G28 A;  1A43 A;  2ONT A;  5F2O A;  2EFJ A;  4XFX A;  3DS1 A;  4M0I A;  5HGN A;  2EIA A;  3CME P;  1RNI A;  3E2D A;  1VQK P;  3I55 P;  1VQM P;  3DS5 A;  1BAJ A;  1K9M Q;  5HGM A;  5HGO A;  3H4E A;  1VQ6 P;  4XRO A;  1YJN P;  3G26 A;  1K73 Q;  2XXM A;  1KD1 Q;  4GR6 A;  3RG6 C;  2XV6 A;  3G29 A;  2PEI A;  1E6J P;  3CXC O;  3CC7 P;  3G71 P;  1Q86 Q;  2OAR A;  4U0B A;  4U0D A;  3H0D A;  2CWO A;  3HZQ A;  3P05 A;  2BQ1 E;  1VQ7 P;  3G6E P;  2M8P A;  1PEM A;  3DS0 A;  1D1D A;  1QVF O;  3DPH A;  2JO0 A;  3H47 A;  2M8L A;  5BS2 A;  4U0C A;  2JYG A;  1VQ5 P;  1YI2 P;  2KOD A;  4PH0 A;  3CCV P;  2JYL A;  1PEO A;  3CC2 P;  1M90 Q;  1EOQ A;  3CD6 P;  1PEU A;  2OTJ P;  2Z44 A;  5HGL A;  2LF4 A;  1M6E X;  4U0F A;  3NTE A;  1AUM A;  2PY8 A;  3CCM P;  3Q20 A;  1RO0 A;  3G21 A;  4PH1 A;  3G4S P;  2PEO A;  3CCU P;  1A8O A;  3DTJ A;  1VQO P;  4GR2 A;  3CCS P;  2PEN A;  1QRJ A;  3CPW O;  2E1M A;  2M8N A;  3DS4 A;  1RO2 A;  1W2B O;  2PEQ A;  1VQN P;  1Q7Y Q;  4U0A A;  2DGY A;  3G1G A;  1PEQ A;  3CCQ P;  3CCL P;  1VQ8 P;  4COP A;  5F2N A;  2PEK A;  3CCR P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...