1VQKP

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqkP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqkP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqkP02
3CCLP 3CC7P 1QVFO 3G4SP 1KD1Q 1W2BO 1Q86Q 1VQ7P 3CD6P 3I56P 1Q7YQ 1VQ8P 3CCEP 3G71P 2QA4P 1VQLP 2QEXP 3G6EP 1Q81Q 1M1KQ 1YI2P 1M90Q 1QVGO 1YIJP 3CPWO 3CCQP 1YJNP 2OTLP 3CC4P 1YHQP 1YJ9P 1K73Q 3I55P 2OTJP 1VQNP 1S72P 3CMEP 1YITP 1JJ2O 3CCSP 1YJWP 1KC8Q 1VQKP 3CCMP 1NJIQ 3OW2O 3CXCO 1VQMP 1K9MQ 1KQSO 1VQ4P 1VQ9P 3CCVP 1VQ6P 3CCUP 1K8AQ 3CCJP 1N8RQ 3CC2P 1VQOP 1VQ5P 3CCRP 1Q82Q 1VQPP 3CMAP
chains in the Genus database with same CATH superfamily
4TLFA 3L73E 1DX7A 3USSA 1FS0E 2RMZA 3MUDC 3H1HE 2NPSB 1XTGB 3RG2A 3CMEP 1YJWP 2AFDA 5CBNA 3G29A 2D2CC 4KHXA 4GOFA 4YPCA 3GJNA 3MTUE 4H13D 3GKLC 3SWYA 1HTLC 2YXQB 2P1JA 5KKZB 4DOJA 1PP9J 3CD6P 5AW9B 2J5UA 2QJYB 1LT9C 1SQBE 5APXA 3D6ZA 1L0LE 2FBWC 2WPRA 2YKPA 5I4TG 2KGAA 1T8KA 2L9FA 1OFCX 3DTJA 2B88A 4D6TJ 2PNGA 5B66H 1LWUB 1S2EA 2HODA 1RO0A 1FZAA 3AEAC 3RK3B 1IUQA 2H89C 2JYGA 1YTZT 4GR2A 3H1LG 3ITKA 2KNCA 1UIXA 2Q7CA 2FYUJ 1IK9A 1JNMA 5KLVE 2FVEA 5AVUB 3P8MC 1E79H 2VLOA 1PP9G 2L0QA 1YJNP 4UB6H 1EDLA 4H0LD 1RH5B 5BS2A 3L70E 2EFJA 2FHSC 4H0LB 5AW1B 1L0NE 1KB9H 2E74D 1X79B 1PIXA 3RL0g 2AFEA 1MZ9A 2FQ1A 1LJ2A 3BRVB 2IYPA 1AA0A 3TF5A 3H1KD 3CWBE 1LT9A 2M3EA 3G71P 4HKGA 2A06D 2YO3A 3L74G 2ZAEB 3HE5A 2L4BA 1JY3N 2FAEA 4H44C 1EC5A 3WUTA 3H1IJ 1JMBA 4PWVB 2NZ2A 5BVZA 1G2CA 2FYZA 1OX3A 2JQ4A 2K3RA 4H0LC 3EWKA 1RF1A 5TJHA 1GD2E 1BGYD 2EG5A 2AEJA 2PFXA 2O01N 2N6ZA 1LTIC 5KJ7C 1OR5A 4IL6H 3OA7A 2YXRB 1S4XA 2N9YB 2Y0CA 2ZJSE 3GMAA 2KIKA 1N86A 3L72E 2JAZA 3EJBA 2QM7A 3L70G 4DZOA 1GL2D 4M3LA 3RBZA 5KP7B 3CWBJ 1LWUC 5AVXB 4BRYA 2Z44A 5AVQB 2WT7A 3G21A 3KZIH 3L75G 1CW5A 2GZJA 1YQ4C 3Q5RA 2K5XA 5HGMA 3M1MA 2GDXA 4W7ZA 3L73D 5KLVK 2D2CD 2FXPA 1G1IA 3HUSC 1GK6A 4U0DA 2O01J 1SQQK 3Q20A 1VKUA 1KV4A 2WITA 3I56P 3G0VA 1NTKE 3EFFK 1MV8A 3HD7B 2FYUK 3H0DA 1HUCA 2Z45A 1BGYE 3H32B 2KLVA 3CX5E 1RO2A 1VQ6P 1M1JC 3CWBG 4GKGA 4GR6A 4OGQB 1S9KD 3G1GA 2JP3A 1X0TA 2FVAA 3K5BA 2QJKC 5HVCA 2NPSD 1PGPA 2RN0A 3VP9A 1ZLLA 3L75D 1S5LX 1VF5C 3AE5C 1N7SC 2WVRA 3VP8A 2J58A 1KYOD 4N6JA 2FQ2A 3CMAP 3CX5H 2H8PD 1LTSC 2KW2A 2VLPA 1N7LA 2QG4A 1FZCA 1EDJA 2KK7A 3GG2A 3KYQA 2MR7A 4PD4I 4JQ0D 2QJYC 3VN0A 1LWUA 1IFIA 1EQ7A 3RL0B 1URQB 4I2LC 3LIDA 1SP4A 3HE4B 2WTYA 1NHLA 1L0NG 4XA4A 3IR9A 4H2WC 2QRXA 1ZMEC 2GZEA 2ZYDA 2K37A 4U0EA 5AW8B 2CGQA 2MJZA 4L75A 1N73C 3CX5I 1Q86Q 3PH0A 1JCDA 4XFYA 4OH8B 2FYNC 3N7NA 3II6A 1OIPA 5AW5B 1EMVA 1JCCA 1CEIA 1KYOI 1SQVD 2LOLA 2VSQA 1RHZB 2N98A 2FYUE 2EHSA 1N73B 2XZRA 2MD9A 1Q82Q 2H7HA 2R3CA 2OYOA 4PD4E 2JU2A 1BCCJ 2X2BA 2W6BA 2OYHC 3GZLA 5APUA 1RE3C 3HE5B 1H0TA 3MD0A 4IFFA 1M7LA 3A0BH 1OVUA 3RL0C 5H2FE 5B5EH 3EJDA 5KAFH 2A45I 2DGYA 1VQ8P 2BCCG 5AW6B 3L72J 2K9YA 2YMYA 3CPWO 1M6EX 2LIUA 3CXHE 1ZNVA 1SQXE 2JJLA 1LTGC 1T2KC 1VDFA 2JU1A 3VMYA 2N6YA 1SLQA 1ZRTE 1KB9D 1KB9E 1KFNA 3JCUH 4A7PA 2O1JA 1R5SA 1W5CE 3RG6C 5KTBA 4NPFX 3CXHI 1F80D 1VF5B 1ZN5A 1YHQP 1KILB 1T8ZA 5TISH 5F2KA 1JJ2O 2LPKA 4BRYB 1ZXGA 2E74B 2K9JA 1SQVJ 1H89A 4B86A 2KNCB 2GA1A 5GTHE 1QLED 4MN4C 2E76C 2KG6A 4GODA 1AUMA 1GTWA 1L0LG 2HLOA 3CCSP 2ONTA 2W6AA 2J59M 1K9MQ 2JGPA 4LGDE 4U0FA 3TGUJ 2YKOA 1JTHA 2BHVA 4GOEA 1W2BO 1QGKB 3HD7D 3G3ZA 5GTIH 1BGYG 3L72D 1EDIA 5AVSB 1LT9B 5APTA 3CXCO 1S5LH 1NTZE 1RE3A 1E0HA 2E76B 3JSVC 5APSA 3L37A 4EOTA 1MZ8A 3L74J 3A0BE 2AXCA 1J2JB 1QVGO 1YIJP 3GZMA 1CI6B 3WUVA 2HPCB 2O3JA 1L0IA 2FYNB 4Y99B 2PEMA 4CA3A 5DJTB 2WPQA 3AEFC 5E79E 3AE1C 1L0NK 1OMIA 1M1KQ 1Q81Q 1OW6A 3H1JD 2Z5HA 4N78E 2N5HA 1SQPG 2KP8A 3P8CD 1RQUA 3H1KE 4NPEA 2EIAA 1NO4A 3A0HE 4LLHA 2QE7H 3O8ZA 4QMAA 2AXTE 1SQPK 3CCLP 4ZNCA 3D6YA 3G26A 3AE2C 4C7RA 3BCCD 2KG8A 2XU6A 3WU2H 1N2DC 3QWOC 2KYVA 3DS3A 3O6QB 2RH0A 1JTHB 1AV1A 2OYIB 1GU4A 4EYYQ 2GUVA 1LTBC 1N7SD 1KQGB 1YTZI 2M8LA 1SQPE 3HYBA 3CX5D 4PV1C 4H44D 4PD4H 3Q3DA 4HKZH 2P10A 1KC8Q 1NTKD 4AYCA 1OVVA 1NTKK 1VHNA 3RK2D 2HFED 4BWNA 3U43A 1J1DC 1BAJA 2KZJA 2VLNA 4ASWA 3FXDA 1KLPA 1QEXA 2IZ1A 2LKMA 1JY3P 4COPA 2KLUA 3DS5A 1ZOYC 2K0XA 2PY8A 3EFGA 3QH9A 1PFIA 1EIAA 3P05A 1GW4A 3D71A 5AW3B 2JWDA 1ZR2A 3FWLA 3BVHA 2M8PA 2BQ1E 2I8DA 4JPZB 3H1HD 1SFCC 2KS1B 1FBMA 2VLQA 5HV8A 4JF7A 2FFDB 1NTME 1Z56A 2HYNA 2ROQA 2WZ7A 5AVYB 3CCJP 1FZBA 1KILC 2KSEA 3H1KG 1HWTC 1ZV8A 1RE4C 5CJ0A 3CL3D 1AJYA 3PHLA 3FX0A 2K0YA 1UNKA 4NEOA 3AEEC 1NU1G 3CI9A 1IJDB 2Y9YA 1RE4A 3AE8C 5GTHH 3N4XA 2PEQA 2P67A 2M5AB 1WMKA 1VQMP 2W83C 3CCVP 3B5NA 4DG9A 3V6IA 1RNIA 5CJ4A 1HBWA 4YTPC 1Y47A 3L73J 5KLVJ 4MRTC 3IFMA 1LTTC 4RJTA 5CMZA 1A43A 4BPHA 3HUSB 3HZQA 1PEOA 2XXMA 1IMQA 1GL2A 2KOQA 5AVWB 5AW0B 3CWBD 3W67A 1IFPA 4RESB 3CCRP 2AXTH 5AVZB 5CCGC 5BS1A 1L4AB 1MFZA 1GK4A 1BE3E 2AVAA 2JB0A 2BCCD 1FDIA 2HG5D 4JYBA 3L70D 4WY4A 1CZQA 1SQQE 2LMLA 3LIEA 1L0HA 3MGEA 1NU1D 2POHA 2KSJA 4R4LA 5AW2B 2ERHA 3TDKA 4PV1B 3SFDC 4HJGH 2E75C 2E43A 1HJBA 2OTJP 2A45G 2ZVNB 3H4EA 2FXOA 1W2EA 1ZW0A 3TNUB 2YIUC 2JYLA 3H47A 1VQOP 4UHPB 3L71E 4HH2A 3OAKA 4ZKUA 1NTZD 3L71G 1U7JA 2ZXXA 1NTZK 2P58A 1SQQG 1P84E 1L0LD 2NPSA 4XFXA 3VRLC 2LF4A 2R44A 2WPTA 2KWLA 1SQBD 1K04A 3L75J 3C1LA 1NU1E 3H1LJ 2Y9ZA 3HRNA 4YXDC 2KR5A 2ZFCA 2K88A 1H88A 2DW3A 3CC7P 3CLQA 2V7QH 3FGAD 2LTEA 1JEKA 2GUSA 2CPBA 3HTKA 2KI7B 3IF4A 2KOSA 1BE3D 4IL6X 3SWFA 1NTMG 1VQNP 3BATA 2G3AA 1M8OB 1NTMK 1Q2NA 1BCCE 2XZ0D 4Z1MH 2AEMA 1X22A 3MIWA 3H6PA 4RO0A 3BASA 4IZ6A 3L35A 1FDMA 1EXJA 1NVOA 2JO1A 2PEIA 2M8RA 2QNWA 1M1JB 1RQVA 1Y8AA 1D1DA 1WT6A 2E5YA 2GDWA 2C9LY 5KLIB 3H1IG 1ZRTD 4PH1A 1GL2C 3EQ2A 2MY5A 1PEUA 4COCA 1SFCA 1KFMA 4TT3H 1M74A 1KTMA 1LTJB 4O9BA 4W7YA 4R0MA 2N50A 3SFEC 2AEFA 1YITP 2PGDA 4WBAA 4ZKPA 2KUBA 4XRQA 4LC1A 4PJ0H 1GMJA 1KILA 1NTMD 1JB0J 2B89A 4U3FJ 3DS0A 3V4WA 2IFMA 1LTAC 3RK3E 2R3SA 1YBKA 5EJDA 1L4AC 1E6JP 4PD4D 1R8EA 1XTCC 2FYUD 3FXEA 4H13B 2P2UA 1GXHA 3NTNA 1QX8A 4XFZA 2W8ZA 1IC2A 1P84D 2B87A 1FJKA 2CPSA 1RY3A 5DCKA 2BUOA 1KQFB 1HQBA 1ZR4A 3SSUA 2PEJA 3Q5SA 1PPJD 2R5BA 1Z6MA 4U3FG 2E1MA 4C46A 2ZXEB 3HUSA 5JPAA 1A8OA 2XNDH 1P84I 1URQA 3OW2O 1AF8A 3HE4A 1SFCD 2KB7P 1VQ5P 2IBZE 3L4FA 1QRJA 1SQQD 2N1TC 4PXHB 3FWNA 2A06E 1KYOH 2BCCE 4D6TD 3KHUA 1NTZG 3R2PA 5CZDB 5APWA 1S5LE 2VRSA 3TGUD 4D6TG 5AW7B 4D6TE 2IFNA 1PGQA 3P8CE 3HD7A 1YI2P 3GF7A 1NKZB 3GHGB 3TSIA 2O01H 3LMOA 2ZVOB 2OGUA 3MGNA 2E75D 2SPZA 4IL6E 4GT1A 2KS1A 1NKNA 3DS2A 4U7JA 4XROA 1ZMBA 2RKLA 2QJPC 1H0TB 1VQ7P 1HVVA 1EZVD 3B5NC 3M0AA 3CCEP 2L22A 2K1AA 5KP6B 2ZT9D 1RF1C 2M5RA 2ZT9B 2C0XA 4L73A 1SQVK 1K30A 1X3OA 2LIWA 2B9BA 2KGEA 2OARA 3H1KJ 1HGVA 1G2CB 3WMM0 3AE6C 2N1TB 4F37A 3U59A 1VQLP 2Q6QA 1U57A 4WVZA 3T97B 1SQQJ 1AQTA 2IZ0A 1SQXK 4IFDK 4L76A 2K94A 1KMIZ 3GLMA 1BDCA 2NO8A 2LXCB 2GZGA 1TU3F 1FE6A 1EXIA 3MP7B 5KLVG 2QA4P 3L74E 2V4HA 2EHTA 1KORA 1NTKJ 4WY4D 3DS1A 4ASVA 1FZCC 1IFJA 4H13C 1PPJG 3BCCJ 1M1JA 2YO2A 1USEA 4K3AA 2KODA 4NPDA 1EDKA 2M0BA 3LW5H 4PJ0E 1M90Q 4PH0A 3I5CA 2JO0A 1DV5A 5BU8B 2GZIA 4EIJA 1SQBG 3RK2C 1EZVE 1UIIA 2FVFA 1U7MA 4EDFA 1L0LK 3CE7A 2WSSH 4I7ZC 1N7SA 4Y28J 1SQBK 2ZT9C 1JOCA 2OTLP 1NYHA 1NTKG 2QJPB 5KLIC 1CI6A 3L71J 1IFMA 1JY2O 1HJ0A 1JY2P 5KAFE 2Z46A 3B71A 2XV6A 2I1KA 3AE7C 4QNBA 2JKVA 4AQRD 4DJGA 3GHGC 3M9BA 3T97A 2WSFH 5HGLA 5KAIH 2W27A 3VTPC 2H88C 1FAVA 2W90A 3AE9C 1X9VA 3H1IE 1PL5A 5F2NA 1CSBA 1URQD 2L91A 2WPVB 1Q7YQ 2A45H 2FACA 5EW5E 3G6EP 4H2XC 1GXGA 1FZCB 2IDBA 1YJ9P 2Q1KA 1OW7A 3LW5J 3M9HA 3PTZA 2MVUA 3HD7C 1N73A 2BCCJ 1JMMA 3WU2E 3L72G 3V2QA 3L70J 1J1EC 3S1KA 2QEXP 2XV5A 3AEBC 2ZYAA 1EOQA 1G1JA 2QIWA 3NMDA 1JY3O 1NJIQ 2D2CB 3ABVC 2YIUB 2KXPB 2IPPA 1DEEG 2FYUG 3BRTB 1N7SB 4OWFA 4DT0A 2O1KA 1AVYA 2KZIA 1NQ4A 2KOOA 3C9IA 4GIFA 3IN6A 1QL2A 5CBOA 2L6EA 1RF1B 2NPSC 3HTKB 3M06A 2BASA 1EZVI 5EFWB 1SS1A 3DPHA 3U1CA 1L2PA 2Y0EA 3KPEA 2PAJA 1QVFO 1BSHA 1FU1A 2N5IA 4IOIH 5L8RJ 1NU1J 1IFDA 3L75E 1SQXG 3B4SA 1BE3G 2QM8A 3ZDMA 1K73Q 4DCKA 2NRGA 2R32A 4H2YC 2KOGA 2K93A 2V7QJ 3CC4P 1URQC 1VL2A 4KT0J 5H2FH 2KORA 2FXMA 5HGNA 2FKWB 3CXHD 2OYHB 1PP9D 4R4MA 1USDA 5KKZC 4WY4C 1IFNA 1SFCB 1JUNA 2PENA 3V2NA 3CCUP 1K8AQ 1N8RQ 3B8EB 3S4RA 1LTJA 1T2KD 3Q2YA 4Y99C 1VQPP 1PZQA 2MVVA 2Z5IA 2AF8A 3NY7B 1ZP0C 2KOPA 3VOPA 2LKIA 2GDYA 2XT1A 3L74D 4CPGA 1DIPA 3O6QA 1BE3J 2OYIA 1P84H 4C7NB 1IMPA 2K9JB 2M8NA 3W68A 4XFJA 2WSCJ 3H32A 3PP5A 2XNXA 1QL1A 2PRRA 2YKQA 1BDDA 1PGOA 1DNYA 1LP1B 1K05A 1YYCA 3E2DA 3VMAA 2QJKB 2H43A 4OGQD 1VQ9P 3KZIE 3BCCG 1AFOA 3AECC 2QVAA 5B5EE 3CXHH 1SQVG 2B87B 3WUUA 2N1TD 2DNWA 3RL0D 3E1RA 3MUDA 3AE4C 1FDOA 4K35A 1YQ3C 2G8YA 1OW8A 1Y9BA 2KG9A 5HGOA 2UWJE 3CC2P 5CCHC 3M0DC 2LR2A 2WSEH 3H1ID 2WSCH 4PV1D 2Y0DA 1NTMJ 5APQA 4U3FD 2FFDA 3U1AA 3B5IA 2N1TA 1JM0A 2R5DA 1S72P 4HB1A 1BGYJ 1KILD 3A2AA 2YNYA 3V2PA 1KYOE 3PJSK 2IBZG 4AUWA 4U0AA 3UIAA 4U3FE 3NXSA 5APYA 4N78D 1PV3A 4L74A 1MKMA 2K2QA 3RK3C 2K0DX 2IBZD 2Q5UA 2C0WA 2IYOA 2WPSA 3GHGA 3B5ND 2OTKE 3H1JJ 4EI2A 1M57D 4RKUJ 4UB6E 1LTJC 5K5GB 2FFDC 1NWQA 4U0CA 2JWAA 4H44B 2ZYGA 1GL2B 1SQPJ 5CCHD 4M0IA 1GPJA 3P32A 5AVVB 5F2OA 5TISE 3NTEA 1L4AA 2W6JH 1Q90D 2WT7B 3VMXA 2E74C 3MZWB 1UJZA 1E5WA 1VF5D 1FZEA 2E76D 2E42A 2Q3IA 1S3JA 2N9BA 4JYCA 3M9QA 1HH0A 2KGDA 2XDJA 1J1DB 4BPGA 7CEIA 2MF4A 1JY2N 2PEOA 3RK3D 1T6AA 5KP8B 4W80A 2WMMA 2L5GB 1FC2C 5KJ7D 2M3BA 2K92A 2HODB 1ACPA 3A5TA 3V5BA 1X8YA 3NFQA 2JEEA 3A0HH 2IBZI 3IAOA 2CG5B 2CK3H 1BSNA 2OYIC 5M1BA 2OQQA 1BXIA 1PP9E 4I7ZB 5C39A 3SWKA 3B4QA 2JR8A 2IX7C 2A06G 1RF0A 3RGUA 4OVNF 3P7KA 4ZMDA 2KGCA 3EJEA 2Q9IA 2WWWA 5BU5A 5E79H 1KQSO 1FJPA 3MHVA 1SQPD 3TYYA 3G9RA 2PEKA 3S9OA 1KB9I 3H1HJ 2GM4A 4I6MC 3E1IA 2ITAA 1MUUA 3AE3C 2BEQD 3JC22 5DJUB 2XZ1C 1L4AD 3VMZA 2YMKA 1DH3A 3BCCE 1PEMA 1RF0C 2WSEJ 5B66E 1NH4A 5GTIE 3B5NB 4OGQC 5CCHA 1DD3A 1FOSF 1NAFA 2I1JA 3TGUE 2Q3EA 4I1LA 1BCCD 2GYKA 1AQ5A 5AVRB 1KD1Q 1DD4A 1FR2A 1KQLA 1PGJA 1KILE 3KXDA 1L0ND 5CHXA 1NAYA 1NOHA 3I55P 4QKOA 4WWIA 1LNQA 3H1JE 1HF9A 1L0LJ 1D7MA 3AEGC 1FOSE 1GDTA 1OXZA 4N3YB 1SQBJ 1SQVE 1GU5A 3H1LD 3L36A 2HPCA 5KLVD 1JO5A 4YXWH 1AYIA 3G4SP 1KN7A 3TK1A 4C7NA 5CCGD 1MFTA 4WYMA 3L73G 1GZLA 3E7KA 2E5TA 2FADA 3C8VA 1IK7A 1VQKP 3L71D 1PPJE 4UB8E 1M6NA 3OJAB 4U0BA 1DEBA 2P9XA 1J1EB 1IO4A 3D70A 1FZFA 1WRGA 3DS4A 3JCUE 4GDOA 1LP1A 4HYTB 4JBZA 3WBHA 1GW3A 1SQXJ 3Q5PA 2PP6A 2LL8A 1SVFA 3CCQP 2CNRA 1HY8A 3V2RA 3LRYA 1OVRA 3H1LE 3CCMP 2M5AA 5CCGA 1R5LA 2JBGA 1VPCA 2OYHA 2FY8A 3KQGA 1NGMB 1LGHB 1LT1A 1H8AA 1A02F 2XKMA 1A02J 1PEQA 1T3UA 3R4YA 5AW4B 1T3JA 2CWOA 3M91A 4IPYA 2FQ0A 1L0NJ 2MKVA 1OWAA 4KJMA 3M0DA 2E75B 5APVA 4BXLA 1KZUB 1FZGA 4WB4A 3V4QA 1NTZJ 2HR3A 3F89A 3VYIA 2JDIH 1IZNB 1EZVG 2LXBA 1OZHA 5KJ7A 2Z4EA 3PLNA 3GF3A 3RBXA 4XE5B 1HGZA 3A7OA 2GZFA 3TGUG 4WY4B 2BEZF 3RK2B 1S9KE 2C9NY 3H25A 3H1HG 3AEDC 3A3YB 2MR8A 1M56D 2P7JA 3G28A 4IFMA 3H1JG 3GW6A 4UB8H 1BCCG 1SQXD 2WSFJ 1AVOA 5KAIE 3G1IA 3Q1MA 3F5HA 2QSIA 1VQ4P 4BPFA 3PRJA 3KDPB 1NU1K 2CQ8A 2WQYC 1S1CX 3TNUA 5AVTB
chains in the Genus database with same CATH topology
3CCLP 3DS4A 3Q20A 3WBHA 1Q86Q 3G26A 3I56P 4XFYA 3G0VA 3G71P 4U0AA 2QEXP 1M90Q 1YI2P 3DS0A 2XT1A 4PH0A 4XFXA 1AUMA 2JO0A 3CCQP 3VRLC 3H0DA 2LF4A 2Z45A 3LRYA 1EOQA 2PEQA 3DS3A 3CMEP 1RO2A 3CCSP 1YJWP 2ONTA 3CCMP 1NJIQ 1VQMP 1E6JP 3G29A 1K9MQ 1KQSO 1VQ6P 4U0FA 3CCVP 4GR6A 2PEKA 3DS2A 2M8NA 4XROA 1ZMBA 1Q82Q 1RNIA 2BHVA 3G1GA 1VQ7P 2M8LA 3CC7P 1PEQA 1W2BO 3CD6P 3CCEP 3HYBA 2CWOA 2EG5A 4XFZA 2OTLP 4IPYA 1A43A 4U0CA 1PEMA 1VQNP 3E2DA 1K30A 3HZQA 1PEOA 2XXMA 2L6EA 1KC8Q 5I4TG 4M0IA 3CXCO 1VQ9P 2OARA 3DTJA 5DCKA 2BUOA 3DPHA 1BAJA 5F2OA 3CCRP 2Z46A 3CMAP 3NTEA 2XV6A 2DGYA 1QVFO 1KD1Q 1RO0A 4QNBA 5BS1A 2PEJA 1VQ8P 1VQLP 1IUQA 1QVGO 1YIJP 3CPWO 5HGLA 1M6EX 2E1MA 2PEIA 2JYGA 4COPA 3DS5A 1K73Q 3I55P 5JPAA 4GR2A 2PY8A 1A8OA 3OW2O 2Z44A 2PEMA 1D1DA 1EIAA 3P05A 5HGOA 3G21A 3MGEA 3CC2P 5F2NA 1VQ5P 4PH1A 3CC4P 2M8PA 3G4SP 2BQ1E 2PEOA 3G28A 3RG6C 5HGNA 1PEUA 4COCA 1Q7YQ 2QA4P 1M74A 1QRJA 3G6EP 1Q81Q 1M1KQ 5HGMA 3M1MA 1YJNP 5BS2A 3B5IA 4WYMA 1YHQP 1YJ9P 3DS1A 2OTJP 2EFJA 3G1IA 1S72P 3H4EA 5F2KA 1YITP 1JJ2O 1VQKP 2PENA 2EIAA 1VQ4P 1M6NA 4U0EA 4U0BA 3CCUP 1K8AQ 3CCJP 1N8RQ 4XRQA 2P9XA 2JYLA 3H47A 1VQOP 4U0DA 2KODA 1VQPP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL P;  3CC7 P;  1QVF O;  3G4S P;  1KD1 Q;  1W2B O;  1Q86 Q;  1VQ7 P;  3CD6 P;  3I56 P;  1Q7Y Q;  1VQ8 P;  3CCE P;  3G71 P;  2QA4 P;  1VQL P;  2QEX P;  3G6E P;  1Q81 Q;  1M1K Q;  1YI2 P;  1M90 Q;  1QVG O;  1YIJ P;  3CPW O;  3CCQ P;  1YJN P;  2OTL P;  3CC4 P;  1YHQ P;  1YJ9 P;  1K73 Q;  3I55 P;  2OTJ P;  1VQN P;  1S72 P;  3CME P;  1YIT P;  1JJ2 O;  3CCS P;  1YJW P;  1KC8 Q;  1VQK P;  3CCM P;  1NJI Q;  3OW2 O;  3CXC O;  1VQM P;  1K9M Q;  1KQS O;  1VQ4 P;  1VQ9 P;  3CCV P;  1VQ6 P;  3CCU P;  1K8A Q;  3CCJ P;  1N8R Q;  3CC2 P;  1VQO P;  1VQ5 P;  3CCR P;  1Q82 Q;  1VQP P;  3CMA P; 
#chains in the Genus database with same CATH topology
 4TLF A;  3L73 E;  1DX7 A;  3USS A;  1FS0 E;  2RMZ A;  3MUD C;  3H1H E;  2NPS B;  1XTG B;  3RG2 A;  3CME P;  1YJW P;  2AFD A;  5CBN A;  3G29 A;  2D2C C;  4KHX A;  4GOF A;  4YPC A;  3GJN A;  3MTU E;  4H13 D;  3GKL C;  3SWY A;  1HTL C;  2YXQ B;  2P1J A;  5KKZ B;  4DOJ A;  1PP9 J;  3CD6 P;  5AW9 B;  2J5U A;  2QJY B;  1LT9 C;  1SQB E;  5APX A;  3D6Z A;  1L0L E;  2FBW C;  2WPR A;  2YKP A;  5I4T G;  2KGA A;  1T8K A;  2L9F A;  1OFC X;  3DTJ A;  2B88 A;  4D6T J;  2PNG A;  5B66 H;  1LWU B;  1S2E A;  2HOD A;  1RO0 A;  1FZA A;  3AEA C;  3RK3 B;  1IUQ A;  2H89 C;  2JYG A;  1YTZ T;  4GR2 A;  3H1L G;  3ITK A;  2KNC A;  1UIX A;  2Q7C A;  2FYU J;  1IK9 A;  1JNM A;  5KLV E;  2FVE A;  5AVU B;  3P8M C;  1E79 H;  2VLO A;  1PP9 G;  2L0Q A;  1YJN P;  4UB6 H;  1EDL A;  4H0L D;  1RH5 B;  5BS2 A;  3L70 E;  2EFJ A;  2FHS C;  4H0L B;  5AW1 B;  1L0N E;  1KB9 H;  2E74 D;  1X79 B;  1PIX A;  3RL0 g;  2AFE A;  1MZ9 A;  2FQ1 A;  1LJ2 A;  3BRV B;  2IYP A;  1AA0 A;  3TF5 A;  3H1K D;  3CWB E;  1LT9 A;  2M3E A;  3G71 P;  4HKG A;  2A06 D;  2YO3 A;  3L74 G;  2ZAE B;  3HE5 A;  2L4B A;  1JY3 N;  2FAE A;  4H44 C;  1EC5 A;  3WUT A;  3H1I J;  1JMB A;  4PWV B;  2NZ2 A;  5BVZ A;  1G2C A;  2FYZ A;  1OX3 A;  2JQ4 A;  2K3R A;  4H0L C;  3EWK A;  1RF1 A;  5TJH A;  1GD2 E;  1BGY D;  2EG5 A;  2AEJ A;  2PFX A;  2O01 N;  2N6Z A;  1LTI C;  5KJ7 C;  1OR5 A;  4IL6 H;  3OA7 A;  2YXR B;  1S4X A;  2N9Y B;  2Y0C A;  2ZJS E;  3GMA A;  2KIK A;  1N86 A;  3L72 E;  2JAZ A;  3EJB A;  2QM7 A;  3L70 G;  4DZO A;  1GL2 D;  4M3L A;  3RBZ A;  5KP7 B;  3CWB J;  1LWU C;  5AVX B;  4BRY A;  2Z44 A;  5AVQ B;  2WT7 A;  3G21 A;  3KZI H;  3L75 G;  1CW5 A;  2GZJ A;  1YQ4 C;  3Q5R A;  2K5X A;  5HGM A;  3M1M A;  2GDX A;  4W7Z A;  3L73 D;  5KLV K;  2D2C D;  2FXP A;  1G1I A;  3HUS C;  1GK6 A;  4U0D A;  2O01 J;  1SQQ K;  3Q20 A;  1VKU A;  1KV4 A;  2WIT A;  3I56 P;  3G0V A;  1NTK E;  3EFF K;  1MV8 A;  3HD7 B;  2FYU K;  3H0D A;  1HUC A;  2Z45 A;  1BGY E;  3H32 B;  2KLV A;  3CX5 E;  1RO2 A;  1VQ6 P;  1M1J C;  3CWB G;  4GKG A;  4GR6 A;  4OGQ B;  1S9K D;  3G1G A;  2JP3 A;  1X0T A;  2FVA A;  3K5B A;  2QJK C;  5HVC A;  2NPS D;  1PGP A;  2RN0 A;  3VP9 A;  1ZLL A;  3L75 D;  1S5L X;  1VF5 C;  3AE5 C;  1N7S C;  2WVR A;  3VP8 A;  2J58 A;  1KYO D;  4N6J A;  2FQ2 A;  3CMA P;  3CX5 H;  2H8P D;  1LTS C;  2KW2 A;  2VLP A;  1N7L A;  2QG4 A;  1FZC A;  1EDJ A;  2KK7 A;  3GG2 A;  3KYQ A;  2MR7 A;  4PD4 I;  4JQ0 D;  2QJY C;  3VN0 A;  1LWU A;  1IFI A;  1EQ7 A;  3RL0 B;  1URQ B;  4I2L C;  3LID A;  1SP4 A;  3HE4 B;  2WTY A;  1NHL A;  1L0N G;  4XA4 A;  3IR9 A;  4H2W C;  2QRX A;  1ZME C;  2GZE A;  2ZYD A;  2K37 A;  4U0E A;  5AW8 B;  2CGQ A;  2MJZ A;  4L75 A;  1N73 C;  3CX5 I;  1Q86 Q;  3PH0 A;  1JCD A;  4XFY A;  4OH8 B;  2FYN C;  3N7N A;  3II6 A;  1OIP A;  5AW5 B;  1EMV A;  1JCC A;  1CEI A;  1KYO I;  1SQV D;  2LOL A;  2VSQ A;  1RHZ B;  2N98 A;  2FYU E;  2EHS A;  1N73 B;  2XZR A;  2MD9 A;  1Q82 Q;  2H7H A;  2R3C A;  2OYO A;  4PD4 E;  2JU2 A;  1BCC J;  2X2B A;  2W6B A;  2OYH C;  3GZL A;  5APU A;  1RE3 C;  3HE5 B;  1H0T A;  3MD0 A;  4IFF A;  1M7L A;  3A0B H;  1OVU A;  3RL0 C;  5H2F E;  5B5E H;  3EJD A;  5KAF H;  2A45 I;  2DGY A;  1VQ8 P;  2BCC G;  5AW6 B;  3L72 J;  2K9Y A;  2YMY A;  3CPW O;  1M6E X;  2LIU A;  3CXH E;  1ZNV A;  1SQX E;  2JJL A;  1LTG C;  1T2K C;  1VDF A;  2JU1 A;  3VMY A;  2N6Y A;  1SLQ A;  1ZRT E;  1KB9 D;  1KB9 E;  1KFN A;  3JCU H;  4A7P A;  2O1J A;  1R5S A;  1W5C E;  3RG6 C;  5KTB A;  4NPF X;  3CXH I;  1F80 D;  1VF5 B;  1ZN5 A;  1YHQ P;  1KIL B;  1T8Z A;  5TIS H;  5F2K A;  1JJ2 O;  2LPK A;  4BRY B;  1ZXG A;  2E74 B;  2K9J A;  1SQV J;  1H89 A;  4B86 A;  2KNC B;  2GA1 A;  5GTH E;  1QLE D;  4MN4 C;  2E76 C;  2KG6 A;  4GOD A;  1AUM A;  1GTW A;  1L0L G;  2HLO A;  3CCS P;  2ONT A;  2W6A A;  2J59 M;  1K9M Q;  2JGP A;  4LGD E;  4U0F A;  3TGU J;  2YKO A;  1JTH A;  2BHV A;  4GOE A;  1W2B O;  1QGK B;  3HD7 D;  3G3Z A;  5GTI H;  1BGY G;  3L72 D;  1EDI A;  5AVS B;  1LT9 B;  5APT A;  3CXC O;  1S5L H;  1NTZ E;  1RE3 A;  1E0H A;  2E76 B;  3JSV C;  5APS A;  3L37 A;  4EOT A;  1MZ8 A;  3L74 J;  3A0B E;  2AXC A;  1J2J B;  1QVG O;  1YIJ P;  3GZM A;  1CI6 B;  3WUV A;  2HPC B;  2O3J A;  1L0I A;  2FYN B;  4Y99 B;  2PEM A;  4CA3 A;  5DJT B;  2WPQ A;  3AEF C;  5E79 E;  3AE1 C;  1L0N K;  1OMI A;  1M1K Q;  1Q81 Q;  1OW6 A;  3H1J D;  2Z5H A;  4N78 E;  2N5H A;  1SQP G;  2KP8 A;  3P8C D;  1RQU A;  3H1K E;  4NPE A;  2EIA A;  1NO4 A;  3A0H E;  4LLH A;  2QE7 H;  3O8Z A;  4QMA A;  2AXT E;  1SQP K;  3CCL P;  4ZNC A;  3D6Y A;  3G26 A;  3AE2 C;  4C7R A;  3BCC D;  2KG8 A;  2XU6 A;  3WU2 H;  1N2D C;  3QWO C;  2KYV A;  3DS3 A;  3O6Q B;  2RH0 A;  1JTH B;  1AV1 A;  2OYI B;  1GU4 A;  4EYY Q;  2GUV A;  1LTB C;  1N7S D;  1KQG B;  1YTZ I;  2M8L A;  1SQP E;  3HYB A;  3CX5 D;  4PV1 C;  4H44 D;  4PD4 H;  3Q3D A;  4HKZ H;  2P10 A;  1KC8 Q;  1NTK D;  4AYC A;  1OVV A;  1NTK K;  1VHN A;  3RK2 D;  2HFE D;  4BWN A;  3U43 A;  1J1D C;  1BAJ A;  2KZJ A;  2VLN A;  4ASW A;  3FXD A;  1KLP A;  1QEX A;  2IZ1 A;  2LKM A;  1JY3 P;  4COP A;  2KLU A;  3DS5 A;  1ZOY C;  2K0X A;  2PY8 A;  3EFG A;  3QH9 A;  1PFI A;  1EIA A;  3P05 A;  1GW4 A;  3D71 A;  5AW3 B;  2JWD A;  1ZR2 A;  3FWL A;  3BVH A;  2M8P A;  2BQ1 E;  2I8D A;  4JPZ B;  3H1H D;  1SFC C;  2KS1 B;  1FBM A;  2VLQ A;  5HV8 A;  4JF7 A;  2FFD B;  1NTM E;  1Z56 A;  2HYN A;  2ROQ A;  2WZ7 A;  5AVY B;  3CCJ P;  1FZB A;  1KIL C;  2KSE A;  3H1K G;  1HWT C;  1ZV8 A;  1RE4 C;  5CJ0 A;  3CL3 D;  1AJY A;  3PHL A;  3FX0 A;  2K0Y A;  1UNK A;  4NEO A;  3AEE C;  1NU1 G;  3CI9 A;  1IJD B;  2Y9Y A;  1RE4 A;  3AE8 C;  5GTH H;  3N4X A;  2PEQ A;  2P67 A;  2M5A B;  1WMK A;  1VQM P;  2W83 C;  3CCV P;  3B5N A;  4DG9 A;  3V6I A;  1RNI A;  5CJ4 A;  1HBW A;  4YTP C;  1Y47 A;  3L73 J;  5KLV J;  4MRT C;  3IFM A;  1LTT C;  4RJT A;  5CMZ A;  1A43 A;  4BPH A;  3HUS B;  3HZQ A;  1PEO A;  2XXM A;  1IMQ A;  1GL2 A;  2KOQ A;  5AVW B;  5AW0 B;  3CWB D;  3W67 A;  1IFP A;  4RES B;  3CCR P;  2AXT H;  5AVZ B;  5CCG C;  5BS1 A;  1L4A B;  1MFZ A;  1GK4 A;  1BE3 E;  2AVA A;  2JB0 A;  2BCC D;  1FDI A;  2HG5 D;  4JYB A;  3L70 D;  4WY4 A;  1CZQ A;  1SQQ E;  2LML A;  3LIE A;  1L0H A;  3MGE A;  1NU1 D;  2POH A;  2KSJ A;  4R4L A;  5AW2 B;  2ERH A;  3TDK A;  4PV1 B;  3SFD C;  4HJG H;  2E75 C;  2E43 A;  1HJB A;  2OTJ P;  2A45 G;  2ZVN B;  3H4E A;  2FXO A;  1W2E A;  1ZW0 A;  3TNU B;  2YIU C;  2JYL A;  3H47 A;  1VQO P;  4UHP B;  3L71 E;  4HH2 A;  3OAK A;  4ZKU A;  1NTZ D;  3L71 G;  1U7J A;  2ZXX A;  1NTZ K;  2P58 A;  1SQQ G;  1P84 E;  1L0L D;  2NPS A;  4XFX A;  3VRL C;  2LF4 A;  2R44 A;  2WPT A;  2KWL A;  1SQB D;  1K04 A;  3L75 J;  3C1L A;  1NU1 E;  3H1L J;  2Y9Z A;  3HRN A;  4YXD C;  2KR5 A;  2ZFC A;  2K88 A;  1H88 A;  2DW3 A;  3CC7 P;  3CLQ A;  2V7Q H;  3FGA D;  2LTE A;  1JEK A;  2GUS A;  2CPB A;  3HTK A;  2KI7 B;  3IF4 A;  2KOS A;  1BE3 D;  4IL6 X;  3SWF A;  1NTM G;  1VQN P;  3BAT A;  2G3A A;  1M8O B;  1NTM K;  1Q2N A;  1BCC E;  2XZ0 D;  4Z1M H;  2AEM A;  1X22 A;  3MIW A;  3H6P A;  4RO0 A;  3BAS A;  4IZ6 A;  3L35 A;  1FDM A;  1EXJ A;  1NVO A;  2JO1 A;  2PEI A;  2M8R A;  2QNW A;  1M1J B;  1RQV A;  1Y8A A;  1D1D A;  1WT6 A;  2E5Y A;  2GDW A;  2C9L Y;  5KLI B;  3H1I G;  1ZRT D;  4PH1 A;  1GL2 C;  3EQ2 A;  2MY5 A;  1PEU A;  4COC A;  1SFC A;  1KFM A;  4TT3 H;  1M74 A;  1KTM A;  1LTJ B;  4O9B A;  4W7Y A;  4R0M A;  2N50 A;  3SFE C;  2AEF A;  1YIT P;  2PGD A;  4WBA A;  4ZKP A;  2KUB A;  4XRQ A;  4LC1 A;  4PJ0 H;  1GMJ A;  1KIL A;  1NTM D;  1JB0 J;  2B89 A;  4U3F J;  3DS0 A;  3V4W A;  2IFM A;  1LTA C;  3RK3 E;  2R3S A;  1YBK A;  5EJD A;  1L4A C;  1E6J P;  4PD4 D;  1R8E A;  1XTC C;  2FYU D;  3FXE A;  4H13 B;  2P2U A;  1GXH A;  3NTN A;  1QX8 A;  4XFZ A;  2W8Z A;  1IC2 A;  1P84 D;  2B87 A;  1FJK A;  2CPS A;  1RY3 A;  5DCK A;  2BUO A;  1KQF B;  1HQB A;  1ZR4 A;  3SSU A;  2PEJ A;  3Q5S A;  1PPJ D;  2R5B A;  1Z6M A;  4U3F G;  2E1M A;  4C46 A;  2ZXE B;  3HUS A;  5JPA A;  1A8O A;  2XND H;  1P84 I;  1URQ A;  3OW2 O;  1AF8 A;  3HE4 A;  1SFC D;  2KB7 P;  1VQ5 P;  2IBZ E;  3L4F A;  1QRJ A;  1SQQ D;  2N1T C;  4PXH B;  3FWN A;  2A06 E;  1KYO H;  2BCC E;  4D6T D;  3KHU A;  1NTZ G;  3R2P A;  5CZD B;  5APW A;  1S5L E;  2VRS A;  3TGU D;  4D6T G;  5AW7 B;  4D6T E;  2IFN A;  1PGQ A;  3P8C E;  3HD7 A;  1YI2 P;  3GF7 A;  1NKZ B;  3GHG B;  3TSI A;  2O01 H;  3LMO A;  2ZVO B;  2OGU A;  3MGN A;  2E75 D;  2SPZ A;  4IL6 E;  4GT1 A;  2KS1 A;  1NKN A;  3DS2 A;  4U7J A;  4XRO A;  1ZMB A;  2RKL A;  2QJP C;  1H0T B;  1VQ7 P;  1HVV A;  1EZV D;  3B5N C;  3M0A A;  3CCE P;  2L22 A;  2K1A A;  5KP6 B;  2ZT9 D;  1RF1 C;  2M5R A;  2ZT9 B;  2C0X A;  4L73 A;  1SQV K;  1K30 A;  1X3O A;  2LIW A;  2B9B A;  2KGE A;  2OAR A;  3H1K J;  1HGV A;  1G2C B;  3WMM 0;  3AE6 C;  2N1T B;  4F37 A;  3U59 A;  1VQL P;  2Q6Q A;  1U57 A;  4WVZ A;  3T97 B;  1SQQ J;  1AQT A;  2IZ0 A;  1SQX K;  4IFD K;  4L76 A;  2K94 A;  1KMI Z;  3GLM A;  1BDC A;  2NO8 A;  2LXC B;  2GZG A;  1TU3 F;  1FE6 A;  1EXI A;  3MP7 B;  5KLV G;  2QA4 P;  3L74 E;  2V4H A;  2EHT A;  1KOR A;  1NTK J;  4WY4 D;  3DS1 A;  4ASV A;  1FZC C;  1IFJ A;  4H13 C;  1PPJ G;  3BCC J;  1M1J A;  2YO2 A;  1USE A;  4K3A A;  2KOD A;  4NPD A;  1EDK A;  2M0B A;  3LW5 H;  4PJ0 E;  1M90 Q;  4PH0 A;  3I5C A;  2JO0 A;  1DV5 A;  5BU8 B;  2GZI A;  4EIJ A;  1SQB G;  3RK2 C;  1EZV E;  1UII A;  2FVF A;  1U7M A;  4EDF A;  1L0L K;  3CE7 A;  2WSS H;  4I7Z C;  1N7S A;  4Y28 J;  1SQB K;  2ZT9 C;  1JOC A;  2OTL P;  1NYH A;  1NTK G;  2QJP B;  5KLI C;  1CI6 A;  3L71 J;  1IFM A;  1JY2 O;  1HJ0 A;  1JY2 P;  5KAF E;  2Z46 A;  3B71 A;  2XV6 A;  2I1K A;  3AE7 C;  4QNB A;  2JKV A;  4AQR D;  4DJG A;  3GHG C;  3M9B A;  3T97 A;  2WSF H;  5HGL A;  5KAI H;  2W27 A;  3VTP C;  2H88 C;  1FAV A;  2W90 A;  3AE9 C;  1X9V A;  3H1I E;  1PL5 A;  5F2N A;  1CSB A;  1URQ D;  2L91 A;  2WPV B;  1Q7Y Q;  2A45 H;  2FAC A;  5EW5 E;  3G6E P;  4H2X C;  1GXG A;  1FZC B;  2IDB A;  1YJ9 P;  2Q1K A;  1OW7 A;  3LW5 J;  3M9H A;  3PTZ A;  2MVU A;  3HD7 C;  1N73 A;  2BCC J;  1JMM A;  3WU2 E;  3L72 G;  3V2Q A;  3L70 J;  1J1E C;  3S1K A;  2QEX P;  2XV5 A;  3AEB C;  2ZYA A;  1EOQ A;  1G1J A;  2QIW A;  3NMD A;  1JY3 O;  1NJI Q;  2D2C B;  3ABV C;  2YIU B;  2KXP B;  2IPP A;  1DEE G;  2FYU G;  3BRT B;  1N7S B;  4OWF A;  4DT0 A;  2O1K A;  1AVY A;  2KZI A;  1NQ4 A;  2KOO A;  3C9I A;  4GIF A;  3IN6 A;  1QL2 A;  5CBO A;  2L6E A;  1RF1 B;  2NPS C;  3HTK B;  3M06 A;  2BAS A;  1EZV I;  5EFW B;  1SS1 A;  3DPH A;  3U1C A;  1L2P A;  2Y0E A;  3KPE A;  2PAJ A;  1QVF O;  1BSH A;  1FU1 A;  2N5I A;  4IOI H;  5L8R J;  1NU1 J;  1IFD A;  3L75 E;  1SQX G;  3B4S A;  1BE3 G;  2QM8 A;  3ZDM A;  1K73 Q;  4DCK A;  2NRG A;  2R32 A;  4H2Y C;  2KOG A;  2K93 A;  2V7Q J;  3CC4 P;  1URQ C;  1VL2 A;  4KT0 J;  5H2F H;  2KOR A;  2FXM A;  5HGN A;  2FKW B;  3CXH D;  2OYH B;  1PP9 D;  4R4M A;  1USD A;  5KKZ C;  4WY4 C;  1IFN A;  1SFC B;  1JUN A;  2PEN A;  3V2N A;  3CCU P;  1K8A Q;  1N8R Q;  3B8E B;  3S4R A;  1LTJ A;  1T2K D;  3Q2Y A;  4Y99 C;  1VQP P;  1PZQ A;  2MVV A;  2Z5I A;  2AF8 A;  3NY7 B;  1ZP0 C;  2KOP A;  3VOP A;  2LKI A;  2GDY A;  2XT1 A;  3L74 D;  4CPG A;  1DIP A;  3O6Q A;  1BE3 J;  2OYI A;  1P84 H;  4C7N B;  1IMP A;  2K9J B;  2M8N A;  3W68 A;  4XFJ A;  2WSC J;  3H32 A;  3PP5 A;  2XNX A;  1QL1 A;  2PRR A;  2YKQ A;  1BDD A;  1PGO A;  1DNY A;  1LP1 B;  1K05 A;  1YYC A;  3E2D A;  3VMA A;  2QJK B;  2H43 A;  4OGQ D;  1VQ9 P;  3KZI E;  3BCC G;  1AFO A;  3AEC C;  2QVA A;  5B5E E;  3CXH H;  1SQV G;  2B87 B;  3WUU A;  2N1T D;  2DNW A;  3RL0 D;  3E1R A;  3MUD A;  3AE4 C;  1FDO A;  4K35 A;  1YQ3 C;  2G8Y A;  1OW8 A;  1Y9B A;  2KG9 A;  5HGO A;  2UWJ E;  3CC2 P;  5CCH C;  3M0D C;  2LR2 A;  2WSE H;  3H1I D;  2WSC H;  4PV1 D;  2Y0D A;  1NTM J;  5APQ A;  4U3F D;  2FFD A;  3U1A A;  3B5I A;  2N1T A;  1JM0 A;  2R5D A;  1S72 P;  4HB1 A;  1BGY J;  1KIL D;  3A2A A;  2YNY A;  3V2P A;  1KYO E;  3PJS K;  2IBZ G;  4AUW A;  4U0A A;  3UIA A;  4U3F E;  3NXS A;  5APY A;  4N78 D;  1PV3 A;  4L74 A;  1MKM A;  2K2Q A;  3RK3 C;  2K0D X;  2IBZ D;  2Q5U A;  2C0W A;  2IYO A;  2WPS A;  3GHG A;  3B5N D;  2OTK E;  3H1J J;  4EI2 A;  1M57 D;  4RKU J;  4UB6 E;  1LTJ C;  5K5G B;  2FFD C;  1NWQ A;  4U0C A;  2JWA A;  4H44 B;  2ZYG A;  1GL2 B;  1SQP J;  5CCH D;  4M0I A;  1GPJ A;  3P32 A;  5AVV B;  5F2O A;  5TIS E;  3NTE A;  1L4A A;  2W6J H;  1Q90 D;  2WT7 B;  3VMX A;  2E74 C;  3MZW B;  1UJZ A;  1E5W A;  1VF5 D;  1FZE A;  2E76 D;  2E42 A;  2Q3I A;  1S3J A;  2N9B A;  4JYC A;  3M9Q A;  1HH0 A;  2KGD A;  2XDJ A;  1J1D B;  4BPG A;  7CEI A;  2MF4 A;  1JY2 N;  2PEO A;  3RK3 D;  1T6A A;  5KP8 B;  4W80 A;  2WMM A;  2L5G B;  1FC2 C;  5KJ7 D;  2M3B A;  2K92 A;  2HOD B;  1ACP A;  3A5T A;  3V5B A;  1X8Y A;  3NFQ A;  2JEE A;  3A0H H;  2IBZ I;  3IAO A;  2CG5 B;  2CK3 H;  1BSN A;  2OYI C;  5M1B A;  2OQQ A;  1BXI A;  1PP9 E;  4I7Z B;  5C39 A;  3SWK A;  3B4Q A;  2JR8 A;  2IX7 C;  2A06 G;  1RF0 A;  3RGU A;  4OVN F;  3P7K A;  4ZMD A;  2KGC A;  3EJE A;  2Q9I A;  2WWW A;  5BU5 A;  5E79 H;  1KQS O;  1FJP A;  3MHV A;  1SQP D;  3TYY A;  3G9R A;  2PEK A;  3S9O A;  1KB9 I;  3H1H J;  2GM4 A;  4I6M C;  3E1I A;  2ITA A;  1MUU A;  3AE3 C;  2BEQ D;  3JC2 2;  5DJU B;  2XZ1 C;  1L4A D;  3VMZ A;  2YMK A;  1DH3 A;  3BCC E;  1PEM A;  1RF0 C;  2WSE J;  5B66 E;  1NH4 A;  5GTI E;  3B5N B;  4OGQ C;  5CCH A;  1DD3 A;  1FOS F;  1NAF A;  2I1J A;  3TGU E;  2Q3E A;  4I1L A;  1BCC D;  2GYK A;  1AQ5 A;  5AVR B;  1KD1 Q;  1DD4 A;  1FR2 A;  1KQL A;  1PGJ A;  1KIL E;  3KXD A;  1L0N D;  5CHX A;  1NAY A;  1NOH A;  3I55 P;  4QKO A;  4WWI A;  1LNQ A;  3H1J E;  1HF9 A;  1L0L J;  1D7M A;  3AEG C;  1FOS E;  1GDT A;  1OXZ A;  4N3Y B;  1SQB J;  1SQV E;  1GU5 A;  3H1L D;  3L36 A;  2HPC A;  5KLV D;  1JO5 A;  4YXW H;  1AYI A;  3G4S P;  1KN7 A;  3TK1 A;  4C7N A;  5CCG D;  1MFT A;  4WYM A;  3L73 G;  1GZL A;  3E7K A;  2E5T A;  2FAD A;  3C8V A;  1IK7 A;  1VQK P;  3L71 D;  1PPJ E;  4UB8 E;  1M6N A;  3OJA B;  4U0B A;  1DEB A;  2P9X A;  1J1E B;  1IO4 A;  3D70 A;  1FZF A;  1WRG A;  3DS4 A;  3JCU E;  4GDO A;  1LP1 A;  4HYT B;  4JBZ A;  3WBH A;  1GW3 A;  1SQX J;  3Q5P A;  2PP6 A;  2LL8 A;  1SVF A;  3CCQ P;  2CNR A;  1HY8 A;  3V2R A;  3LRY A;  1OVR A;  3H1L E;  3CCM P;  2M5A A;  5CCG A;  1R5L A;  2JBG A;  1VPC A;  2OYH A;  2FY8 A;  3KQG A;  1NGM B;  1LGH B;  1LT1 A;  1H8A A;  1A02 F;  2XKM A;  1A02 J;  1PEQ A;  1T3U A;  3R4Y A;  5AW4 B;  1T3J A;  2CWO A;  3M91 A;  4IPY A;  2FQ0 A;  1L0N J;  2MKV A;  1OWA A;  4KJM A;  3M0D A;  2E75 B;  5APV A;  4BXL A;  1KZU B;  1FZG A;  4WB4 A;  3V4Q A;  1NTZ J;  2HR3 A;  3F89 A;  3VYI A;  2JDI H;  1IZN B;  1EZV G;  2LXB A;  1OZH A;  5KJ7 A;  2Z4E A;  3PLN A;  3GF3 A;  3RBX A;  4XE5 B;  1HGZ A;  3A7O A;  2GZF A;  3TGU G;  4WY4 B;  2BEZ F;  3RK2 B;  1S9K E;  2C9N Y;  3H25 A;  3H1H G;  3AED C;  3A3Y B;  2MR8 A;  1M56 D;  2P7J A;  3G28 A;  4IFM A;  3H1J G;  3GW6 A;  4UB8 H;  1BCC G;  1SQX D;  2WSF J;  1AVO A;  5KAI E;  3G1I A;  3Q1M A;  3F5H A;  2QSI A;  1VQ4 P;  4BPF A;  3PRJ A;  3KDP B;  1NU1 K;  2CQ8 A;  2WQY C;  1S1C X;  3TNU A;  5AVT B; 
#chains in the Genus database with same CATH homology
 3CCL P;  3DS4 A;  3Q20 A;  3WBH A;  1Q86 Q;  3G26 A;  3I56 P;  4XFY A;  3G0V A;  3G71 P;  4U0A A;  2QEX P;  1M90 Q;  1YI2 P;  3DS0 A;  2XT1 A;  4PH0 A;  4XFX A;  1AUM A;  2JO0 A;  3CCQ P;  3VRL C;  3H0D A;  2LF4 A;  2Z45 A;  3LRY A;  1EOQ A;  2PEQ A;  3DS3 A;  3CME P;  1RO2 A;  3CCS P;  1YJW P;  2ONT A;  3CCM P;  1NJI Q;  1VQM P;  1E6J P;  3G29 A;  1K9M Q;  1KQS O;  1VQ6 P;  4U0F A;  3CCV P;  4GR6 A;  2PEK A;  3DS2 A;  2M8N A;  4XRO A;  1ZMB A;  1Q82 Q;  1RNI A;  2BHV A;  3G1G A;  1VQ7 P;  2M8L A;  3CC7 P;  1PEQ A;  1W2B O;  3CD6 P;  3CCE P;  3HYB A;  2CWO A;  2EG5 A;  4XFZ A;  2OTL P;  4IPY A;  1A43 A;  4U0C A;  1PEM A;  1VQN P;  3E2D A;  1K30 A;  3HZQ A;  1PEO A;  2XXM A;  2L6E A;  1KC8 Q;  5I4T G;  4M0I A;  3CXC O;  1VQ9 P;  2OAR A;  3DTJ A;  5DCK A;  2BUO A;  3DPH A;  1BAJ A;  5F2O A;  3CCR P;  2Z46 A;  3CMA P;  3NTE A;  2XV6 A;  2DGY A;  1QVF O;  1KD1 Q;  1RO0 A;  4QNB A;  5BS1 A;  2PEJ A;  1VQ8 P;  1VQL P;  1IUQ A;  1QVG O;  1YIJ P;  3CPW O;  5HGL A;  1M6E X;  2E1M A;  2PEI A;  2JYG A;  4COP A;  3DS5 A;  1K73 Q;  3I55 P;  5JPA A;  4GR2 A;  2PY8 A;  1A8O A;  3OW2 O;  2Z44 A;  2PEM A;  1D1D A;  1EIA A;  3P05 A;  5HGO A;  3G21 A;  3MGE A;  3CC2 P;  5F2N A;  1VQ5 P;  4PH1 A;  3CC4 P;  2M8P A;  3G4S P;  2BQ1 E;  2PEO A;  3G28 A;  3RG6 C;  5HGN A;  1PEU A;  4COC A;  1Q7Y Q;  2QA4 P;  1M74 A;  1QRJ A;  3G6E P;  1Q81 Q;  1M1K Q;  5HGM A;  3M1M A;  1YJN P;  5BS2 A;  3B5I A;  4WYM A;  1YHQ P;  1YJ9 P;  3DS1 A;  2OTJ P;  2EFJ A;  3G1I A;  1S72 P;  3H4E A;  5F2K A;  1YIT P;  1JJ2 O;  1VQK P;  2PEN A;  2EIA A;  1VQ4 P;  1M6N A;  4U0E A;  4U0B A;  3CCU P;  1K8A Q;  3CCJ P;  1N8R Q;  4XRQ A;  2P9X A;  2JYL A;  3H47 A;  1VQO P;  4U0D A;  2KOD A;  1VQP P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...