1VQKP

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqkP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqkP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqkP02
1YITP 1Q7YQ 1M1KQ 3CC2P 1VQ6P 2OTLP 3CCVP 1YJ9P 1W2BO 1N8RQ 1YJNP 1K9MQ 1VQ5P 1VQ7P 3CCEP 1QVGO 3CCLP 1VQPP 3CC7P 1YI2P 1KC8Q 3CXCO 3OW2O 3CMAP 3CCJP 1Q86Q 3CMEP 1KQSO 2QEXP 1YIJP 1KD1Q 3CD6P 2OTJP 3I56P 3CCQP 1K73Q 3CCUP 1K8AQ 1VQ9P 1VQNP 1QVFO 3G71P 1JJ2O 1VQ8P 3I55P 3CCMP 1VQKP 1M90Q 1VQMP 1VQOP 2QA4P 1YHQP 1YJWP 1VQ4P 3CC4P 1VQLP 1S72P 3CCSP 1Q81Q 1Q82Q 3CCRP 3G6EP 3G4SP 3CPWO 1NJIQ
chains in the Genus database with same CATH superfamily
1RF0C 3LW5H 1LTJA 1QVGO 3EJBA 1FU1A 1IFIA 1EDIA 4QKOA 2YXQB 4D6TG 1VQ9P 3MD0A 4H13C 4L75A 2Q7CA 1G2CB 1FJPA 4Y99C 1NTMG 2WSCJ 2QM7A 1ZNVA 4NPEA 1S5LH 3P8CE 2K5XA 1KB9D 2B87A 2P1JA 1SFCC 2N6YA 1YJNP 3FWNA 5GTIE 1BGYG 5KP7B 1L4AA 1LTIC 1SQXJ 3V4WA 1SQQJ 2FYUD 1MZ9A 4U0CA 1LT9B 1M6EX 1Z56A 1NO4A 5KAIE 2K93A 1NTZG 1NKZB 4I7ZC 3H6PA 1N73A 3CC2P 1EDLA 2LIWA 2WPQA 2JO1A 2AFEA 3L72D 3L74D 3RK3E 2I1KA 1AF8A 3EJDA 3CL3D 3H1JG 3B5ND 4GR6A 1LTAC 1KB9E 3S4RA 2QNWA 3B5NA 2R32A 1OVUA 3NTNA 1S1CX 2P58A 3DS4A 4H13D 1L0LK 2JYLA 5AW6B 1NU1J 1K05A 3HTKB 2EHSA 1KILA 2I1JA 5APYA 3RL0D 4WY4D 1EZVE 3TYYA 1VDFA 3B5IA 2B87B 3RL0B 2VRSA 3Q5PA 1J1DB 5DCKA 1Q81Q 3CPWO 2KOOA 2OYOA 5H2FE 4I6MC 1GTWA 1RE3C 1RO2A 3NMDA 2M0BA 3L72G 1LTBC 1DD4A 5HGOA 1KD1Q 1AJYA 1S3JA 2CPSA 3PLNA 3HD7D 2FFDA 1BE3D 3H1HJ 5HVCA 4LLHA 2W90A 1ZN5A 2NPSD 2Y0EA 2JU2A 3JCUE 2VLPA 1KFNA 2QM8A 1H8AA 2Y9ZA 1AQTA 2FAEA 1IK9A 1PP9E 3VOPA 2E74B 3L72E 2KOSA 3K5BA 3PHLA 2GZGA 1T2KC 3U43A 1MFZA 1OVVA 4TT3H 3FXEA 4GOFA 1N8RQ 1PEOA 1QEXA 2HPCB 2C0WA 2O01H 3Q1MA 2NRGA 2JU1A 2AVAA 1KQSO 3CXHI 3QWOC 5AVVB 3A0HE 4LGDE 3L73J 3CI9A 1H89A 5CHXA 2N1TD 5TJHA 3II6A 1SP4A 1PGOA 1KYOH 1Q82Q 1DIPA 3H1LE 2FY8A 1VHNA 2WZ7A 2C9LY 1OXZA 3D6YA 5DJUB 3BCCJ 1Y9BA 1GU5A 2ZYAA 2QJYB 3AE4C 3H25A 1YTZI 3KHUA 4HYTB 3E1RA 3U59A 2QA4P 2E5YA 2JQ4A 4H44B 3CCSP 4W7ZA 3SSUA 1QL1A 5KAIH 2FXOA 3V2RA 4U3FE 2Y0DA 2XV5A 1PP9G 2GUVA 2WPRA 1IMQA 2MY5A 5AW7B 1Z6MA 5E79E 4IZ6A 1PPJE 2KNCA 4PV1D 2YKQA 1TU3F 2MF4A 1BE3J 3ABVC 3C1LA 1NHLA 1KN7A 2KS1A 3S9OA 2AEFA 1ZLLA 5AVTB 3P05A 1PGJA 3SWKA 3H1IG 1FZEA 2Z5IA 4WWIA 5K5GB 2QJPB 2FFDC 2NZ2A 1M8OB 5AW9B 2Y0CA 4WVZA 1RQUA 4U0BA 2ITAA 2QEXP 2GZEA 2D2CD 5GTIH 1K73Q 4BPGA 2H43A 2WSEH 3RBXA 1M90Q 1IFMA 5BVZA 3DS3A 1ZW0A 3G9RA 2N6ZA 1OWAA 2LMLA 3H0DA 2IPPA 1DEBA 1PFIA 1NTMD 2IFMA 4JYCA 1L4AD 1PGQA 1UIIA 1CI6B 1RF1B 2MJZA 2GDWA 1S9KD 2FYNC 1GD2E 5EFWB 3O6QB 1JY3N 3LRYA 1VF5D 3E1IA 3VMXA 2KZIA 1NTME 1VF5B 3GHGC 4ASVA 2W6AA 2E75C 1GPJA 1VKUA 3H32B 3BRTB 1IMPA 1CW5A 4YPCA 2AFDA 3WUVA 1J2JB 2W8ZA 4LC1A 2WVRA 2BHVA 1K8AQ 2JP3A 2X2BA 1YBKA 2WSCH 5E79H 3SFDC 2ZYGA 3D6ZA 3M0DC 2OYIB 2ZT9D 1NTZJ 1PV3A 3CWBG 2ZT9B 1LP1B 2Q3EA 2IYOA 5AVQB 3G28A 3IF4A 1EOQA 3L70D 1R8EA 1PZQA 4UB8E 1AVOA 3VMZA 1M1JB 1DEEG 3RK2D 1CEIA 5AVRB 4H0LC 3AE9C 3HD7A 1FAVA 1SQVJ 5BS2A 2E75D 1NU1G 2RN0A 4PJ0H 1KYOE 1GU4A 1MUUA 1PEUA 3LIEA 1JNMA 4GDOA 1Q2NA 1YJ9P 5AW4B 4H2XC 2D2CC 1SQXE 3HE5A 4HKGA 4YXDC 4H13B 3IFMA 4Y99B 2CG5B 1VQ8P 2B89A 3T97B 3CCMP 1ZXGA 3RK3B 1GZLA 1FOSE 1LT1A 3Q5SA 3V6IA 1OW6A 2GZJA 2EFJA 1NTKE 2N1TC 1HUCA 4U3FJ 1LTTC 2O01J 5KLVE 3G71P 1KYOD 3AE8C 2M8NA 1JTHB 1SQQG 2GYKA 3OJAB 5APQA 1AQ5A 2KGDA 2KGAA 1IFJA 4BRYB 4IL6E 3F5HA 4YXWH 1RF0A 1G1IA 4BXLA 3NXSA 2Z4EA 3KZIH 3AEGC 1YQ3C 2FQ1A 4GOEA 3AE6C 1NU1D 2M3BA 1S4XA 2K3RA 2JDIH 2E74D 2CK3H 3CXHE 1KILC 1BGYJ 4IL6X 1LWUB 2JWDA 2PAJA 4NEOA 3L70J 2ZYDA 3RL0C 4OGQD 2M5AA 2M5AB 1JY2O 5KP6B 3M0DA 1UJZA 3KZIE 3I5CA 3MZWB 2EIAA 1GK6A 5GTHH 3JCUH 1NQ4A 3M0AA 3GJNA 1JEKA 1N73B 2K92A 4H2YC 3GW6A 2ZVNB 2FXMA 5KLIC 4KT0J 3VTPC 5KJ7C 1AVYA 2OYHC 1PPJG 2WPVB 2L5GB 2PP6A 1FJKA 1HWTC 1RO0A 1KFMA 3PRJA 1SLQA 5L8RJ 3HTKA 3VP9A 1AYIA 1MFTA 4IFFA 1RE4A 4U7JA 4PV1B 3KYQA 1BDCA 1SQPE 1S2EA 2A45I 2WMMA 2XNXA 1LTSC 1NTZD 1ZRTD 2N1TA 1H0TA 3B71A 2ONTA 2WTYA 3A2AA 1L0NK 1BSHA 2IZ1A 3KXDA 3TNUA 4DJGA 3TGUD 2NO8A 2K94A 4ZNCA 2P9XA 1PP9D 2FBWC 2QJYC 2Z45A 3L71E 4TLFA 2A45G 1EXIA 2O1JA 2K9JA 1URQA 1BCCE 4H44C 3CC4P 2WWWA 1DX7A 1R5LA 1NU1K 3CE7A 3FWLA 2N5IA 2V7QJ 2HFED 4HH2A 3L75E 3C8VA 1BE3E 1L0ND 2FYUG 4OGQC 2JJLA 1FZBA 3L4FA 1RH5B 3W67A 1L0HA 1VQOP 2P10A 1NTZK 2H8PD 2CNRA 2W6BA 3RK2C 3AE3C 1NGMB 1IO4A 1P84E 1KILE 2PEOA 4DT0A 4W80A 1FZFA 2AEMA 3BVHA 4KHXA 2QIWA 5KLVK 1YJWP 1E5WA 1A43A 3ZDMA 2RKLA 1URQB 1E6JP 2AEJA 1EZVG 5KKZC 2JWAA 3MIWA 1HTLC 3OAKA 4K3AA 1Y8AA 2OGUA 2AXCA 4F37A 2E76B 1VQNP 5KAFE 2J5UA 2LR2A 3TDKA 4JPZB 3IN6A 2I8DA 3MHVA 3CWBJ 4D6TJ 4B86A 2M8PA 1FR2A 1JY2N 1SQXK 2WT7A 3L71G 2WT7B 1VQ6P 2OTLP 1U57A 2YMYA 1K9MQ 1OIPA 2FYUK 5C39A 2K9YA 1M74A 2A06G 1RF1C 4COCA 1SQBJ 2N9BA 2KOGA 2LXCB 1VQKP 3HUSB 3HUSA 2O3JA 2FQ2A 5CCHD 3CWBD 3C9IA 1M57D 1VF5C 1T8KA 2ZXXA 3H32A 2BCCE 2XKMA 1NTKJ 1BGYD 3L70G 2K0DX 2NPSC 2DGYA 1Q90D 2E75B 2N9YB 1L0LJ 1W5CE 4L76A 4UB6E 5APWA 1USEA 5AW8B 1JM0A 4HJGH 2OTKE 1FDIA 1KILD 1PL5A 2HG5D 1FC2C 1KB9I 4WY4A 1SFCA 2POHA 2XZRA 5APXA 4MN4C 2K88A 4C7NB 3G21A 1SFCD 2LF4A 2K37A 2ROQA 1T2KD 1LJ2A 2XZ1C 1YIJP 3WU2H 1HQBA 5CJ4A 4EI2A 2OYIC 3Q20A 5EJDA 4Z1MH 2ZT9C 1EZVD 3PH0A 1JY3P 2DW3A 1NTMK 4RJTA 3H1JD 3HD7B 2XNDH 2E1MA 3EJEA 2KOPA 3E2DA 1T8ZA 1RNIA 5I4TG 4BRYA 1IJDB 4H0LB 3USSA 3LW5J 1LTJB 3H47A 2H89C 2YO2A 4C46A 3A0HH 3MUDA 2KUBA 2HR3A 3H1JE 1HJ0A 3T97A 1U7JA 3VMAA 2KWLA 4WBAA 1IFNA 1EXJA 4ZKUA 1U7MA 3A3YB 4M3LA 1AUMA 5B5EH 5DJTB 3HE4A 1L4AB 2PNGA 2KORA 1N7SC 2JR8A 1RE3A 2KGEA 1M6NA 1SQQK 2XDJA 1NKNA 1FE6A 2OARA 1A02J 3U1AA 5HGNA 2WPSA 2KGCA 2FKWB 2ZFCA 1RF1A 4XFXA 1FOSF 4L74A 1OX3A 3P7KA 2LXBA 3VYIA 3W68A 3Q2YA 5CJ0A 3H1LJ 3NY7B 1M1JA 4XFYA 1W2EA 4RKUJ 3A5TA 3CCJP 4H44D 1EDJA 1ZMBA 3H1ID 3Q5RA 3RBZA 2KW2A 3P32A 2M8LA 1EC5A 3R4YA 1UNKA 2VSQA 5BS1A 4R0MA 3BCCD 4EDFA 3L71D 2ERHA 2GA1A 4WB4A 3QH9A 3HRNA 1J1EB 2P67A 2YKPA 3L37A 4ZMDA 2QSIA 1SQBD 4COPA 2PGDA 2IFNA 1JCDA 3L75G 2Y9YA 3A0BE 1BCCJ 3L73D 2OYIA 2R3CA 3H1IE 2BUOA 1PPJD 1HGZA 1X9VA 1KQLA 4PJ0E 2BEQD 1NWQA 3CCLP 1FZCB 1FZCA 1F80D 3CCQP 2L6EA 2JEEA 3B5NB 5KJ7A 1ZR4A 2KIKA 1SQVG 3H1IJ 5AVXB 5CCGD 3H1HG 2MR7A 1PGPA 4GT1A 2P7JA 2ZJSE 1HY8A 2PEQA 2E43A 2IBZD 4CPGA 1OR5A 1SQPJ 1NYHA 1SFCB 3GF7A 3H1KD 3G1IA 1X22A 4EIJA 1LP1A 2GZIA 4DOJA 1R5SA 3SFEC 2E5TA 3M9HA 4QMAA 4I7ZB 2ZVOB 1JJ2O 1HH0A 1SQBK 3V2PA 5CCHC 4GR2A 2YIUB 1SQBE 1BAJA 1ZRTE 2CQ8A 3V2NA 1NTKG 3F89A 5AW1B 3S1KA 1GMJA 4H2WC 1MKMA 3L74G 2QJKC 3CC7P 2LKMA 1L2PA 2FHSC 3CMAP 3V2QA 1URQD 2MKVA 2R5DA 1VQ4P 1RE4C 3MTUE 3L72J 2VLOA 3N4XA 2VLNA 2HODB 4HB1A 1SQVD 2GUSA 3CCEP 2DNWA 1JY2P 3CMEP 1M7LA 1L0LE 3LIDA 3M06A 1JCCA 1N86A 5HV8A 5CBNA 4CA3A 2GM4A 2KSJA 3DS2A 3G0VA 1GXGA 4BPHA 3JC22 2L4BA 3L36A 3M91A 2Q6QA 5BU5A 1W2BO 3Q3DA 1NTMJ 3TSIA 3BCCE 2N98A 4PD4D 1VPCA 2BCCG 1URQC 2KOQA 1SS1A 1YYCA 2PFXA 2B9BA 2XV6A 2LPKA 3KDPB 1NTKD 4UHPB 3L75J 2IBZG 2XT1A 2AXTE 4N6JA 1BCCG 4C7RA 1GXHA 2E74C 2E76C 1FDOA 2JYGA 3RG6C 3H1LD 2R3SA 4QNBA 1NOHA 5HGMA 4O9BA 3IR9A 5EW5E 4W7YA 3BCCG 1QL2A 1JTHA 3H1JJ 3IAOA 5AW5B 2KS1B 1X79B 3NTEA 2KI7B 2N50A 4IFDK 1KC8Q 1IUQA 1SVFA 1XTGB 3OA7A 3H1LG 2KR5A 3HUSC 3O8ZA 2KG9A 3VP8A 4H0LD 1YQ4C 5CCHA 2Q3IA 1K30A 4U0DA 3B4QA 1M1KQ 3DTJA 2KG8A 1VQ7P 3WMM0 3OW2O 2M8RA 1BXIA 3GZLA 3B4SA 2L22A 2IYPA 5AVZB 1LWUA 1JMBA 4EOTA 3I55P 3AE2C 4PWVB 1YHQP 3VN0A 1NAYA 3AE5C 4D6TE 3H1HD 3DS5A 2AF8A 3EQ2A 5B5EE 3CXHH 1FS0E 2BEZF 2RH0A 4U0FA 3H1KJ 4ASWA 4N78D 1FDMA 4PH0A 4U3FD 4NPFX 1XTCC 1SQXD 3O6QA 2A06E 3GF3A 1L0NG 1FZAA 2WSFJ 4DZOA 2PENA 1QRJA 1SQPG 2NPSA 3CCUP 2KLVA 3L75D 2PRRA 3DPHA 4EYYQ 3RG2A 1M56D 2RMZA 4GKGA 5CCGC 2PY8A 2YXRB 4NPDA 1IFDA 4WY4C 1KQGB 1SQQE 2YNYA 2V7QH 2GDYA 2CGQA 1Y47A 3CXCO 1Q86Q 1OFCX 1JO5A 4RO0A 2KK7A 2LIUA 3KQGA 1A8OA 2AXTH 1NAFA 1GDTA 1N7SA 1G1JA 3G29A 4BWNA 1CI6A 2WSSH 4R4LA 4AQRD 3M9QA 3RGUA 4U0AA 3TF5A 2FYNB 4JQ0D 1YI2P 3BASA 4BPFA 2QRXA 4GIFA 3AE1C 2PEJA 1P84I 4IL6H 4XROA 3BRVB 1DV5A 3B8EB 3V5BA 4RESB 3SWFA 2OYHA 3GG2A 1AFOA 3G4SP 3HYBA 2FYUE 2QE7H 3MUDC 4AYCA 2IBZI 1G2CA 2FXPA 1X3OA 1L0IA 2JKVA 3PTZA 1YTZT 1LTGC 4I2LC 2KB7P 4JYBA 1KILB 2FADA 2FACA 2JAZA 1LWUC 2C9NY 1P84D 1HJBA 2K2QA 2SPZA 3L70E 3HZQA 2HODA 4PD4I 1MZ8A 2ZXEB 2EHTA 2M3EA 2H7HA 4XFZA 2UWJE 3WUTA 3AE7C 1S5LE 2PEMA 1KORA 2WPTA 2V4HA 3H1HE 1VQMP 3A7OA 1GL2D 1N73C 1RHZB 3G6EP 5CBOA 2J58A 1M1JC 2JO0A 1GL2B 3MGNA 5KLIB 2OQQA 4AUWA 1SQPD 2W83C 5APSA 1PEQA 5KTBA 1FZCC 5F2NA 2WSEJ 1A02F 1SQVE 1H88A 5KJ7D 3B5NC 1L0LD 1D7MA 1NH4A 2D2CB 2E76D 1YITP 2FQ0A 4PV1C 2O1KA 3RK3C 1VQ5P 4HKZH 4R4MA 2IDBA 1NU1E 3GMAA 1ZOYC 4WYMA 1LGHB 1T6AA 2LL8A 1JY3O 1LT9C 1SQQD 2FYUJ 2QG4A 2N1TB 1ZP0C 1Q7YQ 1KV4A 3CCVP 1OW7A 4GODA 3M9BA 4Y28J 2P2UA 1P84H 2KZJA 2W6JH 3L71J 5F2OA 1MV8A 1USDA 2YIUC 2PEIA 4XA4A 3GZMA 1S9KE 1VL2A 3PJSK 4N78E 3SWYA 2K9JB 2QJKB 2L9FA 4OH8B 2FYZA 2KYVA 3G1GA 3I56P 1NTZE 2KLUA 1HGVA 2LTEA 3RL0g 4N3YB 4PD4H 1J1DC 1L0LG 5TISE 2M5RA 4IPYA 3AEBC 3H1KG 2G3AA 1NJIQ 2B88A 4ZKPA 1JUNA 2QVAA 1ZV8A 1BCCD 4IFMA 5KP8B 3P8MC 1DD3A 1QGKB 4D6TD 2BCCJ 3CLQA 2CWOA 1KYOI 3L73G 1IFPA 2WSFH 2KP8A 3VRLC 1JOCA 3TGUG 3CX5E 5B66H 1HF9A 1EQ7A 3EFGA 4IOIH 5KLVJ 1GW4A 3H1KE 3ITKA 4XE5B 2OYHB 3E7KA 1BDDA 2L91A 3BATA 2XU6A 1L0NE 4I1LA 2YO3A 1BE3G 3A0BH 5APVA 5GTHE 3AECC 1KQFB 2K0XA 1S72P 4A7PA 2MD9A 2Q1KA 5KLVD 1KLPA 4DCKA 1KTMA 3HE4B 2HYNA 2Z46A 1JMMA 2CPBA 3EFFK 3DS0A 1N7LA 5BU8B 2XXMA 1SQPK 1KMIZ 3FGAD 5AVYB 1PP9J 3MP7B 3TK1A 2O01N 2FVFA 5APUA 3L74E 1K04A 1OVRA 3TGUJ 1KZUB 1DNYA 1X0TA 1BGYE 1AA0A 1LT9A 2BCCD 3MGEA 5AW3B 1L0NJ 1CZQA 2KODA 2Q5UA 4U0EA 1QX8A 2IZ0A 3D70A 1JB0J 4PH1A 2JB0A 1LNQA 3UIAA 2K1AA 1ACPA 3G3ZA 4OWFA 2R44A 4YTPC 2HLOA 2N5HA 3P8CD 1GW3A 3PP5A 2NPSB 3D71A 1OZHA 1NTKK 2ZAEB 5H2FH 3AEEC 4MRTC 3GKLC 2R5BA 4KJMA 1E0HA 3CX5D 1QLED 3WU2E 1DH3A 3DS1A 3FXDA 2JBGA 5AVSB 1OMIA 2G8YA 3LMOA 2A45H 3CX5I 2KG6A 2EG5A 2HPCA 2MVVA 4L73A 2FVAA 2YMKA 4OGQB 1GK4A 2JGPA 1WT6A 2WQYC 5AVUB 3G26A 1HVVA 2J59M 3N7NA 2OTJP 2W27A 1EDKA 4M0IA 3RK2B 1UIXA 5JPAA 4DG9A 2QJPC 3KPEA 2FFDB 1GL2A 1PIXA 1SQVK 2E42A 1EIAA 3CX5H 5B66E 5KLVG 3FX0A 2FVEA 1E79H 1T3JA 1LTJC 1IC2A 1HBWA 4JBZA 4JF7A 3VMYA 4UB8H 1QVFO 5KKZB 3TGUE 2MVUA 3HE5B 5CCGA 3RK3D 1IK7A 3M1MA 4PXHB 4WY4B 1RQVA 2MR8A 2K0YA 1X8YA 2Z5HA 2LKIA 2KNCB 4C7NA 2IX7C 5TISH 1L4AC 2L0QA 4PD4E 3AEAC 1N7SB 1WRGA 3L35A 3CWBE 3U1CA 1FZGA 1N7SD 5CZDB 2Z44A 1NVOA 1EMVA 1CSBA 4UB6H 3CCRP 2H88C 1OW8A 1T3UA 1KB9H 5APTA 4XFJA 1H0TB 3GHGB 3GHGA 1EZVI 1FBMA 3CD6P 2C0XA 2GZFA 2Q9IA 1IZNB 2LOLA 7CEIA 3NFQA 3GLMA 5F2KA 2XZ0D 3H4EA 1N2DC 5AW2B 2YKOA 1D1DA 2BASA 2BQ1E 3L73E 5M1BA 5AW0B 2GDXA 2A06D 3JSVC 1RY3A 4OVNF 3WUUA 1AV1A 1J1EC 3L74J 3V4QA 1ZR2A 3AEFC 2KSEA 3EWKA 1PEMA 5KAFH 3AEDC 2KXPB 2PEKA 5HGLA 1SQBG 5AVWB 1VQPP 2WITA 3R2PA 3CXHD 1BSNA 4K35A 4U3FG 1ZMEC 2VLQA 3TNUB 4XRQA 2IBZE 1WMKA 1SQXG 1VQLP 3HD7C 5CMZA 1S5LX 3WBHA 1GL2C
chains in the Genus database with same CATH topology
3G1IA 4U0EA 1RO2A 2XT1A 3G21A 4XFZA 2LF4A 1QVGO 2EFJA 1RO0A 4PH1A 3CCJP 2PENA 5HGOA 1QRJA 1YIJP 1KD1Q 1ZMBA 3G1GA 2PEOA 3I56P 2PEMA 3CCUP 1VQ9P 2JYGA 3RG6C 3G71P 1JJ2O 3DPHA 2M8NA 4GR2A 4QNBA 2Z44A 2M8LA 1VQMP 1BAJA 5HGMA 1YJWP 1A43A 3Q20A 2PY8A 5BS1A 4IPYA 3CCRP 1E6JP 3G6EP 1NJIQ 2JO0A 1YJNP 3NTEA 1PEQA 3CC7P 2E1MA 1KC8Q 3E2DA 5F2NA 3CXCO 3CMAP 1Q86Q 1IUQA 1RNIA 3P05A 5I4TG 4COPA 3CD6P 2BHVA 1K8AQ 1VQNP 2ONTA 3DS1A 1A8OA 4U0CA 2CWOA 3H47A 1VQ4P 5F2KA 1M6EX 3H4EA 1K30A 2EG5A 4U0DA 2M8PA 3G29A 2BUOA 1M1KQ 1YITP 3VRLC 3CC2P 3G28A 1VQ6P 2OTLP 3DTJA 1D1DA 1N8RQ 1K9MQ 3CCEP 4U0BA 2P9XA 4U0AA 1VQ5P 1VQ7P 1PEOA 1EOQA 3CCLP 2BQ1E 1YI2P 3CMEP 3OW2O 3G26A 1KQSO 2QEXP 2OTJP 2PEJA 2Z45A 3CCQP 1M74A 2L6EA 1K73Q 4GR6A 4COCA 4M0IA 4WYMA 3I55P 1VQKP 1M90Q 4XROA 1YHQP 3DS2A 1AUMA 5JPAA 3G0VA 3CC4P 1S72P 5BS2A 3DS4A 1PEMA 2JYLA 1Q82Q 3G4SP 3HYBA 3DS3A 1EIAA 2EIAA 1Q7YQ 1PEUA 3DS5A 1M6NA 3CCVP 1YJ9P 2PEKA 5HGLA 3H0DA 1W2BO 2Z46A 1VQPP 3DS0A 4U0FA 2DGYA 2PEQA 2XXMA 5F2OA 2OARA 3B5IA 1QVFO 4PH0A 1VQ8P 5HGNA 3CCMP 2PEIA 4XFXA 4XRQA 1VQOP 2QA4P 2KODA 1VQLP 3HZQA 5DCKA 3CPWO 3CCSP 3M1MA 3WBHA 1Q81Q 3LRYA 3MGEA 4XFYA 2XV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT P;  1Q7Y Q;  1M1K Q;  3CC2 P;  1VQ6 P;  2OTL P;  3CCV P;  1YJ9 P;  1W2B O;  1N8R Q;  1YJN P;  1K9M Q;  1VQ5 P;  1VQ7 P;  3CCE P;  1QVG O;  3CCL P;  1VQP P;  3CC7 P;  1YI2 P;  1KC8 Q;  3CXC O;  3OW2 O;  3CMA P;  3CCJ P;  1Q86 Q;  3CME P;  1KQS O;  2QEX P;  1YIJ P;  1KD1 Q;  3CD6 P;  2OTJ P;  3I56 P;  3CCQ P;  1K73 Q;  3CCU P;  1K8A Q;  1VQ9 P;  1VQN P;  1QVF O;  3G71 P;  1JJ2 O;  1VQ8 P;  3I55 P;  3CCM P;  1VQK P;  1M90 Q;  1VQM P;  1VQO P;  2QA4 P;  1YHQ P;  1YJW P;  1VQ4 P;  3CC4 P;  1VQL P;  1S72 P;  3CCS P;  1Q81 Q;  1Q82 Q;  3CCR P;  3G6E P;  3G4S P;  3CPW O;  1NJI Q; 
#chains in the Genus database with same CATH topology
 1RF0 C;  3LW5 H;  1LTJ A;  1QVG O;  3EJB A;  1FU1 A;  1IFI A;  1EDI A;  4QKO A;  2YXQ B;  4D6T G;  1VQ9 P;  3MD0 A;  4H13 C;  4L75 A;  2Q7C A;  1G2C B;  1FJP A;  4Y99 C;  1NTM G;  2WSC J;  2QM7 A;  1ZNV A;  4NPE A;  1S5L H;  3P8C E;  2K5X A;  1KB9 D;  2B87 A;  2P1J A;  1SFC C;  2N6Y A;  1YJN P;  3FWN A;  5GTI E;  1BGY G;  5KP7 B;  1L4A A;  1LTI C;  1SQX J;  3V4W A;  1SQQ J;  2FYU D;  1MZ9 A;  4U0C A;  1LT9 B;  1M6E X;  1Z56 A;  1NO4 A;  5KAI E;  2K93 A;  1NTZ G;  1NKZ B;  4I7Z C;  3H6P A;  1N73 A;  3CC2 P;  1EDL A;  2LIW A;  2WPQ A;  2JO1 A;  2AFE A;  3L72 D;  3L74 D;  3RK3 E;  2I1K A;  1AF8 A;  3EJD A;  3CL3 D;  3H1J G;  3B5N D;  4GR6 A;  1LTA C;  1KB9 E;  3S4R A;  2QNW A;  3B5N A;  2R32 A;  1OVU A;  3NTN A;  1S1C X;  2P58 A;  3DS4 A;  4H13 D;  1L0L K;  2JYL A;  5AW6 B;  1NU1 J;  1K05 A;  3HTK B;  2EHS A;  1KIL A;  2I1J A;  5APY A;  3RL0 D;  4WY4 D;  1EZV E;  3TYY A;  1VDF A;  3B5I A;  2B87 B;  3RL0 B;  2VRS A;  3Q5P A;  1J1D B;  5DCK A;  1Q81 Q;  3CPW O;  2KOO A;  2OYO A;  5H2F E;  4I6M C;  1GTW A;  1RE3 C;  1RO2 A;  3NMD A;  2M0B A;  3L72 G;  1LTB C;  1DD4 A;  5HGO A;  1KD1 Q;  1AJY A;  1S3J A;  2CPS A;  3PLN A;  3HD7 D;  2FFD A;  1BE3 D;  3H1H J;  5HVC A;  4LLH A;  2W90 A;  1ZN5 A;  2NPS D;  2Y0E A;  2JU2 A;  3JCU E;  2VLP A;  1KFN A;  2QM8 A;  1H8A A;  2Y9Z A;  1AQT A;  2FAE A;  1IK9 A;  1PP9 E;  3VOP A;  2E74 B;  3L72 E;  2KOS A;  3K5B A;  3PHL A;  2GZG A;  1T2K C;  3U43 A;  1MFZ A;  1OVV A;  4TT3 H;  3FXE A;  4GOF A;  1N8R Q;  1PEO A;  1QEX A;  2HPC B;  2C0W A;  2O01 H;  3Q1M A;  2NRG A;  2JU1 A;  2AVA A;  1KQS O;  3CXH I;  3QWO C;  5AVV B;  3A0H E;  4LGD E;  3L73 J;  3CI9 A;  1H89 A;  5CHX A;  2N1T D;  5TJH A;  3II6 A;  1SP4 A;  1PGO A;  1KYO H;  1Q82 Q;  1DIP A;  3H1L E;  2FY8 A;  1VHN A;  2WZ7 A;  2C9L Y;  1OXZ A;  3D6Y A;  5DJU B;  3BCC J;  1Y9B A;  1GU5 A;  2ZYA A;  2QJY B;  3AE4 C;  3H25 A;  1YTZ I;  3KHU A;  4HYT B;  3E1R A;  3U59 A;  2QA4 P;  2E5Y A;  2JQ4 A;  4H44 B;  3CCS P;  4W7Z A;  3SSU A;  1QL1 A;  5KAI H;  2FXO A;  3V2R A;  4U3F E;  2Y0D A;  2XV5 A;  1PP9 G;  2GUV A;  2WPR A;  1IMQ A;  2MY5 A;  5AW7 B;  1Z6M A;  5E79 E;  4IZ6 A;  1PPJ E;  2KNC A;  4PV1 D;  2YKQ A;  1TU3 F;  2MF4 A;  1BE3 J;  3ABV C;  3C1L A;  1NHL A;  1KN7 A;  2KS1 A;  3S9O A;  2AEF A;  1ZLL A;  5AVT B;  3P05 A;  1PGJ A;  3SWK A;  3H1I G;  1FZE A;  2Z5I A;  4WWI A;  5K5G B;  2QJP B;  2FFD C;  2NZ2 A;  1M8O B;  5AW9 B;  2Y0C A;  4WVZ A;  1RQU A;  4U0B A;  2ITA A;  2QEX P;  2GZE A;  2D2C D;  5GTI H;  1K73 Q;  4BPG A;  2H43 A;  2WSE H;  3RBX A;  1M90 Q;  1IFM A;  5BVZ A;  3DS3 A;  1ZW0 A;  3G9R A;  2N6Z A;  1OWA A;  2LML A;  3H0D A;  2IPP A;  1DEB A;  1PFI A;  1NTM D;  2IFM A;  4JYC A;  1L4A D;  1PGQ A;  1UII A;  1CI6 B;  1RF1 B;  2MJZ A;  2GDW A;  1S9K D;  2FYN C;  1GD2 E;  5EFW B;  3O6Q B;  1JY3 N;  3LRY A;  1VF5 D;  3E1I A;  3VMX A;  2KZI A;  1NTM E;  1VF5 B;  3GHG C;  4ASV A;  2W6A A;  2E75 C;  1GPJ A;  1VKU A;  3H32 B;  3BRT B;  1IMP A;  1CW5 A;  4YPC A;  2AFD A;  3WUV A;  1J2J B;  2W8Z A;  4LC1 A;  2WVR A;  2BHV A;  1K8A Q;  2JP3 A;  2X2B A;  1YBK A;  2WSC H;  5E79 H;  3SFD C;  2ZYG A;  3D6Z A;  3M0D C;  2OYI B;  2ZT9 D;  1NTZ J;  1PV3 A;  3CWB G;  2ZT9 B;  1LP1 B;  2Q3E A;  2IYO A;  5AVQ B;  3G28 A;  3IF4 A;  1EOQ A;  3L70 D;  1R8E A;  1PZQ A;  4UB8 E;  1AVO A;  3VMZ A;  1M1J B;  1DEE G;  3RK2 D;  1CEI A;  5AVR B;  4H0L C;  3AE9 C;  3HD7 A;  1FAV A;  1SQV J;  5BS2 A;  2E75 D;  1NU1 G;  2RN0 A;  4PJ0 H;  1KYO E;  1GU4 A;  1MUU A;  1PEU A;  3LIE A;  1JNM A;  4GDO A;  1Q2N A;  1YJ9 P;  5AW4 B;  4H2X C;  2D2C C;  1SQX E;  3HE5 A;  4HKG A;  4YXD C;  4H13 B;  3IFM A;  4Y99 B;  2CG5 B;  1VQ8 P;  2B89 A;  3T97 B;  3CCM P;  1ZXG A;  3RK3 B;  1GZL A;  1FOS E;  1LT1 A;  3Q5S A;  3V6I A;  1OW6 A;  2GZJ A;  2EFJ A;  1NTK E;  2N1T C;  1HUC A;  4U3F J;  1LTT C;  2O01 J;  5KLV E;  3G71 P;  1KYO D;  3AE8 C;  2M8N A;  1JTH B;  1SQQ G;  2GYK A;  3OJA B;  5APQ A;  1AQ5 A;  2KGD A;  2KGA A;  1IFJ A;  4BRY B;  4IL6 E;  3F5H A;  4YXW H;  1RF0 A;  1G1I A;  4BXL A;  3NXS A;  2Z4E A;  3KZI H;  3AEG C;  1YQ3 C;  2FQ1 A;  4GOE A;  3AE6 C;  1NU1 D;  2M3B A;  1S4X A;  2K3R A;  2JDI H;  2E74 D;  2CK3 H;  3CXH E;  1KIL C;  1BGY J;  4IL6 X;  1LWU B;  2JWD A;  2PAJ A;  4NEO A;  3L70 J;  2ZYD A;  3RL0 C;  4OGQ D;  2M5A A;  2M5A B;  1JY2 O;  5KP6 B;  3M0D A;  1UJZ A;  3KZI E;  3I5C A;  3MZW B;  2EIA A;  1GK6 A;  5GTH H;  3JCU H;  1NQ4 A;  3M0A A;  3GJN A;  1JEK A;  1N73 B;  2K92 A;  4H2Y C;  3GW6 A;  2ZVN B;  2FXM A;  5KLI C;  4KT0 J;  3VTP C;  5KJ7 C;  1AVY A;  2OYH C;  1PPJ G;  2WPV B;  2L5G B;  2PP6 A;  1FJK A;  1HWT C;  1RO0 A;  1KFM A;  3PRJ A;  1SLQ A;  5L8R J;  3HTK A;  3VP9 A;  1AYI A;  1MFT A;  4IFF A;  1RE4 A;  4U7J A;  4PV1 B;  3KYQ A;  1BDC A;  1SQP E;  1S2E A;  2A45 I;  2WMM A;  2XNX A;  1LTS C;  1NTZ D;  1ZRT D;  2N1T A;  1H0T A;  3B71 A;  2ONT A;  2WTY A;  3A2A A;  1L0N K;  1BSH A;  2IZ1 A;  3KXD A;  3TNU A;  4DJG A;  3TGU D;  2NO8 A;  2K94 A;  4ZNC A;  2P9X A;  1PP9 D;  2FBW C;  2QJY C;  2Z45 A;  3L71 E;  4TLF A;  2A45 G;  1EXI A;  2O1J A;  2K9J A;  1URQ A;  1BCC E;  4H44 C;  3CC4 P;  2WWW A;  1DX7 A;  1R5L A;  1NU1 K;  3CE7 A;  3FWL A;  2N5I A;  2V7Q J;  2HFE D;  4HH2 A;  3L75 E;  3C8V A;  1BE3 E;  1L0N D;  2FYU G;  4OGQ C;  2JJL A;  1FZB A;  3L4F A;  1RH5 B;  3W67 A;  1L0H A;  1VQO P;  2P10 A;  1NTZ K;  2H8P D;  2CNR A;  2W6B A;  3RK2 C;  3AE3 C;  1NGM B;  1IO4 A;  1P84 E;  1KIL E;  2PEO A;  4DT0 A;  4W80 A;  1FZF A;  2AEM A;  3BVH A;  4KHX A;  2QIW A;  5KLV K;  1YJW P;  1E5W A;  1A43 A;  3ZDM A;  2RKL A;  1URQ B;  1E6J P;  2AEJ A;  1EZV G;  5KKZ C;  2JWA A;  3MIW A;  1HTL C;  3OAK A;  4K3A A;  1Y8A A;  2OGU A;  2AXC A;  4F37 A;  2E76 B;  1VQN P;  5KAF E;  2J5U A;  2LR2 A;  3TDK A;  4JPZ B;  3IN6 A;  2I8D A;  3MHV A;  3CWB J;  4D6T J;  4B86 A;  2M8P A;  1FR2 A;  1JY2 N;  1SQX K;  2WT7 A;  3L71 G;  2WT7 B;  1VQ6 P;  2OTL P;  1U57 A;  2YMY A;  1K9M Q;  1OIP A;  2FYU K;  5C39 A;  2K9Y A;  1M74 A;  2A06 G;  1RF1 C;  4COC A;  1SQB J;  2N9B A;  2KOG A;  2LXC B;  1VQK P;  3HUS B;  3HUS A;  2O3J A;  2FQ2 A;  5CCH D;  3CWB D;  3C9I A;  1M57 D;  1VF5 C;  1T8K A;  2ZXX A;  3H32 A;  2BCC E;  2XKM A;  1NTK J;  1BGY D;  3L70 G;  2K0D X;  2NPS C;  2DGY A;  1Q90 D;  2E75 B;  2N9Y B;  1L0L J;  1W5C E;  4L76 A;  4UB6 E;  5APW A;  1USE A;  5AW8 B;  1JM0 A;  4HJG H;  2OTK E;  1FDI A;  1KIL D;  1PL5 A;  2HG5 D;  1FC2 C;  1KB9 I;  4WY4 A;  1SFC A;  2POH A;  2XZR A;  5APX A;  4MN4 C;  2K88 A;  4C7N B;  3G21 A;  1SFC D;  2LF4 A;  2K37 A;  2ROQ A;  1T2K D;  1LJ2 A;  2XZ1 C;  1YIJ P;  3WU2 H;  1HQB A;  5CJ4 A;  4EI2 A;  2OYI C;  3Q20 A;  5EJD A;  4Z1M H;  2ZT9 C;  1EZV D;  3PH0 A;  1JY3 P;  2DW3 A;  1NTM K;  4RJT A;  3H1J D;  3HD7 B;  2XND H;  2E1M A;  3EJE A;  2KOP A;  3E2D A;  1T8Z A;  1RNI A;  5I4T G;  4BRY A;  1IJD B;  4H0L B;  3USS A;  3LW5 J;  1LTJ B;  3H47 A;  2H89 C;  2YO2 A;  4C46 A;  3A0H H;  3MUD A;  2KUB A;  2HR3 A;  3H1J E;  1HJ0 A;  3T97 A;  1U7J A;  3VMA A;  2KWL A;  4WBA A;  1IFN A;  1EXJ A;  4ZKU A;  1U7M A;  3A3Y B;  4M3L A;  1AUM A;  5B5E H;  5DJT B;  3HE4 A;  1L4A B;  2PNG A;  2KOR A;  1N7S C;  2JR8 A;  1RE3 A;  2KGE A;  1M6N A;  1SQQ K;  2XDJ A;  1NKN A;  1FE6 A;  2OAR A;  1A02 J;  3U1A A;  5HGN A;  2WPS A;  2KGC A;  2FKW B;  2ZFC A;  1RF1 A;  4XFX A;  1FOS F;  4L74 A;  1OX3 A;  3P7K A;  2LXB A;  3VYI A;  3W68 A;  3Q2Y A;  5CJ0 A;  3H1L J;  3NY7 B;  1M1J A;  4XFY A;  1W2E A;  4RKU J;  3A5T A;  3CCJ P;  4H44 D;  1EDJ A;  1ZMB A;  3H1I D;  3Q5R A;  3RBZ A;  2KW2 A;  3P32 A;  2M8L A;  1EC5 A;  3R4Y A;  1UNK A;  2VSQ A;  5BS1 A;  4R0M A;  3BCC D;  4EDF A;  3L71 D;  2ERH A;  2GA1 A;  4WB4 A;  3QH9 A;  3HRN A;  1J1E B;  2P67 A;  2YKP A;  3L37 A;  4ZMD A;  2QSI A;  1SQB D;  4COP A;  2PGD A;  2IFN A;  1JCD A;  3L75 G;  2Y9Y A;  3A0B E;  1BCC J;  3L73 D;  2OYI A;  2R3C A;  3H1I E;  2BUO A;  1PPJ D;  1HGZ A;  1X9V A;  1KQL A;  4PJ0 E;  2BEQ D;  1NWQ A;  3CCL P;  1FZC B;  1FZC A;  1F80 D;  3CCQ P;  2L6E A;  2JEE A;  3B5N B;  5KJ7 A;  1ZR4 A;  2KIK A;  1SQV G;  3H1I J;  5AVX B;  5CCG D;  3H1H G;  2MR7 A;  1PGP A;  4GT1 A;  2P7J A;  2ZJS E;  1HY8 A;  2PEQ A;  2E43 A;  2IBZ D;  4CPG A;  1OR5 A;  1SQP J;  1NYH A;  1SFC B;  3GF7 A;  3H1K D;  3G1I A;  1X22 A;  4EIJ A;  1LP1 A;  2GZI A;  4DOJ A;  1R5S A;  3SFE C;  2E5T A;  3M9H A;  4QMA A;  4I7Z B;  2ZVO B;  1JJ2 O;  1HH0 A;  1SQB K;  3V2P A;  5CCH C;  4GR2 A;  2YIU B;  1SQB E;  1BAJ A;  1ZRT E;  2CQ8 A;  3V2N A;  1NTK G;  3F89 A;  5AW1 B;  3S1K A;  1GMJ A;  4H2W C;  1MKM A;  3L74 G;  2QJK C;  3CC7 P;  2LKM A;  1L2P A;  2FHS C;  3CMA P;  3V2Q A;  1URQ D;  2MKV A;  2R5D A;  1VQ4 P;  1RE4 C;  3MTU E;  3L72 J;  2VLO A;  3N4X A;  2VLN A;  2HOD B;  4HB1 A;  1SQV D;  2GUS A;  3CCE P;  2DNW A;  1JY2 P;  3CME P;  1M7L A;  1L0L E;  3LID A;  3M06 A;  1JCC A;  1N86 A;  5HV8 A;  5CBN A;  4CA3 A;  2GM4 A;  2KSJ A;  3DS2 A;  3G0V A;  1GXG A;  4BPH A;  3JC2 2;  2L4B A;  3L36 A;  3M91 A;  2Q6Q A;  5BU5 A;  1W2B O;  3Q3D A;  1NTM J;  3TSI A;  3BCC E;  2N98 A;  4PD4 D;  1VPC A;  2BCC G;  1URQ C;  2KOQ A;  1SS1 A;  1YYC A;  2PFX A;  2B9B A;  2XV6 A;  2LPK A;  3KDP B;  1NTK D;  4UHP B;  3L75 J;  2IBZ G;  2XT1 A;  2AXT E;  4N6J A;  1BCC G;  4C7R A;  1GXH A;  2E74 C;  2E76 C;  1FDO A;  2JYG A;  3RG6 C;  3H1L D;  2R3S A;  4QNB A;  1NOH A;  5HGM A;  4O9B A;  3IR9 A;  5EW5 E;  4W7Y A;  3BCC G;  1QL2 A;  1JTH A;  3H1J J;  3IAO A;  5AW5 B;  2KS1 B;  1X79 B;  3NTE A;  2KI7 B;  2N50 A;  4IFD K;  1KC8 Q;  1IUQ A;  1SVF A;  1XTG B;  3OA7 A;  3H1L G;  2KR5 A;  3HUS C;  3O8Z A;  2KG9 A;  3VP8 A;  4H0L D;  1YQ4 C;  5CCH A;  2Q3I A;  1K30 A;  4U0D A;  3B4Q A;  1M1K Q;  3DTJ A;  2KG8 A;  1VQ7 P;  3WMM 0;  3OW2 O;  2M8R A;  1BXI A;  3GZL A;  3B4S A;  2L22 A;  2IYP A;  5AVZ B;  1LWU A;  1JMB A;  4EOT A;  3I55 P;  3AE2 C;  4PWV B;  1YHQ P;  3VN0 A;  1NAY A;  3AE5 C;  4D6T E;  3H1H D;  3DS5 A;  2AF8 A;  3EQ2 A;  5B5E E;  3CXH H;  1FS0 E;  2BEZ F;  2RH0 A;  4U0F A;  3H1K J;  4ASW A;  4N78 D;  1FDM A;  4PH0 A;  4U3F D;  4NPF X;  1XTC C;  1SQX D;  3O6Q A;  2A06 E;  3GF3 A;  1L0N G;  1FZA A;  2WSF J;  4DZO A;  2PEN A;  1QRJ A;  1SQP G;  2NPS A;  3CCU P;  2KLV A;  3L75 D;  2PRR A;  3DPH A;  4EYY Q;  3RG2 A;  1M56 D;  2RMZ A;  4GKG A;  5CCG C;  2PY8 A;  2YXR B;  4NPD A;  1IFD A;  4WY4 C;  1KQG B;  1SQQ E;  2YNY A;  2V7Q H;  2GDY A;  2CGQ A;  1Y47 A;  3CXC O;  1Q86 Q;  1OFC X;  1JO5 A;  4RO0 A;  2KK7 A;  2LIU A;  3KQG A;  1A8O A;  2AXT H;  1NAF A;  1GDT A;  1N7S A;  1G1J A;  3G29 A;  4BWN A;  1CI6 A;  2WSS H;  4R4L A;  4AQR D;  3M9Q A;  3RGU A;  4U0A A;  3TF5 A;  2FYN B;  4JQ0 D;  1YI2 P;  3BAS A;  4BPF A;  2QRX A;  4GIF A;  3AE1 C;  2PEJ A;  1P84 I;  4IL6 H;  4XRO A;  3BRV B;  1DV5 A;  3B8E B;  3V5B A;  4RES B;  3SWF A;  2OYH A;  3GG2 A;  1AFO A;  3G4S P;  3HYB A;  2FYU E;  2QE7 H;  3MUD C;  4AYC A;  2IBZ I;  1G2C A;  2FXP A;  1X3O A;  1L0I A;  2JKV A;  3PTZ A;  1YTZ T;  1LTG C;  4I2L C;  2KB7 P;  4JYB A;  1KIL B;  2FAD A;  2FAC A;  2JAZ A;  1LWU C;  2C9N Y;  1P84 D;  1HJB A;  2K2Q A;  2SPZ A;  3L70 E;  3HZQ A;  2HOD A;  4PD4 I;  1MZ8 A;  2ZXE B;  2EHT A;  2M3E A;  2H7H A;  4XFZ A;  2UWJ E;  3WUT A;  3AE7 C;  1S5L E;  2PEM A;  1KOR A;  2WPT A;  2V4H A;  3H1H E;  1VQM P;  3A7O A;  1GL2 D;  1N73 C;  1RHZ B;  3G6E P;  5CBO A;  2J58 A;  1M1J C;  2JO0 A;  1GL2 B;  3MGN A;  5KLI B;  2OQQ A;  4AUW A;  1SQP D;  2W83 C;  5APS A;  1PEQ A;  5KTB A;  1FZC C;  5F2N A;  2WSE J;  1A02 F;  1SQV E;  1H88 A;  5KJ7 D;  3B5N C;  1L0L D;  1D7M A;  1NH4 A;  2D2C B;  2E76 D;  1YIT P;  2FQ0 A;  4PV1 C;  2O1K A;  3RK3 C;  1VQ5 P;  4HKZ H;  4R4M A;  2IDB A;  1NU1 E;  3GMA A;  1ZOY C;  4WYM A;  1LGH B;  1T6A A;  2LL8 A;  1JY3 O;  1LT9 C;  1SQQ D;  2FYU J;  2QG4 A;  2N1T B;  1ZP0 C;  1Q7Y Q;  1KV4 A;  3CCV P;  1OW7 A;  4GOD A;  3M9B A;  4Y28 J;  2P2U A;  1P84 H;  2KZJ A;  2W6J H;  3L71 J;  5F2O A;  1MV8 A;  1USD A;  2YIU C;  2PEI A;  4XA4 A;  3GZM A;  1S9K E;  1VL2 A;  3PJS K;  4N78 E;  3SWY A;  2K9J B;  2QJK B;  2L9F A;  4OH8 B;  2FYZ A;  2KYV A;  3G1G A;  3I56 P;  1NTZ E;  2KLU A;  1HGV A;  2LTE A;  3RL0 g;  4N3Y B;  4PD4 H;  1J1D C;  1L0L G;  5TIS E;  2M5R A;  4IPY A;  3AEB C;  3H1K G;  2G3A A;  1NJI Q;  2B88 A;  4ZKP A;  1JUN A;  2QVA A;  1ZV8 A;  1BCC D;  4IFM A;  5KP8 B;  3P8M C;  1DD3 A;  1QGK B;  4D6T D;  2BCC J;  3CLQ A;  2CWO A;  1KYO I;  3L73 G;  1IFP A;  2WSF H;  2KP8 A;  3VRL C;  1JOC A;  3TGU G;  3CX5 E;  5B66 H;  1HF9 A;  1EQ7 A;  3EFG A;  4IOI H;  5KLV J;  1GW4 A;  3H1K E;  3ITK A;  4XE5 B;  2OYH B;  3E7K A;  1BDD A;  2L91 A;  3BAT A;  2XU6 A;  1L0N E;  4I1L A;  2YO3 A;  1BE3 G;  3A0B H;  5APV A;  5GTH E;  3AEC C;  1KQF B;  2K0X A;  1S72 P;  4A7P A;  2MD9 A;  2Q1K A;  5KLV D;  1KLP A;  4DCK A;  1KTM A;  3HE4 B;  2HYN A;  2Z46 A;  1JMM A;  2CPB A;  3EFF K;  3DS0 A;  1N7L A;  5BU8 B;  2XXM A;  1SQP K;  1KMI Z;  3FGA D;  5AVY B;  1PP9 J;  3MP7 B;  3TK1 A;  2O01 N;  2FVF A;  5APU A;  3L74 E;  1K04 A;  1OVR A;  3TGU J;  1KZU B;  1DNY A;  1X0T A;  1BGY E;  1AA0 A;  1LT9 A;  2BCC D;  3MGE A;  5AW3 B;  1L0N J;  1CZQ A;  2KOD A;  2Q5U A;  4U0E A;  1QX8 A;  2IZ0 A;  3D70 A;  1JB0 J;  4PH1 A;  2JB0 A;  1LNQ A;  3UIA A;  2K1A A;  1ACP A;  3G3Z A;  4OWF A;  2R44 A;  4YTP C;  2HLO A;  2N5H A;  3P8C D;  1GW3 A;  3PP5 A;  2NPS B;  3D71 A;  1OZH A;  1NTK K;  2ZAE B;  5H2F H;  3AEE C;  4MRT C;  3GKL C;  2R5B A;  4KJM A;  1E0H A;  3CX5 D;  1QLE D;  3WU2 E;  1DH3 A;  3DS1 A;  3FXD A;  2JBG A;  5AVS B;  1OMI A;  2G8Y A;  3LMO A;  2A45 H;  3CX5 I;  2KG6 A;  2EG5 A;  2HPC A;  2MVV A;  4L73 A;  2FVA A;  2YMK A;  4OGQ B;  1GK4 A;  2JGP A;  1WT6 A;  2WQY C;  5AVU B;  3G26 A;  1HVV A;  2J59 M;  3N7N A;  2OTJ P;  2W27 A;  1EDK A;  4M0I A;  3RK2 B;  1UIX A;  5JPA A;  4DG9 A;  2QJP C;  3KPE A;  2FFD B;  1GL2 A;  1PIX A;  1SQV K;  2E42 A;  1EIA A;  3CX5 H;  5B66 E;  5KLV G;  3FX0 A;  2FVE A;  1E79 H;  1T3J A;  1LTJ C;  1IC2 A;  1HBW A;  4JBZ A;  4JF7 A;  3VMY A;  4UB8 H;  1QVF O;  5KKZ B;  3TGU E;  2MVU A;  3HE5 B;  5CCG A;  3RK3 D;  1IK7 A;  3M1M A;  4PXH B;  4WY4 B;  1RQV A;  2MR8 A;  2K0Y A;  1X8Y A;  2Z5H A;  2LKI A;  2KNC B;  4C7N A;  2IX7 C;  5TIS H;  1L4A C;  2L0Q A;  4PD4 E;  3AEA C;  1N7S B;  1WRG A;  3L35 A;  3CWB E;  3U1C A;  1FZG A;  1N7S D;  5CZD B;  2Z44 A;  1NVO A;  1EMV A;  1CSB A;  4UB6 H;  3CCR P;  2H88 C;  1OW8 A;  1T3U A;  1KB9 H;  5APT A;  4XFJ A;  1H0T B;  3GHG B;  3GHG A;  1EZV I;  1FBM A;  3CD6 P;  2C0X A;  2GZF A;  2Q9I A;  1IZN B;  2LOL A;  7CEI A;  3NFQ A;  3GLM A;  5F2K A;  2XZ0 D;  3H4E A;  1N2D C;  5AW2 B;  2YKO A;  1D1D A;  2BAS A;  2BQ1 E;  3L73 E;  5M1B A;  5AW0 B;  2GDX A;  2A06 D;  3JSV C;  1RY3 A;  4OVN F;  3WUU A;  1AV1 A;  1J1E C;  3L74 J;  3V4Q A;  1ZR2 A;  3AEF C;  2KSE A;  3EWK A;  1PEM A;  5KAF H;  3AED C;  2KXP B;  2PEK A;  5HGL A;  1SQB G;  5AVW B;  1VQP P;  2WIT A;  3R2P A;  3CXH D;  1BSN A;  4K35 A;  4U3F G;  1ZME C;  2VLQ A;  3TNU B;  4XRQ A;  2IBZ E;  1WMK A;  1SQX G;  1VQL P;  3HD7 C;  5CMZ A;  1S5L X;  3WBH A;  1GL2 C; 
#chains in the Genus database with same CATH homology
 3G1I A;  4U0E A;  1RO2 A;  2XT1 A;  3G21 A;  4XFZ A;  2LF4 A;  1QVG O;  2EFJ A;  1RO0 A;  4PH1 A;  3CCJ P;  2PEN A;  5HGO A;  1QRJ A;  1YIJ P;  1KD1 Q;  1ZMB A;  3G1G A;  2PEO A;  3I56 P;  2PEM A;  3CCU P;  1VQ9 P;  2JYG A;  3RG6 C;  3G71 P;  1JJ2 O;  3DPH A;  2M8N A;  4GR2 A;  4QNB A;  2Z44 A;  2M8L A;  1VQM P;  1BAJ A;  5HGM A;  1YJW P;  1A43 A;  3Q20 A;  2PY8 A;  5BS1 A;  4IPY A;  3CCR P;  1E6J P;  3G6E P;  1NJI Q;  2JO0 A;  1YJN P;  3NTE A;  1PEQ A;  3CC7 P;  2E1M A;  1KC8 Q;  3E2D A;  5F2N A;  3CXC O;  3CMA P;  1Q86 Q;  1IUQ A;  1RNI A;  3P05 A;  5I4T G;  4COP A;  3CD6 P;  2BHV A;  1K8A Q;  1VQN P;  2ONT A;  3DS1 A;  1A8O A;  4U0C A;  2CWO A;  3H47 A;  1VQ4 P;  5F2K A;  1M6E X;  3H4E A;  1K30 A;  2EG5 A;  4U0D A;  2M8P A;  3G29 A;  2BUO A;  1M1K Q;  1YIT P;  3VRL C;  3CC2 P;  3G28 A;  1VQ6 P;  2OTL P;  3DTJ A;  1D1D A;  1N8R Q;  1K9M Q;  3CCE P;  4U0B A;  2P9X A;  4U0A A;  1VQ5 P;  1VQ7 P;  1PEO A;  1EOQ A;  3CCL P;  2BQ1 E;  1YI2 P;  3CME P;  3OW2 O;  3G26 A;  1KQS O;  2QEX P;  2OTJ P;  2PEJ A;  2Z45 A;  3CCQ P;  1M74 A;  2L6E A;  1K73 Q;  4GR6 A;  4COC A;  4M0I A;  4WYM A;  3I55 P;  1VQK P;  1M90 Q;  4XRO A;  1YHQ P;  3DS2 A;  1AUM A;  5JPA A;  3G0V A;  3CC4 P;  1S72 P;  5BS2 A;  3DS4 A;  1PEM A;  2JYL A;  1Q82 Q;  3G4S P;  3HYB A;  3DS3 A;  1EIA A;  2EIA A;  1Q7Y Q;  1PEU A;  3DS5 A;  1M6N A;  3CCV P;  1YJ9 P;  2PEK A;  5HGL A;  3H0D A;  1W2B O;  2Z46 A;  1VQP P;  3DS0 A;  4U0F A;  2DGY A;  2PEQ A;  2XXM A;  5F2O A;  2OAR A;  3B5I A;  1QVF O;  4PH0 A;  1VQ8 P;  5HGN A;  3CCM P;  2PEI A;  4XFX A;  4XRQ A;  1VQO P;  2QA4 P;  2KOD A;  1VQL P;  3HZQ A;  5DCK A;  3CPW O;  3CCS P;  3M1M A;  3WBH A;  1Q81 Q;  3LRY A;  3MGE A;  4XFY A;  2XV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...