1VQKV

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqkV00
3CXCU 1K8AW 1R73A 3CCRV 1VQ7V 3G71V 1VQKV 5DM6V 1KD1W 1JJ2U 4WCEV 3CCJV 3CCMV 3CPWU 1Q7YW 1YI2V 2D3OW 3G4SV 3CD6V 3CCVV 4WFAV 1KQSU 1NJIW 3CCUV 4WFBV 1QVGU 1KC8W 1M1KW 1VQOV 3CC2V 3CCQV 1Q81W 1K9MW 1VQ5V 1Q86W 1QVFU 1YITV 3CCLV 1K73W 2QA4V 1M90W 1YJ9V 3CCEV 1N8RW 2QEXV 1S72V 4WF9V 3CMEV 1YJNV 3CCSV 3G6EV 1YJWV 3CC4V 1W2BU 1VQ6V 1VQNV 1YIJV 2OTJV 1VQPV 1VQ8V 1VQ4V 2OTLV 1VQLV 1YHQV 3CC7V 1VQMV 3I55V 1Q82W 1VQ9V 3I56V 3CMAV 3OW2U
chains in the Genus database with same CATH superfamily
1UFIA 4LFAB 2WLIA 4MSWC 3JAMN 4HNAB 1I5YA 3GWOA 3WG7C 1RSOA 1OCZB 5IJ9A 2F43G 3SYPA 1QR8A 4AQYB 3D3IA 1NZ6A 4X1YB 2UUAB 4WBNA 2QKSA 2JS5A 2RDCA 1KKCA 2BOCC 3D3QA 1L8DA 2UXDO 4I55A 1SQXH 5C8YA 3A0HZ 3RYHA 1F51A 2ZM6O 3ABKC 3AG7A 4PD4F 5B1NA 3OT7A 2QTSA 1N8RW 4JI8O 3ZMTA 4DR1O 2GTSA 2W6JG 1TGOA 3GWKC 2F1MA 1TUBA 3SPGA 2F4VB 3K06A 2CUGA 2ZD9A 1J95A 3K0GA 4X89A 4J41A 1I0HA 4NXMB 4BR6A 2QA4V 2NN4A 1H2LA 4U7OA 2BCCH 4O4IA 2F23A 1MZEA 4QNHB 2ZINA 3P3NA 1AJQA 4G27B 5CA0B 2EIKC 2WLHA 1Q8IA 3G67A 5JH7A 2WLLA 3JATB 2KG7A 2ODMA 5DECA 3RYCB 5B1AB 3K5MA 2M6YA 5BMVB 4KL1A 3AG2C 2UU9B 4FLTA 4DYLA 2KSDA 3E2EA 2LJ2A 4PA3A 1VF6C 5H2FZ 4HZ3A 4P30A 4AHCA 2FB5A 3ETEA 1THZA 2VQEB 1KECA 4NXMO 4HYOA 4FLXA 3CD6V 3K5NA 2W0FC 1MMMA 2V7QG 1SA0A 1QVGU 1EBOA 5KUMA 1KP3A 4XDJA 5B66Z 1BHBA 2X6BA 5LA6A 3AEIA 2UXCO 2KG7B 2Y4UA 4LC1A 2C2AA 4RUFA 2WLMA 3OGIB 1KD1W 2XOKG 2IM9A 1HNXB 2E76B 1EN6A 5KAFZ 3FFQA 2UU9O 4O2AA 1DK1A 4GKJB 3ASNC 2OIEA 4O4LB 3RW0A 2BTQB 3CX5F 3SJCC 3L72H 3LNMB 4YJ2B 1NR7A 1URFA 2A0LA 5AG2A 2RN9A 1N0NA 1TUBB 4LF8B 1MZFA 3TXQA 1H2GA 1R6KA 4QPJA 4R7CA 3HR0A 3H1HH 1OV9A 2Q69A 3R65A 3JSLA 1PL4A 4GKKB 1M57B 1XHZA 4QE9A 2GHYA 2ZR2A 2WA3A 3Q4HB 3CC2V 3K04A 1FXKC 2PI4A 1H2NA 1M90W 4GX1A 2LW7A 2D2CB 4PDVA 3DGEA 4E4EA 4NVPA 1GN3A 4U3JB 1AR5A 1YSCA 1EM1A 3SPIA 3VQVA 1R3JC 3L71H 5BR8O 1SQPH 3K3WA 3M7MX 2P67A 3E22A 1K92A 1OJHA 1XNRB 2Z3YA 5KHHA 2PI5A 2EIJC 3UQ8A 3CCVV 2YIBA 3BFRA 2ADQB 3ZN0A 3BRCA 1YEWA 1L0NH 4O4JA 1AJNA 1KYOF 4TSFG 2PYLA 3E8BA 2BSKB 2ZDIA 1EZVH 2ITDC 3ZIAG 1BS3A 3T1YO 4YY3B 4DR3B 4YHHB 1P4RA 2BTOA 4TUYB 3AG2B 4TT3G 1T5EA 2IW5A 1R6TA 1N32B 3OAAG 3A2FA 4DW1A 1QHTA 4JGSA 1VQ6V 3B40A 3TETA 4JI7O 5K1PA 2PUSA 2EIJB 4PA4A 4J9YB 1PPJH 1YF2A 4I5SA 5C93A 4KHPB 3JASB 4B08A 4ZOLB 1XQ8A 3E8FA 5ITZB 4LCUC 1VMGA 1WB7A 2DYRC 3P32A 5EYPA 3N2GA 2LQTA 1VF5B 1ZX3A 2X6AA 4ZI7B 3I56V 4ZKIA 3FAVA 3SYCA 4GX2A 3L9DA 4KFMA 5IDJA 2Y48A 4CBCA 4JAUA 4UB8Z 4UCSA 2XAHA 1H8HG 4YIOA 3LNNA 1SKVA 2IJIA 4CH5A 1CEZA 3BHPA 4L87A 3ZMSA 2LW1A 1GRJA 3WG7B 2M7WA 5JQGA 3P30A 5LP6B 2LFRA 4BAYA 1PKXA 2OYQA 2OCHA 4JI2O 4CS4A 4B3TO 3QNEA 2Q8VA 3GB7C 1FD9A 3ABKB 1E1RG 1MNGA 2H94A 5GTIZ 1H2SB 4X66B 1FYJA 2RCVA 2P06A 2E75B 3LUTB 5H9CA 3JD0A 3QO7A 4D6TH 4CC6A 1D2DA 4PI0A 4LFAO 3CC7V 2EIMC 3O65A 1K34A 4X9QA 1S76D 3T1HB 2FL4A 4UCOA 1L1FA 1K5QA 3T4ZA 1PL0A 4X62O 1OCRC 3LSSA 4MT8A 4X8AA 1SZTA 2UXNA 2AZ2A 4TV8B 3CS5A 1GM9A 4ICGA 1X4TA 3A0BZ 2A3QA 1H8EG 4WFEA 3TK1A 1BL8A 4I50A 5KHIA 3WB0A 1W0JG 5IE9A 3CSXA 1N36B 3SYAA 3CRCA 2ETNA 3TJTA 5B1AC 1R3IC 1XUQA 4JI4B 4JTAB 2ADPA 2B1IA 3KG2A 1MABG 2K9PA 2W0XA 1YJ9V 1QR9A 5BXZA 2HHHO 3KZIZ 4YJ3A 3ZN1A 2PY5A 3ABLC 4MTOA 1VEWA 4JI6O 3OEEG 4J11A 3UO3A 3APOA 3CHXA 4JI0O 1S0VA 1TVKA 1KUQA 2CH7B 3SPCA 1Q90D 2B9ZA 2Q9LA 3C90A 1RSOB 2AHYA 2AXTZ 2VS0A 3J7AU 2EULA 2Z5UA 3RGBA 5LHGA 3NXSA 1XHXA 4UCRA 3D8CA 3BEHA 3M99B 1KMIZ 4H13B 4W4LA 3SYQA 2RJZA 3JALB 1Q82W 2JGDA 2Q7GA 4FZ0A 1HDJA 4TWKA 3QF7A 2Q68A 1A32A 3G71V 1P84F 4LF4O 1S77D 5FPRA 3G4SV 2CGNA 5EIBD 1YITV 4IGGA 1EN4A 2G38A 3ZHVA 2VQFO 3LDDA 3VOUA 4JI0B 5FLXN 2CAZC 3RFRA 3RN4A 2DN9A 2ZE5A 1IBLB 2QGNA 4B3RO 2OT5A 4I0XB 1F4MA 4DR6O 3CRQA 3JARA 4X20B 5KA6A 1CXZB 4CH4A 5LGTA 1KC8W 3H1LH 4TUYA 1PNKA 3F7VC 4BIOA 5LMNO 5LOVB 2P5OA 1OZ0A 1GH6A 4CZZA 4PJ0Z 2YSUB 3H1IH 3NR7A 2GTAA 1G8MA 4I55B 2WLKA 3OMIB 4DR5O 1US6A 3JD1A 3E35A 2P22C 4FFKA 5IYBO 3W7SA 2EINB 4FLYA 3JYCA 5L3DA 2VQFB 1S3JA 4O2BA 5J2UA 3L74H 5IJ0B 1Y66A 1YJWV 2OIGA 5KHKA 2R9RB 5LGNA 2PF4E 2A9HA 1SQVH 3JCZA 3AG4C 1I94O 1FKAO 1JJ2U 1E79G 2Q73A 1WNSA 4DV6O 4B3MO 4GX5A 3CCQV 4MVRA 2E74B 3MAQA 1X59A 1KU9A 3CCEV 1KBHA 2EIKB 2CTPA 1AI4A 1JMKC 4HAMA 2FMLA 4FM0A 2YXHA 3IJ4A 3WB1A 1FJGO 3K03A 3ML0A 4EFBA 2JDIG 4FMTA 1JJOA 3JASA 2JGDB 5LGUA 3IC7A 3SDLA 4X1KA 4DR2O 1E1QG 1WA8B 2XT9A 2Q7HA 2EIMB 4PDRA 1CP9A 1S72V 4OX9B 4K3AA 3BVOA 1Y74A 2R72A 1AP5A 4JV5O 4YHHO 4CH3A 3C3TA 3SPJA 1GTOA 3UT5B 1XNQO 4WFFA 2HJDA 2NLJC 1QLEB 1GM8A 3E22B 3JD3A 2GBOA 3K5OA 1Y6XA 4IT5A 4DV2B 2H8PC 1NR1A 4LF8O 3TCUA 4ASUG 2KQXA 3OW2U 2QM7A 1LR1A 3TXSA 5LXTA 5JQGB 2P6JA 1ZL8B 2QWRB 3JAWB 1F23A 4DV3B 2YS8A 1H2MA 4O4HB 4FLZA 1AI7A 4X64O 3N2KB 4PELA 4R8CA 4DV7O 2OWOA 4K0KB 3N27A 4MW3A 2CTQA 3OTOO 4FM2A 3HKDB 1J5EB 5IJ0A 5LHHA 4R6ZA 2P4KA 4TV9A 1HW7A 1NTZH 1NBMG 2QWOB 1HR0B 4E2LA 4Z1VA 4J7ZA 4WCEV 2UUAO 3RBZA 5LA6B 3K9SA 1Y76B 2AW9A 3VQXA 3E8HA 1K73W 4LP8A 3OMAB 4XDKA 2QEXV 3RVZA 3UCSC 1PM9A 5ITZA 2ZM6B 1BT8A 3VQYA 4J7KA 4F6RB 4DUYB 4KXRA 3K79A 4IIJA 1NS1A 1M56B 3E89A 5L3CA 1GM7A 4UVCA 3ZHSA 4DR1B 3T4DA 3OR7C 5EBMC 1FXKA 3ETDA 3OD4A 3CXHF 5L3BA 4DR7O 3WFVA 2A7WA 3W7XA 2HKOA 5LP6C 5KX5B 1YHQV 4DUZO 3CYOA 1RM1B 1AI6A 2UUBB 3FAVB 2Q6AA 2HEPA 4X65B 4DV5B 2A79B 2K1EA 2WLLB 4IYIA 1GN6A 4LF7O 3ZRXA 3M8AA 1YJNV 1SS3A 2Z0AA 4UCTA 1FPOA 1BSMA 2ZIMA 4MVUA 3B2EE 4JI4O 1NKDA 3P3PA 4UXNA 3BCCH 5CBHA 3CCRV 1WP8A 2XAQA 1SQBH 3G80A 2YIDA 4AI8A 4FZ1A 3CPWU 1SRYA 3JALA 2VRZA 2OCCB 4QPKA 2HVKC 2Q5ZA 3F5WC 1NU1H 4UV8A 2H3OA 4JTDB 1V9PA 2Q7EA 2ZT9B 3ABLB 4MVMA 1L0LH 4O2AB 5D5PA 2DYSC 1P7GA 4K8ZA 4NTWA 1JA8A 4DR4B 3ABTA 3FB5C 3X2QB 4FK5C 2PTMA 3SYOA 2ZCEA 4ZHQB 1NQTA 1CPYA 2O57A 5JVDB 1FXVA 1YDXA 5KMGA 5B3SC 3ZX6A 1B04A 2Y0IA 1IBKB 4LFBO 2EILC 2UUCO 3CMEV 4O4HA 4P9PA 5BY1A 2R9IA 2DMXA 4JAAA 2AZ0A 2OCCC 4CH6A 3C3SA 3K9AA 5FPOA 1WP7A 1DLBA 4FFBA 1IDSA 1QLEC 2LO1A 1GAXA 4WFGA 4LR3A 5A9GA 1F7YA 2XAFA 1Z5VA 2JJ1G 4X1IA 5IYZB 4DR4O 5JWPA 1BMFG 1BQZA 3UT5A 4H44B 4FLUA 2BSKA 2CGOA 1N34B 3RYFA 4JI1O 4Z1MG 2YI8A 3L70H 5JCOA 2YEVA 4LBEC 1JQ0A 3U0ZA 4WFBV 1K33A 3AK1A 2Y4TA 2X6CA 5J9PC 3OUSA 3RYFB 5E79Z 1ZUQA 4G2KA 5CBFA 2R70A 1O9HA 5B1BB 2ARHA 1PP9H 4J80A 3E83A 1OCOC 2QWNB 3FB6C 1SERA 5CB4A 4X88A 1NJIW 4B3SO 2F93B 1DTOA 2JVDA 1GN2A 3FKSG 1JFFB 1JPXA 3H1JH 4H37A 1OCCB 1LNQA 2FYUH 4OPAA 5EZYB 3ZHUA 1IBLO 3F7YC 4TV9B 3THOA 4UVAA 4PA9A 4MS2A 2GV9A 5IJ9B 4BWAA 3AG1B 4GYCB 1AR4A 3E8GA 3K5LA 4GUNA 4MTXA 4Q6GA 4CC5A 5J2TB 3FB7C 3LSQA 4H33A 4EEQA 5IY5C 1DF5A 1OCOB 1MA1A 5LHIA 2Y0PA 2V4DA 1XILA 5DM6V 1RPOA 1XL6A 1WN7A 4BW5A 4LF9O 5J2UB 4GKKO 3JAWA 1JFFA 3RWRD 3HKEA 3PN1A 1M5IA 1V55B 1VARA 4GT1A 4YJ3B 4X1IB 4JAVA 3AK3A 1SA0B 2QR4A 2Q0AA 1IBMB 1M4UA 2JGUA 1WPBA 3UO2A 5B1OA 4I4TB 5L3GA 1XMQB 4DV4O 4O4LA 1RP3B 4IHJB 2VWJA 1GK9A 3K57A 3R66A 3L73H 3W7TA 2IH3C 4TV8A 1HNZB 2XNDG 1LUVA 3QG5A 2GUZB 3IC9A 2JEUA 1VQPV 2DE0X 2PYJA 4FLWA 1FJGB 4YXWG 2DQ0A 1WA8A 3VQWA 2UXBO 3B8NA 3D36A 4F6EA 4WFHA 5LYJB 4ZIBA 4LFCB 1XNRO 4DV7B 3H01A 1JOYA 3H1KH 2W6IG 1YZBA 1K7DA 1U97A 1BQ0A 1XDCA 4YJ2A 4CS2A 4W4KA 3X2QC 3G6EV 5C8YB 1D5NA 1HNWO 5JJNB 5GW7A 4IHJA 4MW8A 3ZRSA 4HNAA 4KUMA 2HVJC 3ZMZA 2IU0A 5LMUB 1Q43A 1S5LZ 4NXNB 1QU7A 2LGWA 3CCUV 2RNBA 2KB1A 1Q86W 4D7TA 1NI8A 4QE7A 3ZS8C 4FLVA 1WJZA 1AP6A 4B3MB 5CB4B 1YIJV 3JSNA 1VQ8V 4UVBA 4JI3O 1XOUA 1VQNV 3SJAC 3I55V 2UXBB 4NTYA 3ETQA 1ZL8A 1TA8A 2XHBA 3FX7A 3HB3B 3ZHRA 2Q67A 1YTFB 2GSMB 1IVSA 4K35A 3GVMA 4JI5O 3DXRB 1KKDA 4DV1O 5EYPB 3HKDA 3I5DA 3WU2Z 1OCZC 2F4VO 4U3FH 2XTAA 2IU3A 3AG4B 2AHZA 2JRIA 4JYBA 1NTMH 4RUEA 3DXRA 4NXNO 1K4CC 2WLIB 4AQYO 1PNLA 4U7NA 3JARB 1JVMA 4X20A 1K5SA 1FFXB 2ZE6A 3OM3B 3RVYA 4I4TA 3QO8A 4J42A 2IBZH 4GLXA 2HFEC 2BOBC 5LL6Y 2ZE8A 1FXKB 4B3TB 2ITCC 1MSDA 3T2MA 1ENVA 1Q7YW 4IIJB 4PHZA 4J10A 1BHAA 3ABUA 2N04A 1DGSA 3W7WA 1WLEA 4TQDA 1R3LC 1W2BU 5EIBC 3BA9A 1K4DC 1TAEA 2P7TC 2L35A 3J80N 4JPRA 3DTUB 4FIPC 1O9GA 5KHGA 2FTKA 4FM1A 1G4YB 3BA8A 2UUCB 3CRRA 5IY5B 1W0KG 4RQEA 4EFEA 2X0LA 4ZOLA 1U96A 2X7RB 4DK1A 3N2KA 4BW9A 2ATKC 4PA7A 4FPPA 1SETA 4WBNB 2E5LO 2EILB 5BMVA 3IFXA 5EBLC 4I0XA 4JI2B 2WSSG 4OGQB 2JEXA 1B06A 2YEVB 2YUAA 1Q6UA 4EB6B 4JTCB 1VQ4V 1TVKB 4LF6O 3SPHA 1VQ9V 5H6QA 4JI8B 4ZHQA 1XEQA 2QKCA 2P4VA 2YXLA 3B77A 4EB6A 2HP8A 1FFTB 2B1GA 5IWAB 3CCLV 2IH1C 4P9OA 4X65O 4DK0A 2DQ3A 5CA1B 5JCOC 2GUZA 1MOFA 3OE7G 1P49A 5J2TA 2OTLV 2CE4A 4F6RA 4FJCC 4PI2A 3UM7A 4PDLA 1EZJA 2DWEC 3ZRWA 1HNXO 4MVOA 1XBLA 1G6UA 3SJBC 4UFZA 4UCVA 2WWWA 2GDSA 2YDEA 1KQSU 2WAMA 1Z2GA 1NVPD 1WAZA 1RFYA 1EFRG 2MK3A 3JAKA 2WLJA 5IYCO 3CJHB 2QM4A 1LUWA 1ROPA 5CA3A 2RMKB 1P7BA 1AROP 4DV0B 1AI5A 4Q20A 4DRXA 1RM1C 5KUKA 4C7UA 2DYRB 4GZRB 3VBBA 3OMNB 1SZXA 1ZLZA 1Q6HA 1GO3F 3TGUH 2CTRA 3RYIA 1HP8A 1OCCC 2LP7A 1VP7A 2ZKOA 1HWYA 2DJVA 4DR5B 4LF9B 3ZMVA 3FB8C 2ZXWC 1ZWIC 1K97A 5LBQA 1Q6IA 1Q3EA 5LXTB 4BIUA 4B3SB 2LFSA 4JYAO 2QTOA 2UXXA 1Q5OA 2CH7A 2NR5A 5IYDO 4CS3A 3SJQC 3KCXA 2HG5C 3K58A 1ZSPA 3EHBB 2EINC 1KB9F 2DYSB 1AVMA 2BE3A 1NH2D 4LNUB 3OR6C 1XMQO 4LF5B 3KKYA 1TUEB 1FFXA 1OCRB 3KCYA 4GCZA 2EZPA 3N2GB 3A8TA 3K59A 3AK2A 5B3SB 4UCUA 4LNUA 2QM8A 3A0RA 4DV2O 1QVFU 1NVPB 1GKFA 3FYIB 4QGPA 2ZNJA 4KHPO 3DSQA 1IXBA 4F4LA 3IGAC 3FD9A 3HKEB 1FXHA 1H2KA 4NTXA 5JJEB 2XAJA 4R50A 5LP6A 4JYAB 2YIBD 3ZHTA 3HKBB 1QCEA 3ZCCA 4BIZA 1AJPA 5K1XA 1MG1A 3RT3C 1RPRA 4WF9V 1M93A 4LF5O 4FVMA 4IL6Z 1SC5B 3ABMC 1IBMO 5EC2C 4XBFA 5JVDA 1VF7A 1NH2B 5KX5A 3O9OA 3G6BA 4JV5B 2DOSA 3S3WA 4O4JB 4N23A 2WPDG 5E1AC 1BE3H 3T1YB 1NT2B 3ZRWB 1N32O 4JI3B 1MSWD 4DV6B 2Y69B 2EBOA 3LDEA 5CN0A 1FAFA 2UXDB 1WPXA 2QWPB 2B5UA 4J7JA 2DWDC 4TOIA 3CXCU 3CP1A 5LYJA 3CJHA 4X66O 3Q4HA 3EVKA 1R6NA 5IT9N 1Z5WA 4DV3O 2ZQMA 5TISZ 4I7ZB 4I50B 4DUZB 3U11A 4JYCA 1M9NA 2CDYA 4OXSA 4U3JA 4UV9A 3HKCB 1QLNA 1J5EO 5F2VO 2L6LA 2BTQA 1PNMA 3U10A 4JZGA 2IJKA 2E3CA 3ICXA 4JASA 2D3OW 3AG1C 1SESA 3T1CA 2Q4PA 2VWKA 2LGQA 4DXWA 1GN4A 2HLDG 5GONB 4DV4B 1W59A 2IJJA 3ZRVA 1N36O 5CA1A 4JF3A 1VQLV 1HNZO 2MW2B 2AGAA 4B7EA 2WA4A 2QKAA 4MVZA 5KAIZ 4DUYO 2HHHB 3ZJZA 5HFMA 1K3EA 2QJ1A 4KP4A 1V55C 2YI9A 4MTGA 4JZ2A 3JAKB 3RYHB 3ASNB 4QJFB 2VQEO 4X64B 2YC0A 4FFBB 3STZC 4H0LB 1EN5A 3WB2A 4G28B 4MVQA 3HPLC 1IBKO 4LFBB 1G1XB 2UUBO 1AB3A 1YVWA 5L3FA 3T1HO 4LF7B 2XASA 3EXAA 2UXCB 4LH6A 1YTFD 4DV5O 1Y76A 5JJJB 4X62B 1WB8A 4GX0A 1IX9A 4NYKA 1V54C 2DW4A 2XUMA 1QNMA 4AILC 2RQ6A 4LF4B 1JX9A 2YXYA 5JH7B 1N33O 1QQCA 3CMAV 2EJ7A 2ILMA 2WLNA 3PJSK 1VQKV 5CA0A 3ETGA 1VIBA 5LOVA 4GKJO 5BZBA 1XMOB 4RO2A 1IXMA 3AG3B 5L3EA 1BZKA 3JD4A 1VQ5V 3JATA 4LF6B 3FYEB 4JI6B 4LH7A 3JCUZ 3ZEDA 5A2QN 1Y74B 1DF4A 1Y67A 2XAGA 3CEIA 4DR7B 4DO2A 1D5AA 1SQGA 2PZSA 3K08A 4O2BB 3D36C 4A5UB 1I7FA 5KA5A 1N4CA 5EZYA 1UPGA 3CRMA 4RAIA 3ZMUA 1N33B 2EJRA 4TQFA 1VQMV 2JJ2G 5CBGA 3B09A 1BCCH 3S3XA 2ZIOA 1XMOO 4NB5A 3HKCA 4WFAV 1KP2A 4ZBMA 1K9MW 4X1KB 3ZHQA 5KLVH 3MHHC 1I94B 3DC6A 4NKGB 3ASOB 1N34O 4P2ZA 5FL7G 3OUFA 4DR6B 1S5JA 2PGGA 2ZNIA 2FKXA 1IURA 4DW0A 2HR3A 1Q81W 1GMGA 2NNUA 4J9ZB 1AR1B 1YCIA 1FS0G 2CK3G 5LMNB 1B6QA 3F5TA 3QTCA 3BY6A 3RYCA 3APQA 4PDMA 3ZBHA 1JR9A 1PD3A 1N0JA 1SQFA 3BAAA 4OPHA 4YIPA 3CCJV 2F66C 1NTKH 5B1BC 1M1KW 3E86A 1QBZA 3MD0A 1VF6A 3L75H 4IYHA 2EX3A 4DV0O 1M56C 2E5LB 3SR2C 2ZXWB 1SF9A 3BABA 4YY3O 4DR3O 5KHJA 1B3QA 5CMUA 1R73A 4LWSA 1S5HC 2ZE7A 1ZAUA 5IYZA 1XREA 3OFNG 4B3RB 3EFFK 1VQOV 2A06H 5D5QA 4JI7B 3MDSA 4JI1B 5BR8B 5B5EZ 3OGCC 3HKBA 4D7SA 5FNVB 2IJHA 5H5NA 4N21A 4L8JA 3QO5A 5IWAO 2QWQB 1I5XA 1XI1A 1COWG 4X1YA 5EC1C 3OTOB 3JD2A 1ZTEA 2JK5C 2KKWA 2V1DA 3ABMB 3B8MA 1OHHG 4XDLA 5LMUO 3OTFA 4UUJC 3CRAA 4PV1B 1K8AW 3CE2A 1Y4MA 3CWBH 1XNQB 4NR1A 5GTHZ 5KMGB 4UB6Z 1YI2V 2EZOA 2QE7G 4Z2WA 1V54B 3DC5A 3QVNA 2N05A 3OEHG 3RYIB 4MTFA 2N74A 3CCSV 3IAYA 2JS3A 1R3KC 1PV0A 4I9QA 3J81N 4LFCO 3AG3C 1JCHA 4ABMA 3CCMV 3W7UA 1SQQH 4DRXB 4DV1B 3LSUA 2Y69C 4RQFA 2ZDIC 4B7KA 1ORQC 5H6RA 2HJFC 2ZR3A 3B4SA 1IZ3A 4DR2B 2F95B 4QIWF 5EK0A 1R1BA 4ZI7A 3SGIA 2R9AA 5GONA 1HR0O 1HNWB 4I9WA 4K8XA 4OX9O 2JIZG 3CB2A 3LDCA 5HFLA 1AILA 1F4NA 3K0DA 1BGYH 4RWUA 2QDOA 4PA6A 4LWSB 4O4IB 2YIAA 2Q0OC 3CC4V 4EKWA 5DEDA 5EBWC 1I08A 3BPZA 3STLC 1VQ7V 5FNVA 2QSAA 3UKMA 2CTWA 3MHSC 1M57C 3ASOC 3H9VA 1UJWB 4MVSA 4JI5B 1H38A 5DN6G 1XL4A 2P90A 2YICA 2OTJV 1YXBA 4JYYA 4K0KO 4HBNA
chains in the Genus database with same CATH topology
4UVAA 3SPCA 2WLIA 4MSWC 1I5YA 3GWOA 3WG7C 4PA9A 4MS2A 4N23A 1OCZB 2WPDG 5E1AC 2F43G 2AHYA 3SYPA 1QR8A 3AG1B 2Z5UA 3D3IA 5LHGA 3NXSA 3ZRWB 3E8GA 1MSWD 2Y69B 2EBOA 2QKSA 3BEHA 3LDEA 3M99B 4MTXA 5CN0A 1WPXA 3FB7C 3LSQA 4H33A 3SYQA 5IY5C 1DF5A 2B5UA 2BOCC 1OCOB 2DWDC 1Q82W 5LHIA 4TWKA 3CXCU 3CP1A 2Q68A 3G71V 5DM6V 1RPOA 1XL6A 4BW5A 1S77D 1R6NA 1F51A 3G4SV 3ABKC 5B1NA 2ZQMA 1YITV 1V55B 4GT1A 1N8RW 4JYCA 1M9NA 3LDDA 4JAVA 3ZMTA 3VOUA 4OXSA 2W6JG 4UV9A 1QLNA 1PNMA 2OT5A 5B1OA 3SPGA 5L3GA 2IJKA 3K06A 1F4MA 2ZD9A 1J95A 3K0GA 4JASA 5KA6A 3AG1C 1SESA 4X89A 2D3OW 3T1CA 1GK9A 5LGTA 1KC8W 4DXWA 3W7TA 2IH3C 2HLDG 2QA4V 1PNKA 2XNDG 4U7OA 3F7VC 4QNHB 2IJJA 3ZRVA 1OZ0A 1AJQA 4G27B 2JEUA 2EIKC 4CZZA 1VQPV 4JF3A 1VQLV 2YSUB 2WLHA 1G8MA 2WLKA 2WLLA 4YXWG 3OMIB 2DQ0A 3JD1A 3E35A 3B8NA 3D36A 4WFHA 4MVZA 5IYBO 5B1AB 3W7SA 2EINB 3H01A 1JOYA 2W6IG 3JYCA 3ZJZA 5L3DA 5HFMA 1K3EA 1K7DA 4KP4A 1V55C 3AG2C 4MTGA 1S3JA 3ASNB 4QJFB 3X2QC 1Y66A 3G6EV 1YJWV 2R9RB 5LGNA 3E2EA 2A9HA 3STZC 4PA3A 5GW7A 4HZ3A 3JCZA 4MW8A 4P30A 3AG4C 3ETEA 3ZRSA 4G28B 4MVQA 4KUMA 1THZA 3HPLC 2HVJC 3ZMZA 2IU0A 1E79G 1JJ2U 1KECA 5L3FA 4HYOA 3CD6V 2W0FC 2XASA 2V7QG 3CCUV 4GX5A 1QVGU 1YTFD 3CCQV 4MVRA 2KB1A 1Q86W 1EBOA 5KUMA 1KP3A 4XDJA 1BHBA 2X6BA 4GX0A 3CCEV 4QE7A 1V54C 2DW4A 3AEIA 2EIKB 1AI4A 1YIJV 1VQ8V 1JX9A 4UVBA 4LC1A 4HAMA 1VQNV 2C2AA 3I55V 4RUFA 3CMAV 2WLMA 2WLNA 3PJSK 1VQKV 2XOKG 3K03A 1KD1W 3ML0A 3ETGA 3HB3B 2JDIG 4FMTA 2Q67A 5BZBA 1YTFB 5LGUA 3IC7A 4RO2A 2GSMB 1IXMA 3AG3B 5L3EA 3JD4A 1VQ5V 1E1QG 1KKDA 3FYEB 2EIMB 4PDRA 3ASNC 1CP9A 1S72V 1DF4A 1OCZC 2XAGA 3RW0A 2IU3A 3AG4B 2AHZA 4JYBA 4RUEA 4DO2A 3SPJA 1GTOA 1K4CC 2WLIB 3LNMB 3K08A 1NR7A 2A0LA 1PNLA 4U7NA 5KA5A 1JVMA 4WFFA 1K5SA 3OM3B 3RVYA 2NLJC 1QLEB 1GM8A 3JD3A 4RAIA 3QO8A 3ZMUA 1H2GA 2EJRA 1R6KA 2H8PC 4QPJA 1NR1A 2HFEC 2BOBC 1VQMV 2JJ2G 4R7CA 3TCUA 4ASUG 5CBGA 2Q69A 3R65A 3OW2U 2QM7A 1FXKB 2ITCC 2P6JA 1M57B 3T2MA 1ENVA 1Q7YW 1F23A 2GHYA 2ZR2A 4QE9A 4WFAV 1BHAA 1AI7A 3CC2V 1KP2A 4ZBMA 3K04A 3ABUA 1K9MW 1FXKC 2PI4A 4PELA 3MHHC 1M90W 4R8CA 4MW3A 3W7WA 4GX1A 1WLEA 1R3LC 1W2BU 5LHHA 4PDVA 3ASOB 3DGEA 4R6ZA 1K4DC 4P2ZA 5FL7G 1NBMG 2P7TC 3OUFA 1YSCA 4E2LA 4JPRA 3DTUB 4WCEV 4FIPC 3RBZA 2FTKA 1G4YB 3SPIA 2HR3A 1R3JC 1Q81W 3K3WA 3E8HA 1GMGA 1W0KG 5IY5B 2P67A 4RQEA 4LP8A 3OMAB 1K73W 4XDKA 2X0LA 2QEXV 2NNUA 3RVZA 4J9ZB 1AR1B 1FS0G 2CK3G 1B6QA 1K92A 2X7RB 3BY6A 4PDMA 2ATKC 1PD3A 4PA7A 4FPPA 2Z3YA 1SETA 2PI5A 3K79A 2EIJC 3CCJV 3E89A 1M56B 5L3CA 1GM7A 4UVCA 3CCVV 2EILB 3T4DA 5B1BC 1M1KW 3OR7C 3IFXA 5EBMC 1FXKA 3ETDA 5EBLC 3E86A 5L3BA 1QBZA 2WSSG 3MD0A 3WFVA 3ZN0A 3W7XA 2HKOA 1M56C 2JEXA 2YEVB 1AJNA 2ZXWB 4JTCB 1VQ4V 1YHQV 4TSFG 3E8BA 3SPHA 1VQ9V 3CYOA 5H6QA 1AI6A 1RM1B 2ZDIA 5CMUA 1R73A 2Q6AA 2ITDC 1S5HC 3ZIAG 3OFNG 3B77A 1P4RA 3EFFK 4TT3G 3AG2B 2A79B 1VQOV 1FFTB 2K1EA 2WLLB 2B1GA 2IW5A 3CCLV 3ZRXA 2IH1C 4P9OA 3OGCC 2DQ3A 3OAAG 1YJNV 2IJHA 1VQ6V 4JGSA 1MOFA 3OE7G 4N21A 3TETA 2OTLV 2EIJB 3QO5A 4J9YB 4PA4A 4MVUA 1I5XA 4FJCC 1NKDA 1COWG 4UXNA 3UM7A 4PDLA 1EZJA 2DWEC 4I5SA 3ZRWA 4MVOA 5EC1C 5C93A 5CBHA 3CCRV 2XAQA 3CPWU 1SRYA 2WWWA 2OCCB 1KQSU 2WAMA 3E8FA 3JD2A 4QPKA 2HVKC 4LCUC 2JK5C 1NVPD 3F5WC 4UV8A 1EFRG 2DYRC 2MK3A 2WLJA 3P32A 4JTDB 2V1DA 5IYCO 3ABLB 4MVMA 3ABMB 1ROPA 5CA3A 1P7BA 1AROP 3B8MA 1OHHG 2DYSC 1AI5A 4Q20A 4XDLA 1RM1C 4UUJC 5KUKA 3I56V 2X6AA 3ABTA 2DYRB 3FB5C 3X2QB 4ZKIA 1K8AW 4FK5C 1Y4MA 3OMNB 3VBBA 3SYOA 1NQTA 1CPYA 3SYCA 1YI2V 2EZOA 2QE7G 4GX2A 1FXVA 1V54B 4KFMA 5B3SC 2Y48A 5IDJA 4CBCA 4JAUA 1GO3F 2EILC 2XAHA 1H8HG 1OCCC 2LP7A 3OEHG 4MTFA 3CMEV 3CCSV 2IJIA 4P9PA 1CEZA 1R3KC 4L87A 3ZMSA 1HWYA 3WG7B 2R9IA 2M7WA 3ZMVA 3FB8C 2ZXWC 2OCCC 3P30A 3K9AA 1ZWIC 1K97A 2LFRA 5LBQA 3AG3C 1DLBA 1JCHA 1PKXA 4BAYA 3CCMV 3QNEA 4BIUA 3W7UA 3GB7C 1QLEC 2LFSA 2QTOA 2UXXA 3ABKB 4WFGA 1E1RG 2Y69C 2H94A 4RQFA 2XAFA 2ZDIC 1ORQC 2JJ1G 5H6RA 5IYDO 3LUTB 2HJFC 3SJQC 2ZR3A 5H9CA 2HG5C 3JD0A 3QO7A 3EHBB 2EINC 2DYSB 1NH2D 4QIWF 5EK0A 3OR6C 1BMFG 3CC7V 2EIMC 1K34A 1TUEB 1OCRB 4I9WA 2JIZG 4GCZA 1S76D 2EZPA 1L1FA 3LDCA 4Z1MG 1K5QA 2YEVA 5B3SB 4LBEC 1JQ0A 5HFLA 3T4ZA 1PL0A 1F4NA 3K0DA 4WFBV 1OCRC 3LSSA 4PA6A 2QM8A 3A0RA 1K33A 4MT8A 4X8AA 1QVFU 1SZTA 1NVPB 2UXNA 2X6CA 5J9PC 1GKFA 1GM9A 3FYIB 3OUSA 3CC4V 4EKWA 4G2KA 1H8EG 4WFEA 3TK1A 1BL8A 5CBFA 5EBWC 5B1BB 4F4LA 3IGAC 1W0JG 1FXHA 3STLC 3SYAA 1VQ7V 2XAJA 4R50A 3E83A 1OCOC 3UKMA 3FB6C 5B1AC 1QCEA 1SERA 1R3IC 3ZCCA 4JTAB 4X88A 4BIZA 1NJIW 1AJPA 3MHSC 2B1IA 3KG2A 1M57C 1MABG 1DTOA 1MG1A 3ASOC 1UJWB 1RPRA 1YJ9V 1QR9A 4MVSA 1H38A 5DN6G 1XL4A 2P90A 4WF9V 3FKSG 3ZN1A 1JPXA 3ABLC 4MTOA 3ABMC 4H37A 1OCCB 1LNQA 2OTJV 3OEEG 5EC2C 4XBFA 1S0VA 1NH2B 3F7YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC U;  1K8A W;  1R73 A;  3CCR V;  1VQ7 V;  3G71 V;  1VQK V;  5DM6 V;  1KD1 W;  1JJ2 U;  4WCE V;  3CCJ V;  3CCM V;  3CPW U;  1Q7Y W;  1YI2 V;  2D3O W;  3G4S V;  3CD6 V;  3CCV V;  4WFA V;  1KQS U;  1NJI W;  3CCU V;  4WFB V;  1QVG U;  1KC8 W;  1M1K W;  1VQO V;  3CC2 V;  3CCQ V;  1Q81 W;  1K9M W;  1VQ5 V;  1Q86 W;  1QVF U;  1YIT V;  3CCL V;  1K73 W;  2QA4 V;  1M90 W;  1YJ9 V;  3CCE V;  1N8R W;  2QEX V;  1S72 V;  4WF9 V;  3CME V;  1YJN V;  3CCS V;  3G6E V;  1YJW V;  3CC4 V;  1W2B U;  1VQ6 V;  1VQN V;  1YIJ V;  2OTJ V;  1VQP V;  1VQ8 V;  1VQ4 V;  2OTL V;  1VQL V;  1YHQ V;  3CC7 V;  1VQM V;  3I55 V;  1Q82 W;  1VQ9 V;  3I56 V;  3CMA V;  3OW2 U; 
#chains in the Genus database with same CATH topology
 1UFI A;  4LFA B;  2WLI A;  4MSW C;  3JAM N;  4HNA B;  1I5Y A;  3GWO A;  3WG7 C;  1RSO A;  1OCZ B;  5IJ9 A;  2F43 G;  3SYP A;  1QR8 A;  4AQY B;  3D3I A;  1NZ6 A;  4X1Y B;  2UUA B;  4WBN A;  2QKS A;  2JS5 A;  2RDC A;  1KKC A;  2BOC C;  3D3Q A;  1L8D A;  2UXD O;  4I55 A;  1SQX H;  5C8Y A;  3A0H Z;  3RYH A;  1F51 A;  2ZM6 O;  3ABK C;  3AG7 A;  4PD4 F;  5B1N A;  3OT7 A;  2QTS A;  1N8R W;  4JI8 O;  3ZMT A;  4DR1 O;  2GTS A;  2W6J G;  1TGO A;  3GWK C;  2F1M A;  1TUB A;  3SPG A;  2F4V B;  3K06 A;  2CUG A;  2ZD9 A;  1J95 A;  3K0G A;  4X89 A;  4J41 A;  1I0H A;  4NXM B;  4BR6 A;  2QA4 V;  2NN4 A;  1H2L A;  4U7O A;  2BCC H;  4O4I A;  2F23 A;  1MZE A;  4QNH B;  2ZIN A;  3P3N A;  1AJQ A;  4G27 B;  5CA0 B;  2EIK C;  2WLH A;  1Q8I A;  3G67 A;  5JH7 A;  2WLL A;  3JAT B;  2KG7 A;  2ODM A;  5DEC A;  3RYC B;  5B1A B;  3K5M A;  2M6Y A;  5BMV B;  4KL1 A;  3AG2 C;  2UU9 B;  4FLT A;  4DYL A;  2KSD A;  3E2E A;  2LJ2 A;  4PA3 A;  1VF6 C;  5H2F Z;  4HZ3 A;  4P30 A;  4AHC A;  2FB5 A;  3ETE A;  1THZ A;  2VQE B;  1KEC A;  4NXM O;  4HYO A;  4FLX A;  3CD6 V;  3K5N A;  2W0F C;  1MMM A;  2V7Q G;  1SA0 A;  1QVG U;  1EBO A;  5KUM A;  1KP3 A;  4XDJ A;  5B66 Z;  1BHB A;  2X6B A;  5LA6 A;  3AEI A;  2UXC O;  2KG7 B;  2Y4U A;  4LC1 A;  2C2A A;  4RUF A;  2WLM A;  3OGI B;  1KD1 W;  2XOK G;  2IM9 A;  1HNX B;  2E76 B;  1EN6 A;  5KAF Z;  3FFQ A;  2UU9 O;  4O2A A;  1DK1 A;  4GKJ B;  3ASN C;  2OIE A;  4O4L B;  3RW0 A;  2BTQ B;  3CX5 F;  3SJC C;  3L72 H;  3LNM B;  4YJ2 B;  1NR7 A;  1URF A;  2A0L A;  5AG2 A;  2RN9 A;  1N0N A;  1TUB B;  4LF8 B;  1MZF A;  3TXQ A;  1H2G A;  1R6K A;  4QPJ A;  4R7C A;  3HR0 A;  3H1H H;  1OV9 A;  2Q69 A;  3R65 A;  3JSL A;  1PL4 A;  4GKK B;  1M57 B;  1XHZ A;  4QE9 A;  2GHY A;  2ZR2 A;  2WA3 A;  3Q4H B;  3CC2 V;  3K04 A;  1FXK C;  2PI4 A;  1H2N A;  1M90 W;  4GX1 A;  2LW7 A;  2D2C B;  4PDV A;  3DGE A;  4E4E A;  4NVP A;  1GN3 A;  4U3J B;  1AR5 A;  1YSC A;  1EM1 A;  3SPI A;  3VQV A;  1R3J C;  3L71 H;  5BR8 O;  1SQP H;  3K3W A;  3M7M X;  2P67 A;  3E22 A;  1K92 A;  1OJH A;  1XNR B;  2Z3Y A;  5KHH A;  2PI5 A;  2EIJ C;  3UQ8 A;  3CCV V;  2YIB A;  3BFR A;  2ADQ B;  3ZN0 A;  3BRC A;  1YEW A;  1L0N H;  4O4J A;  1AJN A;  1KYO F;  4TSF G;  2PYL A;  3E8B A;  2BSK B;  2ZDI A;  1EZV H;  2ITD C;  3ZIA G;  1BS3 A;  3T1Y O;  4YY3 B;  4DR3 B;  4YHH B;  1P4R A;  2BTO A;  4TUY B;  3AG2 B;  4TT3 G;  1T5E A;  2IW5 A;  1R6T A;  1N32 B;  3OAA G;  3A2F A;  4DW1 A;  1QHT A;  4JGS A;  1VQ6 V;  3B40 A;  3TET A;  4JI7 O;  5K1P A;  2PUS A;  2EIJ B;  4PA4 A;  4J9Y B;  1PPJ H;  1YF2 A;  4I5S A;  5C93 A;  4KHP B;  3JAS B;  4B08 A;  4ZOL B;  1XQ8 A;  3E8F A;  5ITZ B;  4LCU C;  1VMG A;  1WB7 A;  2DYR C;  3P32 A;  5EYP A;  3N2G A;  2LQT A;  1VF5 B;  1ZX3 A;  2X6A A;  4ZI7 B;  3I56 V;  4ZKI A;  3FAV A;  3SYC A;  4GX2 A;  3L9D A;  4KFM A;  5IDJ A;  2Y48 A;  4CBC A;  4JAU A;  4UB8 Z;  4UCS A;  2XAH A;  1H8H G;  4YIO A;  3LNN A;  1SKV A;  2IJI A;  4CH5 A;  1CEZ A;  3BHP A;  4L87 A;  3ZMS A;  2LW1 A;  1GRJ A;  3WG7 B;  2M7W A;  5JQG A;  3P30 A;  5LP6 B;  2LFR A;  4BAY A;  1PKX A;  2OYQ A;  2OCH A;  4JI2 O;  4CS4 A;  4B3T O;  3QNE A;  2Q8V A;  3GB7 C;  1FD9 A;  3ABK B;  1E1R G;  1MNG A;  2H94 A;  5GTI Z;  1H2S B;  4X66 B;  1FYJ A;  2RCV A;  2P06 A;  2E75 B;  3LUT B;  5H9C A;  3JD0 A;  3QO7 A;  4D6T H;  4CC6 A;  1D2D A;  4PI0 A;  4LFA O;  3CC7 V;  2EIM C;  3O65 A;  1K34 A;  4X9Q A;  1S76 D;  3T1H B;  2FL4 A;  4UCO A;  1L1F A;  1K5Q A;  3T4Z A;  1PL0 A;  4X62 O;  1OCR C;  3LSS A;  4MT8 A;  4X8A A;  1SZT A;  2UXN A;  2AZ2 A;  4TV8 B;  3CS5 A;  1GM9 A;  4ICG A;  1X4T A;  3A0B Z;  2A3Q A;  1H8E G;  4WFE A;  3TK1 A;  1BL8 A;  4I50 A;  5KHI A;  3WB0 A;  1W0J G;  5IE9 A;  3CSX A;  1N36 B;  3SYA A;  3CRC A;  2ETN A;  3TJT A;  5B1A C;  1R3I C;  1XUQ A;  4JI4 B;  4JTA B;  2ADP A;  2B1I A;  3KG2 A;  1MAB G;  2K9P A;  2W0X A;  1YJ9 V;  1QR9 A;  5BXZ A;  2HHH O;  3KZI Z;  4YJ3 A;  3ZN1 A;  2PY5 A;  3ABL C;  4MTO A;  1VEW A;  4JI6 O;  3OEE G;  4J11 A;  3UO3 A;  3APO A;  3CHX A;  4JI0 O;  1S0V A;  1TVK A;  1KUQ A;  2CH7 B;  3SPC A;  1Q90 D;  2B9Z A;  2Q9L A;  3C90 A;  1RSO B;  2AHY A;  2AXT Z;  2VS0 A;  3J7A U;  2EUL A;  2Z5U A;  3RGB A;  5LHG A;  3NXS A;  1XHX A;  4UCR A;  3D8C A;  3BEH A;  3M99 B;  1KMI Z;  4H13 B;  4W4L A;  3SYQ A;  2RJZ A;  3JAL B;  1Q82 W;  2JGD A;  2Q7G A;  4FZ0 A;  1HDJ A;  4TWK A;  3QF7 A;  2Q68 A;  1A32 A;  3G71 V;  1P84 F;  4LF4 O;  1S77 D;  5FPR A;  3G4S V;  2CGN A;  5EIB D;  1YIT V;  4IGG A;  1EN4 A;  2G38 A;  3ZHV A;  2VQF O;  3LDD A;  3VOU A;  4JI0 B;  5FLX N;  2CAZ C;  3RFR A;  3RN4 A;  2DN9 A;  2ZE5 A;  1IBL B;  2QGN A;  4B3R O;  2OT5 A;  4I0X B;  1F4M A;  4DR6 O;  3CRQ A;  3JAR A;  4X20 B;  5KA6 A;  1CXZ B;  4CH4 A;  5LGT A;  1KC8 W;  3H1L H;  4TUY A;  1PNK A;  3F7V C;  4BIO A;  5LMN O;  5LOV B;  2P5O A;  1OZ0 A;  1GH6 A;  4CZZ A;  4PJ0 Z;  2YSU B;  3H1I H;  3NR7 A;  2GTA A;  1G8M A;  4I55 B;  2WLK A;  3OMI B;  4DR5 O;  1US6 A;  3JD1 A;  3E35 A;  2P22 C;  4FFK A;  5IYB O;  3W7S A;  2EIN B;  4FLY A;  3JYC A;  5L3D A;  2VQF B;  1S3J A;  4O2B A;  5J2U A;  3L74 H;  5IJ0 B;  1Y66 A;  1YJW V;  2OIG A;  5KHK A;  2R9R B;  5LGN A;  2PF4 E;  2A9H A;  1SQV H;  3JCZ A;  3AG4 C;  1I94 O;  1FKA O;  1JJ2 U;  1E79 G;  2Q73 A;  1WNS A;  4DV6 O;  4B3M O;  4GX5 A;  3CCQ V;  4MVR A;  2E74 B;  3MAQ A;  1X59 A;  1KU9 A;  3CCE V;  1KBH A;  2EIK B;  2CTP A;  1AI4 A;  1JMK C;  4HAM A;  2FML A;  4FM0 A;  2YXH A;  3IJ4 A;  3WB1 A;  1FJG O;  3K03 A;  3ML0 A;  4EFB A;  2JDI G;  4FMT A;  1JJO A;  3JAS A;  2JGD B;  5LGU A;  3IC7 A;  3SDL A;  4X1K A;  4DR2 O;  1E1Q G;  1WA8 B;  2XT9 A;  2Q7H A;  2EIM B;  4PDR A;  1CP9 A;  1S72 V;  4OX9 B;  4K3A A;  3BVO A;  1Y74 A;  2R72 A;  1AP5 A;  4JV5 O;  4YHH O;  4CH3 A;  3C3T A;  3SPJ A;  1GTO A;  3UT5 B;  1XNQ O;  4WFF A;  2HJD A;  2NLJ C;  1QLE B;  1GM8 A;  3E22 B;  3JD3 A;  2GBO A;  3K5O A;  1Y6X A;  4IT5 A;  4DV2 B;  2H8P C;  1NR1 A;  4LF8 O;  3TCU A;  4ASU G;  2KQX A;  3OW2 U;  2QM7 A;  1LR1 A;  3TXS A;  5LXT A;  5JQG B;  2P6J A;  1ZL8 B;  2QWR B;  3JAW B;  1F23 A;  4DV3 B;  2YS8 A;  1H2M A;  4O4H B;  4FLZ A;  1AI7 A;  4X64 O;  3N2K B;  4PEL A;  4R8C A;  4DV7 O;  2OWO A;  4K0K B;  3N27 A;  4MW3 A;  2CTQ A;  3OTO O;  4FM2 A;  3HKD B;  1J5E B;  5IJ0 A;  5LHH A;  4R6Z A;  2P4K A;  4TV9 A;  1HW7 A;  1NTZ H;  1NBM G;  2QWO B;  1HR0 B;  4E2L A;  4Z1V A;  4J7Z A;  4WCE V;  2UUA O;  3RBZ A;  5LA6 B;  3K9S A;  1Y76 B;  2AW9 A;  3VQX A;  3E8H A;  1K73 W;  4LP8 A;  3OMA B;  4XDK A;  2QEX V;  3RVZ A;  3UCS C;  1PM9 A;  5ITZ A;  2ZM6 B;  1BT8 A;  3VQY A;  4J7K A;  4F6R B;  4DUY B;  4KXR A;  3K79 A;  4IIJ A;  1NS1 A;  1M56 B;  3E89 A;  5L3C A;  1GM7 A;  4UVC A;  3ZHS A;  4DR1 B;  3T4D A;  3OR7 C;  5EBM C;  1FXK A;  3ETD A;  3OD4 A;  3CXH F;  5L3B A;  4DR7 O;  3WFV A;  2A7W A;  3W7X A;  2HKO A;  5LP6 C;  5KX5 B;  1YHQ V;  4DUZ O;  3CYO A;  1RM1 B;  1AI6 A;  2UUB B;  3FAV B;  2Q6A A;  2HEP A;  4X65 B;  4DV5 B;  2A79 B;  2K1E A;  2WLL B;  4IYI A;  1GN6 A;  4LF7 O;  3ZRX A;  3M8A A;  1YJN V;  1SS3 A;  2Z0A A;  4UCT A;  1FPO A;  1BSM A;  2ZIM A;  4MVU A;  3B2E E;  4JI4 O;  1NKD A;  3P3P A;  4UXN A;  3BCC H;  5CBH A;  3CCR V;  1WP8 A;  2XAQ A;  1SQB H;  3G80 A;  2YID A;  4AI8 A;  4FZ1 A;  3CPW U;  1SRY A;  3JAL A;  2VRZ A;  2OCC B;  4QPK A;  2HVK C;  2Q5Z A;  3F5W C;  1NU1 H;  4UV8 A;  2H3O A;  4JTD B;  1V9P A;  2Q7E A;  2ZT9 B;  3ABL B;  4MVM A;  1L0L H;  4O2A B;  5D5P A;  2DYS C;  1P7G A;  4K8Z A;  4NTW A;  1JA8 A;  4DR4 B;  3ABT A;  3FB5 C;  3X2Q B;  4FK5 C;  2PTM A;  3SYO A;  2ZCE A;  4ZHQ B;  1NQT A;  1CPY A;  2O57 A;  5JVD B;  1FXV A;  1YDX A;  5KMG A;  5B3S C;  3ZX6 A;  1B04 A;  2Y0I A;  1IBK B;  4LFB O;  2EIL C;  2UUC O;  3CME V;  4O4H A;  4P9P A;  5BY1 A;  2R9I A;  2DMX A;  4JAA A;  2AZ0 A;  2OCC C;  4CH6 A;  3C3S A;  3K9A A;  5FPO A;  1WP7 A;  1DLB A;  4FFB A;  1IDS A;  1QLE C;  2LO1 A;  1GAX A;  4WFG A;  4LR3 A;  5A9G A;  1F7Y A;  2XAF A;  1Z5V A;  2JJ1 G;  4X1I A;  5IYZ B;  4DR4 O;  5JWP A;  1BMF G;  1BQZ A;  3UT5 A;  4H44 B;  4FLU A;  2BSK A;  2CGO A;  1N34 B;  3RYF A;  4JI1 O;  4Z1M G;  2YI8 A;  3L70 H;  5JCO A;  2YEV A;  4LBE C;  1JQ0 A;  3U0Z A;  4WFB V;  1K33 A;  3AK1 A;  2Y4T A;  2X6C A;  5J9P C;  3OUS A;  3RYF B;  5E79 Z;  1ZUQ A;  4G2K A;  5CBF A;  2R70 A;  1O9H A;  5B1B B;  2ARH A;  1PP9 H;  4J80 A;  3E83 A;  1OCO C;  2QWN B;  3FB6 C;  1SER A;  5CB4 A;  4X88 A;  1NJI W;  4B3S O;  2F93 B;  1DTO A;  2JVD A;  1GN2 A;  3FKS G;  1JFF B;  1JPX A;  3H1J H;  4H37 A;  1OCC B;  1LNQ A;  2FYU H;  4OPA A;  5EZY B;  3ZHU A;  1IBL O;  3F7Y C;  4TV9 B;  3THO A;  4UVA A;  4PA9 A;  4MS2 A;  2GV9 A;  5IJ9 B;  4BWA A;  3AG1 B;  4GYC B;  1AR4 A;  3E8G A;  3K5L A;  4GUN A;  4MTX A;  4Q6G A;  4CC5 A;  5J2T B;  3FB7 C;  3LSQ A;  4H33 A;  4EEQ A;  5IY5 C;  1DF5 A;  1OCO B;  1MA1 A;  5LHI A;  2Y0P A;  2V4D A;  1XIL A;  5DM6 V;  1RPO A;  1XL6 A;  1WN7 A;  4BW5 A;  4LF9 O;  5J2U B;  4GKK O;  3JAW A;  1JFF A;  3RWR D;  3HKE A;  3PN1 A;  1M5I A;  1V55 B;  1VAR A;  4GT1 A;  4YJ3 B;  4X1I B;  4JAV A;  3AK3 A;  1SA0 B;  2QR4 A;  2Q0A A;  1IBM B;  1M4U A;  2JGU A;  1WPB A;  3UO2 A;  5B1O A;  4I4T B;  5L3G A;  1XMQ B;  4DV4 O;  4O4L A;  1RP3 B;  4IHJ B;  2VWJ A;  1GK9 A;  3K57 A;  3R66 A;  3L73 H;  3W7T A;  2IH3 C;  4TV8 A;  1HNZ B;  2XND G;  1LUV A;  3QG5 A;  2GUZ B;  3IC9 A;  2JEU A;  1VQP V;  2DE0 X;  2PYJ A;  4FLW A;  1FJG B;  4YXW G;  2DQ0 A;  1WA8 A;  3VQW A;  2UXB O;  3B8N A;  3D36 A;  4F6E A;  4WFH A;  5LYJ B;  4ZIB A;  4LFC B;  1XNR O;  4DV7 B;  3H01 A;  1JOY A;  3H1K H;  2W6I G;  1YZB A;  1K7D A;  1U97 A;  1BQ0 A;  1XDC A;  4YJ2 A;  4CS2 A;  4W4K A;  3X2Q C;  3G6E V;  5C8Y B;  1D5N A;  1HNW O;  5JJN B;  5GW7 A;  4IHJ A;  4MW8 A;  3ZRS A;  4HNA A;  4KUM A;  2HVJ C;  3ZMZ A;  2IU0 A;  5LMU B;  1Q43 A;  1S5L Z;  4NXN B;  1QU7 A;  2LGW A;  3CCU V;  2RNB A;  2KB1 A;  1Q86 W;  4D7T A;  1NI8 A;  4QE7 A;  3ZS8 C;  4FLV A;  1WJZ A;  1AP6 A;  4B3M B;  5CB4 B;  1YIJ V;  3JSN A;  1VQ8 V;  4UVB A;  4JI3 O;  1XOU A;  1VQN V;  3SJA C;  3I55 V;  2UXB B;  4NTY A;  3ETQ A;  1ZL8 A;  1TA8 A;  2XHB A;  3FX7 A;  3HB3 B;  3ZHR A;  2Q67 A;  1YTF B;  2GSM B;  1IVS A;  4K35 A;  3GVM A;  4JI5 O;  3DXR B;  1KKD A;  4DV1 O;  5EYP B;  3HKD A;  3I5D A;  3WU2 Z;  1OCZ C;  2F4V O;  4U3F H;  2XTA A;  2IU3 A;  3AG4 B;  2AHZ A;  2JRI A;  4JYB A;  1NTM H;  4RUE A;  3DXR A;  4NXN O;  1K4C C;  2WLI B;  4AQY O;  1PNL A;  4U7N A;  3JAR B;  1JVM A;  4X20 A;  1K5S A;  1FFX B;  2ZE6 A;  3OM3 B;  3RVY A;  4I4T A;  3QO8 A;  4J42 A;  2IBZ H;  4GLX A;  2HFE C;  2BOB C;  5LL6 Y;  2ZE8 A;  1FXK B;  4B3T B;  2ITC C;  1MSD A;  3T2M A;  1ENV A;  1Q7Y W;  4IIJ B;  4PHZ A;  4J10 A;  1BHA A;  3ABU A;  2N04 A;  1DGS A;  3W7W A;  1WLE A;  4TQD A;  1R3L C;  1W2B U;  5EIB C;  3BA9 A;  1K4D C;  1TAE A;  2P7T C;  2L35 A;  3J80 N;  4JPR A;  3DTU B;  4FIP C;  1O9G A;  5KHG A;  2FTK A;  4FM1 A;  1G4Y B;  3BA8 A;  2UUC B;  3CRR A;  5IY5 B;  1W0K G;  4RQE A;  4EFE A;  2X0L A;  4ZOL A;  1U96 A;  2X7R B;  4DK1 A;  3N2K A;  4BW9 A;  2ATK C;  4PA7 A;  4FPP A;  1SET A;  4WBN B;  2E5L O;  2EIL B;  5BMV A;  3IFX A;  5EBL C;  4I0X A;  4JI2 B;  2WSS G;  4OGQ B;  2JEX A;  1B06 A;  2YEV B;  2YUA A;  1Q6U A;  4EB6 B;  4JTC B;  1VQ4 V;  1TVK B;  4LF6 O;  3SPH A;  1VQ9 V;  5H6Q A;  4JI8 B;  4ZHQ A;  1XEQ A;  2QKC A;  2P4V A;  2YXL A;  3B77 A;  4EB6 A;  2HP8 A;  1FFT B;  2B1G A;  5IWA B;  3CCL V;  2IH1 C;  4P9O A;  4X65 O;  4DK0 A;  2DQ3 A;  5CA1 B;  5JCO C;  2GUZ A;  1MOF A;  3OE7 G;  1P49 A;  5J2T A;  2OTL V;  2CE4 A;  4F6R A;  4FJC C;  4PI2 A;  3UM7 A;  4PDL A;  1EZJ A;  2DWE C;  3ZRW A;  1HNX O;  4MVO A;  1XBL A;  1G6U A;  3SJB C;  4UFZ A;  4UCV A;  2WWW A;  2GDS A;  2YDE A;  1KQS U;  2WAM A;  1Z2G A;  1NVP D;  1WAZ A;  1RFY A;  1EFR G;  2MK3 A;  3JAK A;  2WLJ A;  5IYC O;  3CJH B;  2QM4 A;  1LUW A;  1ROP A;  5CA3 A;  2RMK B;  1P7B A;  1ARO P;  4DV0 B;  1AI5 A;  4Q20 A;  4DRX A;  1RM1 C;  5KUK A;  4C7U A;  2DYR B;  4GZR B;  3VBB A;  3OMN B;  1SZX A;  1ZLZ A;  1Q6H A;  1GO3 F;  3TGU H;  2CTR A;  3RYI A;  1HP8 A;  1OCC C;  2LP7 A;  1VP7 A;  2ZKO A;  1HWY A;  2DJV A;  4DR5 B;  4LF9 B;  3ZMV A;  3FB8 C;  2ZXW C;  1ZWI C;  1K97 A;  5LBQ A;  1Q6I A;  1Q3E A;  5LXT B;  4BIU A;  4B3S B;  2LFS A;  4JYA O;  2QTO A;  2UXX A;  1Q5O A;  2CH7 A;  2NR5 A;  5IYD O;  4CS3 A;  3SJQ C;  3KCX A;  2HG5 C;  3K58 A;  1ZSP A;  3EHB B;  2EIN C;  1KB9 F;  2DYS B;  1AVM A;  2BE3 A;  1NH2 D;  4LNU B;  3OR6 C;  1XMQ O;  4LF5 B;  3KKY A;  1TUE B;  1FFX A;  1OCR B;  3KCY A;  4GCZ A;  2EZP A;  3N2G B;  3A8T A;  3K59 A;  3AK2 A;  5B3S B;  4UCU A;  4LNU A;  2QM8 A;  3A0R A;  4DV2 O;  1QVF U;  1NVP B;  1GKF A;  3FYI B;  4QGP A;  2ZNJ A;  4KHP O;  3DSQ A;  1IXB A;  4F4L A;  3IGA C;  3FD9 A;  3HKE B;  1FXH A;  1H2K A;  4NTX A;  5JJE B;  2XAJ A;  4R50 A;  5LP6 A;  4JYA B;  2YIB D;  3ZHT A;  3HKB B;  1QCE A;  3ZCC A;  4BIZ A;  1AJP A;  5K1X A;  1MG1 A;  3RT3 C;  1RPR A;  4WF9 V;  1M93 A;  4LF5 O;  4FVM A;  4IL6 Z;  1SC5 B;  3ABM C;  1IBM O;  5EC2 C;  4XBF A;  5JVD A;  1VF7 A;  1NH2 B;  5KX5 A;  3O9O A;  3G6B A;  4JV5 B;  2DOS A;  3S3W A;  4O4J B;  4N23 A;  2WPD G;  5E1A C;  1BE3 H;  3T1Y B;  1NT2 B;  3ZRW B;  1N32 O;  4JI3 B;  1MSW D;  4DV6 B;  2Y69 B;  2EBO A;  3LDE A;  5CN0 A;  1FAF A;  2UXD B;  1WPX A;  2QWP B;  2B5U A;  4J7J A;  2DWD C;  4TOI A;  3CXC U;  3CP1 A;  5LYJ A;  3CJH A;  4X66 O;  3Q4H A;  3EVK A;  1R6N A;  5IT9 N;  1Z5W A;  4DV3 O;  2ZQM A;  5TIS Z;  4I7Z B;  4I50 B;  4DUZ B;  3U11 A;  4JYC A;  1M9N A;  2CDY A;  4OXS A;  4U3J A;  4UV9 A;  3HKC B;  1QLN A;  1J5E O;  5F2V O;  2L6L A;  2BTQ A;  1PNM A;  3U10 A;  4JZG A;  2IJK A;  2E3C A;  3ICX A;  4JAS A;  2D3O W;  3AG1 C;  1SES A;  3T1C A;  2Q4P A;  2VWK A;  2LGQ A;  4DXW A;  1GN4 A;  2HLD G;  5GON B;  4DV4 B;  1W59 A;  2IJJ A;  3ZRV A;  1N36 O;  5CA1 A;  4JF3 A;  1VQL V;  1HNZ O;  2MW2 B;  2AGA A;  4B7E A;  2WA4 A;  2QKA A;  4MVZ A;  5KAI Z;  4DUY O;  2HHH B;  3ZJZ A;  5HFM A;  1K3E A;  2QJ1 A;  4KP4 A;  1V55 C;  2YI9 A;  4MTG A;  4JZ2 A;  3JAK B;  3RYH B;  3ASN B;  4QJF B;  2VQE O;  4X64 B;  2YC0 A;  4FFB B;  3STZ C;  4H0L B;  1EN5 A;  3WB2 A;  4G28 B;  4MVQ A;  3HPL C;  1IBK O;  4LFB B;  1G1X B;  2UUB O;  1AB3 A;  1YVW A;  5L3F A;  3T1H O;  4LF7 B;  2XAS A;  3EXA A;  2UXC B;  4LH6 A;  1YTF D;  4DV5 O;  1Y76 A;  5JJJ B;  4X62 B;  1WB8 A;  4GX0 A;  1IX9 A;  4NYK A;  1V54 C;  2DW4 A;  2XUM A;  1QNM A;  4AIL C;  2RQ6 A;  4LF4 B;  1JX9 A;  2YXY A;  5JH7 B;  1N33 O;  1QQC A;  3CMA V;  2EJ7 A;  2ILM A;  2WLN A;  3PJS K;  1VQK V;  5CA0 A;  3ETG A;  1VIB A;  5LOV A;  4GKJ O;  5BZB A;  1XMO B;  4RO2 A;  1IXM A;  3AG3 B;  5L3E A;  1BZK A;  3JD4 A;  1VQ5 V;  3JAT A;  4LF6 B;  3FYE B;  4JI6 B;  4LH7 A;  3JCU Z;  3ZED A;  5A2Q N;  1Y74 B;  1DF4 A;  1Y67 A;  2XAG A;  3CEI A;  4DR7 B;  4DO2 A;  1D5A A;  1SQG A;  2PZS A;  3K08 A;  4O2B B;  3D36 C;  4A5U B;  1I7F A;  5KA5 A;  1N4C A;  5EZY A;  1UPG A;  3CRM A;  4RAI A;  3ZMU A;  1N33 B;  2EJR A;  4TQF A;  1VQM V;  2JJ2 G;  5CBG A;  3B09 A;  1BCC H;  3S3X A;  2ZIO A;  1XMO O;  4NB5 A;  3HKC A;  4WFA V;  1KP2 A;  4ZBM A;  1K9M W;  4X1K B;  3ZHQ A;  5KLV H;  3MHH C;  1I94 B;  3DC6 A;  4NKG B;  3ASO B;  1N34 O;  4P2Z A;  5FL7 G;  3OUF A;  4DR6 B;  1S5J A;  2PGG A;  2ZNI A;  2FKX A;  1IUR A;  4DW0 A;  2HR3 A;  1Q81 W;  1GMG A;  2NNU A;  4J9Z B;  1AR1 B;  1YCI A;  1FS0 G;  2CK3 G;  5LMN B;  1B6Q A;  3F5T A;  3QTC A;  3BY6 A;  3RYC A;  3APQ A;  4PDM A;  3ZBH A;  1JR9 A;  1PD3 A;  1N0J A;  1SQF A;  3BAA A;  4OPH A;  4YIP A;  3CCJ V;  2F66 C;  1NTK H;  5B1B C;  1M1K W;  3E86 A;  1QBZ A;  3MD0 A;  1VF6 A;  3L75 H;  4IYH A;  2EX3 A;  4DV0 O;  1M56 C;  2E5L B;  3SR2 C;  2ZXW B;  1SF9 A;  3BAB A;  4YY3 O;  4DR3 O;  5KHJ A;  1B3Q A;  5CMU A;  1R73 A;  4LWS A;  1S5H C;  2ZE7 A;  1ZAU A;  5IYZ A;  1XRE A;  3OFN G;  4B3R B;  3EFF K;  1VQO V;  2A06 H;  5D5Q A;  4JI7 B;  3MDS A;  4JI1 B;  5BR8 B;  5B5E Z;  3OGC C;  3HKB A;  4D7S A;  5FNV B;  2IJH A;  5H5N A;  4N21 A;  4L8J A;  3QO5 A;  5IWA O;  2QWQ B;  1I5X A;  1XI1 A;  1COW G;  4X1Y A;  5EC1 C;  3OTO B;  3JD2 A;  1ZTE A;  2JK5 C;  2KKW A;  2V1D A;  3ABM B;  3B8M A;  1OHH G;  4XDL A;  5LMU O;  3OTF A;  4UUJ C;  3CRA A;  4PV1 B;  1K8A W;  3CE2 A;  1Y4M A;  3CWB H;  1XNQ B;  4NR1 A;  5GTH Z;  5KMG B;  4UB6 Z;  1YI2 V;  2EZO A;  2QE7 G;  4Z2W A;  1V54 B;  3DC5 A;  3QVN A;  2N05 A;  3OEH G;  3RYI B;  4MTF A;  2N74 A;  3CCS V;  3IAY A;  2JS3 A;  1R3K C;  1PV0 A;  4I9Q A;  3J81 N;  4LFC O;  3AG3 C;  1JCH A;  4ABM A;  3CCM V;  3W7U A;  1SQQ H;  4DRX B;  4DV1 B;  3LSU A;  2Y69 C;  4RQF A;  2ZDI C;  4B7K A;  1ORQ C;  5H6R A;  2HJF C;  2ZR3 A;  3B4S A;  1IZ3 A;  4DR2 B;  2F95 B;  4QIW F;  5EK0 A;  1R1B A;  4ZI7 A;  3SGI A;  2R9A A;  5GON A;  1HR0 O;  1HNW B;  4I9W A;  4K8X A;  4OX9 O;  2JIZ G;  3CB2 A;  3LDC A;  5HFL A;  1AIL A;  1F4N A;  3K0D A;  1BGY H;  4RWU A;  2QDO A;  4PA6 A;  4LWS B;  4O4I B;  2YIA A;  2Q0O C;  3CC4 V;  4EKW A;  5DED A;  5EBW C;  1I08 A;  3BPZ A;  3STL C;  1VQ7 V;  5FNV A;  2QSA A;  3UKM A;  2CTW A;  3MHS C;  1M57 C;  3ASO C;  3H9V A;  1UJW B;  4MVS A;  4JI5 B;  1H38 A;  5DN6 G;  1XL4 A;  2P90 A;  2YIC A;  2OTJ V;  1YXB A;  4JYY A;  4K0K O;  4HBN A; 
#chains in the Genus database with same CATH homology
 4UVA A;  3SPC A;  2WLI A;  4MSW C;  1I5Y A;  3GWO A;  3WG7 C;  4PA9 A;  4MS2 A;  4N23 A;  1OCZ B;  2WPD G;  5E1A C;  2F43 G;  2AHY A;  3SYP A;  1QR8 A;  3AG1 B;  2Z5U A;  3D3I A;  5LHG A;  3NXS A;  3ZRW B;  3E8G A;  1MSW D;  2Y69 B;  2EBO A;  2QKS A;  3BEH A;  3LDE A;  3M99 B;  4MTX A;  5CN0 A;  1WPX A;  3FB7 C;  3LSQ A;  4H33 A;  3SYQ A;  5IY5 C;  1DF5 A;  2B5U A;  2BOC C;  1OCO B;  2DWD C;  1Q82 W;  5LHI A;  4TWK A;  3CXC U;  3CP1 A;  2Q68 A;  3G71 V;  5DM6 V;  1RPO A;  1XL6 A;  4BW5 A;  1S77 D;  1R6N A;  1F51 A;  3G4S V;  3ABK C;  5B1N A;  2ZQM A;  1YIT V;  1V55 B;  4GT1 A;  1N8R W;  4JYC A;  1M9N A;  3LDD A;  4JAV A;  3ZMT A;  3VOU A;  4OXS A;  2W6J G;  4UV9 A;  1QLN A;  1PNM A;  2OT5 A;  5B1O A;  3SPG A;  5L3G A;  2IJK A;  3K06 A;  1F4M A;  2ZD9 A;  1J95 A;  3K0G A;  4JAS A;  5KA6 A;  3AG1 C;  1SES A;  4X89 A;  2D3O W;  3T1C A;  1GK9 A;  5LGT A;  1KC8 W;  4DXW A;  3W7T A;  2IH3 C;  2HLD G;  2QA4 V;  1PNK A;  2XND G;  4U7O A;  3F7V C;  4QNH B;  2IJJ A;  3ZRV A;  1OZ0 A;  1AJQ A;  4G27 B;  2JEU A;  2EIK C;  4CZZ A;  1VQP V;  4JF3 A;  1VQL V;  2YSU B;  2WLH A;  1G8M A;  2WLK A;  2WLL A;  4YXW G;  3OMI B;  2DQ0 A;  3JD1 A;  3E35 A;  3B8N A;  3D36 A;  4WFH A;  4MVZ A;  5IYB O;  5B1A B;  3W7S A;  2EIN B;  3H01 A;  1JOY A;  2W6I G;  3JYC A;  3ZJZ A;  5L3D A;  5HFM A;  1K3E A;  1K7D A;  4KP4 A;  1V55 C;  3AG2 C;  4MTG A;  1S3J A;  3ASN B;  4QJF B;  3X2Q C;  1Y66 A;  3G6E V;  1YJW V;  2R9R B;  5LGN A;  3E2E A;  2A9H A;  3STZ C;  4PA3 A;  5GW7 A;  4HZ3 A;  3JCZ A;  4MW8 A;  4P30 A;  3AG4 C;  3ETE A;  3ZRS A;  4G28 B;  4MVQ A;  4KUM A;  1THZ A;  3HPL C;  2HVJ C;  3ZMZ A;  2IU0 A;  1E79 G;  1JJ2 U;  1KEC A;  5L3F A;  4HYO A;  3CD6 V;  2W0F C;  2XAS A;  2V7Q G;  3CCU V;  4GX5 A;  1QVG U;  1YTF D;  3CCQ V;  4MVR A;  2KB1 A;  1Q86 W;  1EBO A;  5KUM A;  1KP3 A;  4XDJ A;  1BHB A;  2X6B A;  4GX0 A;  3CCE V;  4QE7 A;  1V54 C;  2DW4 A;  3AEI A;  2EIK B;  1AI4 A;  1YIJ V;  1VQ8 V;  1JX9 A;  4UVB A;  4LC1 A;  4HAM A;  1VQN V;  2C2A A;  3I55 V;  4RUF A;  3CMA V;  2WLM A;  2WLN A;  3PJS K;  1VQK V;  2XOK G;  3K03 A;  1KD1 W;  3ML0 A;  3ETG A;  3HB3 B;  2JDI G;  4FMT A;  2Q67 A;  5BZB A;  1YTF B;  5LGU A;  3IC7 A;  4RO2 A;  2GSM B;  1IXM A;  3AG3 B;  5L3E A;  3JD4 A;  1VQ5 V;  1E1Q G;  1KKD A;  3FYE B;  2EIM B;  4PDR A;  3ASN C;  1CP9 A;  1S72 V;  1DF4 A;  1OCZ C;  2XAG A;  3RW0 A;  2IU3 A;  3AG4 B;  2AHZ A;  4JYB A;  4RUE A;  4DO2 A;  3SPJ A;  1GTO A;  1K4C C;  2WLI B;  3LNM B;  3K08 A;  1NR7 A;  2A0L A;  1PNL A;  4U7N A;  5KA5 A;  1JVM A;  4WFF A;  1K5S A;  3OM3 B;  3RVY A;  2NLJ C;  1QLE B;  1GM8 A;  3JD3 A;  4RAI A;  3QO8 A;  3ZMU A;  1H2G A;  2EJR A;  1R6K A;  2H8P C;  4QPJ A;  1NR1 A;  2HFE C;  2BOB C;  1VQM V;  2JJ2 G;  4R7C A;  3TCU A;  4ASU G;  5CBG A;  2Q69 A;  3R65 A;  3OW2 U;  2QM7 A;  1FXK B;  2ITC C;  2P6J A;  1M57 B;  3T2M A;  1ENV A;  1Q7Y W;  1F23 A;  2GHY A;  2ZR2 A;  4QE9 A;  4WFA V;  1BHA A;  1AI7 A;  3CC2 V;  1KP2 A;  4ZBM A;  3K04 A;  3ABU A;  1K9M W;  1FXK C;  2PI4 A;  4PEL A;  3MHH C;  1M90 W;  4R8C A;  4MW3 A;  3W7W A;  4GX1 A;  1WLE A;  1R3L C;  1W2B U;  5LHH A;  4PDV A;  3ASO B;  3DGE A;  4R6Z A;  1K4D C;  4P2Z A;  5FL7 G;  1NBM G;  2P7T C;  3OUF A;  1YSC A;  4E2L A;  4JPR A;  3DTU B;  4WCE V;  4FIP C;  3RBZ A;  2FTK A;  1G4Y B;  3SPI A;  2HR3 A;  1R3J C;  1Q81 W;  3K3W A;  3E8H A;  1GMG A;  1W0K G;  5IY5 B;  2P67 A;  4RQE A;  4LP8 A;  3OMA B;  1K73 W;  4XDK A;  2X0L A;  2QEX V;  2NNU A;  3RVZ A;  4J9Z B;  1AR1 B;  1FS0 G;  2CK3 G;  1B6Q A;  1K92 A;  2X7R B;  3BY6 A;  4PDM A;  2ATK C;  1PD3 A;  4PA7 A;  4FPP A;  2Z3Y A;  1SET A;  2PI5 A;  3K79 A;  2EIJ C;  3CCJ V;  3E89 A;  1M56 B;  5L3C A;  1GM7 A;  4UVC A;  3CCV V;  2EIL B;  3T4D A;  5B1B C;  1M1K W;  3OR7 C;  3IFX A;  5EBM C;  1FXK A;  3ETD A;  5EBL C;  3E86 A;  5L3B A;  1QBZ A;  2WSS G;  3MD0 A;  3WFV A;  3ZN0 A;  3W7X A;  2HKO A;  1M56 C;  2JEX A;  2YEV B;  1AJN A;  2ZXW B;  4JTC B;  1VQ4 V;  1YHQ V;  4TSF G;  3E8B A;  3SPH A;  1VQ9 V;  3CYO A;  5H6Q A;  1AI6 A;  1RM1 B;  2ZDI A;  5CMU A;  1R73 A;  2Q6A A;  2ITD C;  1S5H C;  3ZIA G;  3OFN G;  3B77 A;  1P4R A;  3EFF K;  4TT3 G;  3AG2 B;  2A79 B;  1VQO V;  1FFT B;  2K1E A;  2WLL B;  2B1G A;  2IW5 A;  3CCL V;  3ZRX A;  2IH1 C;  4P9O A;  3OGC C;  2DQ3 A;  3OAA G;  1YJN V;  2IJH A;  1VQ6 V;  4JGS A;  1MOF A;  3OE7 G;  4N21 A;  3TET A;  2OTL V;  2EIJ B;  3QO5 A;  4J9Y B;  4PA4 A;  4MVU A;  1I5X A;  4FJC C;  1NKD A;  1COW G;  4UXN A;  3UM7 A;  4PDL A;  1EZJ A;  2DWE C;  4I5S A;  3ZRW A;  4MVO A;  5EC1 C;  5C93 A;  5CBH A;  3CCR V;  2XAQ A;  3CPW U;  1SRY A;  2WWW A;  2OCC B;  1KQS U;  2WAM A;  3E8F A;  3JD2 A;  4QPK A;  2HVK C;  4LCU C;  2JK5 C;  1NVP D;  3F5W C;  4UV8 A;  1EFR G;  2DYR C;  2MK3 A;  2WLJ A;  3P32 A;  4JTD B;  2V1D A;  5IYC O;  3ABL B;  4MVM A;  3ABM B;  1ROP A;  5CA3 A;  1P7B A;  1ARO P;  3B8M A;  1OHH G;  2DYS C;  1AI5 A;  4Q20 A;  4XDL A;  1RM1 C;  4UUJ C;  5KUK A;  3I56 V;  2X6A A;  3ABT A;  2DYR B;  3FB5 C;  3X2Q B;  4ZKI A;  1K8A W;  4FK5 C;  1Y4M A;  3OMN B;  3VBB A;  3SYO A;  1NQT A;  1CPY A;  3SYC A;  1YI2 V;  2EZO A;  2QE7 G;  4GX2 A;  1FXV A;  1V54 B;  4KFM A;  5B3S C;  2Y48 A;  5IDJ A;  4CBC A;  4JAU A;  1GO3 F;  2EIL C;  2XAH A;  1H8H G;  1OCC C;  2LP7 A;  3OEH G;  4MTF A;  3CME V;  3CCS V;  2IJI A;  4P9P A;  1CEZ A;  1R3K C;  4L87 A;  3ZMS A;  1HWY A;  3WG7 B;  2R9I A;  2M7W A;  3ZMV A;  3FB8 C;  2ZXW C;  2OCC C;  3P30 A;  3K9A A;  1ZWI C;  1K97 A;  2LFR A;  5LBQ A;  3AG3 C;  1DLB A;  1JCH A;  1PKX A;  4BAY A;  3CCM V;  3QNE A;  4BIU A;  3W7U A;  3GB7 C;  1QLE C;  2LFS A;  2QTO A;  2UXX A;  3ABK B;  4WFG A;  1E1R G;  2Y69 C;  2H94 A;  4RQF A;  2XAF A;  2ZDI C;  1ORQ C;  2JJ1 G;  5H6R A;  5IYD O;  3LUT B;  2HJF C;  3SJQ C;  2ZR3 A;  5H9C A;  2HG5 C;  3JD0 A;  3QO7 A;  3EHB B;  2EIN C;  2DYS B;  1NH2 D;  4QIW F;  5EK0 A;  3OR6 C;  1BMF G;  3CC7 V;  2EIM C;  1K34 A;  1TUE B;  1OCR B;  4I9W A;  2JIZ G;  4GCZ A;  1S76 D;  2EZP A;  1L1F A;  3LDC A;  4Z1M G;  1K5Q A;  2YEV A;  5B3S B;  4LBE C;  1JQ0 A;  5HFL A;  3T4Z A;  1PL0 A;  1F4N A;  3K0D A;  4WFB V;  1OCR C;  3LSS A;  4PA6 A;  2QM8 A;  3A0R A;  1K33 A;  4MT8 A;  4X8A A;  1QVF U;  1SZT A;  1NVP B;  2UXN A;  2X6C A;  5J9P C;  1GKF A;  1GM9 A;  3FYI B;  3OUS A;  3CC4 V;  4EKW A;  4G2K A;  1H8E G;  4WFE A;  3TK1 A;  1BL8 A;  5CBF A;  5EBW C;  5B1B B;  4F4L A;  3IGA C;  1W0J G;  1FXH A;  3STL C;  3SYA A;  1VQ7 V;  2XAJ A;  4R50 A;  3E83 A;  1OCO C;  3UKM A;  3FB6 C;  5B1A C;  1QCE A;  1SER A;  1R3I C;  3ZCC A;  4JTA B;  4X88 A;  4BIZ A;  1NJI W;  1AJP A;  3MHS C;  2B1I A;  3KG2 A;  1M57 C;  1MAB G;  1DTO A;  1MG1 A;  3ASO C;  1UJW B;  1RPR A;  1YJ9 V;  1QR9 A;  4MVS A;  1H38 A;  5DN6 G;  1XL4 A;  2P90 A;  4WF9 V;  3FKS G;  3ZN1 A;  1JPX A;  3ABL C;  4MTO A;  3ABM C;  4H37 A;  1OCC B;  1LNQ A;  2OTJ V;  3OEE G;  5EC2 C;  4XBF A;  1S0V A;  1NH2 B;  3F7Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...