1VQKP

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqkP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqkP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqkP02
1VQ4P 3G71P 1QVGO 1Q81Q 1K8AQ 1KQSO 3CC2P 3CC4P 1YI2P 1KC8Q 3CCQP 3CCMP 1YJNP 3G4SP 1YHQP 1M1KQ 1VQOP 1NJIQ 3CCLP 3CXCO 3OW2O 1Q86Q 1JJ2O 3CCRP 2QA4P 1K73Q 1M90Q 2OTJP 1YITP 1YJ9P 1VQ8P 1K9MQ 1VQ9P 1VQ6P 1VQPP 1VQ5P 3G6EP 1VQ7P 3CCJP 1YJWP 1S72P 3CCVP 1N8RQ 1VQKP 2OTLP 1Q82Q 3CMAP 3CD6P 3CCSP 3CMEP 3CPWO 3CCUP 1W2BO 2QEXP 3I56P 3I55P 3CC7P 1VQMP 3CCEP 1VQLP 1VQNP 1KD1Q 1QVFO 1Q7YQ 1YIJP
chains in the Genus database with same CATH superfamily
3PH0A 2PAJA 4D6TD 1ZP0C 3AE9C 1K73Q 1RHZB 4OH8B 3D6YA 2W6JH 5CJ4A 3RL0D 1URQD 1SQBE 3M1MA 4XRQA 2L91A 2MR8A 1NKNA 2JWAA 1G1IA 1FJPA 1PPJG 1NTKD 5HVCA 1GZLA 2NO8A 3AE2C 2VLQA 2KOSA 3RK3D 1NTZD 4HJGH 3U59A 1G2CA 2VLOA 1GDTA 1JM0A 2M8RA 1USEA 2E76D 1H89A 2KSJA 2WTYA 1L0IA 4XE5B 1FOSF 1R8EA 1GMJA 3L4FA 1OZHA 4H2YC 1QVGO 2WPRA 4OVNF 4NPEA 1VKUA 3CCLP 3V4WA 4H44C 2PRRA 2E74C 5DJTB 3R2PA 3L75D 5AW1B 3M91A 3WU2H 5KAFE 5CZDB 2N1TA 3M9HA 4U3FG 4GIFA 3CX5I 1BE3J 4BXLA 1LJ2A 3HD7C 5KJ7D 1G2CB 2DW3A 3RBXA 3CCRP 1IFPA 2KI7B 2PP6A 4ASVA 2WZ7A 4ZMDA 1L0LK 1X9VA 1OVRA 2M5AA 1W5CE 3AE5C 3P05A 1L4AC 3TGUD 1S5LX 1AUMA 1VQOP 2K88A 4L74A 2N1TB 2HR3A 1PP9E 1J1DC 3H1HJ 2N5IA 2NPSC 2W6BA 1BDDA 5E79H 2PEMA 1KQLA 2XDJA 3AE1C 4D6TE 4U0CA 1T6AA 2FYUD 2M8PA 4B86A 2GDYA 4MN4C 1CZQA 5APVA 3ABVC 1VQ9P 2M5AB 3VP8A 2FADA 5GTIH 1NTKE 1W2BO 4W80A 1NTZE 1BCCJ 1VHNA 2W90A 2QG4A 1KQSO 5BU5A 1JY3N 1RF1A 2O1KA 3CCQP 1OVVA 2FYNC 1HGZA 2KXPB 2WVRA 2IFMA 1GK6A 2A45I 3MHVA 1MZ8A 3H25A 3HRNA 1CW5A 2E5YA 1A02F 2WSEH 4CPGA 3CPWO 2FXMA 3OAKA 1SQQG 1SQPD 1IK9A 1HWTC 3L75E 2FQ0A 1Y8AA 3V2RA 1SQBJ 3FX0A 3RK2D 1NU1G 5AW5B 3EQ2A 3MZWB 4HYTB 2PEOA 3H1IJ 1RF1B 4C7NA 3PJSK 2KODA 4ASWA 1GW3A 2JP3A 2QJPB 1Y9BA 2E42A 1T8KA 1LTJA 1SQVK 4COPA 3BCCD 3L73G 3SWFA 2ZYDA 3JC22 2I1KA 3B5NA 1IUQA 3IFMA 2Y0CA 3TGUE 3CWBE 1LTTC 2ITAA 2H8PD 4KHXA 1EZVI 3GG2A 1N7SD 1FOSE 1NTMG 4HB1A 1U7MA 5KLVG 4BRYA 3BRVB 4C7NB 3AEGC 3OA7A 2N5HA 1VQ5P 4OGQD 3CCVP 2FYUE 5AVZB 3Q3DA 1LTJB 1QVFO 2K37A 5HGLA 2QIWA 3B5NB 3L74G 5CCGC 1VL2A 3MD0A 1EOQA 2YO3A 4C46A 2IYOA 2JWDA 4EIJA 4PH1A 2MVUA 3FXEA 2VLPA 3CMEP 1KILE 2KWLA 1DX7A 1PP9J 3LW5J 2QJKC 1YIJP 1KMIZ 4BRYB 1JO5A 4D6TJ 3OW2O 1LWUC 5AVVB 1NH4A 1SQPE 3HUSC 3RL0B 2O3JA 2V7QJ 1QX8A 2M5RA 1LGHB 3SWKA 2GZFA 3AE3C 3VTPC 4RESB 3M9QA 1JMBA 2WPVB 3TF5A 2IYPA 4HKGA 1NTKJ 3GF3A 1M57D 1L0LD 3RK3B 4UB6H 1NTZJ 3CX5E 1UIXA 3RL0C 3FWNA 1IMPA 1URQC 1JUNA 2FACA 1RNIA 3CLQA 1M6NA 2WSFH 2FKWB 3BCCE 2H7HA 4XFXA 4PJ0H 1OX3A 2E76C 4XFZA 1VPCA 3M0DC 1OVUA 3IN6A 2PY8A 2A06G 5AW8B 3M9BA 1J1EB 2JR8A 3L75J 2K0YA 2YIUB 4PV1D 4WYMA 1BGYD 2OYHC 3S9OA 4IOIH 3U43A 4ZKPA 1OW7A 1YI2P 3GF7A 2K93A 3WUUA 1PEQA 2BCCG 2N1TD 2IBZI 5KJ7C 2KG6A 5AVSB 1S5LE 2WPSA 2G3AA 2LKMA 2L22A 3L70G 3JCUE 2OYIC 3TGUJ 2WT7A 3CWBJ 1RE3A 4PXHB 1JY3O 4YXDC 1SFCD 5EFWB 2Y9ZA 3CXHI 4I7ZB 5APYA 2OTLP 1GU5A 4U0DA 2ONTA 5CMZA 2H43A 3RG6C 1LT9C 1YBKA 1K04A 1SQQK 2FYUJ 5HGMA 1IFNA 2WITA 4AUWA 2QNWA 3USSA 5HV8A 3KDPB 1ZLLA 4EDFA 1YJ9P 4QMAA 1NU1K 3AECC 3L37A 2KGCA 5CCHC 4WY4A 1SQVD 1L0LE 1VQMP 2WT7B 1YTZT 2K3RA 1QLED 1SQXG 2XU6A 4XFJA 2HFED 5TISH 5BU8B 1FAVA 2W6AA 2Q9IA 4UB8E 2FVEA 3AE8C 3AEDC 5KKZC 2Y9YA 2E1MA 2LXCB 2YO2A 5F2KA 4M3LA 1KILC 3D71A 1SQPJ 3AEBC 2E75C 1NVOA 1VF5D 1OWAA 5AW7B 5CJ0A 3DS1A 4WY4B 2VSQA 1HF9A 1EZVE 4Z1MH 5KLVK 2LIUA 1E6JP 2Z5IA 1A8OA 2MF4A 1PPJD 5B5EH 1H0TA 3E1IA 3E1RA 1SS1A 4L75A 2IPPA 4WWIA 3G29A 3H1HG 3V2QA 4Y99B 3RK2C 2L4BA 3Q1MA 3EFFK 3BCCJ 2POHA 3L71E 1AV1A 2M0BA 1ZOYC 5I4TG 4Y28J 2FYZA 2EG5A 3L72G 1S9KD 3KZIH 1DD3A 2CPBA 2CPSA 2CWOA 5B66H 2K94A 4U3FD 1H0TB 3CXCO 3B5ND 3CXHD 2CG5B 1M1JC 1DEBA 5AW3B 4DT0A 1DV5A 1N7SC 2JYGA 1N86A 4W7ZA 1USDA 2QJYB 2FFDC 3QH9A 1NGMB 2I1JA 1L0HA 2O1JA 3V2PA 1LTSC 1L0NG 4OGQC 1SQVE 5AW4B 1M90Q 3LMOA 4WBAA 1FZFA 1SQBG 3GZLA 1A43A 4BPGA 3M06A 3VMXA 1PEOA 3FGAD 3LIDA 3H1KE 3EJBA 4TLFA 4GR6A 1EDIA 1M7LA 3W67A 3G1GA 1GL2D 3RG2A 3MGNA 2ZXEB 3H1IE 1KB9I 4NEOA 2O01J 3GLMA 3I56P 3V6IA 1VQNP 1MV8A 4PD4H 1MUUA 5JPAA 1T2KD 2WSCJ 2YKPA 2IZ0A 1L0LJ 3DS0A 1E0HA 1PPJE 3GKLC 5GTHH 3C9IA 1NAFA 1YTZI 2YNYA 1F80D 4IL6H 4N3YB 2IBZE 2KGAA 1HUCA 1KYOI 2KOGA 2YMYA 3KYQA 3G26A 1SQQD 3H1LG 1SFCA 4PV1B 2R44A 2Y0EA 5CHXA 4ZNCA 1NU1D 2Z46A 3CXHE 2LIWA 1HBWA 2IFNA 3H4EA 3CI9A 4L73A 5TJHA 1EDJA 1IZNB 2JBGA 4PV1C 4U0EA 2L5GB 1K05A 1OIPA 2P9XA 1VQKP 1S4XA 1Q82Q 3L71J 5C39A 4QKOA 3L73D 2OYOA 1SQXK 2SPZA 2C9LY 1KC8Q 1RE4A 4R4LA 2N1TC 2KIKA 1P84H 1SFCB 2CNRA 5EW5E 5AW2B 2RMZA 1KFNA 4LLHA 3R4YA 3GHGA 1NTMD 1NTZG 1N73A 2AXCA 1R5LA 1SP4A 1QGKB 1LNQA 3II6A 3RK3E 5KLVD 1SFCC 2K2QA 3CCMP 1FDMA 2NZ2A 3H1JG 2RH0A 4GKGA 2ZJSE 2XNDH 3B8EB 1KB9D 2K0DX 2WPQA 4GT1A 1VDFA 3FWLA 1T8ZA 1SQVJ 5M1BA 3L74D 4R4MA 3VRLC 1N2DC 2FHSC 3GHGB 3BASA 3H1KJ 1IMQA 1N73B 2KG9A 1FZCA 1RO0A 4WY4D 2Y0DA 1Z6MA 2JDIH 2W8ZA 1HJBA 1NWQA 2AF8A 4H13B 2GM4A 2PEKA 1GU4A 3GHGC 1VF5B 1L2PA 3PHLA 1D1DA 1KYOD 3E2DA 1OXZA 4U7JA 1Q90D 5F2NA 4RKUJ 1NU1E 1VQ7P 3IF4A 3CWBG 1RF1C 4XA4A 2ZT9D 3GZMA 1GXGA 3P8CD 2EFJA 1IC2A 2QJPC 2J59M 3P32A 1WMKA 4M0IA 3CC2P 1DH3A 4JBZA 4K35A 1FZCB 1DNYA 3AEFC 3G0VA 3F5HA 5AVUB 2JEEA 1L0NK 1SLQA 3SWYA 1JY2P 2Z45A 1U57A 2OTKE 3C8VA 1EIAA 2KR5A 4YTPC 1PEUA 1ZV8A 1S1CX 1BSHA 3EFGA 4XFYA 5H2FE 2A06D 1QEXA 1YQ3C 2Q1KA 1MFTA 4JPZB 3SFDC 1NQ4A 2JO1A 3BVHA 1AJYA 1KTMA 1GL2A 2XV5A 1H88A 5KLVE 1AFOA 2KW2A 1LTJC 3A0HE 1K30A 3KPEA 2QE7H 2N6YA 4UHPB 1AF8A 2N98A 1KB9E 3B5NC 2BCCD 2VRSA 2EIAA 1YYCA 2QM7A 1SQPG 3L70D 4EYYQ 2ROQA 2JU2A 2PEIA 2WQYC 5KAFH 2I8DA 2KYVA 1TU3F 5KLIB 1S2EA 2J5UA 2AXTE 3TSIA 1GL2B 1M6EX 2JB0A 3WMM0 1NOHA 4N6JA 2D2CB 2H88C 2AVAA 3P7KA 3PLNA 2KZIA 2E74D 2GZIA 1KYOE 3F89A 1KD1Q 1PL5A 3AE6C 3V5BA 1VQ4P 4GOFA 3RK3C 5EJDA 2JU1A 1SVFA 2FQ1A 3P8CE 1AVOA 1SQXD 5CBOA 1P84D 3H47A 3LW5H 3Q5PA 1T2KC 4O9BA 1S3JA 1X79B 2PENA 1LTIC 1Q7YQ 2XXMA 3HZQA 4BPFA 4N78D 2L6EA 4U0AA 1PGPA 2V7QH 3H6PA 1J1EC 1E79H 1L4AD 2YIUC 3M0AA 1SQQJ 5AVYB 2Q7CA 2G8YA 3A3YB 1ZR2A 2KP8A 2KB7P 1ZXGA 2NPSD 1KN7A 3G1IA 3H32A 1NU1J 1NKZB 3EJDA 3VOPA 4LGDE 4EOTA 2C9NY 1AA0A 2ZAEB 4IZ6A 3K5BA 3PRJA 4RO0A 1CI6A 2QA4P 5DCKA 5KAIH 3H1HD 2BUOA 3WU2E 3N4XA 2BCCE 1T3UA 3IR9A 1FDOA 2A45G 3L73J 2JO0A 2LMLA 3EJEA 5AVTB 3NTEA 3JSVC 4IFDK 2K5XA 2V4HA 1RO2A 1BDCA 3L72D 1PGOA 1EC5A 2KOOA 2PEQA 3FXDA 2QVAA 3TDKA 2ZVOB 4I7ZC 1R5SA 4JYBA 2XZ0D 3A5TA 3H32B 3U1CA 2K92A 4H0LB 4GOEA 1NTMJ 4H2WC 4KT0J 3Q5RA 5KLVJ 5APSA 1CI6B 3B4QA 2XZRA 2NRGA 1Y47A 1T3JA 1BE3G 1FZAA 1LTGC 2FY8A 2ERHA 5E79E 1M8OB 1RE3C 1L0ND 2PEJA 2H89C 3HYBA 4H13D 3C1LA 1SQXE 1HJ0A 1SQBD 2PFXA 3HE4A 3G4SP 1NTMK 2N9YB 3NTNA 1EZVG 1BGYE 2OARA 2E5TA 1ZMBA 3O8ZA 3LRYA 5GTIE 2MY5A 4L76A 4N78E 2FAEA 4COCA 3MUDA 2N6ZA 1GK4A 5BS1A 2X2BA 3L71G 3KQGA 4OWFA 1EXIA 4WY4C 4R0MA 1M56D 1YJNP 1WRGA 5APXA 3NXSA 2W83C 2ZT9B 2LTEA 2MR7A 3GJNA 1RQVA 1ACPA 2KLVA 1VQLP 4Y99C 1GXHA 1KQFB 3HE4B 4GDOA 1KQGB 3DPHA 3RGUA 1FR2A 2LPKA 2B9BA 3DS5A 1BCCG 3HTKA 2MJZA 5CCGD 1N8RQ 2Z4EA 3L72E 1D7MA 3HE5A 4BPHA 3AE7C 1W2EA 2JAZA 3WBHA 3H1LD 4I1LA 2L0QA 3G28A 3SSUA 3MUDC 2KOPA 1EMVA 1ZNVA 2R32A 3CX5H 3DS4A 3P8MC 3DS2A 1WT6A 1MFZA 1QL2A 3CCJP 2IZ1A 3O6QA 3H1KG 2QJYC 4KJMA 3CCSP 1AVYA 3E7KA 2YKOA 4U0BA 3LIEA 1ZRTD 2BCCJ 3HTKB 1UIIA 2M3EA 3H1IG 4F37A 2R3SA 2VLNA 1GTWA 2J58A 1X3OA 1L0NE 3A0BH 3HD7A 1YITP 3L70J 3VMYA 5AW0B 1FZEA 3HE5B 2D2CD 4I2LC 5HGOA 2EHSA 2KG8A 2HG5D 1GPJA 3CCUP 1HY8A 1KORA 3VP9A 5AW9B 2AEJA 2AFDA 3TK1A 3G21A 4XROA 5KP6B 1NJIQ 3O6QB 4W7YA 1JCCA 2GUSA 1EQ7A 3TNUA 4PH0A 1KZUB 2ZFCA 4H44B 2E74B 1L4AA 2GUVA 5AVQB 2MVVA 4JYCA 3H1JD 2KLUA 1S5LH 2IBZG 2YXRB 3V4QA 2NPSA 3HD7B 3JCUH 3SFEC 2BEZF 1S9KE 1KFMA 1QRJA 2BASA 3VMAA 1SQXJ 5AVWB 1CEIA 1BXIA 3OJAB 1BGYJ 2JKVA 2P2UA 4U3FE 1IFDA 1OMIA 1LT1A 2WWWA 2A45H 3TNUB 4UB6E 2P58A 5BS2A 2GZJA 1M1KQ 1L4AB 4DG9A 1PP9G 4JQ0D 2GDXA 3WUVA 2O01H 2HPCA 2HODA 2N50A 1UJZA 3RBZA 1NAYA 3H1LE 2LR2A 1J1DB 2NPSB 4D6TG 2WSCH 2WSEJ 1E5WA 3MIWA 2P1JA 4DOJA 2KORA 4PJ0E 1EXJA 1FBMA 2FXPA 4PWVB 3CWBD 3IAOA 4PD4I 1FU1A 4IL6X 1JJ2O 2R5DA 4UB8H 4HH2A 1ZRTE 1LP1A 4NPDA 4JF7A 1NTKG 4GR2A 4H0LD 2CGQA 5CCHD 2M8LA 1JTHA 1PZQA 2DNWA 3L72J 2HPCB 1HH0A 2HODB 1IK7A 2R5BA 2LL8A 2FYNB 3L36A 3WUTA 2B87A 1ZMEC 1VQ8P 1GW4A 3GW6A 3A7OA 1S72P 2MD9A 2M8NA 2Z44A 1RF0A 1GD2E 3L75G 4NPFX 3G71P 2GZGA 3KXDA 1KILD 1X8YA 2IDBA 1LP1B 2EHTA 4IFFA 1XTGB 5KAIE 2E75D 3H1JE 2K9YA 1RE4C 1JTHB 2PNGA 1L0NJ 3CCEP 4WVZA 4U0FA 1ZR4A 5CBNA 2LXBA 5APQA 5AW6B 1K8AQ 2XT1A 2B87B 1SQQE 1N73C 1JY2N 4YPCA 2B89A 2ZXXA 4ZKUA 3AE4C 1FE6A 1JY3P 5AVRB 3N7NA 4H13C 1NO4A 1P84I 3TGUG 1JNMA 3CX5D 5CCGA 1PV3A 4C7RA 1VF5C 2C0WA 5TISE 3CC4P 1HGVA 2C0XA 1RF0C 2AEMA 3L73E 2FYUG 1JB0J 1BSNA 3CMAP 3CD6P 2FXOA 1OR5A 3I55P 1SQBK 3S4RA 4DCKA 1LWUA 1QL1A 1FZCC 3L35A 3HUSA 3W68A 2WSSH 2OQQA 4PD4D 1YHQP 1NTME 5HGNA 4U3FJ 3A2AA 4WB4A 5B5EE 2P7JA 2Q3EA 1DD4A 2MKVA 1IFMA 4DJGA 1JCDA 5APUA 2UWJE 1AYIA 1HVVA 1IO4A 1OFCX 1URQA 1IJDB 2QRXA 4EI2A 2XV6A 3H1LJ 2WSFJ 2QJKB 4YXWH 5KTBA 2FVFA 5AVXB 1H8AA 3L74E 4IFMA 1JEKA 1OW8A 2KGDA 3KZIE 1LWUB 1NHLA 1YJWP 4AQRD 1OW6A 2CQ8A 3HUSB 2KK7A 3ZDMA 3M0DA 5B66E 1FS0E 1X22A 4DZOA 5K5GB 3D70A 2OYHA 1DEEG 2K9JA 1RY3A 3NY7B 5KP7B 1URQB 1PGQA 3BCCG 4I6MC 5KLIC 4H44D 5L8RJ 2HLOA 3RL0g 2XKMA 1GL2C 5F2OA 1RH5B 3CXHH 5KJ7A 1M74A 2YMKA 3HD7D 3D6ZA 1HQBA 2D2CC 2WMMA 3H0DA 2E76B 2Q3IA 1J2JB 1AQ5A 2OYIA 4AYCA 1X0TA 2GA1A 5KP8B 2FBWC 3H1JJ 2KGEA 1BE3D 1JMMA 2OYHB 2K9JB 4K3AA 3DS3A 3Q2YA 1IFIA 3A0BE 1YQ4C 5BVZA 1LT9A 3MTUE 2WPTA 2LF4A 1NTKK 2A06E 2GDWA 4QNBA 4PD4E 1NTZK 1EZVD 5DJUB 2K0XA 3S1KA 2KZJA 5CCHA 3AEEC 2OYIB 1BAJA 5GTHE 3B71A 3MP7B 1PGJA 1Q86Q 3B4SA 3GMAA 2BHVA 2JJLA 3TYYA 5APTA 3L71D 1JOCA 2W27A 1CSBA 1FDIA 3Q20A 2QM8A 2QEXP 2GZEA 1U7JA 3PTZA 1IFJA 1LTAC 4RJTA 4IL6E 2ZYAA 3V2NA 3ITKA 3L70E 2KNCA 3DTJA 3CE7A 1LT9B 2YKQA 1FC2C 2DGYA 1KV4A 1KILA 1EDKA 1NYHA 1L0LG 2ZYGA 7CEIA 4HKZH 1FZGA 3VMZA 2KUBA 2KS1A 4TT3H 1BCCD 2B88A 3B5IA 3NFQA 2P10A 2YXQB 1G1JA 2JGPA 1JY2O 4H0LC 2HYNA 2P67A 5KKZB 3VN0A 2BQ1E 2KNCB 1ZW0A 3L74J 2XZ1C 2RKLA 2LOLA 1KILB 1P84E 2JYLA 2KSEA 1BGYG 2E75B 3H1KD 2FQ2A 1BE3E 4A7PA 1K9MQ 2Q5UA 2KS1B 1VQPP 2ZVNB 1KLPA 2FYUK 3BRTB 2PGDA 1ZN5A 3T97A 3QWOC 3H1ID 3G9RA 2K1AA 4GODA 2RN0A 1UNKA 3U1AA 1M1JA 5H2FH 1N7SA 3RK2B 3BATA 2IX7C 2L9FA 1HTLC 3VYIA 1VQ6P 2FFDA 3G6EP 1EDLA 2E43A 5APWA 3PP5A 3EWKA 4MRTC 1AQTA 3CC7P 1Q2NA 1N7LA 3A0HH 2JQ4A 2AFEA 2O01N 1PEMA 1Q81Q 2QSIA 3H1HE 1PIXA 1KB9H 2Z5HA 4LC1A 2CK3H 3T97B 3Q5SA 2Q6QA 3NMDA 2M3BA 2ZT9C 2N9BA 1MKMA 1PFIA 3MGEA 3KHUA 1SQPK 2R3CA 3I5CA 2IBZD 1Z56A 2AEFA 1M1JB 1XTCC 4BWNA 2OGUA 1N7SB 4CA3A 2GYKA 3CL3D 1RQUA 1DIPA 2KOQA 1SQVG 2FFDB 2AXTH 2BEQD 1A02J 1LTBC 3G3ZA 1MZ9A 2OTJP 1FZBA 4H2XC 4OGQB 1BCCE 3AEAC 2FVAA 2LKIA 4IPYA 3UIAA 2XNXA 1PP9D 1KYOH 1FJKA
chains in the Genus database with same CATH topology
3P05A 5BS1A 3VRLC 5HGMA 3DS3A 2JYLA 3G21A 4XROA 1AUMA 1YJNP 4COPA 1YHQP 2EIAA 1VQOP 1NJIQ 3CXCO 5HGNA 2QA4P 2CWOA 5DCKA 1K73Q 1YJ9P 2BUOA 4PH0A 1K9MQ 1VQ8P 1RO0A 3G26A 1VQPP 1IUQA 1RNIA 2LF4A 1S72P 2PEIA 2JYGA 2M8NA 2PEMA 4QNBA 1M6NA 2Z44A 1VQMP 1VQLP 2JO0A 2PEKA 3M1MA 4XRQA 3NTEA 4U0CA 2Z46A 3DPHA 4XFXA 3G71P 2XV6A 3H4EA 1RO2A 1M6EX 2M8PA 1D1DA 1BAJA 2PEQA 3E2DA 4XFZA 3DS5A 1Q86Q 1M90Q 1QRJA 4U0EA 5F2NA 2BHVA 2E1MA 1VQ9P 2PY8A 1VQ6P 1VQ5P 1VQ7P 3G6EP 2P9XA 1YJWP 3CCVP 1N8RQ 1VQKP 1A43A 5F2KA 1Q82Q 4WYMA 3Q20A 1W2BO 1PEOA 2QEXP 3CC7P 2EFJA 3CCEP 4U0FA 1KD1Q 1QVFO 1PEMA 1VQ4P 3WBHA 1QVGO 1K8AQ 4M0IA 1Q81Q 1KQSO 2XT1A 4GR6A 3CC2P 3DTJA 1YI2P 3CCQP 1KC8Q 5HGLA 3G1GA 3G28A 5BS2A 1M1KQ 3G0VA 2DGYA 1EOQA 3CCLP 3DS1A 1PEQA 3DS4A 3MGEA 3DS2A 2Z45A 1E6JP 3H47A 1A8OA 4PH1A 3CCJP 1EIAA 3CCSP 3CMEP 3CPWO 1PEUA 3I56P 2PEJA 2PENA 1VQNP 3G29A 3HYBA 4U0BA 1Q7YQ 1YIJP 2XXMA 4XFYA 5JPAA 3HZQA 3B5IA 5F2OA 3CC4P 2L6EA 1M74A 4U0AA 3CCMP 3DS0A 3G4SP 3H0DA 3OW2O 1JJ2O 2OARA 3CCRP 2OTJP 1ZMBA 5I4TG 1YITP 3LRYA 2EG5A 2BQ1E 4IPYA 5HGOA 4U0DA 4GR2A 2OTLP 2ONTA 3CMAP 2PEOA 3CD6P 3CCUP 1K30A 3I55P 4COCA 3G1IA 2M8LA 3RG6C 2KODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 P;  3G71 P;  1QVG O;  1Q81 Q;  1K8A Q;  1KQS O;  3CC2 P;  3CC4 P;  1YI2 P;  1KC8 Q;  3CCQ P;  3CCM P;  1YJN P;  3G4S P;  1YHQ P;  1M1K Q;  1VQO P;  1NJI Q;  3CCL P;  3CXC O;  3OW2 O;  1Q86 Q;  1JJ2 O;  3CCR P;  2QA4 P;  1K73 Q;  1M90 Q;  2OTJ P;  1YIT P;  1YJ9 P;  1VQ8 P;  1K9M Q;  1VQ9 P;  1VQ6 P;  1VQP P;  1VQ5 P;  3G6E P;  1VQ7 P;  3CCJ P;  1YJW P;  1S72 P;  3CCV P;  1N8R Q;  1VQK P;  2OTL P;  1Q82 Q;  3CMA P;  3CD6 P;  3CCS P;  3CME P;  3CPW O;  3CCU P;  1W2B O;  2QEX P;  3I56 P;  3I55 P;  3CC7 P;  1VQM P;  3CCE P;  1VQL P;  1VQN P;  1KD1 Q;  1QVF O;  1Q7Y Q;  1YIJ P; 
#chains in the Genus database with same CATH topology
 3PH0 A;  2PAJ A;  4D6T D;  1ZP0 C;  3AE9 C;  1K73 Q;  1RHZ B;  4OH8 B;  3D6Y A;  2W6J H;  5CJ4 A;  3RL0 D;  1URQ D;  1SQB E;  3M1M A;  4XRQ A;  2L91 A;  2MR8 A;  1NKN A;  2JWA A;  1G1I A;  1FJP A;  1PPJ G;  1NTK D;  5HVC A;  1GZL A;  2NO8 A;  3AE2 C;  2VLQ A;  2KOS A;  3RK3 D;  1NTZ D;  4HJG H;  3U59 A;  1G2C A;  2VLO A;  1GDT A;  1JM0 A;  2M8R A;  1USE A;  2E76 D;  1H89 A;  2KSJ A;  2WTY A;  1L0I A;  4XE5 B;  1FOS F;  1R8E A;  1GMJ A;  3L4F A;  1OZH A;  4H2Y C;  1QVG O;  2WPR A;  4OVN F;  4NPE A;  1VKU A;  3CCL P;  3V4W A;  4H44 C;  2PRR A;  2E74 C;  5DJT B;  3R2P A;  3L75 D;  5AW1 B;  3M91 A;  3WU2 H;  5KAF E;  5CZD B;  2N1T A;  3M9H A;  4U3F G;  4GIF A;  3CX5 I;  1BE3 J;  4BXL A;  1LJ2 A;  3HD7 C;  5KJ7 D;  1G2C B;  2DW3 A;  3RBX A;  3CCR P;  1IFP A;  2KI7 B;  2PP6 A;  4ASV A;  2WZ7 A;  4ZMD A;  1L0L K;  1X9V A;  1OVR A;  2M5A A;  1W5C E;  3AE5 C;  3P05 A;  1L4A C;  3TGU D;  1S5L X;  1AUM A;  1VQO P;  2K88 A;  4L74 A;  2N1T B;  2HR3 A;  1PP9 E;  1J1D C;  3H1H J;  2N5I A;  2NPS C;  2W6B A;  1BDD A;  5E79 H;  2PEM A;  1KQL A;  2XDJ A;  3AE1 C;  4D6T E;  4U0C A;  1T6A A;  2FYU D;  2M8P A;  4B86 A;  2GDY A;  4MN4 C;  1CZQ A;  5APV A;  3ABV C;  1VQ9 P;  2M5A B;  3VP8 A;  2FAD A;  5GTI H;  1NTK E;  1W2B O;  4W80 A;  1NTZ E;  1BCC J;  1VHN A;  2W90 A;  2QG4 A;  1KQS O;  5BU5 A;  1JY3 N;  1RF1 A;  2O1K A;  3CCQ P;  1OVV A;  2FYN C;  1HGZ A;  2KXP B;  2WVR A;  2IFM A;  1GK6 A;  2A45 I;  3MHV A;  1MZ8 A;  3H25 A;  3HRN A;  1CW5 A;  2E5Y A;  1A02 F;  2WSE H;  4CPG A;  3CPW O;  2FXM A;  3OAK A;  1SQQ G;  1SQP D;  1IK9 A;  1HWT C;  3L75 E;  2FQ0 A;  1Y8A A;  3V2R A;  1SQB J;  3FX0 A;  3RK2 D;  1NU1 G;  5AW5 B;  3EQ2 A;  3MZW B;  4HYT B;  2PEO A;  3H1I J;  1RF1 B;  4C7N A;  3PJS K;  2KOD A;  4ASW A;  1GW3 A;  2JP3 A;  2QJP B;  1Y9B A;  2E42 A;  1T8K A;  1LTJ A;  1SQV K;  4COP A;  3BCC D;  3L73 G;  3SWF A;  2ZYD A;  3JC2 2;  2I1K A;  3B5N A;  1IUQ A;  3IFM A;  2Y0C A;  3TGU E;  3CWB E;  1LTT C;  2ITA A;  2H8P D;  4KHX A;  1EZV I;  3GG2 A;  1N7S D;  1FOS E;  1NTM G;  4HB1 A;  1U7M A;  5KLV G;  4BRY A;  3BRV B;  4C7N B;  3AEG C;  3OA7 A;  2N5H A;  1VQ5 P;  4OGQ D;  3CCV P;  2FYU E;  5AVZ B;  3Q3D A;  1LTJ B;  1QVF O;  2K37 A;  5HGL A;  2QIW A;  3B5N B;  3L74 G;  5CCG C;  1VL2 A;  3MD0 A;  1EOQ A;  2YO3 A;  4C46 A;  2IYO A;  2JWD A;  4EIJ A;  4PH1 A;  2MVU A;  3FXE A;  2VLP A;  3CME P;  1KIL E;  2KWL A;  1DX7 A;  1PP9 J;  3LW5 J;  2QJK C;  1YIJ P;  1KMI Z;  4BRY B;  1JO5 A;  4D6T J;  3OW2 O;  1LWU C;  5AVV B;  1NH4 A;  1SQP E;  3HUS C;  3RL0 B;  2O3J A;  2V7Q J;  1QX8 A;  2M5R A;  1LGH B;  3SWK A;  2GZF A;  3AE3 C;  3VTP C;  4RES B;  3M9Q A;  1JMB A;  2WPV B;  3TF5 A;  2IYP A;  4HKG A;  1NTK J;  3GF3 A;  1M57 D;  1L0L D;  3RK3 B;  4UB6 H;  1NTZ J;  3CX5 E;  1UIX A;  3RL0 C;  3FWN A;  1IMP A;  1URQ C;  1JUN A;  2FAC A;  1RNI A;  3CLQ A;  1M6N A;  2WSF H;  2FKW B;  3BCC E;  2H7H A;  4XFX A;  4PJ0 H;  1OX3 A;  2E76 C;  4XFZ A;  1VPC A;  3M0D C;  1OVU A;  3IN6 A;  2PY8 A;  2A06 G;  5AW8 B;  3M9B A;  1J1E B;  2JR8 A;  3L75 J;  2K0Y A;  2YIU B;  4PV1 D;  4WYM A;  1BGY D;  2OYH C;  3S9O A;  4IOI H;  3U43 A;  4ZKP A;  1OW7 A;  1YI2 P;  3GF7 A;  2K93 A;  3WUU A;  1PEQ A;  2BCC G;  2N1T D;  2IBZ I;  5KJ7 C;  2KG6 A;  5AVS B;  1S5L E;  2WPS A;  2G3A A;  2LKM A;  2L22 A;  3L70 G;  3JCU E;  2OYI C;  3TGU J;  2WT7 A;  3CWB J;  1RE3 A;  4PXH B;  1JY3 O;  4YXD C;  1SFC D;  5EFW B;  2Y9Z A;  3CXH I;  4I7Z B;  5APY A;  2OTL P;  1GU5 A;  4U0D A;  2ONT A;  5CMZ A;  2H43 A;  3RG6 C;  1LT9 C;  1YBK A;  1K04 A;  1SQQ K;  2FYU J;  5HGM A;  1IFN A;  2WIT A;  4AUW A;  2QNW A;  3USS A;  5HV8 A;  3KDP B;  1ZLL A;  4EDF A;  1YJ9 P;  4QMA A;  1NU1 K;  3AEC C;  3L37 A;  2KGC A;  5CCH C;  4WY4 A;  1SQV D;  1L0L E;  1VQM P;  2WT7 B;  1YTZ T;  2K3R A;  1QLE D;  1SQX G;  2XU6 A;  4XFJ A;  2HFE D;  5TIS H;  5BU8 B;  1FAV A;  2W6A A;  2Q9I A;  4UB8 E;  2FVE A;  3AE8 C;  3AED C;  5KKZ C;  2Y9Y A;  2E1M A;  2LXC B;  2YO2 A;  5F2K A;  4M3L A;  1KIL C;  3D71 A;  1SQP J;  3AEB C;  2E75 C;  1NVO A;  1VF5 D;  1OWA A;  5AW7 B;  5CJ0 A;  3DS1 A;  4WY4 B;  2VSQ A;  1HF9 A;  1EZV E;  4Z1M H;  5KLV K;  2LIU A;  1E6J P;  2Z5I A;  1A8O A;  2MF4 A;  1PPJ D;  5B5E H;  1H0T A;  3E1I A;  3E1R A;  1SS1 A;  4L75 A;  2IPP A;  4WWI A;  3G29 A;  3H1H G;  3V2Q A;  4Y99 B;  3RK2 C;  2L4B A;  3Q1M A;  3EFF K;  3BCC J;  2POH A;  3L71 E;  1AV1 A;  2M0B A;  1ZOY C;  5I4T G;  4Y28 J;  2FYZ A;  2EG5 A;  3L72 G;  1S9K D;  3KZI H;  1DD3 A;  2CPB A;  2CPS A;  2CWO A;  5B66 H;  2K94 A;  4U3F D;  1H0T B;  3CXC O;  3B5N D;  3CXH D;  2CG5 B;  1M1J C;  1DEB A;  5AW3 B;  4DT0 A;  1DV5 A;  1N7S C;  2JYG A;  1N86 A;  4W7Z A;  1USD A;  2QJY B;  2FFD C;  3QH9 A;  1NGM B;  2I1J A;  1L0H A;  2O1J A;  3V2P A;  1LTS C;  1L0N G;  4OGQ C;  1SQV E;  5AW4 B;  1M90 Q;  3LMO A;  4WBA A;  1FZF A;  1SQB G;  3GZL A;  1A43 A;  4BPG A;  3M06 A;  3VMX A;  1PEO A;  3FGA D;  3LID A;  3H1K E;  3EJB A;  4TLF A;  4GR6 A;  1EDI A;  1M7L A;  3W67 A;  3G1G A;  1GL2 D;  3RG2 A;  3MGN A;  2ZXE B;  3H1I E;  1KB9 I;  4NEO A;  2O01 J;  3GLM A;  3I56 P;  3V6I A;  1VQN P;  1MV8 A;  4PD4 H;  1MUU A;  5JPA A;  1T2K D;  2WSC J;  2YKP A;  2IZ0 A;  1L0L J;  3DS0 A;  1E0H A;  1PPJ E;  3GKL C;  5GTH H;  3C9I A;  1NAF A;  1YTZ I;  2YNY A;  1F80 D;  4IL6 H;  4N3Y B;  2IBZ E;  2KGA A;  1HUC A;  1KYO I;  2KOG A;  2YMY A;  3KYQ A;  3G26 A;  1SQQ D;  3H1L G;  1SFC A;  4PV1 B;  2R44 A;  2Y0E A;  5CHX A;  4ZNC A;  1NU1 D;  2Z46 A;  3CXH E;  2LIW A;  1HBW A;  2IFN A;  3H4E A;  3CI9 A;  4L73 A;  5TJH A;  1EDJ A;  1IZN B;  2JBG A;  4PV1 C;  4U0E A;  2L5G B;  1K05 A;  1OIP A;  2P9X A;  1VQK P;  1S4X A;  1Q82 Q;  3L71 J;  5C39 A;  4QKO A;  3L73 D;  2OYO A;  1SQX K;  2SPZ A;  2C9L Y;  1KC8 Q;  1RE4 A;  4R4L A;  2N1T C;  2KIK A;  1P84 H;  1SFC B;  2CNR A;  5EW5 E;  5AW2 B;  2RMZ A;  1KFN A;  4LLH A;  3R4Y A;  3GHG A;  1NTM D;  1NTZ G;  1N73 A;  2AXC A;  1R5L A;  1SP4 A;  1QGK B;  1LNQ A;  3II6 A;  3RK3 E;  5KLV D;  1SFC C;  2K2Q A;  3CCM P;  1FDM A;  2NZ2 A;  3H1J G;  2RH0 A;  4GKG A;  2ZJS E;  2XND H;  3B8E B;  1KB9 D;  2K0D X;  2WPQ A;  4GT1 A;  1VDF A;  3FWL A;  1T8Z A;  1SQV J;  5M1B A;  3L74 D;  4R4M A;  3VRL C;  1N2D C;  2FHS C;  3GHG B;  3BAS A;  3H1K J;  1IMQ A;  1N73 B;  2KG9 A;  1FZC A;  1RO0 A;  4WY4 D;  2Y0D A;  1Z6M A;  2JDI H;  2W8Z A;  1HJB A;  1NWQ A;  2AF8 A;  4H13 B;  2GM4 A;  2PEK A;  1GU4 A;  3GHG C;  1VF5 B;  1L2P A;  3PHL A;  1D1D A;  1KYO D;  3E2D A;  1OXZ A;  4U7J A;  1Q90 D;  5F2N A;  4RKU J;  1NU1 E;  1VQ7 P;  3IF4 A;  3CWB G;  1RF1 C;  4XA4 A;  2ZT9 D;  3GZM A;  1GXG A;  3P8C D;  2EFJ A;  1IC2 A;  2QJP C;  2J59 M;  3P32 A;  1WMK A;  4M0I A;  3CC2 P;  1DH3 A;  4JBZ A;  4K35 A;  1FZC B;  1DNY A;  3AEF C;  3G0V A;  3F5H A;  5AVU B;  2JEE A;  1L0N K;  1SLQ A;  3SWY A;  1JY2 P;  2Z45 A;  1U57 A;  2OTK E;  3C8V A;  1EIA A;  2KR5 A;  4YTP C;  1PEU A;  1ZV8 A;  1S1C X;  1BSH A;  3EFG A;  4XFY A;  5H2F E;  2A06 D;  1QEX A;  1YQ3 C;  2Q1K A;  1MFT A;  4JPZ B;  3SFD C;  1NQ4 A;  2JO1 A;  3BVH A;  1AJY A;  1KTM A;  1GL2 A;  2XV5 A;  1H88 A;  5KLV E;  1AFO A;  2KW2 A;  1LTJ C;  3A0H E;  1K30 A;  3KPE A;  2QE7 H;  2N6Y A;  4UHP B;  1AF8 A;  2N98 A;  1KB9 E;  3B5N C;  2BCC D;  2VRS A;  2EIA A;  1YYC A;  2QM7 A;  1SQP G;  3L70 D;  4EYY Q;  2ROQ A;  2JU2 A;  2PEI A;  2WQY C;  5KAF H;  2I8D A;  2KYV A;  1TU3 F;  5KLI B;  1S2E A;  2J5U A;  2AXT E;  3TSI A;  1GL2 B;  1M6E X;  2JB0 A;  3WMM 0;  1NOH A;  4N6J A;  2D2C B;  2H88 C;  2AVA A;  3P7K A;  3PLN A;  2KZI A;  2E74 D;  2GZI A;  1KYO E;  3F89 A;  1KD1 Q;  1PL5 A;  3AE6 C;  3V5B A;  1VQ4 P;  4GOF A;  3RK3 C;  5EJD A;  2JU1 A;  1SVF A;  2FQ1 A;  3P8C E;  1AVO A;  1SQX D;  5CBO A;  1P84 D;  3H47 A;  3LW5 H;  3Q5P A;  1T2K C;  4O9B A;  1S3J A;  1X79 B;  2PEN A;  1LTI C;  1Q7Y Q;  2XXM A;  3HZQ A;  4BPF A;  4N78 D;  2L6E A;  4U0A A;  1PGP A;  2V7Q H;  3H6P A;  1J1E C;  1E79 H;  1L4A D;  2YIU C;  3M0A A;  1SQQ J;  5AVY B;  2Q7C A;  2G8Y A;  3A3Y B;  1ZR2 A;  2KP8 A;  2KB7 P;  1ZXG A;  2NPS D;  1KN7 A;  3G1I A;  3H32 A;  1NU1 J;  1NKZ B;  3EJD A;  3VOP A;  4LGD E;  4EOT A;  2C9N Y;  1AA0 A;  2ZAE B;  4IZ6 A;  3K5B A;  3PRJ A;  4RO0 A;  1CI6 A;  2QA4 P;  5DCK A;  5KAI H;  3H1H D;  2BUO A;  3WU2 E;  3N4X A;  2BCC E;  1T3U A;  3IR9 A;  1FDO A;  2A45 G;  3L73 J;  2JO0 A;  2LML A;  3EJE A;  5AVT B;  3NTE A;  3JSV C;  4IFD K;  2K5X A;  2V4H A;  1RO2 A;  1BDC A;  3L72 D;  1PGO A;  1EC5 A;  2KOO A;  2PEQ A;  3FXD A;  2QVA A;  3TDK A;  2ZVO B;  4I7Z C;  1R5S A;  4JYB A;  2XZ0 D;  3A5T A;  3H32 B;  3U1C A;  2K92 A;  4H0L B;  4GOE A;  1NTM J;  4H2W C;  4KT0 J;  3Q5R A;  5KLV J;  5APS A;  1CI6 B;  3B4Q A;  2XZR A;  2NRG A;  1Y47 A;  1T3J A;  1BE3 G;  1FZA A;  1LTG C;  2FY8 A;  2ERH A;  5E79 E;  1M8O B;  1RE3 C;  1L0N D;  2PEJ A;  2H89 C;  3HYB A;  4H13 D;  3C1L A;  1SQX E;  1HJ0 A;  1SQB D;  2PFX A;  3HE4 A;  3G4S P;  1NTM K;  2N9Y B;  3NTN A;  1EZV G;  1BGY E;  2OAR A;  2E5T A;  1ZMB A;  3O8Z A;  3LRY A;  5GTI E;  2MY5 A;  4L76 A;  4N78 E;  2FAE A;  4COC A;  3MUD A;  2N6Z A;  1GK4 A;  5BS1 A;  2X2B A;  3L71 G;  3KQG A;  4OWF A;  1EXI A;  4WY4 C;  4R0M A;  1M56 D;  1YJN P;  1WRG A;  5APX A;  3NXS A;  2W83 C;  2ZT9 B;  2LTE A;  2MR7 A;  3GJN A;  1RQV A;  1ACP A;  2KLV A;  1VQL P;  4Y99 C;  1GXH A;  1KQF B;  3HE4 B;  4GDO A;  1KQG B;  3DPH A;  3RGU A;  1FR2 A;  2LPK A;  2B9B A;  3DS5 A;  1BCC G;  3HTK A;  2MJZ A;  5CCG D;  1N8R Q;  2Z4E A;  3L72 E;  1D7M A;  3HE5 A;  4BPH A;  3AE7 C;  1W2E A;  2JAZ A;  3WBH A;  3H1L D;  4I1L A;  2L0Q A;  3G28 A;  3SSU A;  3MUD C;  2KOP A;  1EMV A;  1ZNV A;  2R32 A;  3CX5 H;  3DS4 A;  3P8M C;  3DS2 A;  1WT6 A;  1MFZ A;  1QL2 A;  3CCJ P;  2IZ1 A;  3O6Q A;  3H1K G;  2QJY C;  4KJM A;  3CCS P;  1AVY A;  3E7K A;  2YKO A;  4U0B A;  3LIE A;  1ZRT D;  2BCC J;  3HTK B;  1UII A;  2M3E A;  3H1I G;  4F37 A;  2R3S A;  2VLN A;  1GTW A;  2J58 A;  1X3O A;  1L0N E;  3A0B H;  3HD7 A;  1YIT P;  3L70 J;  3VMY A;  5AW0 B;  1FZE A;  3HE5 B;  2D2C D;  4I2L C;  5HGO A;  2EHS A;  2KG8 A;  2HG5 D;  1GPJ A;  3CCU P;  1HY8 A;  1KOR A;  3VP9 A;  5AW9 B;  2AEJ A;  2AFD A;  3TK1 A;  3G21 A;  4XRO A;  5KP6 B;  1NJI Q;  3O6Q B;  4W7Y A;  1JCC A;  2GUS A;  1EQ7 A;  3TNU A;  4PH0 A;  1KZU B;  2ZFC A;  4H44 B;  2E74 B;  1L4A A;  2GUV A;  5AVQ B;  2MVV A;  4JYC A;  3H1J D;  2KLU A;  1S5L H;  2IBZ G;  2YXR B;  3V4Q A;  2NPS A;  3HD7 B;  3JCU H;  3SFE C;  2BEZ F;  1S9K E;  1KFM A;  1QRJ A;  2BAS A;  3VMA A;  1SQX J;  5AVW B;  1CEI A;  1BXI A;  3OJA B;  1BGY J;  2JKV A;  2P2U A;  4U3F E;  1IFD A;  1OMI A;  1LT1 A;  2WWW A;  2A45 H;  3TNU B;  4UB6 E;  2P58 A;  5BS2 A;  2GZJ A;  1M1K Q;  1L4A B;  4DG9 A;  1PP9 G;  4JQ0 D;  2GDX A;  3WUV A;  2O01 H;  2HPC A;  2HOD A;  2N50 A;  1UJZ A;  3RBZ A;  1NAY A;  3H1L E;  2LR2 A;  1J1D B;  2NPS B;  4D6T G;  2WSC H;  2WSE J;  1E5W A;  3MIW A;  2P1J A;  4DOJ A;  2KOR A;  4PJ0 E;  1EXJ A;  1FBM A;  2FXP A;  4PWV B;  3CWB D;  3IAO A;  4PD4 I;  1FU1 A;  4IL6 X;  1JJ2 O;  2R5D A;  4UB8 H;  4HH2 A;  1ZRT E;  1LP1 A;  4NPD A;  4JF7 A;  1NTK G;  4GR2 A;  4H0L D;  2CGQ A;  5CCH D;  2M8L A;  1JTH A;  1PZQ A;  2DNW A;  3L72 J;  2HPC B;  1HH0 A;  2HOD B;  1IK7 A;  2R5B A;  2LL8 A;  2FYN B;  3L36 A;  3WUT A;  2B87 A;  1ZME C;  1VQ8 P;  1GW4 A;  3GW6 A;  3A7O A;  1S72 P;  2MD9 A;  2M8N A;  2Z44 A;  1RF0 A;  1GD2 E;  3L75 G;  4NPF X;  3G71 P;  2GZG A;  3KXD A;  1KIL D;  1X8Y A;  2IDB A;  1LP1 B;  2EHT A;  4IFF A;  1XTG B;  5KAI E;  2E75 D;  3H1J E;  2K9Y A;  1RE4 C;  1JTH B;  2PNG A;  1L0N J;  3CCE P;  4WVZ A;  4U0F A;  1ZR4 A;  5CBN A;  2LXB A;  5APQ A;  5AW6 B;  1K8A Q;  2XT1 A;  2B87 B;  1SQQ E;  1N73 C;  1JY2 N;  4YPC A;  2B89 A;  2ZXX A;  4ZKU A;  3AE4 C;  1FE6 A;  1JY3 P;  5AVR B;  3N7N A;  4H13 C;  1NO4 A;  1P84 I;  3TGU G;  1JNM A;  3CX5 D;  5CCG A;  1PV3 A;  4C7R A;  1VF5 C;  2C0W A;  5TIS E;  3CC4 P;  1HGV A;  2C0X A;  1RF0 C;  2AEM A;  3L73 E;  2FYU G;  1JB0 J;  1BSN A;  3CMA P;  3CD6 P;  2FXO A;  1OR5 A;  3I55 P;  1SQB K;  3S4R A;  4DCK A;  1LWU A;  1QL1 A;  1FZC C;  3L35 A;  3HUS A;  3W68 A;  2WSS H;  2OQQ A;  4PD4 D;  1YHQ P;  1NTM E;  5HGN A;  4U3F J;  3A2A A;  4WB4 A;  5B5E E;  2P7J A;  2Q3E A;  1DD4 A;  2MKV A;  1IFM A;  4DJG A;  1JCD A;  5APU A;  2UWJ E;  1AYI A;  1HVV A;  1IO4 A;  1OFC X;  1URQ A;  1IJD B;  2QRX A;  4EI2 A;  2XV6 A;  3H1L J;  2WSF J;  2QJK B;  4YXW H;  5KTB A;  2FVF A;  5AVX B;  1H8A A;  3L74 E;  4IFM A;  1JEK A;  1OW8 A;  2KGD A;  3KZI E;  1LWU B;  1NHL A;  1YJW P;  4AQR D;  1OW6 A;  2CQ8 A;  3HUS B;  2KK7 A;  3ZDM A;  3M0D A;  5B66 E;  1FS0 E;  1X22 A;  4DZO A;  5K5G B;  3D70 A;  2OYH A;  1DEE G;  2K9J A;  1RY3 A;  3NY7 B;  5KP7 B;  1URQ B;  1PGQ A;  3BCC G;  4I6M C;  5KLI C;  4H44 D;  5L8R J;  2HLO A;  3RL0 g;  2XKM A;  1GL2 C;  5F2O A;  1RH5 B;  3CXH H;  5KJ7 A;  1M74 A;  2YMK A;  3HD7 D;  3D6Z A;  1HQB A;  2D2C C;  2WMM A;  3H0D A;  2E76 B;  2Q3I A;  1J2J B;  1AQ5 A;  2OYI A;  4AYC A;  1X0T A;  2GA1 A;  5KP8 B;  2FBW C;  3H1J J;  2KGE A;  1BE3 D;  1JMM A;  2OYH B;  2K9J B;  4K3A A;  3DS3 A;  3Q2Y A;  1IFI A;  3A0B E;  1YQ4 C;  5BVZ A;  1LT9 A;  3MTU E;  2WPT A;  2LF4 A;  1NTK K;  2A06 E;  2GDW A;  4QNB A;  4PD4 E;  1NTZ K;  1EZV D;  5DJU B;  2K0X A;  3S1K A;  2KZJ A;  5CCH A;  3AEE C;  2OYI B;  1BAJ A;  5GTH E;  3B71 A;  3MP7 B;  1PGJ A;  1Q86 Q;  3B4S A;  3GMA A;  2BHV A;  2JJL A;  3TYY A;  5APT A;  3L71 D;  1JOC A;  2W27 A;  1CSB A;  1FDI A;  3Q20 A;  2QM8 A;  2QEX P;  2GZE A;  1U7J A;  3PTZ A;  1IFJ A;  1LTA C;  4RJT A;  4IL6 E;  2ZYA A;  3V2N A;  3ITK A;  3L70 E;  2KNC A;  3DTJ A;  3CE7 A;  1LT9 B;  2YKQ A;  1FC2 C;  2DGY A;  1KV4 A;  1KIL A;  1EDK A;  1NYH A;  1L0L G;  2ZYG A;  7CEI A;  4HKZ H;  1FZG A;  3VMZ A;  2KUB A;  2KS1 A;  4TT3 H;  1BCC D;  2B88 A;  3B5I A;  3NFQ A;  2P10 A;  2YXQ B;  1G1J A;  2JGP A;  1JY2 O;  4H0L C;  2HYN A;  2P67 A;  5KKZ B;  3VN0 A;  2BQ1 E;  2KNC B;  1ZW0 A;  3L74 J;  2XZ1 C;  2RKL A;  2LOL A;  1KIL B;  1P84 E;  2JYL A;  2KSE A;  1BGY G;  2E75 B;  3H1K D;  2FQ2 A;  1BE3 E;  4A7P A;  1K9M Q;  2Q5U A;  2KS1 B;  1VQP P;  2ZVN B;  1KLP A;  2FYU K;  3BRT B;  2PGD A;  1ZN5 A;  3T97 A;  3QWO C;  3H1I D;  3G9R A;  2K1A A;  4GOD A;  2RN0 A;  1UNK A;  3U1A A;  1M1J A;  5H2F H;  1N7S A;  3RK2 B;  3BAT A;  2IX7 C;  2L9F A;  1HTL C;  3VYI A;  1VQ6 P;  2FFD A;  3G6E P;  1EDL A;  2E43 A;  5APW A;  3PP5 A;  3EWK A;  4MRT C;  1AQT A;  3CC7 P;  1Q2N A;  1N7L A;  3A0H H;  2JQ4 A;  2AFE A;  2O01 N;  1PEM A;  1Q81 Q;  2QSI A;  3H1H E;  1PIX A;  1KB9 H;  2Z5H A;  4LC1 A;  2CK3 H;  3T97 B;  3Q5S A;  2Q6Q A;  3NMD A;  2M3B A;  2ZT9 C;  2N9B A;  1MKM A;  1PFI A;  3MGE A;  3KHU A;  1SQP K;  2R3C A;  3I5C A;  2IBZ D;  1Z56 A;  2AEF A;  1M1J B;  1XTC C;  4BWN A;  2OGU A;  1N7S B;  4CA3 A;  2GYK A;  3CL3 D;  1RQU A;  1DIP A;  2KOQ A;  1SQV G;  2FFD B;  2AXT H;  2BEQ D;  1A02 J;  1LTB C;  3G3Z A;  1MZ9 A;  2OTJ P;  1FZB A;  4H2X C;  4OGQ B;  1BCC E;  3AEA C;  2FVA A;  2LKI A;  4IPY A;  3UIA A;  2XNX A;  1PP9 D;  1KYO H;  1FJK A; 
#chains in the Genus database with same CATH homology
 3P05 A;  5BS1 A;  3VRL C;  5HGM A;  3DS3 A;  2JYL A;  3G21 A;  4XRO A;  1AUM A;  1YJN P;  4COP A;  1YHQ P;  2EIA A;  1VQO P;  1NJI Q;  3CXC O;  5HGN A;  2QA4 P;  2CWO A;  5DCK A;  1K73 Q;  1YJ9 P;  2BUO A;  4PH0 A;  1K9M Q;  1VQ8 P;  1RO0 A;  3G26 A;  1VQP P;  1IUQ A;  1RNI A;  2LF4 A;  1S72 P;  2PEI A;  2JYG A;  2M8N A;  2PEM A;  4QNB A;  1M6N A;  2Z44 A;  1VQM P;  1VQL P;  2JO0 A;  2PEK A;  3M1M A;  4XRQ A;  3NTE A;  4U0C A;  2Z46 A;  3DPH A;  4XFX A;  3G71 P;  2XV6 A;  3H4E A;  1RO2 A;  1M6E X;  2M8P A;  1D1D A;  1BAJ A;  2PEQ A;  3E2D A;  4XFZ A;  3DS5 A;  1Q86 Q;  1M90 Q;  1QRJ A;  4U0E A;  5F2N A;  2BHV A;  2E1M A;  1VQ9 P;  2PY8 A;  1VQ6 P;  1VQ5 P;  1VQ7 P;  3G6E P;  2P9X A;  1YJW P;  3CCV P;  1N8R Q;  1VQK P;  1A43 A;  5F2K A;  1Q82 Q;  4WYM A;  3Q20 A;  1W2B O;  1PEO A;  2QEX P;  3CC7 P;  2EFJ A;  3CCE P;  4U0F A;  1KD1 Q;  1QVF O;  1PEM A;  1VQ4 P;  3WBH A;  1QVG O;  1K8A Q;  4M0I A;  1Q81 Q;  1KQS O;  2XT1 A;  4GR6 A;  3CC2 P;  3DTJ A;  1YI2 P;  3CCQ P;  1KC8 Q;  5HGL A;  3G1G A;  3G28 A;  5BS2 A;  1M1K Q;  3G0V A;  2DGY A;  1EOQ A;  3CCL P;  3DS1 A;  1PEQ A;  3DS4 A;  3MGE A;  3DS2 A;  2Z45 A;  1E6J P;  3H47 A;  1A8O A;  4PH1 A;  3CCJ P;  1EIA A;  3CCS P;  3CME P;  3CPW O;  1PEU A;  3I56 P;  2PEJ A;  2PEN A;  1VQN P;  3G29 A;  3HYB A;  4U0B A;  1Q7Y Q;  1YIJ P;  2XXM A;  4XFY A;  5JPA A;  3HZQ A;  3B5I A;  5F2O A;  3CC4 P;  2L6E A;  1M74 A;  4U0A A;  3CCM P;  3DS0 A;  3G4S P;  3H0D A;  3OW2 O;  1JJ2 O;  2OAR A;  3CCR P;  2OTJ P;  1ZMB A;  5I4T G;  1YIT P;  3LRY A;  2EG5 A;  2BQ1 E;  4IPY A;  5HGO A;  4U0D A;  4GR2 A;  2OTL P;  2ONT A;  3CMA P;  2PEO A;  3CD6 P;  3CCU P;  1K30 A;  3I55 P;  4COC A;  3G1I A;  2M8L A;  3RG6 C;  2KOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...