1VQKP

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqkP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqkP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqkP02
1Q86Q 3CD6P 3G71P 1VQPP 1M1KQ 1QVFO 1VQ4P 3CMAP 3CCSP 1Q7YQ 2QA4P 3CCMP 1VQMP 3G4SP 1YHQP 3CXCO 3CCUP 1YJWP 1QVGO 1Q81Q 1VQKP 3CCLP 1YITP 1Q82Q 1VQLP 1W2BO 1KC8Q 3CCVP 1VQ9P 3CC2P 1VQNP 2OTLP 1VQ8P 3I56P 1K9MQ 1N8RQ 1M90Q 1KD1Q 2OTJP 1YJNP 3CC7P 3CC4P 3CCRP 1VQ7P 3OW2O 3CPWO 1VQOP 1YIJP 3I55P 3CCJP 1JJ2O 3CMEP 1S72P 1VQ6P 3CCQP 1K8AQ 1YJ9P 3CCEP 3G6EP 2QEXP 1K73Q 1KQSO 1NJIQ 1YI2P 1VQ5P
chains in the Genus database with same CATH superfamily
1LTJA 5TISH 2OYIB 3MZWB 1LTIC 5F2NA 3CCMP 3D70A 4HYTB 2GZEA 4PD4I 4XFXA 2KG6A 2QJKB 5I4TG 3KQGA 5C39A 5AVQB 2CPBA 4R0MA 4UB8H 1URQA 1ZV8A 2HR3A 5AW7B 3G1IA 5TJHA 3KXDA 3EQ2A 2GUVA 2A06D 3JC22 1NTMJ 3TK1A 3I56P 1L0LK 4JQ0D 1YJNP 2P2UA 5AW0B 2FYNB 1N73C 1SQPJ 2PRRA 2ZYDA 4IZ6A 2AEMA 1JB0J 5AW9B 1NTZG 2LKMA 2WPTA 2HYNA 2FHSC 4C7NB 1NVOA 2LPKA 1H0TA 2IFNA 5APUA 1NU1E 2XNDH 2CNRA 2KSEA 2A45I 4OWFA 1PV3A 3V6IA 2Q9IA 3N7NA 1GDTA 1NWQA 1IFDA 4ZNCA 1VDFA 2W6JH 2QSIA 2FVEA 2N50A 1VQLP 3EFFK 2L22A 5CCGD 1FOSF 1IJDB 1AA0A 3G21A 5CCHA 4BXLA 1N8RQ 3CE7A 2OYHB 2QJYC 1JY3O 1NTZD 3AE6C 5EJDA 4QNBA 2Y9ZA 3NMDA 2A45H 4WY4D 5HVCA 2WT7B 3PRJA 2CK3H 1L4AD 1IO4A 1IFPA 1AJYA 1KYOH 1SQBJ 2V4HA 2N5HA 3L73G 3L71D 1JY3P 2BCCJ 1BGYE 1DIPA 1M1JB 1FJPA 4WB4A 4IPYA 3TGUG 3EJDA 3WUTA 2JYLA 1M6EX 4D6TG 1T2KC 4H0LD 2GZFA 1QL2A 3B5IA 4RO0A 1YJWP 2IZ0A 2W6BA 1W2BO 2ZYAA 1N7LA 4MN4C 2FACA 2YXQB 1ZOYC 3HE4A 1YBKA 1L0HA 2JYGA 4HJGH 2XV6A 3HE5A 1EOQA 2O1KA 1KB9H 3LW5J 1SQQK 1E6JP 2NPSB 2M5RA 1GU5A 4XROA 5HGOA 2ZT9D 4K3AA 3IFMA 3LRYA 2YMYA 4NPFX 3H47A 3KHUA 2AXTH 4U0CA 1L0NJ 3VYIA 1X79B 5BU5A 1VQNP 1OX3A 5CJ0A 1LWUA 2HODB 1HQBA 1URQC 3JCUH 1EIAA 4D6TD 3PH0A 1GK6A 3G6EP 5CBOA 1NJIQ 4U3FG 4W7ZA 5E79E 2UWJE 5AVRB 2RMZA 1MFZA 1R5SA 2OYIA 3H1HE 4L74A 3DS1A 1MKMA 1JMMA 1LP1B 2Y0EA 2JU2A 5F2KA 1P84E 2K2QA 1N7SC 3DS5A 3G28A 3H0DA 2AFEA 2KP8A 3CCQP 1RH5B 1L0LD 3L72G 1JY2N 3BRVB 1VQ4P 1L0NK 1ZLLA 2PEOA 2VRSA 4U3FE 3CXCO 2Z46A 1IUQA 1YITP 3WUVA 1L2PA 1NHLA 3RL0B 2JKVA 3E1IA 3P32A 5CHXA 3CCEP 2KLUA 1FDMA 1BCCJ 1NKNA 3AEEC 4BWNA 3CMAP 2WZ7A 2QVAA 2KGEA 4PXHB 3CC2P 2IYPA 3M91A 2WWWA 4LLHA 4U0DA 3HRNA 2KI7B 2WITA 5AVUB 3L72D 2HPCA 4AYCA 1PGPA 5DJUB 1Z6MA 2M8RA 3G71P 3VOPA 1SFCA 2KOPA 4C7RA 1KMIZ 3A0BH 2R5DA 4Y99C 1S4XA 2LTEA 2I8DA 3SFEC 1VQ7P 4UB6E 2QRXA 3AE4C 5AW4B 1PL5A 2K88A 3H32A 1VQPP 1JNMA 2BHVA 1UIIA 1OW7A 3RK2C 1PP9J 5HGMA 1BDDA 1NH4A 3RK3B 2KXPB 3SSUA 2CG5B 3AEGC 1M74A 2XZRA 3M1MA 1YQ3C 3PJSK 3T97B 1KQFB 5APQA 1M1JA 1KV4A 2E5YA 2JDIH 2K37A 3H1IJ 1NTKK 2EG5A 1SQQD 2IBZD 4LC1A 1QX8A 4ZMDA 1VQ8P 2E74B 1LWUC 3MGEA 4A7PA 3CX5D 2IZ1A 3H6PA 2Y0DA 2VSQA 2MVUA 1SQVK 3KZIE 3AE1C 1UNKA 1LNQA 1ZR2A 3GF3A 3M0AA 1RO2A 1BE3D 2PP6A 3RK3E 3CCVP 4YXDC 2FYUG 3CXHD 4H44C 3P8MC 2ZVNB 1D7MA 3FWLA 1Y47A 2XU6A 3D71A 3NY7B 3ABVC 2K9JB 1K73Q 2FQ2A 2HODA 3S9OA 1HBWA 3CWBD 1ZR4A 3H1KG 3GLMA 1GW3A 3L35A 2YKOA 4I7ZC 3B71A 1SQXK 4XRQA 1KZUB 1XTCC 1J1EB 3LIEA 2R5BA 1L0ND 3CL3D 3DS3A 2B87B 1USEA 2KWLA 2IYOA 3MUDA 5KLIB 3Q5RA 5CMZA 2GDXA 2GUSA 1VHNA 2FYUD 2W90A 4L76A 3D6ZA 3Q5SA 4GR6A 5HGLA 1CW5A 1L4AC 5KJ7A 2R3CA 3H1KE 2GA1A 1JTHB 5KLVG 1IFNA 5CZDB 3VN0A 2W83C 1YJ9P 4H2YC 1VF5C 4YXWH 2LR2A 1SFCC 1LT9B 2E42A 4PD4D 2K3RA 1PEOA 1GK4A 2JQ4A 1NTZJ 1Q2NA 2WSFH 2NZ2A 2MVVA 1ZN5A 1XTGB 2OYOA 1URQD 5GTHE 1EDKA 3H1LG 2W8ZA 4RESB 3B5NA 2JB0A 3B4SA 2FXOA 3V2QA 2N6ZA 2MF4A 1G2CA 4JBZA 1DD3A 2E75C 1EXJA 3GHGB 3HZQA 4U0EA 1LT1A 4O9BA 3V2RA 4W80A 4OGQB 2Q3EA 3M9QA 4COCA 1NTZK 3L74G 1FOSE 4H2XC 3H1LD 3CC7P 1GZLA 1KFMA 1UIXA 3VMZA 1NTKD 1EMVA 3H4EA 2D2CB 3L70G 2K9YA 2L0QA 4HKGA 3IF4A 3L75E 1J1DC 5AVSB 1EZVE 2WPSA 2O01H 1QL1A 3TF5A 2E43A 1JM0A 3T97A 2AEJA 3DS4A 2L9FA 2BUOA 1NAFA 3Q2YA 2E5TA 1SQVD 2PEJA 4PV1C 1GL2B 3BCCE 3VRLC 3VMYA 1PPJG 4D6TJ 1AQTA 1S9KE 1RY3A 2XNXA 1S2EA 1DNYA 2N9BA 2QEXP 1ZMBA 2KGAA 2KS1B 3L74D 2IFMA 1PP9E 2YNYA 2N1TB 1EDLA 2KG8A 2WTYA 3I5CA 5AVYB 4DZOA 1SQXD 3H1IE 2LIWA 4U7JA 2I1KA 3CC4P 3C8VA 4IL6X 1S5LH 3H1JE 1OFCX 4DOJA 2JGPA 2PY8A 3E1RA 1KTMA 4GT1A 1VQKP 1JOCA 2WSCH 2DW3A 3RG6C 3RK2D 2QE7H 2OTKE 5KKZC 3R4YA 4XFYA 2B87A 5H2FH 1YI2P 1SVFA 3A0HH 1RF1C 1X0TA 1RO0A 5BS1A 2KIKA 3IR9A 3OA7A 2Q5UA 2B9BA 1NU1G 3L72J 3L37A 3HYBA 3PLNA 1JTHA 1GTWA 4HH2A 1YIJP 4PD4H 2K92A 2KNCB 3BATA 5AW8B 1KILC 3R2PA 2VLQA 3B5NC 2WSFJ 2G8YA 1X8YA 1AVOA 1FDOA 2LIUA 1WMKA 2E76C 4QMAA 2VLOA 3VMXA 1AF8A 3CLQA 1BXIA 4H44D 2KZIA 1RQVA 3U1AA 4WY4B 1PGOA 2KZJA 2I1JA 1ZP0C 1X3OA 3FX0A 1KD1Q 1NU1D 3A3YB 3G4SP 1FZCB 3W67A 1GMJA 3ZDMA 2LXBA 3OAKA 2M0BA 2M8LA 1BGYG 1FZBA 3HUSA 3RK3C 5K5GB 4XA4A 4H0LB 1SLQA 5KP8B 2PEKA 2B89A 1AQ5A 3AEDC 1W2EA 2QA4P 1SQQJ 3O6QB 2EHSA 3C9IA 2KOSA 2O01J 4BPFA 3PHLA 4MRTC 1RE4A 4I6MC 1OMIA 2ZT9B 5CJ4A 3DS2A 1VF5D 1BE3J 1VKUA 3L71E 1SFCD 1LTSC 1BGYD 5APYA 2JO1A 2AEFA 5AW5B 1X9VA 3RL0g 3WMM0 1GL2A 3JSVC 2WVRA 2XKMA 2JAZA 1IK9A 3CWBJ 2L4BA 4H13C 1LTJC 1M1KQ 3AEFC 5DCKA 2FBWC 3H1HG 5APSA 2P7JA 2KS1A 3L73D 2FQ1A 2N1TA 1FZFA 3MHVA 4L75A 4XE5B 2E75D 4PH1A 1HGVA 2XV5A 1AVYA 3TGUD 4BPHA 3MTUE 1OVUA 1TU3F 2QIWA 2FYUJ 2OGUA 1N86A 3L36A 2FFDB 1IFJA 1YTZT 2VLNA 2HFED 1FE6A 2KUBA 2N5IA 2BEQD 2ZAEB 1VL2A 2FQ0A 1PFIA 1UJZA 1KQSO 2G3AA 2C9LY 3RG2A 1Q7YQ 2JP3A 2Q6QA 3TNUB 1BDCA 5L8RJ 1PEMA 1L0LE 3AE7C 4PV1D 1FR2A 3DS0A 4NPDA 5B66E 2PEMA 3CCJP 4U3FD 1EC5A 2FYUK 2WPRA 3ITKA 1NTMG 2K0XA 1IMQA 5KLVJ 3HD7B 1QVFO 1PZQA 2NRGA 1Y8AA 5CCGA 2YXRB 4EYYQ 5CCHC 3MP7B 1T3JA 3HUSC 5APVA 4C7NA 2YIUC 4KJMA 2QM7A 3GMAA 2CWOA 1VPCA 2W6AA 4WY4A 4BRYB 1NTME 3GJNA 1ZRTE 4OH8B 3A5TA 3H25A 3AE9C 3H1LJ 1LTAC 4OGQC 5KJ7D 1FZCA 1FAVA 1SQPE 1N73B 1NTKJ 1A02F 2FXMA 2FADA 2K1AA 3I55P 3NFQA 1JCCA 4JPZB 5KLVK 2OYHA 1H88A 2FY8A 1NAYA 4PJ0E 1SP4A 1SQVJ 5GTIE 3M06A 4U0FA 2N6YA 3WU2E 3O6QA 4IOIH 2R3SA 2WT7A 4CA3A 3BASA 1OW8A 1FDIA 1A43A 2K5XA 5APXA 1K8AQ 3L74J 1KILD 1SQBG 3LIDA 3B5ND 3E2DA 5HGNA 4IL6E 3SWYA 5KAFE 3G1GA 2E76D 1T6AA 2LL8A 2LMLA 2H43A 2QJYB 5JPAA 1SQXJ 2KSJA 1K04A 2Y9YA 1OW6A 1JY2P 2IBZE 2PAJA 5KAIE 4B86A 4JYCA 3CX5E 2QJPC 2NPSA 1P84I 1SQBE 2OYIC 3P8CE 3GW6A 2MKVA 2BCCE 2C0WA 1U57A 3WBHA 2QJKC 1BE3E 1OZHA 3RK3D 2KK7A 4LGDE 1BAJA 1FJKA 3CXHE 5EW5E 1ZXGA 3MGNA 5E79H 2RH0A 3FGAD 4PWVB 1NQ4A 3CCSP 2Q3IA 1P84H 3SWKA 1MZ9A 3AE5C 2BQ1E 3CWBE 1LP1A 3U1CA 1ZW0A 1X22A 1VQ6P 1G1IA 1H89A 2FYNC 2QNWA 3F5HA 1L0NE 1KQGB 4YTPC 5TISE 2GZJA 1BSHA 2MD9A 2W27A 1OVVA 3USSA 3RBZA 4U0AA 2H88C 1URQB 2X2BA 3M0DA 1QEXA 4F37A 3H1KD 1NOHA 2OARA 4UB8E 1AUMA 1NU1J 1JMBA 4H13D 2L5GB 5KP6B 3HD7A 4Y28J 1N7SB 3MD0A 2KR5A 3RBXA 2JEEA 1AYIA 4JF7A 3GKLC 4R4MA 5M1BA 2OYHC 3KYQA 1RHZB 1M57D 1A02J 1U7JA 2PEIA 1H0TB 2LKIA 4BRYA 5KLVD 1FU1A 2FYZA 1DEEG 4UB6H 3OW2O 3CPWO 3A2AA 3L75G 1NU1K 1BCCE 1N73A 4RKUJ 1EZVG 4WYMA 2L91A 4UHPB 4OVNF 2GDWA 5AVXB 1BGYJ 1M1JC 3S4RA 4TLFA 3BCCG 3VMAA 3CCUP 7CEIA 3Q5PA 1GXGA 1OXZA 1JUNA 4W7YA 1IK7A 1K05A 3FXDA 1PP9G 1RF0A 4M0IA 3L73J 2NPSC 1KLPA 3M9HA 2HLOA 4Y99B 1DH3A 3L75D 1HGZA 2OTJP 3TGUJ 1BSNA 1KYOE 5CCHD 3Q1MA 2FVFA 1EQ7A 3H1IG 2C0XA 1E0HA 3H1JG 2ZXXA 2E1MA 1H8AA 3KZIH 1SQVE 3G9RA 1PGQA 3W68A 1NYHA 4IFFA 3EJEA 3RK2B 3HE4B 2Z45A 1IC2A 2LF4A 2QM8A 2Z4EA 1MFTA 4OGQD 4XFJA 3L70D 2DNWA 1ZMEC 3HE5B 4EI2A 4N78E 1N2DC 2GZGA 1GD2E 5AVTB 1DV5A 1Q90D 3FXEA 3MUDC 3S1KA 3TSIA 1KORA 3CI9A 2XXMA 4GKGA 1KB9E 2IPPA 2D2CD 2K9JA 1LWUB 1PPJD 4IFDK 5KJ7C 2AXTE 3E7KA 1QRJA 2O3JA 4U3FJ 1HVVA 2H89C 3M0DC 3V5BA 4AQRD 1GL2D 2XDJA 3BRTB 3WUUA 3RL0C 3JCUE 1JY3N 4IFMA 5BVZA 1U7MA 3AECC 3V2NA 2P58A 4BPGA 3HD7C 3II6A 4H44B 3U59A 2ZVOB 1KFNA 2WMMA 2YMKA 2N1TD 2WSEH 2GYKA 3N4XA 5B5EE 2N98A 2AF8A 2M3EA 1EDJA 1E79H 1K30A 1NKZB 2PGDA 2A06E 2YKPA 1CSBA 4GDOA 1OR5A 4I7ZB 3KDPB 1QGKB 1HJ0A 1KQLA 3V2PA 1LT9A 1VQ9P 1RQUA 1N7SA 5DJTB 1GPJA 4Z1MH 4COPA 5GTHH 2WPQA 3G3ZA 1MUUA 1Z56A 3NTEA 1L0IA 4GODA 1S5LX 2JBGA 1L4AB 1HY8A 3GZLA 4HB1A 2GM4A 2HPCB 2KORA 3V4QA 1EZVI 3GHGA 4HKZH 1VF5B 1IZNB 1SFCB 3L4FA 3TYYA 3U43A 3L71G 4RJTA 1RF0C 1NTMK 1KYOI 4C46A 3OJAB 1NTZE 2OTLP 1FZEA 3A0BE 1JCDA 4YPCA 1SQPK 1PGJA 1OIPA 2E74C 2M8PA 3H32B 4I2LC 3V4WA 3K5BA 1CZQA 5HV8A 1EDIA 2E75B 1FC2C 1JEKA 1ACPA 4H2WC 3SWFA 2KYVA 1KB9I 1S72P 4GOEA 3M9BA 1PIXA 3UIAA 4KHXA 4GOFA 1Q81Q 2O1JA 1S3JA 1CI6B 2PFXA 2IDBA 2KOGA 2SPZA 2ZXEB 4EIJA 3FWNA 2JU1A 1PEUA 2AVAA 1E5WA 1GW4A 5AVWB 1J1EC 1J1DB 3L73E 1G1JA 2WSCJ 1HH0A 2JR8A 3EFGA 5KLIC 4ASVA 2DGYA 1L0LG 2ITAA 4PV1B 3G29A 1SQBK 3TGUE 4JYBA 4D6TE 4ZKUA 2J59M 2WPVB 1S1CX 2ROQA 3H1KJ 2O01N 2Y0CA 3H1HD 5APTA 2M5AB 2H7HA 2WSEJ 4K35A 1RE3A 1P84D 3AEAC 2ONTA 3BVHA 2NPSD 1NO4A 1LT9C 5B5EH 3IN6A 5KTBA 3F89A 2CPSA 3NXSA 3QH9A 5AW6B 1A8OA 3VTPC 2YKQA 2K0DX 2KNCA 3D6YA 3LMOA 3AE2C 1M56D 3Q20A 1SQPG 2IX7C 1Q82Q 2P67A 1YYCA 1ZNVA 4ASWA 5KKZB 3GHGC 4TT3H 2MJZA 3GZMA 2P10A 2MR8A 1OWAA 1YQ4C 2M3BA 2K93A 3QWOC 1RF1B 2HG5D 3L72E 1L4AA 4ZKPA 1FBMA 3PP5A 3DPHA 3A7OA 1NTMD 4I1LA 5AVZB 1KILB 1ZRTD 2R44A 2M8NA 3EJBA 3B5NB 1RE4C 4DG9A 3RL0D 4DCKA 2E76B 1SQPD 2C9NY 1LJ2A 2D2CC 2BASA 4DT0A 2EIAA 1G2CB 3L75J 2OQQA 3HD7D 1T8KA 3VP9A 1AFOA 5AW2B 1WRGA 3GG2A 4WWIA 1SQQG 2IBZG 1GL2C 3HTKB 2PEQA 4CPGA 5KP7B 3BCCJ 5CBNA 1JY2O 1QVGO 5AW1B 5APWA 2PNGA 1RNIA 3P05A 2BCCG 1HJBA 2XT1A 3L70J 3TDKA 2N1TC 1KILE 2CGQA 4U0BA 4EOTA 1BE3G 2POHA 2RKLA 2EFJA 1SQQE 3SFDC 3CD6P 4M3LA 1T8ZA 1CI6A 2JJLA 2P1JA 1MV8A 3H1JJ 1DEBA 3CWBG 2LOLA 3VP8A 1T3UA 4KT0J 1SQBD 3P8CD 1LTGC 3EWKA 1L0NG 2BCCD 3GF7A 1W5CE 2FAEA 2NO8A 1RE3C 1D1DA 1MZ8A 2N9YB 3AE8C 2KOQA 1JO5A 2FFDA 2XZ0D 2V7QH 2KW2A 2WSSH 1FZAA 4NPEA 4WVZA 2Z5IA 2E74D 4H13B 1LTJB 4N3YB 1VQ5P 3Q3DA 2RN0A 2M5AA 5F2OA 1S5LE 1QLED 2YO3A 1DX7A 1FZGA 1EXIA 5CCGC 2MR7A 2KB7P 2ZFCA 3MIWA 5B66H 3TNUA 3B4QA 1Y9BA 2FYUE 1NGMB 3G26A 4WY4C 1Q86Q 5H2FE 1IMPA 1T2KD 3A0HE 2QG4A 2L6EA 3IAOA 1F80D 4XFZA 5EFWB 1FZCC 1BCCG 2KOOA 4N6JA 4L73A 3CMEP 3O8ZA 4PD4E 1CEIA 4GIFA 1FS0E 2KGDA 1HUCA 2VLPA 2LXCB 4H0LC 1RF1A 4DJGA 2BEZF 2Q7CA 1YHQP 1R8EA 2H8PD 1YTZI 2B88A 3NTNA 1GU4A 2KG9A 3C1LA 5KLVE 1KILA 2A45G 3RGUA 2ZT9C 3P7KA 4PJ0H 4NEOA 2K94A 1NTKG 4PH0A 1M8OB 2GDYA 2WQYC 1J2JB 5GTIH 1BCCD 1LTTC 1LTBC 3WU2H 1DD4A 3HUSB 3L71J 5BU8B 2K0YA 2YIUB 2IBZI 2CQ8A 2PENA 1OVRA 2ERHA 1USDA 2J5UA 3CCRP 1N7SD 1IFMA 1SQVG 3AEBC 2Z5HA 1GXHA 3CX5I 4AUWA 3HTKA 2JO0A 3B8EB 4IL6H 1R5LA 2R32A 2KODA 1M6NA 2Z44A 5KAFH 3H1LE 1PEQA 1SS1A 2MY5A 4EDFA 1WT6A 2P9XA 5AW3B 2FKWB 1NTKE 5BS2A 5AVVB 3CCLP 3PTZA 3KPEA 1HTLC 4QKOA 1EZVD 3CXHI 2YO2A 2JWAA 1VQOP 3G0VA 4WBAA 5KAIH 2ZJSE 1M7LA 3BCCD 2FVAA 3CX5H 1KYOD 2GZIA 1LGHB 1SQXG 2EHTA 1S9KD 1VQMP 2FXPA 2FFDC 1KN7A 1KC8Q 3DTJA 2JWDA 2ZYGA 1M90Q 1IFIA 3H1HJ 3L74E 1PP9D 1HF9A 1AV1A 3CXHH 2XZ1C 2V7QJ 1HWTC 2AXCA 3L70E 3AE3C 4GR2A 2Q1KA 4N78D 2KGCA 2KLVA 2J58A 4R4LA 1SQXE 3H1ID 1KB9D 1K9MQ 3LW5H 3H1JD 2A06G 1L0LJ 1JJ2O 1PPJE 2AFDA 2QJPB
chains in the Genus database with same CATH topology
4M0IA 1ZMBA 4PH0A 1D1DA 1VQ4P 5F2NA 2PEOA 3CCMP 1PEUA 3G4SP 3CXCO 2Z46A 4U0FA 1IUQA 1YITP 2EG5A 4XFXA 1VQ9P 1PEOA 4U0AA 1VQ8P 3DPHA 2PENA 2M8LA 2OTJP 3MGEA 3CCRP 5I4TG 4COPA 2M8NA 1A43A 1K8AQ 2OARA 2E1MA 2JO0A 3CCEP 1AUMA 3NTEA 1KQSO 4IPYA 1VQ5P 3CC4P 3G1IA 2KODA 5F2OA 1M6NA 2EIAA 2PEKA 2JYLA 1M6EX 2PY8A 2Z44A 3E2DA 5HGNA 3CMAP 1Q7YQ 1PEQA 2QA4P 2DGYA 3G1GA 3B5IA 3G29A 1RO2A 2P9XA 1YJWP 5BS2A 1VQKP 3CCLP 1W2BO 2Z45A 3CCVP 2LF4A 3CC2P 1PEMA 3HZQA 3I56P 4U0EA 4U0DA 1YJNP 3DS0A 3RG6C 5JPAA 1VQOP 3G0VA 2PEMA 2PEQA 3CCJP 2JYGA 3DS2A 3G26A 2XV6A 4XFYA 1EOQA 1K73Q 1QVGO 1E6JP 2XXMA 1YI2P 1Q86Q 4XROA 5HGOA 3G71P 2ONTA 1QVFO 1RO0A 5BS1A 3LRYA 1RNIA 2PEIA 3P05A 1VQMP 2L6EA 3H47A 2XT1A 4COCA 4U0CA 4XFZA 1KC8Q 4XRQA 3DTJA 1VQNP 2OTLP 1QRJA 4U0BA 3HYBA 1M90Q 3CC7P 3WBHA 3DS3A 1VQ7P 3OW2O 3CPWO 1YIJP 2CWOA 2M8PA 3CMEP 1EIAA 2EFJA 3H4EA 4WYMA 1A8OA 3G6EP 1BAJA 1NJIQ 3CD6P 1M1KQ 1VQPP 5DCKA 4GR2A 2BHVA 3CCSP 3DS4A 3Q20A 2BUOA 4GR6A 5HGLA 3CCUP 1YHQP 1VQLP 1Q82Q 3DS1A 2PEJA 1K9MQ 3G21A 5HGMA 3VRLC 1N8RQ 5F2KA 2BQ1E 3DS5A 3G28A 4PH1A 1M74A 3I55P 3H0DA 1JJ2O 1K30A 1S72P 1VQ6P 3M1MA 4QNBA 3CCQP 1YJ9P 2QEXP 1KD1Q 1Q81Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 Q;  3CD6 P;  3G71 P;  1VQP P;  1M1K Q;  1QVF O;  1VQ4 P;  3CMA P;  3CCS P;  1Q7Y Q;  2QA4 P;  3CCM P;  1VQM P;  3G4S P;  1YHQ P;  3CXC O;  3CCU P;  1YJW P;  1QVG O;  1Q81 Q;  1VQK P;  3CCL P;  1YIT P;  1Q82 Q;  1VQL P;  1W2B O;  1KC8 Q;  3CCV P;  1VQ9 P;  3CC2 P;  1VQN P;  2OTL P;  1VQ8 P;  3I56 P;  1K9M Q;  1N8R Q;  1M90 Q;  1KD1 Q;  2OTJ P;  1YJN P;  3CC7 P;  3CC4 P;  3CCR P;  1VQ7 P;  3OW2 O;  3CPW O;  1VQO P;  1YIJ P;  3I55 P;  3CCJ P;  1JJ2 O;  3CME P;  1S72 P;  1VQ6 P;  3CCQ P;  1K8A Q;  1YJ9 P;  3CCE P;  3G6E P;  2QEX P;  1K73 Q;  1KQS O;  1NJI Q;  1YI2 P;  1VQ5 P; 
#chains in the Genus database with same CATH topology
 1LTJ A;  5TIS H;  2OYI B;  3MZW B;  1LTI C;  5F2N A;  3CCM P;  3D70 A;  4HYT B;  2GZE A;  4PD4 I;  4XFX A;  2KG6 A;  2QJK B;  5I4T G;  3KQG A;  5C39 A;  5AVQ B;  2CPB A;  4R0M A;  4UB8 H;  1URQ A;  1ZV8 A;  2HR3 A;  5AW7 B;  3G1I A;  5TJH A;  3KXD A;  3EQ2 A;  2GUV A;  2A06 D;  3JC2 2;  1NTM J;  3TK1 A;  3I56 P;  1L0L K;  4JQ0 D;  1YJN P;  2P2U A;  5AW0 B;  2FYN B;  1N73 C;  1SQP J;  2PRR A;  2ZYD A;  4IZ6 A;  2AEM A;  1JB0 J;  5AW9 B;  1NTZ G;  2LKM A;  2WPT A;  2HYN A;  2FHS C;  4C7N B;  1NVO A;  2LPK A;  1H0T A;  2IFN A;  5APU A;  1NU1 E;  2XND H;  2CNR A;  2KSE A;  2A45 I;  4OWF A;  1PV3 A;  3V6I A;  2Q9I A;  3N7N A;  1GDT A;  1NWQ A;  1IFD A;  4ZNC A;  1VDF A;  2W6J H;  2QSI A;  2FVE A;  2N50 A;  1VQL P;  3EFF K;  2L22 A;  5CCG D;  1FOS F;  1IJD B;  1AA0 A;  3G21 A;  5CCH A;  4BXL A;  1N8R Q;  3CE7 A;  2OYH B;  2QJY C;  1JY3 O;  1NTZ D;  3AE6 C;  5EJD A;  4QNB A;  2Y9Z A;  3NMD A;  2A45 H;  4WY4 D;  5HVC A;  2WT7 B;  3PRJ A;  2CK3 H;  1L4A D;  1IO4 A;  1IFP A;  1AJY A;  1KYO H;  1SQB J;  2V4H A;  2N5H A;  3L73 G;  3L71 D;  1JY3 P;  2BCC J;  1BGY E;  1DIP A;  1M1J B;  1FJP A;  4WB4 A;  4IPY A;  3TGU G;  3EJD A;  3WUT A;  2JYL A;  1M6E X;  4D6T G;  1T2K C;  4H0L D;  2GZF A;  1QL2 A;  3B5I A;  4RO0 A;  1YJW P;  2IZ0 A;  2W6B A;  1W2B O;  2ZYA A;  1N7L A;  4MN4 C;  2FAC A;  2YXQ B;  1ZOY C;  3HE4 A;  1YBK A;  1L0H A;  2JYG A;  4HJG H;  2XV6 A;  3HE5 A;  1EOQ A;  2O1K A;  1KB9 H;  3LW5 J;  1SQQ K;  1E6J P;  2NPS B;  2M5R A;  1GU5 A;  4XRO A;  5HGO A;  2ZT9 D;  4K3A A;  3IFM A;  3LRY A;  2YMY A;  4NPF X;  3H47 A;  3KHU A;  2AXT H;  4U0C A;  1L0N J;  3VYI A;  1X79 B;  5BU5 A;  1VQN P;  1OX3 A;  5CJ0 A;  1LWU A;  2HOD B;  1HQB A;  1URQ C;  3JCU H;  1EIA A;  4D6T D;  3PH0 A;  1GK6 A;  3G6E P;  5CBO A;  1NJI Q;  4U3F G;  4W7Z A;  5E79 E;  2UWJ E;  5AVR B;  2RMZ A;  1MFZ A;  1R5S A;  2OYI A;  3H1H E;  4L74 A;  3DS1 A;  1MKM A;  1JMM A;  1LP1 B;  2Y0E A;  2JU2 A;  5F2K A;  1P84 E;  2K2Q A;  1N7S C;  3DS5 A;  3G28 A;  3H0D A;  2AFE A;  2KP8 A;  3CCQ P;  1RH5 B;  1L0L D;  3L72 G;  1JY2 N;  3BRV B;  1VQ4 P;  1L0N K;  1ZLL A;  2PEO A;  2VRS A;  4U3F E;  3CXC O;  2Z46 A;  1IUQ A;  1YIT P;  3WUV A;  1L2P A;  1NHL A;  3RL0 B;  2JKV A;  3E1I A;  3P32 A;  5CHX A;  3CCE P;  2KLU A;  1FDM A;  1BCC J;  1NKN A;  3AEE C;  4BWN A;  3CMA P;  2WZ7 A;  2QVA A;  2KGE A;  4PXH B;  3CC2 P;  2IYP A;  3M91 A;  2WWW A;  4LLH A;  4U0D A;  3HRN A;  2KI7 B;  2WIT A;  5AVU B;  3L72 D;  2HPC A;  4AYC A;  1PGP A;  5DJU B;  1Z6M A;  2M8R A;  3G71 P;  3VOP A;  1SFC A;  2KOP A;  4C7R A;  1KMI Z;  3A0B H;  2R5D A;  4Y99 C;  1S4X A;  2LTE A;  2I8D A;  3SFE C;  1VQ7 P;  4UB6 E;  2QRX A;  3AE4 C;  5AW4 B;  1PL5 A;  2K88 A;  3H32 A;  1VQP P;  1JNM A;  2BHV A;  1UII A;  1OW7 A;  3RK2 C;  1PP9 J;  5HGM A;  1BDD A;  1NH4 A;  3RK3 B;  2KXP B;  3SSU A;  2CG5 B;  3AEG C;  1M74 A;  2XZR A;  3M1M A;  1YQ3 C;  3PJS K;  3T97 B;  1KQF B;  5APQ A;  1M1J A;  1KV4 A;  2E5Y A;  2JDI H;  2K37 A;  3H1I J;  1NTK K;  2EG5 A;  1SQQ D;  2IBZ D;  4LC1 A;  1QX8 A;  4ZMD A;  1VQ8 P;  2E74 B;  1LWU C;  3MGE A;  4A7P A;  3CX5 D;  2IZ1 A;  3H6P A;  2Y0D A;  2VSQ A;  2MVU A;  1SQV K;  3KZI E;  3AE1 C;  1UNK A;  1LNQ A;  1ZR2 A;  3GF3 A;  3M0A A;  1RO2 A;  1BE3 D;  2PP6 A;  3RK3 E;  3CCV P;  4YXD C;  2FYU G;  3CXH D;  4H44 C;  3P8M C;  2ZVN B;  1D7M A;  3FWL A;  1Y47 A;  2XU6 A;  3D71 A;  3NY7 B;  3ABV C;  2K9J B;  1K73 Q;  2FQ2 A;  2HOD A;  3S9O A;  1HBW A;  3CWB D;  1ZR4 A;  3H1K G;  3GLM A;  1GW3 A;  3L35 A;  2YKO A;  4I7Z C;  3B71 A;  1SQX K;  4XRQ A;  1KZU B;  1XTC C;  1J1E B;  3LIE A;  2R5B A;  1L0N D;  3CL3 D;  3DS3 A;  2B87 B;  1USE A;  2KWL A;  2IYO A;  3MUD A;  5KLI B;  3Q5R A;  5CMZ A;  2GDX A;  2GUS A;  1VHN A;  2FYU D;  2W90 A;  4L76 A;  3D6Z A;  3Q5S A;  4GR6 A;  5HGL A;  1CW5 A;  1L4A C;  5KJ7 A;  2R3C A;  3H1K E;  2GA1 A;  1JTH B;  5KLV G;  1IFN A;  5CZD B;  3VN0 A;  2W83 C;  1YJ9 P;  4H2Y C;  1VF5 C;  4YXW H;  2LR2 A;  1SFC C;  1LT9 B;  2E42 A;  4PD4 D;  2K3R A;  1PEO A;  1GK4 A;  2JQ4 A;  1NTZ J;  1Q2N A;  2WSF H;  2NZ2 A;  2MVV A;  1ZN5 A;  1XTG B;  2OYO A;  1URQ D;  5GTH E;  1EDK A;  3H1L G;  2W8Z A;  4RES B;  3B5N A;  2JB0 A;  3B4S A;  2FXO A;  3V2Q A;  2N6Z A;  2MF4 A;  1G2C A;  4JBZ A;  1DD3 A;  2E75 C;  1EXJ A;  3GHG B;  3HZQ A;  4U0E A;  1LT1 A;  4O9B A;  3V2R A;  4W80 A;  4OGQ B;  2Q3E A;  3M9Q A;  4COC A;  1NTZ K;  3L74 G;  1FOS E;  4H2X C;  3H1L D;  3CC7 P;  1GZL A;  1KFM A;  1UIX A;  3VMZ A;  1NTK D;  1EMV A;  3H4E A;  2D2C B;  3L70 G;  2K9Y A;  2L0Q A;  4HKG A;  3IF4 A;  3L75 E;  1J1D C;  5AVS B;  1EZV E;  2WPS A;  2O01 H;  1QL1 A;  3TF5 A;  2E43 A;  1JM0 A;  3T97 A;  2AEJ A;  3DS4 A;  2L9F A;  2BUO A;  1NAF A;  3Q2Y A;  2E5T A;  1SQV D;  2PEJ A;  4PV1 C;  1GL2 B;  3BCC E;  3VRL C;  3VMY A;  1PPJ G;  4D6T J;  1AQT A;  1S9K E;  1RY3 A;  2XNX A;  1S2E A;  1DNY A;  2N9B A;  2QEX P;  1ZMB A;  2KGA A;  2KS1 B;  3L74 D;  2IFM A;  1PP9 E;  2YNY A;  2N1T B;  1EDL A;  2KG8 A;  2WTY A;  3I5C A;  5AVY B;  4DZO A;  1SQX D;  3H1I E;  2LIW A;  4U7J A;  2I1K A;  3CC4 P;  3C8V A;  4IL6 X;  1S5L H;  3H1J E;  1OFC X;  4DOJ A;  2JGP A;  2PY8 A;  3E1R A;  1KTM A;  4GT1 A;  1VQK P;  1JOC A;  2WSC H;  2DW3 A;  3RG6 C;  3RK2 D;  2QE7 H;  2OTK E;  5KKZ C;  3R4Y A;  4XFY A;  2B87 A;  5H2F H;  1YI2 P;  1SVF A;  3A0H H;  1RF1 C;  1X0T A;  1RO0 A;  5BS1 A;  2KIK A;  3IR9 A;  3OA7 A;  2Q5U A;  2B9B A;  1NU1 G;  3L72 J;  3L37 A;  3HYB A;  3PLN A;  1JTH A;  1GTW A;  4HH2 A;  1YIJ P;  4PD4 H;  2K92 A;  2KNC B;  3BAT A;  5AW8 B;  1KIL C;  3R2P A;  2VLQ A;  3B5N C;  2WSF J;  2G8Y A;  1X8Y A;  1AVO A;  1FDO A;  2LIU A;  1WMK A;  2E76 C;  4QMA A;  2VLO A;  3VMX A;  1AF8 A;  3CLQ A;  1BXI A;  4H44 D;  2KZI A;  1RQV A;  3U1A A;  4WY4 B;  1PGO A;  2KZJ A;  2I1J A;  1ZP0 C;  1X3O A;  3FX0 A;  1KD1 Q;  1NU1 D;  3A3Y B;  3G4S P;  1FZC B;  3W67 A;  1GMJ A;  3ZDM A;  2LXB A;  3OAK A;  2M0B A;  2M8L A;  1BGY G;  1FZB A;  3HUS A;  3RK3 C;  5K5G B;  4XA4 A;  4H0L B;  1SLQ A;  5KP8 B;  2PEK A;  2B89 A;  1AQ5 A;  3AED C;  1W2E A;  2QA4 P;  1SQQ J;  3O6Q B;  2EHS A;  3C9I A;  2KOS A;  2O01 J;  4BPF A;  3PHL A;  4MRT C;  1RE4 A;  4I6M C;  1OMI A;  2ZT9 B;  5CJ4 A;  3DS2 A;  1VF5 D;  1BE3 J;  1VKU A;  3L71 E;  1SFC D;  1LTS C;  1BGY D;  5APY A;  2JO1 A;  2AEF A;  5AW5 B;  1X9V A;  3RL0 g;  3WMM 0;  1GL2 A;  3JSV C;  2WVR A;  2XKM A;  2JAZ A;  1IK9 A;  3CWB J;  2L4B A;  4H13 C;  1LTJ C;  1M1K Q;  3AEF C;  5DCK A;  2FBW C;  3H1H G;  5APS A;  2P7J A;  2KS1 A;  3L73 D;  2FQ1 A;  2N1T A;  1FZF A;  3MHV A;  4L75 A;  4XE5 B;  2E75 D;  4PH1 A;  1HGV A;  2XV5 A;  1AVY A;  3TGU D;  4BPH A;  3MTU E;  1OVU A;  1TU3 F;  2QIW A;  2FYU J;  2OGU A;  1N86 A;  3L36 A;  2FFD B;  1IFJ A;  1YTZ T;  2VLN A;  2HFE D;  1FE6 A;  2KUB A;  2N5I A;  2BEQ D;  2ZAE B;  1VL2 A;  2FQ0 A;  1PFI A;  1UJZ A;  1KQS O;  2G3A A;  2C9L Y;  3RG2 A;  1Q7Y Q;  2JP3 A;  2Q6Q A;  3TNU B;  1BDC A;  5L8R J;  1PEM A;  1L0L E;  3AE7 C;  4PV1 D;  1FR2 A;  3DS0 A;  4NPD A;  5B66 E;  2PEM A;  3CCJ P;  4U3F D;  1EC5 A;  2FYU K;  2WPR A;  3ITK A;  1NTM G;  2K0X A;  1IMQ A;  5KLV J;  3HD7 B;  1QVF O;  1PZQ A;  2NRG A;  1Y8A A;  5CCG A;  2YXR B;  4EYY Q;  5CCH C;  3MP7 B;  1T3J A;  3HUS C;  5APV A;  4C7N A;  2YIU C;  4KJM A;  2QM7 A;  3GMA A;  2CWO A;  1VPC A;  2W6A A;  4WY4 A;  4BRY B;  1NTM E;  3GJN A;  1ZRT E;  4OH8 B;  3A5T A;  3H25 A;  3AE9 C;  3H1L J;  1LTA C;  4OGQ C;  5KJ7 D;  1FZC A;  1FAV A;  1SQP E;  1N73 B;  1NTK J;  1A02 F;  2FXM A;  2FAD A;  2K1A A;  3I55 P;  3NFQ A;  1JCC A;  4JPZ B;  5KLV K;  2OYH A;  1H88 A;  2FY8 A;  1NAY A;  4PJ0 E;  1SP4 A;  1SQV J;  5GTI E;  3M06 A;  4U0F A;  2N6Y A;  3WU2 E;  3O6Q A;  4IOI H;  2R3S A;  2WT7 A;  4CA3 A;  3BAS A;  1OW8 A;  1FDI A;  1A43 A;  2K5X A;  5APX A;  1K8A Q;  3L74 J;  1KIL D;  1SQB G;  3LID A;  3B5N D;  3E2D A;  5HGN A;  4IL6 E;  3SWY A;  5KAF E;  3G1G A;  2E76 D;  1T6A A;  2LL8 A;  2LML A;  2H43 A;  2QJY B;  5JPA A;  1SQX J;  2KSJ A;  1K04 A;  2Y9Y A;  1OW6 A;  1JY2 P;  2IBZ E;  2PAJ A;  5KAI E;  4B86 A;  4JYC A;  3CX5 E;  2QJP C;  2NPS A;  1P84 I;  1SQB E;  2OYI C;  3P8C E;  3GW6 A;  2MKV A;  2BCC E;  2C0W A;  1U57 A;  3WBH A;  2QJK C;  1BE3 E;  1OZH A;  3RK3 D;  2KK7 A;  4LGD E;  1BAJ A;  1FJK A;  3CXH E;  5EW5 E;  1ZXG A;  3MGN A;  5E79 H;  2RH0 A;  3FGA D;  4PWV B;  1NQ4 A;  3CCS P;  2Q3I A;  1P84 H;  3SWK A;  1MZ9 A;  3AE5 C;  2BQ1 E;  3CWB E;  1LP1 A;  3U1C A;  1ZW0 A;  1X22 A;  1VQ6 P;  1G1I A;  1H89 A;  2FYN C;  2QNW A;  3F5H A;  1L0N E;  1KQG B;  4YTP C;  5TIS E;  2GZJ A;  1BSH A;  2MD9 A;  2W27 A;  1OVV A;  3USS A;  3RBZ A;  4U0A A;  2H88 C;  1URQ B;  2X2B A;  3M0D A;  1QEX A;  4F37 A;  3H1K D;  1NOH A;  2OAR A;  4UB8 E;  1AUM A;  1NU1 J;  1JMB A;  4H13 D;  2L5G B;  5KP6 B;  3HD7 A;  4Y28 J;  1N7S B;  3MD0 A;  2KR5 A;  3RBX A;  2JEE A;  1AYI A;  4JF7 A;  3GKL C;  4R4M A;  5M1B A;  2OYH C;  3KYQ A;  1RHZ B;  1M57 D;  1A02 J;  1U7J A;  2PEI A;  1H0T B;  2LKI A;  4BRY A;  5KLV D;  1FU1 A;  2FYZ A;  1DEE G;  4UB6 H;  3OW2 O;  3CPW O;  3A2A A;  3L75 G;  1NU1 K;  1BCC E;  1N73 A;  4RKU J;  1EZV G;  4WYM A;  2L91 A;  4UHP B;  4OVN F;  2GDW A;  5AVX B;  1BGY J;  1M1J C;  3S4R A;  4TLF A;  3BCC G;  3VMA A;  3CCU P;  7CEI A;  3Q5P A;  1GXG A;  1OXZ A;  1JUN A;  4W7Y A;  1IK7 A;  1K05 A;  3FXD A;  1PP9 G;  1RF0 A;  4M0I A;  3L73 J;  2NPS C;  1KLP A;  3M9H A;  2HLO A;  4Y99 B;  1DH3 A;  3L75 D;  1HGZ A;  2OTJ P;  3TGU J;  1BSN A;  1KYO E;  5CCH D;  3Q1M A;  2FVF A;  1EQ7 A;  3H1I G;  2C0X A;  1E0H A;  3H1J G;  2ZXX A;  2E1M A;  1H8A A;  3KZI H;  1SQV E;  3G9R A;  1PGQ A;  3W68 A;  1NYH A;  4IFF A;  3EJE A;  3RK2 B;  3HE4 B;  2Z45 A;  1IC2 A;  2LF4 A;  2QM8 A;  2Z4E A;  1MFT A;  4OGQ D;  4XFJ A;  3L70 D;  2DNW A;  1ZME C;  3HE5 B;  4EI2 A;  4N78 E;  1N2D C;  2GZG A;  1GD2 E;  5AVT B;  1DV5 A;  1Q90 D;  3FXE A;  3MUD C;  3S1K A;  3TSI A;  1KOR A;  3CI9 A;  2XXM A;  4GKG A;  1KB9 E;  2IPP A;  2D2C D;  2K9J A;  1LWU B;  1PPJ D;  4IFD K;  5KJ7 C;  2AXT E;  3E7K A;  1QRJ A;  2O3J A;  4U3F J;  1HVV A;  2H89 C;  3M0D C;  3V5B A;  4AQR D;  1GL2 D;  2XDJ A;  3BRT B;  3WUU A;  3RL0 C;  3JCU E;  1JY3 N;  4IFM A;  5BVZ A;  1U7M A;  3AEC C;  3V2N A;  2P58 A;  4BPG A;  3HD7 C;  3II6 A;  4H44 B;  3U59 A;  2ZVO B;  1KFN A;  2WMM A;  2YMK A;  2N1T D;  2WSE H;  2GYK A;  3N4X A;  5B5E E;  2N98 A;  2AF8 A;  2M3E A;  1EDJ A;  1E79 H;  1K30 A;  1NKZ B;  2PGD A;  2A06 E;  2YKP A;  1CSB A;  4GDO A;  1OR5 A;  4I7Z B;  3KDP B;  1QGK B;  1HJ0 A;  1KQL A;  3V2P A;  1LT9 A;  1VQ9 P;  1RQU A;  1N7S A;  5DJT B;  1GPJ A;  4Z1M H;  4COP A;  5GTH H;  2WPQ A;  3G3Z A;  1MUU A;  1Z56 A;  3NTE A;  1L0I A;  4GOD A;  1S5L X;  2JBG A;  1L4A B;  1HY8 A;  3GZL A;  4HB1 A;  2GM4 A;  2HPC B;  2KOR A;  3V4Q A;  1EZV I;  3GHG A;  4HKZ H;  1VF5 B;  1IZN B;  1SFC B;  3L4F A;  3TYY A;  3U43 A;  3L71 G;  4RJT A;  1RF0 C;  1NTM K;  1KYO I;  4C46 A;  3OJA B;  1NTZ E;  2OTL P;  1FZE A;  3A0B E;  1JCD A;  4YPC A;  1SQP K;  1PGJ A;  1OIP A;  2E74 C;  2M8P A;  3H32 B;  4I2L C;  3V4W A;  3K5B A;  1CZQ A;  5HV8 A;  1EDI A;  2E75 B;  1FC2 C;  1JEK A;  1ACP A;  4H2W C;  3SWF A;  2KYV A;  1KB9 I;  1S72 P;  4GOE A;  3M9B A;  1PIX A;  3UIA A;  4KHX A;  4GOF A;  1Q81 Q;  2O1J A;  1S3J A;  1CI6 B;  2PFX A;  2IDB A;  2KOG A;  2SPZ A;  2ZXE B;  4EIJ A;  3FWN A;  2JU1 A;  1PEU A;  2AVA A;  1E5W A;  1GW4 A;  5AVW B;  1J1E C;  1J1D B;  3L73 E;  1G1J A;  2WSC J;  1HH0 A;  2JR8 A;  3EFG A;  5KLI C;  4ASV A;  2DGY A;  1L0L G;  2ITA A;  4PV1 B;  3G29 A;  1SQB K;  3TGU E;  4JYB A;  4D6T E;  4ZKU A;  2J59 M;  2WPV B;  1S1C X;  2ROQ A;  3H1K J;  2O01 N;  2Y0C A;  3H1H D;  5APT A;  2M5A B;  2H7H A;  2WSE J;  4K35 A;  1RE3 A;  1P84 D;  3AEA C;  2ONT A;  3BVH A;  2NPS D;  1NO4 A;  1LT9 C;  5B5E H;  3IN6 A;  5KTB A;  3F89 A;  2CPS A;  3NXS A;  3QH9 A;  5AW6 B;  1A8O A;  3VTP C;  2YKQ A;  2K0D X;  2KNC A;  3D6Y A;  3LMO A;  3AE2 C;  1M56 D;  3Q20 A;  1SQP G;  2IX7 C;  1Q82 Q;  2P67 A;  1YYC A;  1ZNV A;  4ASW A;  5KKZ B;  3GHG C;  4TT3 H;  2MJZ A;  3GZM A;  2P10 A;  2MR8 A;  1OWA A;  1YQ4 C;  2M3B A;  2K93 A;  3QWO C;  1RF1 B;  2HG5 D;  3L72 E;  1L4A A;  4ZKP A;  1FBM A;  3PP5 A;  3DPH A;  3A7O A;  1NTM D;  4I1L A;  5AVZ B;  1KIL B;  1ZRT D;  2R44 A;  2M8N A;  3EJB A;  3B5N B;  1RE4 C;  4DG9 A;  3RL0 D;  4DCK A;  2E76 B;  1SQP D;  2C9N Y;  1LJ2 A;  2D2C C;  2BAS A;  4DT0 A;  2EIA A;  1G2C B;  3L75 J;  2OQQ A;  3HD7 D;  1T8K A;  3VP9 A;  1AFO A;  5AW2 B;  1WRG A;  3GG2 A;  4WWI A;  1SQQ G;  2IBZ G;  1GL2 C;  3HTK B;  2PEQ A;  4CPG A;  5KP7 B;  3BCC J;  5CBN A;  1JY2 O;  1QVG O;  5AW1 B;  5APW A;  2PNG A;  1RNI A;  3P05 A;  2BCC G;  1HJB A;  2XT1 A;  3L70 J;  3TDK A;  2N1T C;  1KIL E;  2CGQ A;  4U0B A;  4EOT A;  1BE3 G;  2POH A;  2RKL A;  2EFJ A;  1SQQ E;  3SFD C;  3CD6 P;  4M3L A;  1T8Z A;  1CI6 A;  2JJL A;  2P1J A;  1MV8 A;  3H1J J;  1DEB A;  3CWB G;  2LOL A;  3VP8 A;  1T3U A;  4KT0 J;  1SQB D;  3P8C D;  1LTG C;  3EWK A;  1L0N G;  2BCC D;  3GF7 A;  1W5C E;  2FAE A;  2NO8 A;  1RE3 C;  1D1D A;  1MZ8 A;  2N9Y B;  3AE8 C;  2KOQ A;  1JO5 A;  2FFD A;  2XZ0 D;  2V7Q H;  2KW2 A;  2WSS H;  1FZA A;  4NPE A;  4WVZ A;  2Z5I A;  2E74 D;  4H13 B;  1LTJ B;  4N3Y B;  1VQ5 P;  3Q3D A;  2RN0 A;  2M5A A;  5F2O A;  1S5L E;  1QLE D;  2YO3 A;  1DX7 A;  1FZG A;  1EXI A;  5CCG C;  2MR7 A;  2KB7 P;  2ZFC A;  3MIW A;  5B66 H;  3TNU A;  3B4Q A;  1Y9B A;  2FYU E;  1NGM B;  3G26 A;  4WY4 C;  1Q86 Q;  5H2F E;  1IMP A;  1T2K D;  3A0H E;  2QG4 A;  2L6E A;  3IAO A;  1F80 D;  4XFZ A;  5EFW B;  1FZC C;  1BCC G;  2KOO A;  4N6J A;  4L73 A;  3CME P;  3O8Z A;  4PD4 E;  1CEI A;  4GIF A;  1FS0 E;  2KGD A;  1HUC A;  2VLP A;  2LXC B;  4H0L C;  1RF1 A;  4DJG A;  2BEZ F;  2Q7C A;  1YHQ P;  1R8E A;  2H8P D;  1YTZ I;  2B88 A;  3NTN A;  1GU4 A;  2KG9 A;  3C1L A;  5KLV E;  1KIL A;  2A45 G;  3RGU A;  2ZT9 C;  3P7K A;  4PJ0 H;  4NEO A;  2K94 A;  1NTK G;  4PH0 A;  1M8O B;  2GDY A;  2WQY C;  1J2J B;  5GTI H;  1BCC D;  1LTT C;  1LTB C;  3WU2 H;  1DD4 A;  3HUS B;  3L71 J;  5BU8 B;  2K0Y A;  2YIU B;  2IBZ I;  2CQ8 A;  2PEN A;  1OVR A;  2ERH A;  1USD A;  2J5U A;  3CCR P;  1N7S D;  1IFM A;  1SQV G;  3AEB C;  2Z5H A;  1GXH A;  3CX5 I;  4AUW A;  3HTK A;  2JO0 A;  3B8E B;  4IL6 H;  1R5L A;  2R32 A;  2KOD A;  1M6N A;  2Z44 A;  5KAF H;  3H1L E;  1PEQ A;  1SS1 A;  2MY5 A;  4EDF A;  1WT6 A;  2P9X A;  5AW3 B;  2FKW B;  1NTK E;  5BS2 A;  5AVV B;  3CCL P;  3PTZ A;  3KPE A;  1HTL C;  4QKO A;  1EZV D;  3CXH I;  2YO2 A;  2JWA A;  1VQO P;  3G0V A;  4WBA A;  5KAI H;  2ZJS E;  1M7L A;  3BCC D;  2FVA A;  3CX5 H;  1KYO D;  2GZI A;  1LGH B;  1SQX G;  2EHT A;  1S9K D;  1VQM P;  2FXP A;  2FFD C;  1KN7 A;  1KC8 Q;  3DTJ A;  2JWD A;  2ZYG A;  1M90 Q;  1IFI A;  3H1H J;  3L74 E;  1PP9 D;  1HF9 A;  1AV1 A;  3CXH H;  2XZ1 C;  2V7Q J;  1HWT C;  2AXC A;  3L70 E;  3AE3 C;  4GR2 A;  2Q1K A;  4N78 D;  2KGC A;  2KLV A;  2J58 A;  4R4L A;  1SQX E;  3H1I D;  1KB9 D;  1K9M Q;  3LW5 H;  3H1J D;  2A06 G;  1L0L J;  1JJ2 O;  1PPJ E;  2AFD A;  2QJP B; 
#chains in the Genus database with same CATH homology
 4M0I A;  1ZMB A;  4PH0 A;  1D1D A;  1VQ4 P;  5F2N A;  2PEO A;  3CCM P;  1PEU A;  3G4S P;  3CXC O;  2Z46 A;  4U0F A;  1IUQ A;  1YIT P;  2EG5 A;  4XFX A;  1VQ9 P;  1PEO A;  4U0A A;  1VQ8 P;  3DPH A;  2PEN A;  2M8L A;  2OTJ P;  3MGE A;  3CCR P;  5I4T G;  4COP A;  2M8N A;  1A43 A;  1K8A Q;  2OAR A;  2E1M A;  2JO0 A;  3CCE P;  1AUM A;  3NTE A;  1KQS O;  4IPY A;  1VQ5 P;  3CC4 P;  3G1I A;  2KOD A;  5F2O A;  1M6N A;  2EIA A;  2PEK A;  2JYL A;  1M6E X;  2PY8 A;  2Z44 A;  3E2D A;  5HGN A;  3CMA P;  1Q7Y Q;  1PEQ A;  2QA4 P;  2DGY A;  3G1G A;  3B5I A;  3G29 A;  1RO2 A;  2P9X A;  1YJW P;  5BS2 A;  1VQK P;  3CCL P;  1W2B O;  2Z45 A;  3CCV P;  2LF4 A;  3CC2 P;  1PEM A;  3HZQ A;  3I56 P;  4U0E A;  4U0D A;  1YJN P;  3DS0 A;  3RG6 C;  5JPA A;  1VQO P;  3G0V A;  2PEM A;  2PEQ A;  3CCJ P;  2JYG A;  3DS2 A;  3G26 A;  2XV6 A;  4XFY A;  1EOQ A;  1K73 Q;  1QVG O;  1E6J P;  2XXM A;  1YI2 P;  1Q86 Q;  4XRO A;  5HGO A;  3G71 P;  2ONT A;  1QVF O;  1RO0 A;  5BS1 A;  3LRY A;  1RNI A;  2PEI A;  3P05 A;  1VQM P;  2L6E A;  3H47 A;  2XT1 A;  4COC A;  4U0C A;  4XFZ A;  1KC8 Q;  4XRQ A;  3DTJ A;  1VQN P;  2OTL P;  1QRJ A;  4U0B A;  3HYB A;  1M90 Q;  3CC7 P;  3WBH A;  3DS3 A;  1VQ7 P;  3OW2 O;  3CPW O;  1YIJ P;  2CWO A;  2M8P A;  3CME P;  1EIA A;  2EFJ A;  3H4E A;  4WYM A;  1A8O A;  3G6E P;  1BAJ A;  1NJI Q;  3CD6 P;  1M1K Q;  1VQP P;  5DCK A;  4GR2 A;  2BHV A;  3CCS P;  3DS4 A;  3Q20 A;  2BUO A;  4GR6 A;  5HGL A;  3CCU P;  1YHQ P;  1VQL P;  1Q82 Q;  3DS1 A;  2PEJ A;  1K9M Q;  3G21 A;  5HGM A;  3VRL C;  1N8R Q;  5F2K A;  2BQ1 E;  3DS5 A;  3G28 A;  4PH1 A;  1M74 A;  3I55 P;  3H0D A;  1JJ2 O;  1K30 A;  1S72 P;  1VQ6 P;  3M1M A;  4QNB A;  3CCQ P;  1YJ9 P;  2QEX P;  1KD1 Q;  1Q81 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...