1VQKP

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqkP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqkP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqkP02
3CMEP 1NJIQ 2QA4P 3CCRP 1YITP 2OTJP 1VQ8P 1YHQP 1VQKP 1QVGO 1JJ2O 1VQOP 1K73Q 1VQLP 3I56P 1Q86Q 3CCSP 1VQPP 1VQ5P 1Q81Q 3G4SP 3CC4P 3CCQP 1KQSO 3CCLP 1N8RQ 1KD1Q 3CC7P 1KC8Q 2QEXP 1M1KQ 3CCEP 1VQ6P 3CXCO 1S72P 1QVFO 1YI2P 1YJWP 1M90Q 3CCJP 3OW2O 3CMAP 3CCMP 1YIJP 1Q7YQ 1K8AQ 3I55P 1YJNP 3CC2P 3CD6P 1VQ9P 3CPWO 1W2BO 1VQ4P 3G71P 1Q82Q 1YJ9P 1K9MQ 1VQ7P 3CCVP 1VQNP 2OTLP 3CCUP 1VQMP 3G6EP
chains in the Genus database with same CATH superfamily
1SQQG 4IFMA 1JJ2O 5HVCA 2VLOA 1YTZI 1LP1A 1NTZJ 3P8CD 2PFXA 1P84H 4C7RA 3FGAD 1DEBA 3H1HE 1MZ8A 1HUCA 3L75G 3DS5A 5E79E 1KB9E 3B4QA 2Q5UA 1L4AC 1JCDA 2IDBA 1LTBC 3L71E 1BSHA 2K92A 3V2RA 3RK3B 3L75D 4NPDA 3L73D 3GHGC 2WVRA 5L8RJ 4NPEA 1ACPA 1AV1A 3C8VA 2FFDB 2KG6A 3V6IA 3CC2P 4UHPB 1SFCA 4UB8H 1BE3J 1GXHA 2A45G 2KORA 1S5LE 2VLPA 3G1GA 1PGQA 5BU8B 1AQTA 1JY2O 4U0AA 1SQQD 4W80A 3GKLC 3HTKB 3HRNA 4H44C 5AW5B 1K05A 4IZ6A 1D1DA 4PWVB 2O01H 3L74G 2FYUG 2WQYC 5K5GB 2JQ4A 2MD9A 1SQPD 3RGUA 5APVA 1EZVG 4PV1C 2CQ8A 3MTUE 1M6NA 3M9BA 1JCCA 2KIKA 1QGKB 1OIPA 2JO0A 3PP5A 2LXCB 2LKMA 1SQPE 3BRTB 3TSIA 1UNKA 1S5LX 1PP9E 1J2JB 3RG6C 2Z44A 3TK1A 1JY2N 4BXLA 3G1IA 3E7KA 3A5TA 2AXCA 1HWTC 1RNIA 2EFJA 2WSFJ 2Z45A 1JY3P 3D70A 4ZKUA 3H1IJ 1GL2D 2NPSC 2Q6QA 2KOGA 5HGNA 1U7JA 2LOLA 3D6YA 2ZT9B 1LP1B 1NQ4A 2LF4A 1W2EA 3TGUJ 2ZAEB 2L6EA 3EFFK 4U7JA 3V4QA 1SQVG 1RH5B 1PL5A 5EW5E 2W6JH 4IL6H 3OAKA 1SLQA 2WTYA 2IBZI 2FXPA 2O3JA 5M1BA 2KNCB 4BRYA 1W5CE 1KILD 3WUTA 4PV1D 5KLIC 2WSEH 2YNYA 3CCSP 3U59A 5APWA 5TISH 1L4AA 1KMIZ 2KG8A 3VOPA 4EIJA 5B66E 2BCCE 2LKIA 3GHGB 5CHXA 1Y9BA 3BCCJ 4XFXA 2CG5B 1JEKA 2IFNA 3IFMA 1NTZD 4YXDC 1OX3A 1U57A 2O01N 1H0TB 3VYIA 3L75J 3S9OA 2QJPC 4L73A 5EFWB 1OZHA 1BGYJ 3VTPC 3OW2O 1VQ9P 4PD4H 5TISE 2IZ1A 3HD7A 3VN0A 3B5NB 1JY3O 2K94A 1FZBA 2OYIB 2EIAA 2WSCJ 1QL2A 1M1JB 2WWWA 3TF5A 2PEOA 1S2EA 3GLMA 5BU5A 3OA7A 5APSA 1S1CX 2M5AA 3H1JG 3WU2H 3Q20A 3G0VA 5AVXB 2YKPA 2OTLP 2LR2A 1A8OA 2RH0A 1KYOD 3AE9C 2BQ1E 3G6EP 2A06D 2XKMA 1VPCA 4XROA 2YXRB 5KLVJ 2MF4A 3Q3DA 3N4XA 1NTKJ 3AE7C 1N73A 2KR5A 2ZT9C 5CBNA 5KP7B 4EOTA 3N7NA 1BDDA 2NPSB 2I1JA 2JJLA 5AVRB 3NXSA 1ZNVA 2P9XA 4YTPC 2ZVNB 1FR2A 2OARA 3FXEA 4IL6E 1GMJA 2R32A 1KQSO 1EDJA 2IPPA 3LIEA 5CZDB 1NU1J 1SFCB 1UJZA 2K9YA 1PPJG 1HGZA 1EZVD 4N78E 2JB0A 3Q2YA 2J59M 1D7MA 2O1JA 2A45H 1NTZE 1ZRTE 3BRVB 3KPEA 3CMAP 1T8KA 3RK2C 3RL0g 3DS0A 4JYBA 2L9FA 3CMEP 4C46A 2WSFH 1FZFA 2RKLA 4AUWA 5AW2B 1PZQA 3EFGA 4K35A 3DS1A 1LTGC 2N50A 1GK6A 1JY3N 3G28A 2PRRA 2ZYGA 3AEDC 2CNRA 2IBZD 2NPSA 5AW7B 3L4FA 3HTKA 3B5NC 2LMLA 2D2CC 1BDCA 2L4BA 1L0LK 1FZCB 4GR6A 1W2BO 2IX7C 2LTEA 1PEUA 1PP9J 3FWNA 1PPJD 2WSSH 2K0YA 1LJ2A 1QEXA 2H88C 1YBKA 2QRXA 2OYHC 1LT9C 2Y0DA 1NTZG 4XE5B 1HJBA 1SQXJ 1KC8Q 3FX0A 2E76C 2N1TB 1OR5A 1OVUA 3L70D 3AE1C 4COCA 2KG9A 1SQBK 3M0DA 3HE5A 5HGMA 5KAFH 3F89A 5CCGA 3CC4P 1M1JA 3M06A 3A0HH 2GDWA 2O01J 2FYNC 1EC5A 2K2QA 2HPCA 3CWBJ 2P10A 2E5TA 3TGUE 3HZQA 2B87A 2JYLA 4RJTA 4U0EA 2ZYDA 1G2CB 3HE4A 2GA1A 2P1JA 4GT1A 1K9MQ 3L74E 1YYCA 3L71G 4GR2A 1KFNA 4D6TD 3R2PA 2BEQD 3CXHE 2JWDA 3T97B 4H0LC 3AEFC 2BUOA 1N2DC 2KS1B 1VQNP 2YIUC 2KK7A 3CCQP 1ZRTD 3L36A 1S9KE 4N6JA 2WZ7A 4M0IA 1J1EB 2G3AA 5GTHH 3RL0B 4WWIA 2FXOA 4R0MA 1PGJA 3P7KA 1GDTA 5AW1B 5DJUB 2GZFA 1IFMA 1JB0J 2CPBA 3CPWO 1PGOA 1MUUA 2C9NY 5H2FH 1L0NG 4U3FE 3H1IG 3D6ZA 1NWQA 3H47A 1GXGA 1LGHB 1RF1B 5AVTB 4W7YA 1KV4A 1OW8A 3WUVA 1EXJA 3JC22 3MIWA 1IMPA 1VQ6P 1M6EX 3CCEP 5BS1A 1QVFO 1L2PA 3L37A 1JUNA 3RG2A 1WT6A 1NKNA 1PGPA 1PP9G 1L0NJ 1FOSE 3HUSA 3RBZA 2PGDA 2OGUA 2KB7P 2IFMA 3QWOC 1SQBE 1KILA 2AFEA 2WPTA 1NTKE 3CXCO 2FADA 2EHSA 2N1TC 3H6PA 2FQ0A 4XFYA 5APXA 2K0DX 2JR8A 1X79B 5KLVD 5AVYB 3O6QA 3V5BA 1S4XA 3GMAA 2R3SA 1GL2C 2NPSD 3P8CE 2PEKA 1OXZA 3RK3D 1URQA 2FYNB 1NH4A 1M1JC 4KJMA 2ZFCA 2ZVOB 4W7ZA 1YJNP 5F2NA 1P84I 5APQA 1RQVA 2DGYA 1UIXA 2K93A 1GW3A 2L5GB 3HD7D 3B4SA 1NTMK 2A06G 4EDFA 3KZIE 1AFOA 3G3ZA 1XTGB 1ZOYC 2E74C 3HUSC 3S4RA 4XA4A 1XTCC 3AEGC 4CPGA 1IUQA 1EXIA 1GD2E 2BCCD 2JGPA 1VQ8P 4GKGA 2R5DA 2ERHA 4PD4I 1NGMB 2QJYC 2CPSA 1VHNA 2FY8A 3L75E 2WPSA 2L0QA 5CCGD 1LTJB 3O6QB 2I1KA 3H1LE 4MN4C 1FAVA 2M8PA 1RE3A 1IC2A 2Q1KA 5TJHA 1LWUA 4EI2A 2WITA 1YQ4C 1Z56A 3NTEA 2W8ZA 3NY7B 4HYTB 4JYCA 3M1MA 1NTMD 1N7SD 3L70E 2XT1A 2C0XA 1FDMA 2HLOA 1EDLA 1VDFA 5AVVB 3GF7A 4F37A 2YMYA 1QRJA 2XV6A 5H2FE 3AE6C 1SP4A 3E1IA 1E79H 1SQXG 2ROQA 2Z46A 1EZVI 4ASWA 3PTZA 2FHSC 1IFJA 1Y8AA 1R5LA 3BVHA 2YO2A 4WY4C 3VRLC 3GG2A 5KJ7C 2IYPA 3AEEC 2FBWC 2QG4A 3RBXA 5BVZA 1BCCJ 4OVNF 2AEFA 4PV1B 1SVFA 2CGQA 2ZXEB 1BCCE 2H43A 2GYKA 3AECC 4JBZA 3HE5B 2LIWA 2A45I 4OGQB 2E76B 2HR3A 3F5HA 1KYOH 3LRYA 2KGEA 3G26A 1GZLA 3H1KJ 4UB6H 1KZUB 2KSEA 1SFCD 3TGUG 1EDKA 3EQ2A 1HGVA 1N7SC 3C9IA 1SQXK 1NHLA 5AW3B 2FYUK 4N78D 4PH0A 1KB9D 2M8RA 1T2KC 3H1KD 1NU1G 1M56D 1BE3D 3H4EA 1FZAA 2AXTH 4KHXA 3TYYA 1DH3A 2JO1A 2AF8A 3A0HE 3KZIH 5CCHD 2GZEA 2OYHB 1K30A 3SFDC 2FYZA 1SQPG 1ZR4A 1NAFA 4D6TG 2FQ2A 1HF9A 1KQLA 3H1LG 2YKOA 2E75D 3SFEC 5KLIB 1SQQJ 1M1KQ 3R4YA 1DIPA 2UWJE 1S3JA 1H8AA 1GU4A 1N73B 3CCMP 1Q7YQ 1Q90D 1USDA 3TNUA 3CD6P 2NRGA 1NTZK 2N9YB 4PH1A 5KP8B 4EYYQ 3BCCG 1NOHA 1E5WA 1T6AA 5KAFE 2R44A 1VQOP 2LPKA 1FDIA 1OWAA 4QNBA 1Q86Q 1KTMA 1FZEA 1KQGB 4WY4B 4C7NB 1ZP0C 3H32A 1RF1C 1S72P 2P58A 5CMZA 1E6JP 1KB9I 1OW7A 2KLUA 3IN6A 2XZRA 1SQVK 1AVYA 2JU2A 2Q3IA 4Z1MH 4H0LB 2PENA 1L4AD 4D6TJ 2GM4A 2MR7A 4NEOA 1SQVJ 2JEEA 3AEBC 1URQC 1KQFB 4BPFA 5HV8A 1G2CA 3HE4B 1X8YA 1EIAA 3B5ND 1X9VA 2O1KA 2JU1A 5AW6B 5F2KA 1BCCG 3BCCD 2AVAA 4COPA 3AE8C 3U1CA 2Y0CA 5BS2A 4PJ0E 1L4AB 4BPHA 1YIJP 2JYGA 2V4HA 4Y28J 1J1DC 4PJ0H 1M74A 3H1LD 4JPZB 2LXBA 1YHQP 2Y9ZA 2KS1A 2RN0A 2K5XA 5DCKA 4HB1A 2FFDC 1IJDB 3M91A 1SFCC 2DW3A 2EG5A 1KORA 3G71P 4LLHA 2N9BA 1DEEG 2KOOA 3L70J 5AW8B 4PD4D 1DV5A 4CA3A 3GZMA 1JTHB 2R3CA 4BRYB 3GW6A 4H44B 2KNCA 3AE5C 1KB9H 2XU6A 2OYIC 1P84D 2HPCB 3JCUE 3D71A 3A0BH 2PY8A 3SWFA 3DS2A 1UIIA 3A3YB 3TDKA 2OYIA 4IFDK 2QIWA 1RO2A 3RK2B 1CW5A 2QA4P 3CL3D 3H0DA 1QVGO 4UB6E 1USEA 2EHTA 2QEXP 4I7ZC 1VF5C 1YJWP 2K0XA 5KLVK 1DNYA 1GTWA 2W27A 1NTMG 2GZGA 2JDIH 3JCUH 4LGDE 2B88A 1VQPP 5APYA 1NU1E 2PAJA 2N6YA 2A06E 4ZMDA 5JPAA 3H32B 1URQB 3II6A 5CCHC 1Y47A 2QE7H 2FVFA 3UIAA 4R4MA 2W90A 1NU1K 2FACA 2OTJP 2J5UA 3BASA 1AQ5A 4DT0A 2KI7B 1YTZT 3RK3C 2Z5HA 3L71J 4ZNCA 3VMYA 4M3LA 3BCCE 3L72G 3A7OA 1Q82Q 1G1IA 1JMMA 2C9LY 2N1TD 4DOJA 4HJGH 2E75B 1S9KD 2PEJA 3CLQA 3GJNA 3H1LJ 3IAOA 2LL8A 2KXPB 3MD0A 3E1RA 2M8NA 1LWUC 4U3FJ 3FXDA 1NTKK 1EMVA 1RE3C 1IFDA 4WYMA 1RF0A 3VMAA 2G8YA 3ABVC 2E42A 3Q1MA 3WBHA 1K73Q 1U7MA 2PEQA 2K9JB 2JWAA 1HJ0A 2QSIA 1OVRA 4H13C 1L0IA 3VP8A 1X0TA 1M57D 4IOIH 1EDIA 3MGNA 1SQBJ 1BGYD 2M5AB 3H1KG 3KXDA 3MUDC 3CXHI 3AE3C 1SQBD 1CSBA 4OGQC 3I55P 3RL0D 5CJ4A 1PFIA 3PHLA 1JNMA 1T3UA 4K3AA 2MVUA 2QM7A 4QMAA 1JMBA 1NTKG 2ZJSE 2FFDA 1SQBG 2HYNA 3TGUD 2KZIA 3CCJP 2QNWA 3CX5E 1VF5D 1VQ4P 4H2XC 1L0LD 3CCVP 2PEIA 1FJPA 1N7LA 3DTJA 1KYOI 4TLFA 3MP7B 3V2NA 4XRQA 5GTIH 4WB4A 2JBGA 3GHGA 1L0LJ 2V7QH 4D6TE 3L72E 2L91A 1L0LE 3MZWB 1H89A 3L73J 3U43A 3NMDA 2V7QJ 3EJBA 3RL0C 1VQ7P 1G1JA 2WT7A 2E74D 3GZLA 1H0TA 2KP8A 2MY5A 1LT1A 1KILE 1FBMA 1LTJA 3CC7P 1DD3A 5KJ7A 1FZCA 3Q5RA 4UB8E 3Q5SA 4HH2A 4R4LA 2IYOA 1FC2C 1MKMA 2K9JA 2GDXA 1SQPK 2XDJA 3M9HA 2E76D 2KGCA 3BATA 4YPCA 2BEZF 1OVVA 4A7PA 2M3BA 5KAIH 4Y99C 1ZN5A 1SQQE 2OYHA 2K1AA 1J1DB 3A0BE 1E0HA 3I56P 1MFTA 1MV8A 3G4SP 1KD1Q 2E5YA 1IMQA 2FYUD 3EJEA 3GF3A 4BWNA 1KLPA 3H25A 4RESB 3M0DC 3G21A 2MVVA 2KOPA 1F80D 1BGYG 1VQLP 5B66H 3CWBE 2ZXXA 2C0WA 2FYUE 2P67A 3KDPB 4GIFA 4L76A 1LTIC 3CXHH 1PP9D 1FE6A 1URQD 3H1ID 2P7JA 4I2LC 1HQBA 4U0CA 3ZDMA 1EQ7A 1YJ9P 3AE4C 2YMKA 4H13D 2N5IA 4AYCA 1PV3A 4ZKPA 2KYVA 1SQXE 5KTBA 3V4WA 5KLVE 4GODA 2GUVA 1T8ZA 2JKVA 4I7ZB 2FXMA 2K3RA 4KT0J 4B86A 1LTSC 2VRSA 3VP9A 2MJZA 3O8ZA 3H1JD 1PEQA 1GK4A 5HGOA 1LNQA 3C1LA 2QJYB 2YXQB 4L74A 2SPZA 2ZT9D 2Q9IA 3H1JJ 1SS1A 3L73E 1NVOA 3G29A 1AJYA 3H1JE 1EZVE 3PLNA 2QJKB 5CBOA 3L35A 3U1AA 1X22A 2PEMA 5CCHA 1OFCX 2HFED 2VLQA 2KOSA 3SWYA 1HVVA 1H88A 1L0NE 4U3FG 3W68A 2H7HA 2YKQA 1P84E 2KSJA 3B5IA 1N86A 2QJPB 4GDOA 4Y99B 3QH9A 2VSQA 3NFQA 1L0HA 5KLVG 1QL1A 3M0AA 1ZR2A 3HD7C 2N5HA 2XNDH 1LT9A 2VLNA 5HGLA 3CWBD 2MR8A 2KUBA 1EOQA 1M8OB 3CI9A 2MKVA 5DJTB 3A2AA 1JTHA 1ZMEC 2BHVA 4HKZH 4RO0A 1VQKP 2FVEA 3NTNA 3P8MC 2K88A 2AEMA 1GU5A 1RE4C 3IR9A 1BE3G 5KKZC 3PH0A 3Q5PA 1BAJA 3PRJA 2E1MA 1ZV8A 2AEJA 1GL2A 1AYIA 2PNGA 4BPGA 2OQQA 1CZQA 2N6ZA 3V2PA 1SQVE 1PEMA 1ZXGA 3H1HD 1FDOA 2KZJA 3B8EB 3PJSK 1HH0A 4AQRD 5KAIE 2LIUA 2HODB 4HKGA 2GZIA 2B89A 1PEOA 3CXHD 3USSA 4O9BA 3SSUA 2YIUB 4WVZA 2ITAA 3L74D 4H2WC 3IF4A 1N7SB 3DPHA 1VQ5P 2M0BA 1ZW0A 2E74B 1FJKA 1LTAC 4WY4A 4C7NA 1DD4A 1NKZB 2K37A 4N3YB 3CCUP 3L72D 3HYBA 1N7SA 1HY8A 4U0BA 2ONTA 1L0LG 2GZJA 3W67A 1IFPA 1L0ND 2QJKC 2QM8A 1N73C 1N8RQ 1QX8A 4U0FA 2HODA 1S5LH 1CI6B 1YQ3C 5GTHE 3P05A 1SQQK 5APUA 2H89C 1GW4A 2GUSA 5KP6B 1IZNB 1KILB 3LW5H 2AXTE 5KJ7D 4H0LD 3JSVC 3LIDA 3MGEA 5AW9B 2X2BA 1FS0E 3TNUB 2FAEA 1M90Q 3AEAC 2IBZG 5GTIE 2RMZA 4PXHB 1OW6A 2XZ0D 2Q7CA 2KGAA 1PPJE 2JP3A 3LW5J 2M5RA 3DS3A 1IO4A 2D2CB 3K5BA 1FZCC 1RQUA 2I8DA 1FOSF 1A02J 4I1LA 1IK7A 3L70G 2POHA 4OGQD 2WPVB 1ZMBA 2XXMA 2Q3EA 2FYUJ 1KFMA 1T2KD 4JQ0D 2AFDA 3S1KA 1JOCA 1A43A 3DS4A 2KW2A 2HG5D 2BASA 1IK9A 2FKWB 2FQ1A 4OWFA 2WT7B 2NZ2A 4H2YC 2WMMA 1ZLLA 2D2CD 4WBAA 5AVQB 4DZOA 2W6BA 1FZGA 1VF5B 3HUSB 4H44D 4MRTC 1JO5A 3EJDA 3CCRP 1YITP 1RHZB 3L74J 3B5NA 4I6MC 3VMZA 3KYQA 1VL2A 4U0DA 1L0NK 2E43A 2QVAA 3B71A 1T3JA 1BE3E 3KQGA 3V2QA 2B9BA 3M9QA 3E2DA 2DNWA 4WY4D 1CEIA 2J58A 1RF1A 1J1EC 2BCCJ 1TU3F 2XV5A 4U3FD 3CX5H 2H8PD 3MUDA 1PIXA 3FWLA 4QKOA 4PD4E 2KOQA 3H1KE 5CJ0A 2N98A 1SQPJ 2Y0EA 5B5EE 3P32A 4RKUJ 1JM0A 2NO8A 2JAZA 1R5SA 1Q2NA 1RF0C 1NJIQ 4LC1A 1BGYE 1KILC 5AVWB 2ZYAA 2KGDA 3CWBG 3WUUA 5C39A 1DX7A 2IBZE 2WPQA 2FVAA 1NTMJ 4YXWH 3SWKA 2KODA 3EWKA 1KN7A 1BXIA 1NTME 1HBWA 5I4TG 1LWUB 4IL6X 2XZ1C 2L22A 1AUMA 1RO0A 1AA0A 5E79H 1SQVD 1VKUA 1NAYA 1NO4A 1QLED 1KYOE 3ITKA 1JY2P 1X3OA 1MZ9A 4GOEA 3L72J 2M8LA 1Z6MA 2KLVA 1Q81Q 1M7LA 1NYHA 3CCLP 1HTLC 5AVZB 1YI2P 1GL2B 2CK3H 1K8AQ 7CEIA 1LTTC 2GDYA 5KKZB 2OTKE 5EJDA 3H1HG 4DJGA 2WSCH 3L73G 1RE4A 3H1HJ 5CCGC 1AF8A 4JF7A 2XNXA 1CI6A 2Y9YA 3L71D 2E75C 4IPYA 1RY3A 5AW0B 3I5CA 4DCKA 1WMKA 4XFJA 1OMIA 5B5EH 3T97A 4GOFA 4IFFA 3CX5I 3HD7B 1FU1A 1LTJC 3AE2C 3RK2D 1MFZA 2Z4EA 2P2UA 5APTA 4ASVA 3WMM0 4DG9A 2IZ0A 4NPFX 5AW4B 2Z5IA 2B87B 1VQMP 2WSEJ 2OYOA 1GPJA 4H13B 5AVSB 3VMXA 1R8EA 2WPRA 3KHUA 2M3EA 4OH8B 1WRGA 1K04A 5AVUB 3MHVA 2BCCG 1A02F 2CWOA 1IFIA 2W6AA 4TT3H 2N1TA 3CE7A 5F2OA 1BCCD 3RK3E 3H1IE 3LMOA 1SQXD 3WU2E 2YO3A 1AVOA 4XFZA 1LT9B 2PP6A 1NTKD 1NU1D 1BSNA 2W83C 3OJAB 3CX5D 4L75A 2R5BA 3G9RA 1IFNA 2KWLA
chains in the Genus database with same CATH topology
3DTJA 3CMEP 3G1IA 2BHVA 3DS1A 4XRQA 2EIAA 1VQKP 1JJ2O 4M0IA 1VQOP 1RNIA 2EFJA 2PEOA 3G28A 4QNBA 1Q86Q 3MGEA 2Z45A 2PEJA 1S72P 1M90Q 1BAJA 3DS5A 2E1MA 3Q20A 1E6JP 4IPYA 2M8NA 3G0VA 2PY8A 3DS2A 5HGNA 3CPWO 4GR6A 1IUQA 1W2BO 1VQ7P 2OTLP 1A8OA 1RO2A 1PEUA 2BQ1E 3G6EP 2LF4A 4WYMA 3H47A 3DS3A 2QA4P 1NJIQ 1VQ8P 4XROA 3H0DA 1QVGO 2PENA 3WBHA 3LRYA 1K73Q 1PEMA 2L6EA 2PEQA 3G26A 1ZMBA 1KC8Q 3CC7P 2QEXP 1VQ6P 1M6EX 3CCEP 1PEQA 2XXMA 5BS1A 1QVFO 1YJWP 5HGOA 2KODA 4COCA 1PEOA 3CC2P 5HGMA 1EIAA 5I4TG 1VQMP 3CC4P 2P9XA 3G29A 1A43A 3DS4A 2M8PA 4PH0A 3G1GA 5F2KA 1AUMA 1RO0A 2OARA 4U0AA 3DPHA 3I56P 3CCSP 1VQPP 1VQ5P 3G4SP 3H4EA 1KQSO 4COPA 1KD1Q 3NTEA 3HZQA 2PEMA 3CXCO 2JYLA 3M1MA 5BS2A 4U0EA 5JPAA 1YIJP 1D1DA 2CWOA 3I55P 2JYGA 2XT1A 3G21A 4XFYA 1K9MQ 3B5IA 4XFXA 5F2OA 3CCUP 3HYBA 1VQLP 4GR2A 1K30A 1M74A 3CCRP 1YITP 2OTJP 4U0BA 2ONTA 1YHQP 1M6NA 1QRJA 2M8LA 5DCKA 2XV6A 2JO0A 4U0DA 1Q81Q 2PEKA 4XFZA 3CCLP 1N8RQ 4U0FA 1M1KQ 2Z46A 1YI2P 2BUOA 3CCJP 3OW2O 5HGLA 1VQNP 3CMAP 3CCMP 1K8AQ 1Q7YQ 3E2DA 1EOQA 1YJNP 3CD6P 4U0CA 2EG5A 3RG6C 3DS0A 1VQ4P 1VQ9P 5F2NA 3G71P 3VRLC 1YJ9P 2Z44A 3P05A 2DGYA 3CCVP 2PEIA 1Q82Q 4PH1A 3CCQP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME P;  1NJI Q;  2QA4 P;  3CCR P;  1YIT P;  2OTJ P;  1VQ8 P;  1YHQ P;  1VQK P;  1QVG O;  1JJ2 O;  1VQO P;  1K73 Q;  1VQL P;  3I56 P;  1Q86 Q;  3CCS P;  1VQP P;  1VQ5 P;  1Q81 Q;  3G4S P;  3CC4 P;  3CCQ P;  1KQS O;  3CCL P;  1N8R Q;  1KD1 Q;  3CC7 P;  1KC8 Q;  2QEX P;  1M1K Q;  3CCE P;  1VQ6 P;  3CXC O;  1S72 P;  1QVF O;  1YI2 P;  1YJW P;  1M90 Q;  3CCJ P;  3OW2 O;  3CMA P;  3CCM P;  1YIJ P;  1Q7Y Q;  1K8A Q;  3I55 P;  1YJN P;  3CC2 P;  3CD6 P;  1VQ9 P;  3CPW O;  1W2B O;  1VQ4 P;  3G71 P;  1Q82 Q;  1YJ9 P;  1K9M Q;  1VQ7 P;  3CCV P;  1VQN P;  2OTL P;  3CCU P;  1VQM P;  3G6E P; 
#chains in the Genus database with same CATH topology
 1SQQ G;  4IFM A;  1JJ2 O;  5HVC A;  2VLO A;  1YTZ I;  1LP1 A;  1NTZ J;  3P8C D;  2PFX A;  1P84 H;  4C7R A;  3FGA D;  1DEB A;  3H1H E;  1MZ8 A;  1HUC A;  3L75 G;  3DS5 A;  5E79 E;  1KB9 E;  3B4Q A;  2Q5U A;  1L4A C;  1JCD A;  2IDB A;  1LTB C;  3L71 E;  1BSH A;  2K92 A;  3V2R A;  3RK3 B;  3L75 D;  4NPD A;  3L73 D;  3GHG C;  2WVR A;  5L8R J;  4NPE A;  1ACP A;  1AV1 A;  3C8V A;  2FFD B;  2KG6 A;  3V6I A;  3CC2 P;  4UHP B;  1SFC A;  4UB8 H;  1BE3 J;  1GXH A;  2A45 G;  2KOR A;  1S5L E;  2VLP A;  3G1G A;  1PGQ A;  5BU8 B;  1AQT A;  1JY2 O;  4U0A A;  1SQQ D;  4W80 A;  3GKL C;  3HTK B;  3HRN A;  4H44 C;  5AW5 B;  1K05 A;  4IZ6 A;  1D1D A;  4PWV B;  2O01 H;  3L74 G;  2FYU G;  2WQY C;  5K5G B;  2JQ4 A;  2MD9 A;  1SQP D;  3RGU A;  5APV A;  1EZV G;  4PV1 C;  2CQ8 A;  3MTU E;  1M6N A;  3M9B A;  1JCC A;  2KIK A;  1QGK B;  1OIP A;  2JO0 A;  3PP5 A;  2LXC B;  2LKM A;  1SQP E;  3BRT B;  3TSI A;  1UNK A;  1S5L X;  1PP9 E;  1J2J B;  3RG6 C;  2Z44 A;  3TK1 A;  1JY2 N;  4BXL A;  3G1I A;  3E7K A;  3A5T A;  2AXC A;  1HWT C;  1RNI A;  2EFJ A;  2WSF J;  2Z45 A;  1JY3 P;  3D70 A;  4ZKU A;  3H1I J;  1GL2 D;  2NPS C;  2Q6Q A;  2KOG A;  5HGN A;  1U7J A;  2LOL A;  3D6Y A;  2ZT9 B;  1LP1 B;  1NQ4 A;  2LF4 A;  1W2E A;  3TGU J;  2ZAE B;  2L6E A;  3EFF K;  4U7J A;  3V4Q A;  1SQV G;  1RH5 B;  1PL5 A;  5EW5 E;  2W6J H;  4IL6 H;  3OAK A;  1SLQ A;  2WTY A;  2IBZ I;  2FXP A;  2O3J A;  5M1B A;  2KNC B;  4BRY A;  1W5C E;  1KIL D;  3WUT A;  4PV1 D;  5KLI C;  2WSE H;  2YNY A;  3CCS P;  3U59 A;  5APW A;  5TIS H;  1L4A A;  1KMI Z;  2KG8 A;  3VOP A;  4EIJ A;  5B66 E;  2BCC E;  2LKI A;  3GHG B;  5CHX A;  1Y9B A;  3BCC J;  4XFX A;  2CG5 B;  1JEK A;  2IFN A;  3IFM A;  1NTZ D;  4YXD C;  1OX3 A;  1U57 A;  2O01 N;  1H0T B;  3VYI A;  3L75 J;  3S9O A;  2QJP C;  4L73 A;  5EFW B;  1OZH A;  1BGY J;  3VTP C;  3OW2 O;  1VQ9 P;  4PD4 H;  5TIS E;  2IZ1 A;  3HD7 A;  3VN0 A;  3B5N B;  1JY3 O;  2K94 A;  1FZB A;  2OYI B;  2EIA A;  2WSC J;  1QL2 A;  1M1J B;  2WWW A;  3TF5 A;  2PEO A;  1S2E A;  3GLM A;  5BU5 A;  3OA7 A;  5APS A;  1S1C X;  2M5A A;  3H1J G;  3WU2 H;  3Q20 A;  3G0V A;  5AVX B;  2YKP A;  2OTL P;  2LR2 A;  1A8O A;  2RH0 A;  1KYO D;  3AE9 C;  2BQ1 E;  3G6E P;  2A06 D;  2XKM A;  1VPC A;  4XRO A;  2YXR B;  5KLV J;  2MF4 A;  3Q3D A;  3N4X A;  1NTK J;  3AE7 C;  1N73 A;  2KR5 A;  2ZT9 C;  5CBN A;  5KP7 B;  4EOT A;  3N7N A;  1BDD A;  2NPS B;  2I1J A;  2JJL A;  5AVR B;  3NXS A;  1ZNV A;  2P9X A;  4YTP C;  2ZVN B;  1FR2 A;  2OAR A;  3FXE A;  4IL6 E;  1GMJ A;  2R32 A;  1KQS O;  1EDJ A;  2IPP A;  3LIE A;  5CZD B;  1NU1 J;  1SFC B;  1UJZ A;  2K9Y A;  1PPJ G;  1HGZ A;  1EZV D;  4N78 E;  2JB0 A;  3Q2Y A;  2J59 M;  1D7M A;  2O1J A;  2A45 H;  1NTZ E;  1ZRT E;  3BRV B;  3KPE A;  3CMA P;  1T8K A;  3RK2 C;  3RL0 g;  3DS0 A;  4JYB A;  2L9F A;  3CME P;  4C46 A;  2WSF H;  1FZF A;  2RKL A;  4AUW A;  5AW2 B;  1PZQ A;  3EFG A;  4K35 A;  3DS1 A;  1LTG C;  2N50 A;  1GK6 A;  1JY3 N;  3G28 A;  2PRR A;  2ZYG A;  3AED C;  2CNR A;  2IBZ D;  2NPS A;  5AW7 B;  3L4F A;  3HTK A;  3B5N C;  2LML A;  2D2C C;  1BDC A;  2L4B A;  1L0L K;  1FZC B;  4GR6 A;  1W2B O;  2IX7 C;  2LTE A;  1PEU A;  1PP9 J;  3FWN A;  1PPJ D;  2WSS H;  2K0Y A;  1LJ2 A;  1QEX A;  2H88 C;  1YBK A;  2QRX A;  2OYH C;  1LT9 C;  2Y0D A;  1NTZ G;  4XE5 B;  1HJB A;  1SQX J;  1KC8 Q;  3FX0 A;  2E76 C;  2N1T B;  1OR5 A;  1OVU A;  3L70 D;  3AE1 C;  4COC A;  2KG9 A;  1SQB K;  3M0D A;  3HE5 A;  5HGM A;  5KAF H;  3F89 A;  5CCG A;  3CC4 P;  1M1J A;  3M06 A;  3A0H H;  2GDW A;  2O01 J;  2FYN C;  1EC5 A;  2K2Q A;  2HPC A;  3CWB J;  2P10 A;  2E5T A;  3TGU E;  3HZQ A;  2B87 A;  2JYL A;  4RJT A;  4U0E A;  2ZYD A;  1G2C B;  3HE4 A;  2GA1 A;  2P1J A;  4GT1 A;  1K9M Q;  3L74 E;  1YYC A;  3L71 G;  4GR2 A;  1KFN A;  4D6T D;  3R2P A;  2BEQ D;  3CXH E;  2JWD A;  3T97 B;  4H0L C;  3AEF C;  2BUO A;  1N2D C;  2KS1 B;  1VQN P;  2YIU C;  2KK7 A;  3CCQ P;  1ZRT D;  3L36 A;  1S9K E;  4N6J A;  2WZ7 A;  4M0I A;  1J1E B;  2G3A A;  5GTH H;  3RL0 B;  4WWI A;  2FXO A;  4R0M A;  1PGJ A;  3P7K A;  1GDT A;  5AW1 B;  5DJU B;  2GZF A;  1IFM A;  1JB0 J;  2CPB A;  3CPW O;  1PGO A;  1MUU A;  2C9N Y;  5H2F H;  1L0N G;  4U3F E;  3H1I G;  3D6Z A;  1NWQ A;  3H47 A;  1GXG A;  1LGH B;  1RF1 B;  5AVT B;  4W7Y A;  1KV4 A;  1OW8 A;  3WUV A;  1EXJ A;  3JC2 2;  3MIW A;  1IMP A;  1VQ6 P;  1M6E X;  3CCE P;  5BS1 A;  1QVF O;  1L2P A;  3L37 A;  1JUN A;  3RG2 A;  1WT6 A;  1NKN A;  1PGP A;  1PP9 G;  1L0N J;  1FOS E;  3HUS A;  3RBZ A;  2PGD A;  2OGU A;  2KB7 P;  2IFM A;  3QWO C;  1SQB E;  1KIL A;  2AFE A;  2WPT A;  1NTK E;  3CXC O;  2FAD A;  2EHS A;  2N1T C;  3H6P A;  2FQ0 A;  4XFY A;  5APX A;  2K0D X;  2JR8 A;  1X79 B;  5KLV D;  5AVY B;  3O6Q A;  3V5B A;  1S4X A;  3GMA A;  2R3S A;  1GL2 C;  2NPS D;  3P8C E;  2PEK A;  1OXZ A;  3RK3 D;  1URQ A;  2FYN B;  1NH4 A;  1M1J C;  4KJM A;  2ZFC A;  2ZVO B;  4W7Z A;  1YJN P;  5F2N A;  1P84 I;  5APQ A;  1RQV A;  2DGY A;  1UIX A;  2K93 A;  1GW3 A;  2L5G B;  3HD7 D;  3B4S A;  1NTM K;  2A06 G;  4EDF A;  3KZI E;  1AFO A;  3G3Z A;  1XTG B;  1ZOY C;  2E74 C;  3HUS C;  3S4R A;  4XA4 A;  1XTC C;  3AEG C;  4CPG A;  1IUQ A;  1EXI A;  1GD2 E;  2BCC D;  2JGP A;  1VQ8 P;  4GKG A;  2R5D A;  2ERH A;  4PD4 I;  1NGM B;  2QJY C;  2CPS A;  1VHN A;  2FY8 A;  3L75 E;  2WPS A;  2L0Q A;  5CCG D;  1LTJ B;  3O6Q B;  2I1K A;  3H1L E;  4MN4 C;  1FAV A;  2M8P A;  1RE3 A;  1IC2 A;  2Q1K A;  5TJH A;  1LWU A;  4EI2 A;  2WIT A;  1YQ4 C;  1Z56 A;  3NTE A;  2W8Z A;  3NY7 B;  4HYT B;  4JYC A;  3M1M A;  1NTM D;  1N7S D;  3L70 E;  2XT1 A;  2C0X A;  1FDM A;  2HLO A;  1EDL A;  1VDF A;  5AVV B;  3GF7 A;  4F37 A;  2YMY A;  1QRJ A;  2XV6 A;  5H2F E;  3AE6 C;  1SP4 A;  3E1I A;  1E79 H;  1SQX G;  2ROQ A;  2Z46 A;  1EZV I;  4ASW A;  3PTZ A;  2FHS C;  1IFJ A;  1Y8A A;  1R5L A;  3BVH A;  2YO2 A;  4WY4 C;  3VRL C;  3GG2 A;  5KJ7 C;  2IYP A;  3AEE C;  2FBW C;  2QG4 A;  3RBX A;  5BVZ A;  1BCC J;  4OVN F;  2AEF A;  4PV1 B;  1SVF A;  2CGQ A;  2ZXE B;  1BCC E;  2H43 A;  2GYK A;  3AEC C;  4JBZ A;  3HE5 B;  2LIW A;  2A45 I;  4OGQ B;  2E76 B;  2HR3 A;  3F5H A;  1KYO H;  3LRY A;  2KGE A;  3G26 A;  1GZL A;  3H1K J;  4UB6 H;  1KZU B;  2KSE A;  1SFC D;  3TGU G;  1EDK A;  3EQ2 A;  1HGV A;  1N7S C;  3C9I A;  1SQX K;  1NHL A;  5AW3 B;  2FYU K;  4N78 D;  4PH0 A;  1KB9 D;  2M8R A;  1T2K C;  3H1K D;  1NU1 G;  1M56 D;  1BE3 D;  3H4E A;  1FZA A;  2AXT H;  4KHX A;  3TYY A;  1DH3 A;  2JO1 A;  2AF8 A;  3A0H E;  3KZI H;  5CCH D;  2GZE A;  2OYH B;  1K30 A;  3SFD C;  2FYZ A;  1SQP G;  1ZR4 A;  1NAF A;  4D6T G;  2FQ2 A;  1HF9 A;  1KQL A;  3H1L G;  2YKO A;  2E75 D;  3SFE C;  5KLI B;  1SQQ J;  1M1K Q;  3R4Y A;  1DIP A;  2UWJ E;  1S3J A;  1H8A A;  1GU4 A;  1N73 B;  3CCM P;  1Q7Y Q;  1Q90 D;  1USD A;  3TNU A;  3CD6 P;  2NRG A;  1NTZ K;  2N9Y B;  4PH1 A;  5KP8 B;  4EYY Q;  3BCC G;  1NOH A;  1E5W A;  1T6A A;  5KAF E;  2R44 A;  1VQO P;  2LPK A;  1FDI A;  1OWA A;  4QNB A;  1Q86 Q;  1KTM A;  1FZE A;  1KQG B;  4WY4 B;  4C7N B;  1ZP0 C;  3H32 A;  1RF1 C;  1S72 P;  2P58 A;  5CMZ A;  1E6J P;  1KB9 I;  1OW7 A;  2KLU A;  3IN6 A;  2XZR A;  1SQV K;  1AVY A;  2JU2 A;  2Q3I A;  4Z1M H;  4H0L B;  2PEN A;  1L4A D;  4D6T J;  2GM4 A;  2MR7 A;  4NEO A;  1SQV J;  2JEE A;  3AEB C;  1URQ C;  1KQF B;  4BPF A;  5HV8 A;  1G2C A;  3HE4 B;  1X8Y A;  1EIA A;  3B5N D;  1X9V A;  2O1K A;  2JU1 A;  5AW6 B;  5F2K A;  1BCC G;  3BCC D;  2AVA A;  4COP A;  3AE8 C;  3U1C A;  2Y0C A;  5BS2 A;  4PJ0 E;  1L4A B;  4BPH A;  1YIJ P;  2JYG A;  2V4H A;  4Y28 J;  1J1D C;  4PJ0 H;  1M74 A;  3H1L D;  4JPZ B;  2LXB A;  1YHQ P;  2Y9Z A;  2KS1 A;  2RN0 A;  2K5X A;  5DCK A;  4HB1 A;  2FFD C;  1IJD B;  3M91 A;  1SFC C;  2DW3 A;  2EG5 A;  1KOR A;  3G71 P;  4LLH A;  2N9B A;  1DEE G;  2KOO A;  3L70 J;  5AW8 B;  4PD4 D;  1DV5 A;  4CA3 A;  3GZM A;  1JTH B;  2R3C A;  4BRY B;  3GW6 A;  4H44 B;  2KNC A;  3AE5 C;  1KB9 H;  2XU6 A;  2OYI C;  1P84 D;  2HPC B;  3JCU E;  3D71 A;  3A0B H;  2PY8 A;  3SWF A;  3DS2 A;  1UII A;  3A3Y B;  3TDK A;  2OYI A;  4IFD K;  2QIW A;  1RO2 A;  3RK2 B;  1CW5 A;  2QA4 P;  3CL3 D;  3H0D A;  1QVG O;  4UB6 E;  1USE A;  2EHT A;  2QEX P;  4I7Z C;  1VF5 C;  1YJW P;  2K0X A;  5KLV K;  1DNY A;  1GTW A;  2W27 A;  1NTM G;  2GZG A;  2JDI H;  3JCU H;  4LGD E;  2B88 A;  1VQP P;  5APY A;  1NU1 E;  2PAJ A;  2N6Y A;  2A06 E;  4ZMD A;  5JPA A;  3H32 B;  1URQ B;  3II6 A;  5CCH C;  1Y47 A;  2QE7 H;  2FVF A;  3UIA A;  4R4M A;  2W90 A;  1NU1 K;  2FAC A;  2OTJ P;  2J5U A;  3BAS A;  1AQ5 A;  4DT0 A;  2KI7 B;  1YTZ T;  3RK3 C;  2Z5H A;  3L71 J;  4ZNC A;  3VMY A;  4M3L A;  3BCC E;  3L72 G;  3A7O A;  1Q82 Q;  1G1I A;  1JMM A;  2C9L Y;  2N1T D;  4DOJ A;  4HJG H;  2E75 B;  1S9K D;  2PEJ A;  3CLQ A;  3GJN A;  3H1L J;  3IAO A;  2LL8 A;  2KXP B;  3MD0 A;  3E1R A;  2M8N A;  1LWU C;  4U3F J;  3FXD A;  1NTK K;  1EMV A;  1RE3 C;  1IFD A;  4WYM A;  1RF0 A;  3VMA A;  2G8Y A;  3ABV C;  2E42 A;  3Q1M A;  3WBH A;  1K73 Q;  1U7M A;  2PEQ A;  2K9J B;  2JWA A;  1HJ0 A;  2QSI A;  1OVR A;  4H13 C;  1L0I A;  3VP8 A;  1X0T A;  1M57 D;  4IOI H;  1EDI A;  3MGN A;  1SQB J;  1BGY D;  2M5A B;  3H1K G;  3KXD A;  3MUD C;  3CXH I;  3AE3 C;  1SQB D;  1CSB A;  4OGQ C;  3I55 P;  3RL0 D;  5CJ4 A;  1PFI A;  3PHL A;  1JNM A;  1T3U A;  4K3A A;  2MVU A;  2QM7 A;  4QMA A;  1JMB A;  1NTK G;  2ZJS E;  2FFD A;  1SQB G;  2HYN A;  3TGU D;  2KZI A;  3CCJ P;  2QNW A;  3CX5 E;  1VF5 D;  1VQ4 P;  4H2X C;  1L0L D;  3CCV P;  2PEI A;  1FJP A;  1N7L A;  3DTJ A;  1KYO I;  4TLF A;  3MP7 B;  3V2N A;  4XRQ A;  5GTI H;  4WB4 A;  2JBG A;  3GHG A;  1L0L J;  2V7Q H;  4D6T E;  3L72 E;  2L91 A;  1L0L E;  3MZW B;  1H89 A;  3L73 J;  3U43 A;  3NMD A;  2V7Q J;  3EJB A;  3RL0 C;  1VQ7 P;  1G1J A;  2WT7 A;  2E74 D;  3GZL A;  1H0T A;  2KP8 A;  2MY5 A;  1LT1 A;  1KIL E;  1FBM A;  1LTJ A;  3CC7 P;  1DD3 A;  5KJ7 A;  1FZC A;  3Q5R A;  4UB8 E;  3Q5S A;  4HH2 A;  4R4L A;  2IYO A;  1FC2 C;  1MKM A;  2K9J A;  2GDX A;  1SQP K;  2XDJ A;  3M9H A;  2E76 D;  2KGC A;  3BAT A;  4YPC A;  2BEZ F;  1OVV A;  4A7P A;  2M3B A;  5KAI H;  4Y99 C;  1ZN5 A;  1SQQ E;  2OYH A;  2K1A A;  1J1D B;  3A0B E;  1E0H A;  3I56 P;  1MFT A;  1MV8 A;  3G4S P;  1KD1 Q;  2E5Y A;  1IMQ A;  2FYU D;  3EJE A;  3GF3 A;  4BWN A;  1KLP A;  3H25 A;  4RES B;  3M0D C;  3G21 A;  2MVV A;  2KOP A;  1F80 D;  1BGY G;  1VQL P;  5B66 H;  3CWB E;  2ZXX A;  2C0W A;  2FYU E;  2P67 A;  3KDP B;  4GIF A;  4L76 A;  1LTI C;  3CXH H;  1PP9 D;  1FE6 A;  1URQ D;  3H1I D;  2P7J A;  4I2L C;  1HQB A;  4U0C A;  3ZDM A;  1EQ7 A;  1YJ9 P;  3AE4 C;  2YMK A;  4H13 D;  2N5I A;  4AYC A;  1PV3 A;  4ZKP A;  2KYV A;  1SQX E;  5KTB A;  3V4W A;  5KLV E;  4GOD A;  2GUV A;  1T8Z A;  2JKV A;  4I7Z B;  2FXM A;  2K3R A;  4KT0 J;  4B86 A;  1LTS C;  2VRS A;  3VP9 A;  2MJZ A;  3O8Z A;  3H1J D;  1PEQ A;  1GK4 A;  5HGO A;  1LNQ A;  3C1L A;  2QJY B;  2YXQ B;  4L74 A;  2SPZ A;  2ZT9 D;  2Q9I A;  3H1J J;  1SS1 A;  3L73 E;  1NVO A;  3G29 A;  1AJY A;  3H1J E;  1EZV E;  3PLN A;  2QJK B;  5CBO A;  3L35 A;  3U1A A;  1X22 A;  2PEM A;  5CCH A;  1OFC X;  2HFE D;  2VLQ A;  2KOS A;  3SWY A;  1HVV A;  1H88 A;  1L0N E;  4U3F G;  3W68 A;  2H7H A;  2YKQ A;  1P84 E;  2KSJ A;  3B5I A;  1N86 A;  2QJP B;  4GDO A;  4Y99 B;  3QH9 A;  2VSQ A;  3NFQ A;  1L0H A;  5KLV G;  1QL1 A;  3M0A A;  1ZR2 A;  3HD7 C;  2N5H A;  2XND H;  1LT9 A;  2VLN A;  5HGL A;  3CWB D;  2MR8 A;  2KUB A;  1EOQ A;  1M8O B;  3CI9 A;  2MKV A;  5DJT B;  3A2A A;  1JTH A;  1ZME C;  2BHV A;  4HKZ H;  4RO0 A;  1VQK P;  2FVE A;  3NTN A;  3P8M C;  2K88 A;  2AEM A;  1GU5 A;  1RE4 C;  3IR9 A;  1BE3 G;  5KKZ C;  3PH0 A;  3Q5P A;  1BAJ A;  3PRJ A;  2E1M A;  1ZV8 A;  2AEJ A;  1GL2 A;  1AYI A;  2PNG A;  4BPG A;  2OQQ A;  1CZQ A;  2N6Z A;  3V2P A;  1SQV E;  1PEM A;  1ZXG A;  3H1H D;  1FDO A;  2KZJ A;  3B8E B;  3PJS K;  1HH0 A;  4AQR D;  5KAI E;  2LIU A;  2HOD B;  4HKG A;  2GZI A;  2B89 A;  1PEO A;  3CXH D;  3USS A;  4O9B A;  3SSU A;  2YIU B;  4WVZ A;  2ITA A;  3L74 D;  4H2W C;  3IF4 A;  1N7S B;  3DPH A;  1VQ5 P;  2M0B A;  1ZW0 A;  2E74 B;  1FJK A;  1LTA C;  4WY4 A;  4C7N A;  1DD4 A;  1NKZ B;  2K37 A;  4N3Y B;  3CCU P;  3L72 D;  3HYB A;  1N7S A;  1HY8 A;  4U0B A;  2ONT A;  1L0L G;  2GZJ A;  3W67 A;  1IFP A;  1L0N D;  2QJK C;  2QM8 A;  1N73 C;  1N8R Q;  1QX8 A;  4U0F A;  2HOD A;  1S5L H;  1CI6 B;  1YQ3 C;  5GTH E;  3P05 A;  1SQQ K;  5APU A;  2H89 C;  1GW4 A;  2GUS A;  5KP6 B;  1IZN B;  1KIL B;  3LW5 H;  2AXT E;  5KJ7 D;  4H0L D;  3JSV C;  3LID A;  3MGE A;  5AW9 B;  2X2B A;  1FS0 E;  3TNU B;  2FAE A;  1M90 Q;  3AEA C;  2IBZ G;  5GTI E;  2RMZ A;  4PXH B;  1OW6 A;  2XZ0 D;  2Q7C A;  2KGA A;  1PPJ E;  2JP3 A;  3LW5 J;  2M5R A;  3DS3 A;  1IO4 A;  2D2C B;  3K5B A;  1FZC C;  1RQU A;  2I8D A;  1FOS F;  1A02 J;  4I1L A;  1IK7 A;  3L70 G;  2POH A;  4OGQ D;  2WPV B;  1ZMB A;  2XXM A;  2Q3E A;  2FYU J;  1KFM A;  1T2K D;  4JQ0 D;  2AFD A;  3S1K A;  1JOC A;  1A43 A;  3DS4 A;  2KW2 A;  2HG5 D;  2BAS A;  1IK9 A;  2FKW B;  2FQ1 A;  4OWF A;  2WT7 B;  2NZ2 A;  4H2Y C;  2WMM A;  1ZLL A;  2D2C D;  4WBA A;  5AVQ B;  4DZO A;  2W6B A;  1FZG A;  1VF5 B;  3HUS B;  4H44 D;  4MRT C;  1JO5 A;  3EJD A;  3CCR P;  1YIT P;  1RHZ B;  3L74 J;  3B5N A;  4I6M C;  3VMZ A;  3KYQ A;  1VL2 A;  4U0D A;  1L0N K;  2E43 A;  2QVA A;  3B71 A;  1T3J A;  1BE3 E;  3KQG A;  3V2Q A;  2B9B A;  3M9Q A;  3E2D A;  2DNW A;  4WY4 D;  1CEI A;  2J58 A;  1RF1 A;  1J1E C;  2BCC J;  1TU3 F;  2XV5 A;  4U3F D;  3CX5 H;  2H8P D;  3MUD A;  1PIX A;  3FWL A;  4QKO A;  4PD4 E;  2KOQ A;  3H1K E;  5CJ0 A;  2N98 A;  1SQP J;  2Y0E A;  5B5E E;  3P32 A;  4RKU J;  1JM0 A;  2NO8 A;  2JAZ A;  1R5S A;  1Q2N A;  1RF0 C;  1NJI Q;  4LC1 A;  1BGY E;  1KIL C;  5AVW B;  2ZYA A;  2KGD A;  3CWB G;  3WUU A;  5C39 A;  1DX7 A;  2IBZ E;  2WPQ A;  2FVA A;  1NTM J;  4YXW H;  3SWK A;  2KOD A;  3EWK A;  1KN7 A;  1BXI A;  1NTM E;  1HBW A;  5I4T G;  1LWU B;  4IL6 X;  2XZ1 C;  2L22 A;  1AUM A;  1RO0 A;  1AA0 A;  5E79 H;  1SQV D;  1VKU A;  1NAY A;  1NO4 A;  1QLE D;  1KYO E;  3ITK A;  1JY2 P;  1X3O A;  1MZ9 A;  4GOE A;  3L72 J;  2M8L A;  1Z6M A;  2KLV A;  1Q81 Q;  1M7L A;  1NYH A;  3CCL P;  1HTL C;  5AVZ B;  1YI2 P;  1GL2 B;  2CK3 H;  1K8A Q;  7CEI A;  1LTT C;  2GDY A;  5KKZ B;  2OTK E;  5EJD A;  3H1H G;  4DJG A;  2WSC H;  3L73 G;  1RE4 A;  3H1H J;  5CCG C;  1AF8 A;  4JF7 A;  2XNX A;  1CI6 A;  2Y9Y A;  3L71 D;  2E75 C;  4IPY A;  1RY3 A;  5AW0 B;  3I5C A;  4DCK A;  1WMK A;  4XFJ A;  1OMI A;  5B5E H;  3T97 A;  4GOF A;  4IFF A;  3CX5 I;  3HD7 B;  1FU1 A;  1LTJ C;  3AE2 C;  3RK2 D;  1MFZ A;  2Z4E A;  2P2U A;  5APT A;  4ASV A;  3WMM 0;  4DG9 A;  2IZ0 A;  4NPF X;  5AW4 B;  2Z5I A;  2B87 B;  1VQM P;  2WSE J;  2OYO A;  1GPJ A;  4H13 B;  5AVS B;  3VMX A;  1R8E A;  2WPR A;  3KHU A;  2M3E A;  4OH8 B;  1WRG A;  1K04 A;  5AVU B;  3MHV A;  2BCC G;  1A02 F;  2CWO A;  1IFI A;  2W6A A;  4TT3 H;  2N1T A;  3CE7 A;  5F2O A;  1BCC D;  3RK3 E;  3H1I E;  3LMO A;  1SQX D;  3WU2 E;  2YO3 A;  1AVO A;  4XFZ A;  1LT9 B;  2PP6 A;  1NTK D;  1NU1 D;  1BSN A;  2W83 C;  3OJA B;  3CX5 D;  4L75 A;  2R5B A;  3G9R A;  1IFN A;  2KWL A; 
#chains in the Genus database with same CATH homology
 3DTJ A;  3CME P;  3G1I A;  2BHV A;  3DS1 A;  4XRQ A;  2EIA A;  1VQK P;  1JJ2 O;  4M0I A;  1VQO P;  1RNI A;  2EFJ A;  2PEO A;  3G28 A;  4QNB A;  1Q86 Q;  3MGE A;  2Z45 A;  2PEJ A;  1S72 P;  1M90 Q;  1BAJ A;  3DS5 A;  2E1M A;  3Q20 A;  1E6J P;  4IPY A;  2M8N A;  3G0V A;  2PY8 A;  3DS2 A;  5HGN A;  3CPW O;  4GR6 A;  1IUQ A;  1W2B O;  1VQ7 P;  2OTL P;  1A8O A;  1RO2 A;  1PEU A;  2BQ1 E;  3G6E P;  2LF4 A;  4WYM A;  3H47 A;  3DS3 A;  2QA4 P;  1NJI Q;  1VQ8 P;  4XRO A;  3H0D A;  1QVG O;  2PEN A;  3WBH A;  3LRY A;  1K73 Q;  1PEM A;  2L6E A;  2PEQ A;  3G26 A;  1ZMB A;  1KC8 Q;  3CC7 P;  2QEX P;  1VQ6 P;  1M6E X;  3CCE P;  1PEQ A;  2XXM A;  5BS1 A;  1QVF O;  1YJW P;  5HGO A;  2KOD A;  4COC A;  1PEO A;  3CC2 P;  5HGM A;  1EIA A;  5I4T G;  1VQM P;  3CC4 P;  2P9X A;  3G29 A;  1A43 A;  3DS4 A;  2M8P A;  4PH0 A;  3G1G A;  5F2K A;  1AUM A;  1RO0 A;  2OAR A;  4U0A A;  3DPH A;  3I56 P;  3CCS P;  1VQP P;  1VQ5 P;  3G4S P;  3H4E A;  1KQS O;  4COP A;  1KD1 Q;  3NTE A;  3HZQ A;  2PEM A;  3CXC O;  2JYL A;  3M1M A;  5BS2 A;  4U0E A;  5JPA A;  1YIJ P;  1D1D A;  2CWO A;  3I55 P;  2JYG A;  2XT1 A;  3G21 A;  4XFY A;  1K9M Q;  3B5I A;  4XFX A;  5F2O A;  3CCU P;  3HYB A;  1VQL P;  4GR2 A;  1K30 A;  1M74 A;  3CCR P;  1YIT P;  2OTJ P;  4U0B A;  2ONT A;  1YHQ P;  1M6N A;  1QRJ A;  2M8L A;  5DCK A;  2XV6 A;  2JO0 A;  4U0D A;  1Q81 Q;  2PEK A;  4XFZ A;  3CCL P;  1N8R Q;  4U0F A;  1M1K Q;  2Z46 A;  1YI2 P;  2BUO A;  3CCJ P;  3OW2 O;  5HGL A;  1VQN P;  3CMA P;  3CCM P;  1K8A Q;  1Q7Y Q;  3E2D A;  1EOQ A;  1YJN P;  3CD6 P;  4U0C A;  2EG5 A;  3RG6 C;  3DS0 A;  1VQ4 P;  1VQ9 P;  5F2N A;  3G71 P;  3VRL C;  1YJ9 P;  2Z44 A;  3P05 A;  2DGY A;  3CCV P;  2PEI A;  1Q82 Q;  4PH1 A;  3CCQ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...