1VQKV

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqkV00
3G6EV 4WFBV 1Q86W 1KD1W 3CC2V 1VQ9V 3CMAV 3CCVV 1QVFU 1YIJV 3CCJV 1Q81W 1VQNV 3OW2U 1YHQV 1W2BU 3CCRV 1M90W 1VQPV 3CCQV 1Q82W 3CCUV 3I55V 1VQ7V 1N8RW 3CC4V 1Q7YW 1YJWV 3CCSV 1YITV 5DM6V 2QEXV 1KQSU 3CCMV 1R73A 1M1KW 1JJ2U 3G4SV 3CC7V 1NJIW 3CMEV 1VQ5V 1K73W 3CCEV 2D3OW 1VQMV 3CXCU 2OTJV 3G71V 1QVGU 1S72V 3CCLV 4WCEV 1VQ4V 1YJNV 1KC8W 1K8AW 4WFAV 3CPWU 3CD6V 1K9MW 4WF9V 2QA4V 1VQ8V 2OTLV 1VQLV 1VQOV 1YI2V 3I56V 1VQ6V 1YJ9V 1VQKV
chains in the Genus database with same CATH superfamily
4FLWA 3R66A 1K4DC 3TXQA 1N0NA 3CMAV 5CN0A 2BSKA 2EILC 5F2VO 2XT9A 4C7UA 4KHPB 4LFAB 2A7WA 1PL0A 3T4DA 3OR6C 2XAFA 5KHHA 2DQ3A 5LOVA 4JI2O 4A5UB 5LMUO 3AG1B 2GBOA 4OGQB 1SA0B 2Q9LA 4RO2A 4DV3B 3OGIB 4UVAA 4LF4B 3TCUA 3MD0A 2IU3A 3JD1A 1BT8A 4UUJC 2EJ7A 3ABUA 1XI1A 4GX1A 4TQFA 3FB6C 1RPRA 1Z5VA 4JI3B 4LCUC 2NNUA 1EN5A 2ZXWC 1FXKB 3ABMB 5LHHA 4JGSA 1M4UA 2KSDA 2W0FC 4X20B 4DRXB 4JI6B 1VQ9V 3E86A 2HVJC 3H1HH 5CBFA 1YJWV 2DWEC 5LGTA 1KQSU 3DXRA 3CEIA 4DR7B 4B3SB 1J95A 2EIMB 2C2AA 2EIKC 4JV5O 4JI7O 1NVPD 1XMOO 1BQZA 4JYAO 3ML0A 4TUYA 1SA0A 4HNAA 5CA1B 3RT3C 5HFLA 4DYLA 4H33A 4GLXA 1YHQV 3I55V 3BA8A 1YDXA 5BR8O 5KHGA 1K3EA 4EFBA 1QBZA 3FB8C 4UXNA 4FVMA 3QO7A 3C3SA 1PL4A 4DV4O 3K06A 4BR6A 3CCLV 2EINB 1QLEC 4L87A 3F7YC 4K0KB 1FXKA 2CDYA 2JGUA 3HKCA 1PM9A 2XUMA 5A2QN 3AG7A 3FB7C 4I5SA 1FFXA 3SPIA 4ZKIA 1AILA 3OR7C 4NYKA 2WSSG 2KQXA 4GKKO 1N36O 2QKCA 1I5XA 3D3IA 4UCOA 3DXRB 5CA3A 3TJTA 2F4VO 2X6BA 2HKOA 3W7SA 1VQLV 2YEVB 4D7SA 4WFBV 4J9YB 1DLBA 3CCRV 4FFBB 2Q0OC 1P84F 4PDMA 4X66O 2LGQA 2EX3A 4FZ1A 3KCYA 5GONB 2BE3A 5H5NA 4GKKB 2EILB 3SPCA 3T1CA 3FB5C 1MZFA 3KCXA 3ICXA 1ZLZA 4LR3A 4NXMO 3CCEV 4X64B 1KMIZ 3SYPA 2PI5A 1YEWA 3TK1A 4LFCO 3OTOO 2N05A 4ZHQA 2QWNB 3JAKB 2ZIOA 4O4JB 4GZRB 5LHGA 1PNMA 2QTSA 3UQ8A 4JYCA 4TWKA 4DV3O 3DGEA 3U0ZA 4Q20A 3QVNA 1KKDA 5KMGB 2FYUH 1NQTA 4TQDA 1OCCC 3K03A 5ITZB 3JAWB 1R6NA 2YIBA 5JJJB 1KYOF 2GUZA 3JATB 4KHPO 5GONA 2WLKA 3JSNA 4BW9A 3E22B 1E1QG 1QR9A 4UV8A 3AG4B 2ATKC 2OCCC 1B04A 4JTAB 2JDIG 4DV7O 1L1FA 2A06H 3FX7A 2BTQA 3H1KH 3DSQA 1T5EA 1XMQB 4TOIA 2UUCB 2HLDG 3ZRWB 1K97A 5H2FZ 1YIJV 4LF5B 3UT5B 4YIPA 3OUFA 3T1HB 4HYOA 1E79G 1EM1A 5B1OA 2ZNIA 3CX5F 3RYCA 4FIPC 1KP2A 1NS1A 2DJVA 2Q6AA 4LF8O 4O4HA 4GYCB 3RYFA 2Y48A 2YICA 4DR6O 3RFRA 2UU9B 3JAWA 1GMGA 4B7EA 1SQPH 2GUZB 5E1AC 3E2EA 2ZD9A 4JI8O 2K1EA 4UFZA 3STLC 1TUBA 1JA8A 4YJ3B 4RUFA 1GH6A 1MMMA 1XL6A 3L73H 3NR7A 4B3SO 2DYSC 3QG5A 3AG2C 3AG1C 3BA9A 2PZSA 3S3XA 1JCHA 4MVMA 2N04A 4JAVA 2PYJA 2OTLV 1US6A 1AR1B 4DV5O 2E74B 1X59A 2HR3A 2WLIB 3BY6A 1FXHA 4CBCA 1Y66A 2HG5C 1VQPV 4AHCA 1N4CA 1IURA 3ASNB 4YJ2A 3K0DA 3JSLA 3I5DA 3FD9A 2GSMB 3HKCB 4JI3O 4MTXA 3X2QB 1BE3H 3CRQA 4LF9B 4ZOLA 2GTAA 5IYCO 3ZRSA 3D3QA 3CCJV 2YI8A 1SERA 4LWSA 3A0BZ 1U97A 3JASB 2BOBC 2BCCH 1FJGO 2EZOA 3TETA 2UU9O 1HNWO 1A32A 1VQMV 3B4SA 4X89A 4I4TA 2NLJC 4CH3A 5LP6A 1OCRB 1AI4A 3ZRXA 3JD4A 2MW2B 1G6UA 3BFRA 4MW3A 2PY5A 3BRCA 4RUEA 2XAGA 5BZBA 1WPXA 1GN3A 1HNZB 5JVDA 3Q4HA 2LO1A 1YZBA 4NTXA 2CTWA 2QDOA 4O4IB 3LDDA 2IJKA 1IVSA 4J11A 1XOUA 4AI8A 3P3PA 5LBQA 2Q7GA 4K0KO 3JASA 5LMUB 4TT3G 2IM9A 5JJEB 4PA7A 3OAAG 3OD4A 1F51A 4K8ZA 1QQCA 3JD2A 4X1YB 4MT8A 2OIGA 4X1IA 1V55C 3CCQV 3E8FA 1IXMA 2Y4UA 2K9PA 4X62B 3CWBH 3SJQC 4JYAB 4J10A 1PPJH 1JMKC 3ZHRA 5B1AB 2FKXA 4J9ZB 1BSMA 1WN7A 2CGOA 3CC7V 3OGCC 4I55B 1AJQA 2L35A 4FK5C 3CHXA 3OMIB 3RYIA 3K79A 4WFGA 1GO3F 2LQTA 2CK3G 1GK9A 4IIJB 1LNQA 2JJ2G 4O4LA 4IGGA 3FYIB 1M57C 2KKWA 1DK1A 3RVZA 4UCRA 4CZZA 1WPBA 1V54B 2DOSA 3GWKC 1N32B 3WB1A 1M56B 2UXBB 1K5QA 1GN2A 3CJHA 1SRYA 4DV5B 3R65A 4DXWA 2QA4V 5H9CA 2Q5ZA 2ODMA 1S3JA 4DR5B 1X4TA 2OWOA 1YSCA 5KA5A 5J9PC 4FM0A 4DR4B 2H3OA 3D36C 2R9RB 4OXSA 5EIBD 2QEXV 3C90A 1NBMG 1OHHG 1M5IA 1YCIA 3M99B 4WCEV 4HAMA 1P7GA 2DE0X 4OX9B 2BTOA 3RYIB 1I08A 1AR5A 4N23A 2HVKC 4P2ZA 4JI6O 2QE7G 3WG7B 1H2LA 4I0XB 4DRXA 2WLNA 3L74H 1IDSA 1JR9A 1OCOC 1R3LC 4PD4F 2LFRA 4CS2A 4QJFB 4FLZA 5EC1C 1H2SB 1R1BA 3CXHF 4FLXA 3JATA 1YJNV 1ROPA 2LJ2A 5EYPA 4BW5A 3LSSA 2UUCO 1EFRG 2ZXWB 1M57B 3E8BA 5JH7A 4X64O 4XDLA 1OCZB 2VQFO 5IJ0A 4UV9A 4RAIA 2O57A 1K73W 1SQBH 1SQFA 2WAMA 4DK1A 1H8EG 3AG2B 1Y76A 2RN9A 2DYSB 3MHSC 4D7TA 2XASA 1XEQA 4CS3A 5CB4A 5LGUA 1JFFA 3VQVA 3AK3A 5IYDO 1Q82W 2YIBD 3CYOA 4NXNB 4ABMA 4O2AA 2A3QA 1SQXH 3LNNA 3JAMN 2GHYA 3AG3C 2DYRB 5GTIZ 4FZ0A 3VQYA 4N21A 3ASOB 4UCVA 1NH2B 1RSOB 4WFFA 4B3RB 4LFCB 1NU1H 1HDJA 5JQGA 1P49A 5LYJA 1K92A 1SQGA 3RWRD 5JH7B 1RM1C 5JVDB 1P4RA 3CCMV 3ETDA 2ADQB 3A8TA 1JJ2U 3G4SV 3VQWA 5IJ0B 3IGAC 5IYZA 2RJZA 3LDCA 2L6LA 1WLEA 1D5NA 4JI2B 1QVFU 4PHZA 3ZN1A 3SPJA 1ENVA 4TUYB 1IBLB 2QWOB 1L0LH 5B66Z 3A2FA 1EN4A 2QWQB 4X20A 5HFMA 3K5NA 2CH7B 2X7RB 2Z5UA 5L3FA 5IWAB 2DN9A 4PI2A 4WF9V 5EIBC 4PJ0Z 3CCVV 3ZHVA 3M8AA 4EKWA 2VWKA 1QCEA 5JQGB 5KX5B 5JCOC 4W4KA 4JI4O 3ZN0A 2QTOA 1URFA 4QIWF 1IZ3A 1HR0B 1N0JA 5IJ9B 2ARHA 3G6BA 1PV0A 4DR3O 5JWPA 2UXCB 2A79B 3CD6V 3SPHA 3ZJZA 4MVRA 2ZR3A 4KFMA 2JEUA 4AQYO 1VQOV 1Q86W 1QNMA 3K3WA 1GAXA 2ITDC 3P30A 4MVSA 5KHIA 1VQ7V 2IH3C 3ASOC 2QGNA 2R70A 1BHBA 2QWPB 1SZTA 1G1XB 4ICGA 3CRRA 5LHIA 4MTFA 1N33O 3K58A 2X6AA 5B1AC 1KUQA 5L3EA 3ZMSA 2BTQB 3P3NA 2Q8VA 4JV5B 4DV6O 5H6QA 4B3MO 2QM8A 2WLLB 1KBHA 1ZWIC 3TGUH 3EXAA 5B1BB 4I9QA 3ZMZA 2ZM6B 4J7KA 2Y69C 4MS2A 3SJBC 2E76B 4YIOA 4HZ3A 1H2GA 4LP8A 3JCZA 1AROP 4J80A 1QLEB 5LMNB 4JI4B 1R3IC 3H01A 2RDCA 3OUSA 3HKDA 3L9DA 5LXTB 5IY5C 4GKJB 2OCCB 4IHJB 4K3AA 1BHAA 2P4KA 4MVZA 5LL6Y 5DM6V 3FKSG 4JI5O 4Z2WA 2AHYA 1K34A 1NTMH 1AJNA 2XAQA 2WA4A 2Q7HA 3RN4A 3LNMB 4MVQA 1JFFB 1H2MA 4TSFG 1KC8W 3MAQA 4X62O 2Y4TA 5LP6C 1NTZH 3F7VC 2JGDB 4LF6O 1SESA 4F6EA 2LFSA 2QSAA 4YY3O 4EEQA 1RSOA 2M7WA 2IBZH 1S0VA 1O9GA 3K5MA 2F66C 5DECA 4XBFA 4NVPA 5L3DA 3OMNB 4Z1MG 2QKSA 3K59A 1I5YA 5DEDA 4PA3A 4I4TB 3T1YO 3RYCB 3N2GA 5B1BC 2LGWA 4O4HB 1BS3A 3OTFA 2BSKB 2VWJA 5C8YB 1GN4A 2Q68A 3B40A 1QU7A 4PELA 4JAAA 4OX9O 4AILC 2IJJA 2A0LA 1TAEA 3AG3B 2NR5A 4H0LB 1H2KA 3UT5A 3W7WA 2CTQA 2ZDIC 3UO2A 1GTOA 1RP3B 1NVPB 5J2UA 2ADPA 4NKGB 4GCZA 2RNBA 2R9IA 4W4LA 4QNHB 1Y76B 4F6RA 4KL1A 1XHXA 5KX5A 3VQXA 3CC2V 2MK3A 1AP6A 1Q8IA 4EB6B 4NTYA 1XNRO 5IT9N 2HJDA 1MA1A 2QKAA 1KECA 2EINC 3WG7C 2CE4A 4X1IB 1HW7A 1I7FA 2XOKG 3A0RA 2IJHA 3N2KA 2KG7B 2HHHO 2UXDO 3PJSK 4UCSA 4I55A 3ZHQA 3CRAA 1CXZB 3B8MA 2XNDG 1Z5WA 1AB3A 5IWAO 5IY5B 5IYZB 4LH7A 4DV0B 1QR8A 1FXKC 1ORQC 3D36A 4UB6Z 2W0XA 3STZC 5JCOA 1MZEA 3ASNC 4X1KB 2H8PC 3ETQA 5AG2A 4H13B 4LF7B 2CUGA 4DR2B 3CJHB 3P32A 4DV2B 1J5EB 4J7ZA 3O9OA 5KAIZ 2AHZA 1FFXB 1DF4A 4P9OA 3CRCA 1NR7A 2QR4A 4LH6A 3SGIA 1PP9H 3MHHC 1HNZO 4ZI7B 3IAYA 4FFKA 5KLVH 2KG7A 2CGNA 1NTKH 5BY1A 1GRJA 5A9GA 1N34O 4J7JA 2EBOA 4X88A 3EVKA 1VMGA 3Q4HB 4JYBA 3RYHA 1RPOA 3OEHG 3L71H 3EHBB 1PKXA 3OM3B 3ABKC 3HB3B 4NR1A 3EFFK 4JI1O 2D3OW 2IW5A 3ZMUA 2B5UA 3I56V 1YXBA 3NXSA 3L70H 3LSQA 2AZ2A 1PNLA 3BHPA 4J41A 5LOVB 4JZGA 4JAUA 5J2TA 4PDRA 1NKDA 2YSUB 2ITCC 2DW4A 4LF9O 5E79Z 3W7XA 1BL8A 2EIJC 4DR3B 3MDSA 3QO5A 4LF8B 4BIZA 3IFXA 3SYOA 3B8NA 1Y74A 4X65B 2ZCEA 1VF6A 2WLLA 5L3BA 4DR1O 1Q81W 3KZIZ 1Q6IA 3W7TA 2AW9A 5LA6B 5B1NA 3OTOB 2FL4A 1SETA 3JYCA 3H1JH 1OCZC 2ZDIA 1M93A 2V4DA 1NI8A 4IIJA 2LW7A 1JPXA 3IC7A 2CTRA 2PGGA 1QHTA 2P06A 1F4MA 2FMLA 5ITZA 3APOA 4B3TB 4DR2O 5BXZA 4CH6A 1OCOB 2E3CA 1FS0G 3K9SA 3E83A 4IYIA 5L3CA 2AGAA 2DQ0A 2H94A 4PA9A 1UPGA 4PDLA 4I0XA 4DK0A 1XQ8A 5KHKA 3OEEG 1SC5B 5CA1A 4LNUB 3QO8A 5EBMC 1MABG 4TV9A 2CTPA 3K08A 3OW2U 1N33B 2ZE5A 4WBNB 4UCTA 1WA8A 1DTOA 4CS4A 3WB0A 3U11A 3HKEA 5BR8B 2X0LA 5CA0A 1IX9A 1FD9A 2PF4E 1M90W 2YXYA 1N8RW 3OT7A 1VF6C 1XMOB 4CC5A 1RM1B 4GX0A 5EYPB 3N2KB 4YJ3A 3RBZA 4UCUA 5KAFZ 3RW0A 1V55B 2P6JA 2DMXA 1S77D 1JJOA 2OT5A 2R72A 1MNGA 2EULA 4ZBMA 3ZBHA 2ETNA 1VP7A 2Q0AA 3S3WA 5K1XA 3W7UA 4FLUA 1Y4MA 1H38A 4YXWG 4XDKA 1UJWB 2ZKOA 3PN1A 5BMVB 2WA3A 4WBNA 2IU0A 5DN6G 2AZ0A 3ZRVA 1S5HC 1JX9A 4IT5A 5D5QA 1XNQO 3UCSC 3CPWU 1SQVH 1WP7A 4EFEA 1V9PA 4LF4O 1S5JA 5KHJA 5KUKA 2WLJA 1J5EO 2DWDC 3K57A 1Q5OA 4MTOA 2HJFC 4LWSB 2N74A 3ZHSA 5EZYA 2IH1C 4U3JA 2X6CA 1NJIW 2YI9A 3K0GA 1OV9A 3SR2C 1YTFD 2OTJV 5C93A 2YXHA 4FLYA 1XHZA 1ZUQA 3UM7A 3K04A 1EZJA 3CSXA 3FAVA 4NTWA 2ZQMA 2EIKB 5IE9A 1WB8A 4DV1B 3JALA 3J81N 1OJHA 3AEIA 3UO3A 4E2LA 1S76D 1FJGB 4JI1B 1O9HA 4IL6Z 2JJ1G 2P4VA 1HNWB 4LC1A 1AI7A 2WPDG 2F4VB 3CXCU 5TISZ 1D2DA 4I50A 2XHBA 4LFAO 1LUVA 3APQA 3IC9A 1JVMA 1AR4A 1BZKA 1MSDA 1ZX3A 2ILMA 1BGYH 4UB8Z 4DW1A 2UXCO 3ZX6A 1TVKB 5CBGA 1B6QA 5FPOA 3CCSV 1XNQB 1BCCH 4X1KA 4IHJA 1HR0O 3ZS8C 2F93B 3BCCH 1QVGU 2Q4PA 1BQ0A 1YTFB 1K9MW 2BOCC 1G4YB 4X8AA 1KD1W 2DYRC 2XTAA 2IJIA 1ZL8A 3SYAA 3FAVB 2UUBO 1WAZA 4I7ZB 2VRZA 2FB5A 1IBLO 1Y67A 4WFHA 3ABKB 1BMFG 4MSWC 4ZHQB 4QE9A 2RQ6A 4PA6A 4Q6GA 4YHHO 4GKJO 1Q6UA 3SDLA 2HEPA 4KXRA 4DV6B 1MSWD 1Z2GA 1VEWA 4B3TO 4GX5A 4DR6B 2JVDA 3N27A 1HNXO 2QJ1A 1D5AA 2JEXA 4IYHA 3N2GB 3CMEV 1Q43A 4LF5O 2B1IA 3SYCA 4DV2O 4R8CA 3AK1A 2YXLA 3ZEDA 1ZAUA 3QTCA 4DUYO 1VQ6V 2UUAO 1YJ9V 2ZE6A 3ZHTA 2WLHA 1H8HG 3LUTB 2V1DA 1PD3A 1GKFA 2UXXA 1F7YA 1EN6A 5FLXN 3DC5A 4DV4B 4LF6B 4FLVA 3AG4C 5LXTA 1VF7A 2P5OA 1S5LZ 4J42A 4DV0O 1AP5A 1L8DA 4KUMA 1HP8A 4WFEA 2YUAA 1DF5A 2EIMC 5LA6A 4JI5B 4NB5A 2OCHA 3GWOA 4R7CA 1FPOA 1KP3A 2HP8A 4JI7B 1FXVA 1XBLA 3DC6A 3IJ4A 4Z1VA 5K1PA 3L75H 3J80N 4HNAB 1CP9A 4DUZO 2RCVA 4MTGA 3HKDB 1VQ8V 1K4CC 1Q3EA 5LMNO 2W6IG 4P30A 1IXBA 1THZA 3LDEA 4X65O 2B1GA 4FM1A 2RMKB 3KG2A 1YITV 4LFBO 2YDEA 4RWUA 3VOUA 4DUYB 3BABA 2F1MA 3E8GA 4LNUA 2GV9A 4YY3B 2XAHA 3VBBA 4B08A 2QWRB 2AXTZ 2Y0PA 4RQEA 1HNXB 3ZMTA 3JD3A 3JD0A 1B3QA 3UKMA 3D8CA 1WA8B 4UVBA 1PNKA 4YJ2B 3DTUB 1NR1A 1NZ6A 4XDJA 2HFEC 3JCUZ 2A9HA 4RQFA 4L8JA 4OPAA 3SYQA 4P9PA 1AI6A 1K33A 1VQKV 2LP7A 4E4EA 4FMTA 4F6RB 3JALB 2E5LO 1NT2B 4F4LA 3FYEB 1LUWA 3KKYA 4JTCB 3WB2A 4DR1B 1R3KC 4KP4A 2OIEA 4MW8A 5J2UB 1FFTB 1XMQO 3ZIAG 1I94O 1YI2V 2YIDA 3G6EV 5KMGA 1I94B 3ABTA 2JRIA 3U10A 3E8HA 5GW7A 3WFVA 1MG1A 2JS5A 2LW1A 3BEHA 2EJRA 3K5OA 1RFYA 4B3RO 1Q7YW 2ZM6O 1FKAO 3G80A 4G2KA 4MVOA 3E22A 1SQQH 1XL4A 1VQ4V 1Q90D 1SF9A 1R3JC 1ZL8B 1R6TA 2CH7A 2CAZC 2PTMA 5B5EZ 2Q7EA 1YF2A 3G67A 4DO2A 1ZTEA 4MVUA 5EBWC 3H1LH 5EZYB 4JASA 1N34B 1XREA 5JJNB 1W0KG 1VF5B 3ABLC 1SS3A 5EK0A 1OCRC 1ZSPA 1EZVH 2EIJB 2ZIMA 2M6YA 2ZE8A 2E75B 1L0NH 4FLTA 1JQ0A 2WWWA 3ZMVA 4G28B 2JS3A 3JARA 1H2NA 3B77A 2V7QG 2P67A 4ZIBA 4ZI7A 1TGOA 1WJZA 3E35A 2F95B 1WP8A 1GM8A 4LF7O 1XILA 1TUBB 1HWYA 2E5LB 3SJAC 1KU9A 4FJCC 4WFAV 1N32O 2YIAA 3CE2A 4B7KA 1FYJA 1TVKA 3RGBA 4PDVA 4JF3A 3M7MX 2F23A 5B3SC 3K5LA 4R50A 1IBMB 4QGPA 2QM7A 1TA8A 1NH2D 3RYFB 5IDJA 2WLIA 4OPHA 1E1RG 1GN6A 1AVMA 4LBEC 5B3SB 2ZT9B 2VQEB 3HKBB 2VQEO 1K8AW 2PYLA 1W59A 2G38A 4DR5O 1TUEB 3T1YB 5LGNA 3HR0A 1P7BA 5IYBO 3GB7C 2VQFB 2ZE7A 5KA6A 3H1IH 3B09A 1JOYA 2R9AA 2FTKA 4PI0A 3QNEA 3CB2A 1VQ5V 4GX2A 4K8XA 2VS0A 4H44B 2KB1A 1COWG 5FL7G 4O2BA 4BIOA 3O65A 3K9AA 2WLMA 3ZCCA 4DW0A 1LR1A 1W0JG 4DV7B 3A0HZ 1B06A 1OCCB 4YHHB 1IBMO 2ZR2A 4B3MB 5EC2C 4X66B 1G8MA 4JPRA 4FM2A 3B2EE 4EB6A 4DR4O 1UFIA 5D5PA 4O4IA 4JTDB 2JGDA 4TV9B 1VIBA 4CH5A 4GUNA 1WNSA 4JI0B 1R73A 3SJCC 3ZHUA 1KB9F 2Y69B 2UUBB 5H6RA 3FFQA 1IBKB 2UXNA 2JIZG 4U3JB 5EBLC 4CH4A 2P22C 2Y0IA 1Q6HA 2UXDB 4H37A 5L3GA 2ZINA 1F4NA 4GT1A 3THOA 1K5SA 4O2AB 3TXSA 4O2BB 3CS5A 1N36B 5CA0B 4BAYA 1Y6XA 1XUQA 4AQYB 3OE7G 4FFBA 4NXMB 2OYQA 5C8YA 2EZPA 2NN4A 4U3FH 4CC6A 1S72V 2D2CB 2PI4A 3WU2Z 2QM4A 4JZ2A 4JYYA 4I50B 5LYJB 4FPPA 2YC0A 3E89A 3HKEB 1MOFA 2Q69A 2P90A 1M9NA 1EBOA 1SZXA 4ZOLB 4U7NA 3GVMA 2PUSA 4BIUA 1DGSA 4X1YA 5FNVA 1GM9A 4TV8B 1VARA 4D6TH 4U7OA 5BMVA 2HHHB 3RVYA 3JAKA 1W2BU 4DR7O 3CCUV 4UVCA 3CP1A 4O4JA 1XDCA 3T2MA 5LP6B 2W6JG 3BPZA 3RYHB 4QPKA 1M1KW 4QE7A 4K35A 1XNRB 4O4LB 3G71V 3J7AU 3JARB 1FAFA 1KKCA 4ASUG 1OZ0A 3ETGA 4X9QA 1CEZA 4QPJA 2Q73A 2YEVA 4R6ZA 5KUMA 1AI5A 1IBKO 2GDSA 4JI0O 2Z0AA 5IJ9A 5J2TB 5GTHZ 3AK2A 4I9WA 2Z3YA 4TV8A 1U96A 5FNVB 4BWAA 3ETEA 4NXNO 2ZNJA 4DUZB 2JK5C 3OMAB 1Y74B 4JI8B 3ZRWA 1VQNV 1K7DA 1F23A 1WB7A 5FPRA 3CC4V 1V54C 3X2QC 1YVWA 3HKBA 3QF7A 2UXBO 3BAAA 2XAJA 3ABLB 1M56C 2F43G 2YS8A 3OFNG 2Q67A 3T1HO 1QLNA 4LFBB 3ABMC 1I0HA 3CRMA 1SKVA 3BVOA 3SPGA 5CBHA 3LSUA 4PV1B 2P7TC 3F5TA 3C3TA 3T4ZA 5CB4B 1GM7A 2UUAB 3F5WC 2B9ZA 1CPYA 3HPLC 3L72H 4G27B 2GTSA 4HBNA 4DV1O 1R6KA 5CMUA 1AJPA 3H9VA 4PA4A
chains in the Genus database with same CATH topology
1K4DC 1K4CC 3CMAV 5CN0A 1LNQA 2EILC 2JJ2G 2W6IG 4P30A 3FYIB 1M57C 1THZA 3LDEA 3B8MA 3RVZA 2B1GA 2XNDG 4CZZA 1PL0A 3KG2A 1V54B 3T4DA 1YITV 5IY5B 3OR6C 2XAFA 2DQ3A 3VOUA 1M56B 1QR8A 1FXKC 1ORQC 3D36A 3E8GA 3AG1B 3STZC 1K5QA 3ASNC 4RO2A 1SRYA 2XAHA 2H8PC 3R65A 3VBBA 5H9CA 4DXWA 2QA4V 4RQEA 3ZMTA 1S3JA 3JD3A 3JD0A 4UVAA 3UKMA 4UVBA 1YSCA 3TCUA 3MD0A 3P32A 5J9PC 2IU3A 3JD1A 5KA5A 1PNKA 2R9RB 4OXSA 4UUJC 3DTUB 2AHZA 1NR1A 4P9OA 1DF4A 3ABUA 2QEXV 4GX1A 4XDJA 2HFEC 3FB6C 1RPRA 4LCUC 1NR7A 2NNUA 1NBMG 1OHHG 2A9HA 2ZXWC 4RQFA 3M99B 1FXKB 3ABMB 5LHHA 4WCEV 4HAMA 3MHHC 4JGSA 3SYQA 4P9PA 1AI6A 2W0FC 1K33A 1VQKV 2LP7A 4FMTA 1VQ9V 4N23A 2HVKC 4P2ZA 3E86A 2QE7G 4F4LA 3FYEB 2HVJC 2EBOA 3WG7B 4X88A 4JTCB 5CBFA 4JYBA 1YJWV 2DWEC 2WLNA 1RPOA 3OEHG 1OCOC 5LGTA 1KQSU 3EHBB 1R3LC 1PKXA 2LFRA 3OM3B 3ABKC 4QJFB 3HB3B 1R3KC 4KP4A 5EC1C 3EFFK 1J95A 2EIMB 2IW5A 4MW8A 1FFTB 2C2AA 3ZMUA 2D3OW 2EIKC 1NVPD 2B5UA 1YJNV 3ZIAG 1ROPA 4BW5A 3ML0A 1YI2V 3I56V 3LSSA 1EFRG 3G6EV 2ZXWB 3NXSA 1M57B 3ABTA 5HFLA 3E8BA 4H33A 1YHQV 3E8HA 5GW7A 3LSQA 1MG1A 1PNLA 3WFVA 4XDLA 3I55V 1OCZB 2EJRA 3BEHA 4JAUA 4PDRA 1Q7YW 1NKDA 2YSUB 2ITCC 4UV9A 1K3EA 4RAIA 2DW4A 4G2KA 1QBZA 3FB8C 4MVOA 1BL8A 4UXNA 3W7XA 1K73W 2EIJC 3QO7A 3QO5A 2WAMA 1XL4A 3K06A 3CCLV 1H8EG 2EINB 1VQ4V 1QLEC 3AG2B 4L87A 3F7YC 4BIZA 1FXKA 1R3JC 3IFXA 2DYSB 3B8NA 3SYOA 3MHSC 2XASA 3FB7C 5LGUA 2WLLA 5L3BA 1Q81W 3W7TA 4I5SA 4DO2A 5IYDO 3SPIA 4MVUA 5EBWC 4ZKIA 1Q82W 4JASA 3CYOA 5B1NA 1SETA 3JYCA 3OR7C 1OCZC 1W0KG 2WSSG 2ZDIA 3ABLC 2GHYA 3AG3C 2DYRB 1I5XA 5EK0A 1OCRC 3D3IA 5CA3A 4N21A 3ASOB 1JPXA 3IC7A 2X6BA 1NH2B 2EIJB 4WFFA 2HKOA 3W7SA 1VQLV 1JQ0A 2WWWA 2YEVB 3ZMVA 4WFBV 1F4MA 4G28B 4J9YB 3B77A 2V7QG 1DLBA 3CCRV 2P67A 1OCOB 1K92A 1FS0G 1RM1C 1P4RA 3E35A 3E83A 3CCMV 3ETDA 5L3CA 1GM8A 1JJ2U 2DQ0A 2H94A 4PDMA 4PA9A 3G4SV 4PDLA 1HWYA 3IGAC 3LDCA 4FJCC 3OEEG 4WFAV 1WLEA 3QO8A 5EBMC 1MABG 1QVFU 3K08A 3OW2U 2EILB 3SPCA 4PDVA 3T1CA 3ZN1A 3SPJA 4JF3A 3FB5C 5B3SC 1ENVA 4R50A 2QM7A 1DTOA 1GK9A 1NH2D 5IDJA 2WLIA 1E1RG 5HFMA 3CCEV 2X7RB 4LBEC 5B3SB 2Z5UA 3SYPA 5L3FA 2PI5A 1K8AW 3TK1A 2X0LA 4WF9V 3CCVV 4EKWA 5LHGA 1PNMA 1TUEB 5LGNA 1QCEA 1P7BA 1M90W 4JYCA 4TWKA 5IYBO 1N8RW 3ZN0A 2QTOA 3DGEA 3GB7C 5KA6A 1RM1B 4Q20A 4GX0A 4QIWF 1JOYA 1KKDA 2FTKA 3RBZA 3RW0A 1V55B 2P6JA 1S77D 1NQTA 1OCCC 3K03A 2A79B 2OT5A 3CD6V 3SPHA 1R6NA 3ZJZA 4MVRA 2ZR3A 4KFMA 2JEUA 1VQOV 3QNEA 1VQ5V 4GX2A 1Q86W 3K3WA 4ZBMA 2WLKA 2ITDC 2KB1A 1COWG 3P30A 5FL7G 4MVSA 1E1QG 3W7UA 3K9AA 2IH3C 1VQ7V 1Y4MA 1QR9A 3ASOC 4UV8A 4YXWG 4XDKA 1UJWB 1H38A 1BHBA 3AG4B 2ATKC 1SZTA 2OCCC 4JTAB 2JDIG 2WLMA 1L1FA 2IU0A 3ZCCA 5DN6G 1W0JG 3ZRVA 1S5HC 5LHIA 1JX9A 4MTFA 2X6AA 5B1AC 3CPWU 2HLDG 3ZRWB 1OCCB 5L3EA 3ZMSA 2ZR2A 1K97A 1YIJV 5EC2C 1G8MA 2WLJA 5H6QA 5KUKA 4JPRA 2QM8A 2DWDC 2WLLB 4MTOA 3OUFA 4HYOA 4JTDB 2HJFC 1E79G 2IH1C 1R73A 2X6CA 1ZWIC 5B1OA 1NJIW 5B1BB 3K0GA 1YTFD 2OTJV 4FIPC 2Y69B 1KP2A 5C93A 3ZMZA 5H6RA 2Q6AA 2UXNA 2JIZG 5EBLC 2Y48A 3UM7A 3K04A 1GMGA 5E1AC 3E2EA 4H37A 5L3GA 2ZD9A 2Y69C 1F4NA 4GT1A 1EZJA 4MS2A 2K1EA 3STLC 1K5SA 2ZQMA 2EIKB 4RUFA 4BAYA 3AEIA 1XL6A 4E2LA 1S76D 4HZ3A 1H2GA 3OE7G 4LP8A 3JCZA 2JJ1G 2DYSC 1AROP 2EZPA 4LC1A 1AI7A 2WPDG 1QLEB 3AG2C 3AG1C 3CXCU 1JCHA 1S72V 4MVMA 4JAVA 2PI4A 1R3IC 3H01A 2OTLV 3OUSA 1AR1B 1JVMA 2HR3A 2WLIB 3BY6A 4FPPA 5IY5C 1FXHA 1Y66A 2HG5C 2OCCB 3E89A 4CBCA 1VQPV 1BHAA 4MVZA 1MOFA 5CBGA 2Q69A 2P90A 1M9NA 1EBOA 1B6QA 3CCSV 5DM6V 3ASNB 3FKSG 3K0DA 4U7NA 2AHYA 2GSMB 4BIUA 1K34A 1AJNA 2XAQA 4MTXA 3X2QB 1GM9A 4U7OA 3LNMB 4MVQA 1QVGU 4TSFG 1KC8W 1YTFB 5IYCO 1K9MW 3ZRSA 2BOCC 1G4YB 4X8AA 1KD1W 3CCJV 3RVYA 2DYRC 3F7VC 2IJIA 1W2BU 1SERA 3SYAA 1SESA 3CCUV 4UVCA 3CP1A 2LFSA 2BOBC 3T2MA 2EZOA 3TETA 2W6JG 4QPKA 2M7WA 1M1KW 4QE7A 4WFHA 3ABKB 1S0VA 1BMFG 1VQMV 4X89A 3G71V 2NLJC 4MSWC 4XBFA 5L3DA 3OMNB 4ASUG 4QE9A 4Z1MG 2QKSA 4PA6A 1OZ0A 1OCRB 1I5YA 1AI4A 3ETGA 3JD4A 4PA3A 3ZRXA 4MW3A 1CEZA 1MSWD 4QPJA 4RUEA 5B1BC 4GX5A 2XAGA 5BZBA 2YEVA 4R6ZA 1WPXA 5KUMA 1AI5A 2JEXA 2Q68A 4PELA 2IJJA 2A0LA 3CMEV 3AG3B 2Z3YA 4I9WA 5CMUA 2B1IA 3SYCA 3W7WA 4R8CA 3ETEA 2ZDIC 1VQ6V 1YJ9V 1GTOA 3LDDA 2JK5C 2IJKA 1NVPB 3OMAB 2WLHA 1H8HG 3ZRWA 1VQNV 3LUTB 1K7DA 1F23A 1PD3A 1GKFA 2UXXA 2V1DA 4GCZA 2R9IA 4QNHB 3CC4V 1V54C 3X2QC 5LBQA 3AG4C 2XAJA 4TT3G 3ABLB 1M56C 2F43G 4PA7A 3OAAG 4KUMA 1F51A 3OFNG 2Q67A 1QLNA 3ABMC 4WFEA 3JD2A 3CC2V 1DF5A 2MK3A 2EIMC 4MT8A 3GWOA 4R7CA 3SPGA 5CBHA 1V55C 3CCQV 3E8FA 1IXMA 1KP3A 3SJQC 1FXVA 1KECA 2EINC 2P7TC 3WG7C 3T4ZA 5B1AB 1CP9A 1GM7A 4J9ZB 3CC7V 2XOKG 4MTGA 3F5WC 4G27B 1CPYA 3HPLC 3OGCC 1AJQA 3A0RA 4FK5C 1R6KA 2IJHA 3OMIB 1VQ8V 3K79A 3PJSK 4WFGA 1GO3F 1AJPA 4PA4A 2CK3G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E V;  4WFB V;  1Q86 W;  1KD1 W;  3CC2 V;  1VQ9 V;  3CMA V;  3CCV V;  1QVF U;  1YIJ V;  3CCJ V;  1Q81 W;  1VQN V;  3OW2 U;  1YHQ V;  1W2B U;  3CCR V;  1M90 W;  1VQP V;  3CCQ V;  1Q82 W;  3CCU V;  3I55 V;  1VQ7 V;  1N8R W;  3CC4 V;  1Q7Y W;  1YJW V;  3CCS V;  1YIT V;  5DM6 V;  2QEX V;  1KQS U;  3CCM V;  1R73 A;  1M1K W;  1JJ2 U;  3G4S V;  3CC7 V;  1NJI W;  3CME V;  1VQ5 V;  1K73 W;  3CCE V;  2D3O W;  1VQM V;  3CXC U;  2OTJ V;  3G71 V;  1QVG U;  1S72 V;  3CCL V;  4WCE V;  1VQ4 V;  1YJN V;  1KC8 W;  1K8A W;  4WFA V;  3CPW U;  3CD6 V;  1K9M W;  4WF9 V;  2QA4 V;  1VQ8 V;  2OTL V;  1VQL V;  1VQO V;  1YI2 V;  3I56 V;  1VQ6 V;  1YJ9 V;  1VQK V; 
#chains in the Genus database with same CATH topology
 4FLW A;  3R66 A;  1K4D C;  3TXQ A;  1N0N A;  3CMA V;  5CN0 A;  2BSK A;  2EIL C;  5F2V O;  2XT9 A;  4C7U A;  4KHP B;  4LFA B;  2A7W A;  1PL0 A;  3T4D A;  3OR6 C;  2XAF A;  5KHH A;  2DQ3 A;  5LOV A;  4JI2 O;  4A5U B;  5LMU O;  3AG1 B;  2GBO A;  4OGQ B;  1SA0 B;  2Q9L A;  4RO2 A;  4DV3 B;  3OGI B;  4UVA A;  4LF4 B;  3TCU A;  3MD0 A;  2IU3 A;  3JD1 A;  1BT8 A;  4UUJ C;  2EJ7 A;  3ABU A;  1XI1 A;  4GX1 A;  4TQF A;  3FB6 C;  1RPR A;  1Z5V A;  4JI3 B;  4LCU C;  2NNU A;  1EN5 A;  2ZXW C;  1FXK B;  3ABM B;  5LHH A;  4JGS A;  1M4U A;  2KSD A;  2W0F C;  4X20 B;  4DRX B;  4JI6 B;  1VQ9 V;  3E86 A;  2HVJ C;  3H1H H;  5CBF A;  1YJW V;  2DWE C;  5LGT A;  1KQS U;  3DXR A;  3CEI A;  4DR7 B;  4B3S B;  1J95 A;  2EIM B;  2C2A A;  2EIK C;  4JV5 O;  4JI7 O;  1NVP D;  1XMO O;  1BQZ A;  4JYA O;  3ML0 A;  4TUY A;  1SA0 A;  4HNA A;  5CA1 B;  3RT3 C;  5HFL A;  4DYL A;  4H33 A;  4GLX A;  1YHQ V;  3I55 V;  3BA8 A;  1YDX A;  5BR8 O;  5KHG A;  1K3E A;  4EFB A;  1QBZ A;  3FB8 C;  4UXN A;  4FVM A;  3QO7 A;  3C3S A;  1PL4 A;  4DV4 O;  3K06 A;  4BR6 A;  3CCL V;  2EIN B;  1QLE C;  4L87 A;  3F7Y C;  4K0K B;  1FXK A;  2CDY A;  2JGU A;  3HKC A;  1PM9 A;  2XUM A;  5A2Q N;  3AG7 A;  3FB7 C;  4I5S A;  1FFX A;  3SPI A;  4ZKI A;  1AIL A;  3OR7 C;  4NYK A;  2WSS G;  2KQX A;  4GKK O;  1N36 O;  2QKC A;  1I5X A;  3D3I A;  4UCO A;  3DXR B;  5CA3 A;  3TJT A;  2F4V O;  2X6B A;  2HKO A;  3W7S A;  1VQL V;  2YEV B;  4D7S A;  4WFB V;  4J9Y B;  1DLB A;  3CCR V;  4FFB B;  2Q0O C;  1P84 F;  4PDM A;  4X66 O;  2LGQ A;  2EX3 A;  4FZ1 A;  3KCY A;  5GON B;  2BE3 A;  5H5N A;  4GKK B;  2EIL B;  3SPC A;  3T1C A;  3FB5 C;  1MZF A;  3KCX A;  3ICX A;  1ZLZ A;  4LR3 A;  4NXM O;  3CCE V;  4X64 B;  1KMI Z;  3SYP A;  2PI5 A;  1YEW A;  3TK1 A;  4LFC O;  3OTO O;  2N05 A;  4ZHQ A;  2QWN B;  3JAK B;  2ZIO A;  4O4J B;  4GZR B;  5LHG A;  1PNM A;  2QTS A;  3UQ8 A;  4JYC A;  4TWK A;  4DV3 O;  3DGE A;  3U0Z A;  4Q20 A;  3QVN A;  1KKD A;  5KMG B;  2FYU H;  1NQT A;  4TQD A;  1OCC C;  3K03 A;  5ITZ B;  3JAW B;  1R6N A;  2YIB A;  5JJJ B;  1KYO F;  2GUZ A;  3JAT B;  4KHP O;  5GON A;  2WLK A;  3JSN A;  4BW9 A;  3E22 B;  1E1Q G;  1QR9 A;  4UV8 A;  3AG4 B;  2ATK C;  2OCC C;  1B04 A;  4JTA B;  2JDI G;  4DV7 O;  1L1F A;  2A06 H;  3FX7 A;  2BTQ A;  3H1K H;  3DSQ A;  1T5E A;  1XMQ B;  4TOI A;  2UUC B;  2HLD G;  3ZRW B;  1K97 A;  5H2F Z;  1YIJ V;  4LF5 B;  3UT5 B;  4YIP A;  3OUF A;  3T1H B;  4HYO A;  1E79 G;  1EM1 A;  5B1O A;  2ZNI A;  3CX5 F;  3RYC A;  4FIP C;  1KP2 A;  1NS1 A;  2DJV A;  2Q6A A;  4LF8 O;  4O4H A;  4GYC B;  3RYF A;  2Y48 A;  2YIC A;  4DR6 O;  3RFR A;  2UU9 B;  3JAW A;  1GMG A;  4B7E A;  1SQP H;  2GUZ B;  5E1A C;  3E2E A;  2ZD9 A;  4JI8 O;  2K1E A;  4UFZ A;  3STL C;  1TUB A;  1JA8 A;  4YJ3 B;  4RUF A;  1GH6 A;  1MMM A;  1XL6 A;  3L73 H;  3NR7 A;  4B3S O;  2DYS C;  3QG5 A;  3AG2 C;  3AG1 C;  3BA9 A;  2PZS A;  3S3X A;  1JCH A;  4MVM A;  2N04 A;  4JAV A;  2PYJ A;  2OTL V;  1US6 A;  1AR1 B;  4DV5 O;  2E74 B;  1X59 A;  2HR3 A;  2WLI B;  3BY6 A;  1FXH A;  4CBC A;  1Y66 A;  2HG5 C;  1VQP V;  4AHC A;  1N4C A;  1IUR A;  3ASN B;  4YJ2 A;  3K0D A;  3JSL A;  3I5D A;  3FD9 A;  2GSM B;  3HKC B;  4JI3 O;  4MTX A;  3X2Q B;  1BE3 H;  3CRQ A;  4LF9 B;  4ZOL A;  2GTA A;  5IYC O;  3ZRS A;  3D3Q A;  3CCJ V;  2YI8 A;  1SER A;  4LWS A;  3A0B Z;  1U97 A;  3JAS B;  2BOB C;  2BCC H;  1FJG O;  2EZO A;  3TET A;  2UU9 O;  1HNW O;  1A32 A;  1VQM V;  3B4S A;  4X89 A;  4I4T A;  2NLJ C;  4CH3 A;  5LP6 A;  1OCR B;  1AI4 A;  3ZRX A;  3JD4 A;  2MW2 B;  1G6U A;  3BFR A;  4MW3 A;  2PY5 A;  3BRC A;  4RUE A;  2XAG A;  5BZB A;  1WPX A;  1GN3 A;  1HNZ B;  5JVD A;  3Q4H A;  2LO1 A;  1YZB A;  4NTX A;  2CTW A;  2QDO A;  4O4I B;  3LDD A;  2IJK A;  1IVS A;  4J11 A;  1XOU A;  4AI8 A;  3P3P A;  5LBQ A;  2Q7G A;  4K0K O;  3JAS A;  5LMU B;  4TT3 G;  2IM9 A;  5JJE B;  4PA7 A;  3OAA G;  3OD4 A;  1F51 A;  4K8Z A;  1QQC A;  3JD2 A;  4X1Y B;  4MT8 A;  2OIG A;  4X1I A;  1V55 C;  3CCQ V;  3E8F A;  1IXM A;  2Y4U A;  2K9P A;  4X62 B;  3CWB H;  3SJQ C;  4JYA B;  4J10 A;  1PPJ H;  1JMK C;  3ZHR A;  5B1A B;  2FKX A;  4J9Z B;  1BSM A;  1WN7 A;  2CGO A;  3CC7 V;  3OGC C;  4I55 B;  1AJQ A;  2L35 A;  4FK5 C;  3CHX A;  3OMI B;  3RYI A;  3K79 A;  4WFG A;  1GO3 F;  2LQT A;  2CK3 G;  1GK9 A;  4IIJ B;  1LNQ A;  2JJ2 G;  4O4L A;  4IGG A;  3FYI B;  1M57 C;  2KKW A;  1DK1 A;  3RVZ A;  4UCR A;  4CZZ A;  1WPB A;  1V54 B;  2DOS A;  3GWK C;  1N32 B;  3WB1 A;  1M56 B;  2UXB B;  1K5Q A;  1GN2 A;  3CJH A;  1SRY A;  4DV5 B;  3R65 A;  4DXW A;  2QA4 V;  5H9C A;  2Q5Z A;  2ODM A;  1S3J A;  4DR5 B;  1X4T A;  2OWO A;  1YSC A;  5KA5 A;  5J9P C;  4FM0 A;  4DR4 B;  2H3O A;  3D36 C;  2R9R B;  4OXS A;  5EIB D;  2QEX V;  3C90 A;  1NBM G;  1OHH G;  1M5I A;  1YCI A;  3M99 B;  4WCE V;  4HAM A;  1P7G A;  2DE0 X;  4OX9 B;  2BTO A;  3RYI B;  1I08 A;  1AR5 A;  4N23 A;  2HVK C;  4P2Z A;  4JI6 O;  2QE7 G;  3WG7 B;  1H2L A;  4I0X B;  4DRX A;  2WLN A;  3L74 H;  1IDS A;  1JR9 A;  1OCO C;  1R3L C;  4PD4 F;  2LFR A;  4CS2 A;  4QJF B;  4FLZ A;  5EC1 C;  1H2S B;  1R1B A;  3CXH F;  4FLX A;  3JAT A;  1YJN V;  1ROP A;  2LJ2 A;  5EYP A;  4BW5 A;  3LSS A;  2UUC O;  1EFR G;  2ZXW B;  1M57 B;  3E8B A;  5JH7 A;  4X64 O;  4XDL A;  1OCZ B;  2VQF O;  5IJ0 A;  4UV9 A;  4RAI A;  2O57 A;  1K73 W;  1SQB H;  1SQF A;  2WAM A;  4DK1 A;  1H8E G;  3AG2 B;  1Y76 A;  2RN9 A;  2DYS B;  3MHS C;  4D7T A;  2XAS A;  1XEQ A;  4CS3 A;  5CB4 A;  5LGU A;  1JFF A;  3VQV A;  3AK3 A;  5IYD O;  1Q82 W;  2YIB D;  3CYO A;  4NXN B;  4ABM A;  4O2A A;  2A3Q A;  1SQX H;  3LNN A;  3JAM N;  2GHY A;  3AG3 C;  2DYR B;  5GTI Z;  4FZ0 A;  3VQY A;  4N21 A;  3ASO B;  4UCV A;  1NH2 B;  1RSO B;  4WFF A;  4B3R B;  4LFC B;  1NU1 H;  1HDJ A;  5JQG A;  1P49 A;  5LYJ A;  1K92 A;  1SQG A;  3RWR D;  5JH7 B;  1RM1 C;  5JVD B;  1P4R A;  3CCM V;  3ETD A;  2ADQ B;  3A8T A;  1JJ2 U;  3G4S V;  3VQW A;  5IJ0 B;  3IGA C;  5IYZ A;  2RJZ A;  3LDC A;  2L6L A;  1WLE A;  1D5N A;  4JI2 B;  1QVF U;  4PHZ A;  3ZN1 A;  3SPJ A;  1ENV A;  4TUY B;  1IBL B;  2QWO B;  1L0L H;  5B66 Z;  3A2F A;  1EN4 A;  2QWQ B;  4X20 A;  5HFM A;  3K5N A;  2CH7 B;  2X7R B;  2Z5U A;  5L3F A;  5IWA B;  2DN9 A;  4PI2 A;  4WF9 V;  5EIB C;  4PJ0 Z;  3CCV V;  3ZHV A;  3M8A A;  4EKW A;  2VWK A;  1QCE A;  5JQG B;  5KX5 B;  5JCO C;  4W4K A;  4JI4 O;  3ZN0 A;  2QTO A;  1URF A;  4QIW F;  1IZ3 A;  1HR0 B;  1N0J A;  5IJ9 B;  2ARH A;  3G6B A;  1PV0 A;  4DR3 O;  5JWP A;  2UXC B;  2A79 B;  3CD6 V;  3SPH A;  3ZJZ A;  4MVR A;  2ZR3 A;  4KFM A;  2JEU A;  4AQY O;  1VQO V;  1Q86 W;  1QNM A;  3K3W A;  1GAX A;  2ITD C;  3P30 A;  4MVS A;  5KHI A;  1VQ7 V;  2IH3 C;  3ASO C;  2QGN A;  2R70 A;  1BHB A;  2QWP B;  1SZT A;  1G1X B;  4ICG A;  3CRR A;  5LHI A;  4MTF A;  1N33 O;  3K58 A;  2X6A A;  5B1A C;  1KUQ A;  5L3E A;  3ZMS A;  2BTQ B;  3P3N A;  2Q8V A;  4JV5 B;  4DV6 O;  5H6Q A;  4B3M O;  2QM8 A;  2WLL B;  1KBH A;  1ZWI C;  3TGU H;  3EXA A;  5B1B B;  4I9Q A;  3ZMZ A;  2ZM6 B;  4J7K A;  2Y69 C;  4MS2 A;  3SJB C;  2E76 B;  4YIO A;  4HZ3 A;  1H2G A;  4LP8 A;  3JCZ A;  1ARO P;  4J80 A;  1QLE B;  5LMN B;  4JI4 B;  1R3I C;  3H01 A;  2RDC A;  3OUS A;  3HKD A;  3L9D A;  5LXT B;  5IY5 C;  4GKJ B;  2OCC B;  4IHJ B;  4K3A A;  1BHA A;  2P4K A;  4MVZ A;  5LL6 Y;  5DM6 V;  3FKS G;  4JI5 O;  4Z2W A;  2AHY A;  1K34 A;  1NTM H;  1AJN A;  2XAQ A;  2WA4 A;  2Q7H A;  3RN4 A;  3LNM B;  4MVQ A;  1JFF B;  1H2M A;  4TSF G;  1KC8 W;  3MAQ A;  4X62 O;  2Y4T A;  5LP6 C;  1NTZ H;  3F7V C;  2JGD B;  4LF6 O;  1SES A;  4F6E A;  2LFS A;  2QSA A;  4YY3 O;  4EEQ A;  1RSO A;  2M7W A;  2IBZ H;  1S0V A;  1O9G A;  3K5M A;  2F66 C;  5DEC A;  4XBF A;  4NVP A;  5L3D A;  3OMN B;  4Z1M G;  2QKS A;  3K59 A;  1I5Y A;  5DED A;  4PA3 A;  4I4T B;  3T1Y O;  3RYC B;  3N2G A;  5B1B C;  2LGW A;  4O4H B;  1BS3 A;  3OTF A;  2BSK B;  2VWJ A;  5C8Y B;  1GN4 A;  2Q68 A;  3B40 A;  1QU7 A;  4PEL A;  4JAA A;  4OX9 O;  4AIL C;  2IJJ A;  2A0L A;  1TAE A;  3AG3 B;  2NR5 A;  4H0L B;  1H2K A;  3UT5 A;  3W7W A;  2CTQ A;  2ZDI C;  3UO2 A;  1GTO A;  1RP3 B;  1NVP B;  5J2U A;  2ADP A;  4NKG B;  4GCZ A;  2RNB A;  2R9I A;  4W4L A;  4QNH B;  1Y76 B;  4F6R A;  4KL1 A;  1XHX A;  5KX5 A;  3VQX A;  3CC2 V;  2MK3 A;  1AP6 A;  1Q8I A;  4EB6 B;  4NTY A;  1XNR O;  5IT9 N;  2HJD A;  1MA1 A;  2QKA A;  1KEC A;  2EIN C;  3WG7 C;  2CE4 A;  4X1I B;  1HW7 A;  1I7F A;  2XOK G;  3A0R A;  2IJH A;  3N2K A;  2KG7 B;  2HHH O;  2UXD O;  3PJS K;  4UCS A;  4I55 A;  3ZHQ A;  3CRA A;  1CXZ B;  3B8M A;  2XND G;  1Z5W A;  1AB3 A;  5IWA O;  5IY5 B;  5IYZ B;  4LH7 A;  4DV0 B;  1QR8 A;  1FXK C;  1ORQ C;  3D36 A;  4UB6 Z;  2W0X A;  3STZ C;  5JCO A;  1MZE A;  3ASN C;  4X1K B;  2H8P C;  3ETQ A;  5AG2 A;  4H13 B;  4LF7 B;  2CUG A;  4DR2 B;  3CJH B;  3P32 A;  4DV2 B;  1J5E B;  4J7Z A;  3O9O A;  5KAI Z;  2AHZ A;  1FFX B;  1DF4 A;  4P9O A;  3CRC A;  1NR7 A;  2QR4 A;  4LH6 A;  3SGI A;  1PP9 H;  3MHH C;  1HNZ O;  4ZI7 B;  3IAY A;  4FFK A;  5KLV H;  2KG7 A;  2CGN A;  1NTK H;  5BY1 A;  1GRJ A;  5A9G A;  1N34 O;  4J7J A;  2EBO A;  4X88 A;  3EVK A;  1VMG A;  3Q4H B;  4JYB A;  3RYH A;  1RPO A;  3OEH G;  3L71 H;  3EHB B;  1PKX A;  3OM3 B;  3ABK C;  3HB3 B;  4NR1 A;  3EFF K;  4JI1 O;  2D3O W;  2IW5 A;  3ZMU A;  2B5U A;  3I56 V;  1YXB A;  3NXS A;  3L70 H;  3LSQ A;  2AZ2 A;  1PNL A;  3BHP A;  4J41 A;  5LOV B;  4JZG A;  4JAU A;  5J2T A;  4PDR A;  1NKD A;  2YSU B;  2ITC C;  2DW4 A;  4LF9 O;  5E79 Z;  3W7X A;  1BL8 A;  2EIJ C;  4DR3 B;  3MDS A;  3QO5 A;  4LF8 B;  4BIZ A;  3IFX A;  3SYO A;  3B8N A;  1Y74 A;  4X65 B;  2ZCE A;  1VF6 A;  2WLL A;  5L3B A;  4DR1 O;  1Q81 W;  3KZI Z;  1Q6I A;  3W7T A;  2AW9 A;  5LA6 B;  5B1N A;  3OTO B;  2FL4 A;  1SET A;  3JYC A;  3H1J H;  1OCZ C;  2ZDI A;  1M93 A;  2V4D A;  1NI8 A;  4IIJ A;  2LW7 A;  1JPX A;  3IC7 A;  2CTR A;  2PGG A;  1QHT A;  2P06 A;  1F4M A;  2FML A;  5ITZ A;  3APO A;  4B3T B;  4DR2 O;  5BXZ A;  4CH6 A;  1OCO B;  2E3C A;  1FS0 G;  3K9S A;  3E83 A;  4IYI A;  5L3C A;  2AGA A;  2DQ0 A;  2H94 A;  4PA9 A;  1UPG A;  4PDL A;  4I0X A;  4DK0 A;  1XQ8 A;  5KHK A;  3OEE G;  1SC5 B;  5CA1 A;  4LNU B;  3QO8 A;  5EBM C;  1MAB G;  4TV9 A;  2CTP A;  3K08 A;  3OW2 U;  1N33 B;  2ZE5 A;  4WBN B;  4UCT A;  1WA8 A;  1DTO A;  4CS4 A;  3WB0 A;  3U11 A;  3HKE A;  5BR8 B;  2X0L A;  5CA0 A;  1IX9 A;  1FD9 A;  2PF4 E;  1M90 W;  2YXY A;  1N8R W;  3OT7 A;  1VF6 C;  1XMO B;  4CC5 A;  1RM1 B;  4GX0 A;  5EYP B;  3N2K B;  4YJ3 A;  3RBZ A;  4UCU A;  5KAF Z;  3RW0 A;  1V55 B;  2P6J A;  2DMX A;  1S77 D;  1JJO A;  2OT5 A;  2R72 A;  1MNG A;  2EUL A;  4ZBM A;  3ZBH A;  2ETN A;  1VP7 A;  2Q0A A;  3S3W A;  5K1X A;  3W7U A;  4FLU A;  1Y4M A;  1H38 A;  4YXW G;  4XDK A;  1UJW B;  2ZKO A;  3PN1 A;  5BMV B;  2WA3 A;  4WBN A;  2IU0 A;  5DN6 G;  2AZ0 A;  3ZRV A;  1S5H C;  1JX9 A;  4IT5 A;  5D5Q A;  1XNQ O;  3UCS C;  3CPW U;  1SQV H;  1WP7 A;  4EFE A;  1V9P A;  4LF4 O;  1S5J A;  5KHJ A;  5KUK A;  2WLJ A;  1J5E O;  2DWD C;  3K57 A;  1Q5O A;  4MTO A;  2HJF C;  4LWS B;  2N74 A;  3ZHS A;  5EZY A;  2IH1 C;  4U3J A;  2X6C A;  1NJI W;  2YI9 A;  3K0G A;  1OV9 A;  3SR2 C;  1YTF D;  2OTJ V;  5C93 A;  2YXH A;  4FLY A;  1XHZ A;  1ZUQ A;  3UM7 A;  3K04 A;  1EZJ A;  3CSX A;  3FAV A;  4NTW A;  2ZQM A;  2EIK B;  5IE9 A;  1WB8 A;  4DV1 B;  3JAL A;  3J81 N;  1OJH A;  3AEI A;  3UO3 A;  4E2L A;  1S76 D;  1FJG B;  4JI1 B;  1O9H A;  4IL6 Z;  2JJ1 G;  2P4V A;  1HNW B;  4LC1 A;  1AI7 A;  2WPD G;  2F4V B;  3CXC U;  5TIS Z;  1D2D A;  4I50 A;  2XHB A;  4LFA O;  1LUV A;  3APQ A;  3IC9 A;  1JVM A;  1AR4 A;  1BZK A;  1MSD A;  1ZX3 A;  2ILM A;  1BGY H;  4UB8 Z;  4DW1 A;  2UXC O;  3ZX6 A;  1TVK B;  5CBG A;  1B6Q A;  5FPO A;  3CCS V;  1XNQ B;  1BCC H;  4X1K A;  4IHJ A;  1HR0 O;  3ZS8 C;  2F93 B;  3BCC H;  1QVG U;  2Q4P A;  1BQ0 A;  1YTF B;  1K9M W;  2BOC C;  1G4Y B;  4X8A A;  1KD1 W;  2DYR C;  2XTA A;  2IJI A;  1ZL8 A;  3SYA A;  3FAV B;  2UUB O;  1WAZ A;  4I7Z B;  2VRZ A;  2FB5 A;  1IBL O;  1Y67 A;  4WFH A;  3ABK B;  1BMF G;  4MSW C;  4ZHQ B;  4QE9 A;  2RQ6 A;  4PA6 A;  4Q6G A;  4YHH O;  4GKJ O;  1Q6U A;  3SDL A;  2HEP A;  4KXR A;  4DV6 B;  1MSW D;  1Z2G A;  1VEW A;  4B3T O;  4GX5 A;  4DR6 B;  2JVD A;  3N27 A;  1HNX O;  2QJ1 A;  1D5A A;  2JEX A;  4IYH A;  3N2G B;  3CME V;  1Q43 A;  4LF5 O;  2B1I A;  3SYC A;  4DV2 O;  4R8C A;  3AK1 A;  2YXL A;  3ZED A;  1ZAU A;  3QTC A;  4DUY O;  1VQ6 V;  2UUA O;  1YJ9 V;  2ZE6 A;  3ZHT A;  2WLH A;  1H8H G;  3LUT B;  2V1D A;  1PD3 A;  1GKF A;  2UXX A;  1F7Y A;  1EN6 A;  5FLX N;  3DC5 A;  4DV4 B;  4LF6 B;  4FLV A;  3AG4 C;  5LXT A;  1VF7 A;  2P5O A;  1S5L Z;  4J42 A;  4DV0 O;  1AP5 A;  1L8D A;  4KUM A;  1HP8 A;  4WFE A;  2YUA A;  1DF5 A;  2EIM C;  5LA6 A;  4JI5 B;  4NB5 A;  2OCH A;  3GWO A;  4R7C A;  1FPO A;  1KP3 A;  2HP8 A;  4JI7 B;  1FXV A;  1XBL A;  3DC6 A;  3IJ4 A;  4Z1V A;  5K1P A;  3L75 H;  3J80 N;  4HNA B;  1CP9 A;  4DUZ O;  2RCV A;  4MTG A;  3HKD B;  1VQ8 V;  1K4C C;  1Q3E A;  5LMN O;  2W6I G;  4P30 A;  1IXB A;  1THZ A;  3LDE A;  4X65 O;  2B1G A;  4FM1 A;  2RMK B;  3KG2 A;  1YIT V;  4LFB O;  2YDE A;  4RWU A;  3VOU A;  4DUY B;  3BAB A;  2F1M A;  3E8G A;  4LNU A;  2GV9 A;  4YY3 B;  2XAH A;  3VBB A;  4B08 A;  2QWR B;  2AXT Z;  2Y0P A;  4RQE A;  1HNX B;  3ZMT A;  3JD3 A;  3JD0 A;  1B3Q A;  3UKM A;  3D8C A;  1WA8 B;  4UVB A;  1PNK A;  4YJ2 B;  3DTU B;  1NR1 A;  1NZ6 A;  4XDJ A;  2HFE C;  3JCU Z;  2A9H A;  4RQF A;  4L8J A;  4OPA A;  3SYQ A;  4P9P A;  1AI6 A;  1K33 A;  1VQK V;  2LP7 A;  4E4E A;  4FMT A;  4F6R B;  3JAL B;  2E5L O;  1NT2 B;  4F4L A;  3FYE B;  1LUW A;  3KKY A;  4JTC B;  3WB2 A;  4DR1 B;  1R3K C;  4KP4 A;  2OIE A;  4MW8 A;  5J2U B;  1FFT B;  1XMQ O;  3ZIA G;  1I94 O;  1YI2 V;  2YID A;  3G6E V;  5KMG A;  1I94 B;  3ABT A;  2JRI A;  3U10 A;  3E8H A;  5GW7 A;  3WFV A;  1MG1 A;  2JS5 A;  2LW1 A;  3BEH A;  2EJR A;  3K5O A;  1RFY A;  4B3R O;  1Q7Y W;  2ZM6 O;  1FKA O;  3G80 A;  4G2K A;  4MVO A;  3E22 A;  1SQQ H;  1XL4 A;  1VQ4 V;  1Q90 D;  1SF9 A;  1R3J C;  1ZL8 B;  1R6T A;  2CH7 A;  2CAZ C;  2PTM A;  5B5E Z;  2Q7E A;  1YF2 A;  3G67 A;  4DO2 A;  1ZTE A;  4MVU A;  5EBW C;  3H1L H;  5EZY B;  4JAS A;  1N34 B;  1XRE A;  5JJN B;  1W0K G;  1VF5 B;  3ABL C;  1SS3 A;  5EK0 A;  1OCR C;  1ZSP A;  1EZV H;  2EIJ B;  2ZIM A;  2M6Y A;  2ZE8 A;  2E75 B;  1L0N H;  4FLT A;  1JQ0 A;  2WWW A;  3ZMV A;  4G28 B;  2JS3 A;  3JAR A;  1H2N A;  3B77 A;  2V7Q G;  2P67 A;  4ZIB A;  4ZI7 A;  1TGO A;  1WJZ A;  3E35 A;  2F95 B;  1WP8 A;  1GM8 A;  4LF7 O;  1XIL A;  1TUB B;  1HWY A;  2E5L B;  3SJA C;  1KU9 A;  4FJC C;  4WFA V;  1N32 O;  2YIA A;  3CE2 A;  4B7K A;  1FYJ A;  1TVK A;  3RGB A;  4PDV A;  4JF3 A;  3M7M X;  2F23 A;  5B3S C;  3K5L A;  4R50 A;  1IBM B;  4QGP A;  2QM7 A;  1TA8 A;  1NH2 D;  3RYF B;  5IDJ A;  2WLI A;  4OPH A;  1E1R G;  1GN6 A;  1AVM A;  4LBE C;  5B3S B;  2ZT9 B;  2VQE B;  3HKB B;  2VQE O;  1K8A W;  2PYL A;  1W59 A;  2G38 A;  4DR5 O;  1TUE B;  3T1Y B;  5LGN A;  3HR0 A;  1P7B A;  5IYB O;  3GB7 C;  2VQF B;  2ZE7 A;  5KA6 A;  3H1I H;  3B09 A;  1JOY A;  2R9A A;  2FTK A;  4PI0 A;  3QNE A;  3CB2 A;  1VQ5 V;  4GX2 A;  4K8X A;  2VS0 A;  4H44 B;  2KB1 A;  1COW G;  5FL7 G;  4O2B A;  4BIO A;  3O65 A;  3K9A A;  2WLM A;  3ZCC A;  4DW0 A;  1LR1 A;  1W0J G;  4DV7 B;  3A0H Z;  1B06 A;  1OCC B;  4YHH B;  1IBM O;  2ZR2 A;  4B3M B;  5EC2 C;  4X66 B;  1G8M A;  4JPR A;  4FM2 A;  3B2E E;  4EB6 A;  4DR4 O;  1UFI A;  5D5P A;  4O4I A;  4JTD B;  2JGD A;  4TV9 B;  1VIB A;  4CH5 A;  4GUN A;  1WNS A;  4JI0 B;  1R73 A;  3SJC C;  3ZHU A;  1KB9 F;  2Y69 B;  2UUB B;  5H6R A;  3FFQ A;  1IBK B;  2UXN A;  2JIZ G;  4U3J B;  5EBL C;  4CH4 A;  2P22 C;  2Y0I A;  1Q6H A;  2UXD B;  4H37 A;  5L3G A;  2ZIN A;  1F4N A;  4GT1 A;  3THO A;  1K5S A;  4O2A B;  3TXS A;  4O2B B;  3CS5 A;  1N36 B;  5CA0 B;  4BAY A;  1Y6X A;  1XUQ A;  4AQY B;  3OE7 G;  4FFB A;  4NXM B;  2OYQ A;  5C8Y A;  2EZP A;  2NN4 A;  4U3F H;  4CC6 A;  1S72 V;  2D2C B;  2PI4 A;  3WU2 Z;  2QM4 A;  4JZ2 A;  4JYY A;  4I50 B;  5LYJ B;  4FPP A;  2YC0 A;  3E89 A;  3HKE B;  1MOF A;  2Q69 A;  2P90 A;  1M9N A;  1EBO A;  1SZX A;  4ZOL B;  4U7N A;  3GVM A;  2PUS A;  4BIU A;  1DGS A;  4X1Y A;  5FNV A;  1GM9 A;  4TV8 B;  1VAR A;  4D6T H;  4U7O A;  5BMV A;  2HHH B;  3RVY A;  3JAK A;  1W2B U;  4DR7 O;  3CCU V;  4UVC A;  3CP1 A;  4O4J A;  1XDC A;  3T2M A;  5LP6 B;  2W6J G;  3BPZ A;  3RYH B;  4QPK A;  1M1K W;  4QE7 A;  4K35 A;  1XNR B;  4O4L B;  3G71 V;  3J7A U;  3JAR B;  1FAF A;  1KKC A;  4ASU G;  1OZ0 A;  3ETG A;  4X9Q A;  1CEZ A;  4QPJ A;  2Q73 A;  2YEV A;  4R6Z A;  5KUM A;  1AI5 A;  1IBK O;  2GDS A;  4JI0 O;  2Z0A A;  5IJ9 A;  5J2T B;  5GTH Z;  3AK2 A;  4I9W A;  2Z3Y A;  4TV8 A;  1U96 A;  5FNV B;  4BWA A;  3ETE A;  4NXN O;  2ZNJ A;  4DUZ B;  2JK5 C;  3OMA B;  1Y74 B;  4JI8 B;  3ZRW A;  1VQN V;  1K7D A;  1F23 A;  1WB7 A;  5FPR A;  3CC4 V;  1V54 C;  3X2Q C;  1YVW A;  3HKB A;  3QF7 A;  2UXB O;  3BAA A;  2XAJ A;  3ABL B;  1M56 C;  2F43 G;  2YS8 A;  3OFN G;  2Q67 A;  3T1H O;  1QLN A;  4LFB B;  3ABM C;  1I0H A;  3CRM A;  1SKV A;  3BVO A;  3SPG A;  5CBH A;  3LSU A;  4PV1 B;  2P7T C;  3F5T A;  3C3T A;  3T4Z A;  5CB4 B;  1GM7 A;  2UUA B;  3F5W C;  2B9Z A;  1CPY A;  3HPL C;  3L72 H;  4G27 B;  2GTS A;  4HBN A;  4DV1 O;  1R6K A;  5CMU A;  1AJP A;  3H9V A;  4PA4 A; 
#chains in the Genus database with same CATH homology
 1K4D C;  1K4C C;  3CMA V;  5CN0 A;  1LNQ A;  2EIL C;  2JJ2 G;  2W6I G;  4P30 A;  3FYI B;  1M57 C;  1THZ A;  3LDE A;  3B8M A;  3RVZ A;  2B1G A;  2XND G;  4CZZ A;  1PL0 A;  3KG2 A;  1V54 B;  3T4D A;  1YIT V;  5IY5 B;  3OR6 C;  2XAF A;  2DQ3 A;  3VOU A;  1M56 B;  1QR8 A;  1FXK C;  1ORQ C;  3D36 A;  3E8G A;  3AG1 B;  3STZ C;  1K5Q A;  3ASN C;  4RO2 A;  1SRY A;  2XAH A;  2H8P C;  3R65 A;  3VBB A;  5H9C A;  4DXW A;  2QA4 V;  4RQE A;  3ZMT A;  1S3J A;  3JD3 A;  3JD0 A;  4UVA A;  3UKM A;  4UVB A;  1YSC A;  3TCU A;  3MD0 A;  3P32 A;  5J9P C;  2IU3 A;  3JD1 A;  5KA5 A;  1PNK A;  2R9R B;  4OXS A;  4UUJ C;  3DTU B;  2AHZ A;  1NR1 A;  4P9O A;  1DF4 A;  3ABU A;  2QEX V;  4GX1 A;  4XDJ A;  2HFE C;  3FB6 C;  1RPR A;  4LCU C;  1NR7 A;  2NNU A;  1NBM G;  1OHH G;  2A9H A;  2ZXW C;  4RQF A;  3M99 B;  1FXK B;  3ABM B;  5LHH A;  4WCE V;  4HAM A;  3MHH C;  4JGS A;  3SYQ A;  4P9P A;  1AI6 A;  2W0F C;  1K33 A;  1VQK V;  2LP7 A;  4FMT A;  1VQ9 V;  4N23 A;  2HVK C;  4P2Z A;  3E86 A;  2QE7 G;  4F4L A;  3FYE B;  2HVJ C;  2EBO A;  3WG7 B;  4X88 A;  4JTC B;  5CBF A;  4JYB A;  1YJW V;  2DWE C;  2WLN A;  1RPO A;  3OEH G;  1OCO C;  5LGT A;  1KQS U;  3EHB B;  1R3L C;  1PKX A;  2LFR A;  3OM3 B;  3ABK C;  4QJF B;  3HB3 B;  1R3K C;  4KP4 A;  5EC1 C;  3EFF K;  1J95 A;  2EIM B;  2IW5 A;  4MW8 A;  1FFT B;  2C2A A;  3ZMU A;  2D3O W;  2EIK C;  1NVP D;  2B5U A;  1YJN V;  3ZIA G;  1ROP A;  4BW5 A;  3ML0 A;  1YI2 V;  3I56 V;  3LSS A;  1EFR G;  3G6E V;  2ZXW B;  3NXS A;  1M57 B;  3ABT A;  5HFL A;  3E8B A;  4H33 A;  1YHQ V;  3E8H A;  5GW7 A;  3LSQ A;  1MG1 A;  1PNL A;  3WFV A;  4XDL A;  3I55 V;  1OCZ B;  2EJR A;  3BEH A;  4JAU A;  4PDR A;  1Q7Y W;  1NKD A;  2YSU B;  2ITC C;  4UV9 A;  1K3E A;  4RAI A;  2DW4 A;  4G2K A;  1QBZ A;  3FB8 C;  4MVO A;  1BL8 A;  4UXN A;  3W7X A;  1K73 W;  2EIJ C;  3QO7 A;  3QO5 A;  2WAM A;  1XL4 A;  3K06 A;  3CCL V;  1H8E G;  2EIN B;  1VQ4 V;  1QLE C;  3AG2 B;  4L87 A;  3F7Y C;  4BIZ A;  1FXK A;  1R3J C;  3IFX A;  2DYS B;  3B8N A;  3SYO A;  3MHS C;  2XAS A;  3FB7 C;  5LGU A;  2WLL A;  5L3B A;  1Q81 W;  3W7T A;  4I5S A;  4DO2 A;  5IYD O;  3SPI A;  4MVU A;  5EBW C;  4ZKI A;  1Q82 W;  4JAS A;  3CYO A;  5B1N A;  1SET A;  3JYC A;  3OR7 C;  1OCZ C;  1W0K G;  2WSS G;  2ZDI A;  3ABL C;  2GHY A;  3AG3 C;  2DYR B;  1I5X A;  5EK0 A;  1OCR C;  3D3I A;  5CA3 A;  4N21 A;  3ASO B;  1JPX A;  3IC7 A;  2X6B A;  1NH2 B;  2EIJ B;  4WFF A;  2HKO A;  3W7S A;  1VQL V;  1JQ0 A;  2WWW A;  2YEV B;  3ZMV A;  4WFB V;  1F4M A;  4G28 B;  4J9Y B;  3B77 A;  2V7Q G;  1DLB A;  3CCR V;  2P67 A;  1OCO B;  1K92 A;  1FS0 G;  1RM1 C;  1P4R A;  3E35 A;  3E83 A;  3CCM V;  3ETD A;  5L3C A;  1GM8 A;  1JJ2 U;  2DQ0 A;  2H94 A;  4PDM A;  4PA9 A;  3G4S V;  4PDL A;  1HWY A;  3IGA C;  3LDC A;  4FJC C;  3OEE G;  4WFA V;  1WLE A;  3QO8 A;  5EBM C;  1MAB G;  1QVF U;  3K08 A;  3OW2 U;  2EIL B;  3SPC A;  4PDV A;  3T1C A;  3ZN1 A;  3SPJ A;  4JF3 A;  3FB5 C;  5B3S C;  1ENV A;  4R50 A;  2QM7 A;  1DTO A;  1GK9 A;  1NH2 D;  5IDJ A;  2WLI A;  1E1R G;  5HFM A;  3CCE V;  2X7R B;  4LBE C;  5B3S B;  2Z5U A;  3SYP A;  5L3F A;  2PI5 A;  1K8A W;  3TK1 A;  2X0L A;  4WF9 V;  3CCV V;  4EKW A;  5LHG A;  1PNM A;  1TUE B;  5LGN A;  1QCE A;  1P7B A;  1M90 W;  4JYC A;  4TWK A;  5IYB O;  1N8R W;  3ZN0 A;  2QTO A;  3DGE A;  3GB7 C;  5KA6 A;  1RM1 B;  4Q20 A;  4GX0 A;  4QIW F;  1JOY A;  1KKD A;  2FTK A;  3RBZ A;  3RW0 A;  1V55 B;  2P6J A;  1S77 D;  1NQT A;  1OCC C;  3K03 A;  2A79 B;  2OT5 A;  3CD6 V;  3SPH A;  1R6N A;  3ZJZ A;  4MVR A;  2ZR3 A;  4KFM A;  2JEU A;  1VQO V;  3QNE A;  1VQ5 V;  4GX2 A;  1Q86 W;  3K3W A;  4ZBM A;  2WLK A;  2ITD C;  2KB1 A;  1COW G;  3P30 A;  5FL7 G;  4MVS A;  1E1Q G;  3W7U A;  3K9A A;  2IH3 C;  1VQ7 V;  1Y4M A;  1QR9 A;  3ASO C;  4UV8 A;  4YXW G;  4XDK A;  1UJW B;  1H38 A;  1BHB A;  3AG4 B;  2ATK C;  1SZT A;  2OCC C;  4JTA B;  2JDI G;  2WLM A;  1L1F A;  2IU0 A;  3ZCC A;  5DN6 G;  1W0J G;  3ZRV A;  1S5H C;  5LHI A;  1JX9 A;  4MTF A;  2X6A A;  5B1A C;  3CPW U;  2HLD G;  3ZRW B;  1OCC B;  5L3E A;  3ZMS A;  2ZR2 A;  1K97 A;  1YIJ V;  5EC2 C;  1G8M A;  2WLJ A;  5H6Q A;  5KUK A;  4JPR A;  2QM8 A;  2DWD C;  2WLL B;  4MTO A;  3OUF A;  4HYO A;  4JTD B;  2HJF C;  1E79 G;  2IH1 C;  1R73 A;  2X6C A;  1ZWI C;  5B1O A;  1NJI W;  5B1B B;  3K0G A;  1YTF D;  2OTJ V;  4FIP C;  2Y69 B;  1KP2 A;  5C93 A;  3ZMZ A;  5H6R A;  2Q6A A;  2UXN A;  2JIZ G;  5EBL C;  2Y48 A;  3UM7 A;  3K04 A;  1GMG A;  5E1A C;  3E2E A;  4H37 A;  5L3G A;  2ZD9 A;  2Y69 C;  1F4N A;  4GT1 A;  1EZJ A;  4MS2 A;  2K1E A;  3STL C;  1K5S A;  2ZQM A;  2EIK B;  4RUF A;  4BAY A;  3AEI A;  1XL6 A;  4E2L A;  1S76 D;  4HZ3 A;  1H2G A;  3OE7 G;  4LP8 A;  3JCZ A;  2JJ1 G;  2DYS C;  1ARO P;  2EZP A;  4LC1 A;  1AI7 A;  2WPD G;  1QLE B;  3AG2 C;  3AG1 C;  3CXC U;  1JCH A;  1S72 V;  4MVM A;  4JAV A;  2PI4 A;  1R3I C;  3H01 A;  2OTL V;  3OUS A;  1AR1 B;  1JVM A;  2HR3 A;  2WLI B;  3BY6 A;  4FPP A;  5IY5 C;  1FXH A;  1Y66 A;  2HG5 C;  2OCC B;  3E89 A;  4CBC A;  1VQP V;  1BHA A;  4MVZ A;  1MOF A;  5CBG A;  2Q69 A;  2P90 A;  1M9N A;  1EBO A;  1B6Q A;  3CCS V;  5DM6 V;  3ASN B;  3FKS G;  3K0D A;  4U7N A;  2AHY A;  2GSM B;  4BIU A;  1K34 A;  1AJN A;  2XAQ A;  4MTX A;  3X2Q B;  1GM9 A;  4U7O A;  3LNM B;  4MVQ A;  1QVG U;  4TSF G;  1KC8 W;  1YTF B;  5IYC O;  1K9M W;  3ZRS A;  2BOC C;  1G4Y B;  4X8A A;  1KD1 W;  3CCJ V;  3RVY A;  2DYR C;  3F7V C;  2IJI A;  1W2B U;  1SER A;  3SYA A;  1SES A;  3CCU V;  4UVC A;  3CP1 A;  2LFS A;  2BOB C;  3T2M A;  2EZO A;  3TET A;  2W6J G;  4QPK A;  2M7W A;  1M1K W;  4QE7 A;  4WFH A;  3ABK B;  1S0V A;  1BMF G;  1VQM V;  4X89 A;  3G71 V;  2NLJ C;  4MSW C;  4XBF A;  5L3D A;  3OMN B;  4ASU G;  4QE9 A;  4Z1M G;  2QKS A;  4PA6 A;  1OZ0 A;  1OCR B;  1I5Y A;  1AI4 A;  3ETG A;  3JD4 A;  4PA3 A;  3ZRX A;  4MW3 A;  1CEZ A;  1MSW D;  4QPJ A;  4RUE A;  5B1B C;  4GX5 A;  2XAG A;  5BZB A;  2YEV A;  4R6Z A;  1WPX A;  5KUM A;  1AI5 A;  2JEX A;  2Q68 A;  4PEL A;  2IJJ A;  2A0L A;  3CME V;  3AG3 B;  2Z3Y A;  4I9W A;  5CMU A;  2B1I A;  3SYC A;  3W7W A;  4R8C A;  3ETE A;  2ZDI C;  1VQ6 V;  1YJ9 V;  1GTO A;  3LDD A;  2JK5 C;  2IJK A;  1NVP B;  3OMA B;  2WLH A;  1H8H G;  3ZRW A;  1VQN V;  3LUT B;  1K7D A;  1F23 A;  1PD3 A;  1GKF A;  2UXX A;  2V1D A;  4GCZ A;  2R9I A;  4QNH B;  3CC4 V;  1V54 C;  3X2Q C;  5LBQ A;  3AG4 C;  2XAJ A;  4TT3 G;  3ABL B;  1M56 C;  2F43 G;  4PA7 A;  3OAA G;  4KUM A;  1F51 A;  3OFN G;  2Q67 A;  1QLN A;  3ABM C;  4WFE A;  3JD2 A;  3CC2 V;  1DF5 A;  2MK3 A;  2EIM C;  4MT8 A;  3GWO A;  4R7C A;  3SPG A;  5CBH A;  1V55 C;  3CCQ V;  3E8F A;  1IXM A;  1KP3 A;  3SJQ C;  1FXV A;  1KEC A;  2EIN C;  2P7T C;  3WG7 C;  3T4Z A;  5B1A B;  1CP9 A;  1GM7 A;  4J9Z B;  3CC7 V;  2XOK G;  4MTG A;  3F5W C;  4G27 B;  1CPY A;  3HPL C;  3OGC C;  1AJQ A;  3A0R A;  4FK5 C;  1R6K A;  2IJH A;  3OMI B;  1VQ8 V;  3K79 A;  3PJS K;  4WFG A;  1GO3 F;  1AJP A;  4PA4 A;  2CK3 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...