1VQL3

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vql300
1N8R4 2QA43 2QEX3 1VQ63 1KC84 1VQ93 1KQS2 1Q824 3CC23 1NJI4 3CCJ3 1M904 3I563 1VQ53 3CCU3 1YIJ3 3CC73 1YIT3 1VQ43 1VQN3 1VQM3 3OW22 1VQL3 3CCV3 1M1K4 3CME3 3CPW2 3CCM3 3I553 2OTL3 1VQK3 1Q864 3CXC2 1W2B2 1K734 3CC43 1S723 1K9M4 3G6E3 1YJ93 1YI23 1VQO3 1VQ83 3G4S3 1K8A4 1Q814 3G713 3CCS3 1YHQ3 1QVG2 1QVF2 1KD14 1JJ22 2OTJ3 1Q7Y4 3CCL3 3CCQ3 1VQ73 1YJN3 3CCE3 3CD63 1YJW3 3CCR3 3CMA3 1VQP3
chains in the Genus database with same CATH superfamily
5TGNA 3SLUA 2PZVA 4R1KA 3UJMA 3EN1B 3VF1A 5M1AA 4HM1B 1QJGA 1R4YA 4K1VA 4FCJA 3RNTA 1A90A 1NB3I 4JRFA 3DGNA 1MGWA 1VQL3 1B2SA 4MJDA 3UNLA 3CME3 3VGNA 2WGOA 1TFOA 3S27A 1FGMA 2W56B 5G2GA 4G1MB 3X3XA 1S723 3UL5A 5BXQA 1IU7A 4MMZB 3J7Yd 1TU5A 1BRKA 1ZS7A 3FZWA 1TRQA 4HYZA 1W01A 3KN4A 3KIIA 4KFEA 1RGHA 2W9QA 1T3BA 3ALAA 2XGLA 3X41A 3ER7A 3FG3A 3JUNA 2KXGA 4IPBA 1F8NA 1PU4A 3CCR3 2BMOB 2Y74A 4N6OB 5FW5A 1DMNA 1KC84 1B27A 3NV0A 2W03A 4FCZA 1ZX2A 1BSCA 4MMYB 1VQ53 3SVAA 4O2HA 3V98A 5BIRA 3CC73 1OUNA 4KFDA 2D1WA 2CX0A 4CDLA 1SIHA 2HMKB 1YVSA 6GSPA 4TX4A 1BU4A 4NPBA 3ZG0A 4N6MA 6STDA 1BRHA 3WOEB 1VQO3 5M18A 3FH1A 3H3HA 3LH4A 5IG3A 1BSBA 1UI7A 5KP1A 3G713 5AIGA 3CCS3 1FW7A 1QVF2 4J5KA 3WA3A 3AHWA 3G8ZA 4WYKA 2UGIA 5BU4A 1A67A 3RGAA 4XB5A 1FZUA 2ZA4A 3F8HA 1HYFA 1HU9A 2QA43 3V92A 1JZDA 2RFRA 1NU3A 2P05A 4HM8B 5A0OB 1US1A 2FGTA 2Y73A 3IMAB 3KE7A 1UGHI 2W6JH 3D79A 3PZWA 1IV7A 1BNJA 1GOYA 1ISKA 3STDA 1E97A 1Q864 1I2EA 4LEHA 1ROVA 3X40A 1MGRA 2HMJB 2KRTA 1GY7A 2QGUA 4PEJA 2OQEA 2KF3A 1GSPA 3EBTA 4O02B 1KD14 4MEIA 1RKYA 1OACA 2OOVA 1IDPA 3NUVA 3DZLA 4RZMA 1B2MA 1RLSA 1NB5I 4RNYA 3K7CA 1VQ63 1MNLA 5D83A 4L7KA 4L8PA 5CK6A 1BSEA 3BNCA 1R4CA 4QWTA 3HI7A 3NV0B 1VQ43 3O8YA 3FG1A 1YVBI 3BNEA 4OK0A 4XBTA 3LOYA 3FLJA 4KFFA 1IQXA 1WMNA 1BRNL 1G0TA 4K90B 3BNDA 3AMOA 2PNCA 1YJ93 1OHPA 2CFGA 1YI23 4EC6A 4XDWA 1I3FA 1BANA 3GAXA 1Q814 1PYLA 4HVNA 3N9HA 2I9WA 5KP4A 1O7HB 2L4VA 1BNGA 1FGQA 1ROAA 3DGYA 4FR9A 5AIHA 3SOYA 1Q7HA 4ILFA 5IF6A 2YFIB 3DUKA 5I97A 1EQKA 1YJW3 1IVUA 2H0HA 2W04A 4WWUC 4WYKB 5EVHA 1D6YA 1C54A 1RGFA 1ULJB 5GSPA 1RHLA 4AKYA 1JB4A 1OGZA 1EA2A 1TFKA 5CF2A 4HM6B 1JZOA 3NM7A 4Q53A 1CYUA 4LGQA 1BNEA 4LSOA 4O8SA 4HM7B 3WODG 4GSPA 2L1SA 1RN4A 3WHOA 1N5PA 3MYTA 1O7WB 1GD4A 1M9GA 1DVDA 5IEPA 4X2OA 1JNQA 1T2IA 1VQ83 1B2ZA 3G4S3 1OF5B 3PCSA 3KZTA 3S28A 2F98A 1B2UA 2CH9A 3URPA 1RGKA 1CH0A 1AVKA 1GD3A 1OHSA 3SOAA 2ML6A 2Z76A 4O3VA 1IQ8A 1X1XA 4AKZA 1YJN3 2CFDA 1O7MB 2D42A 3NBBA 2KF6A 5D82A 3DY5A 1RDSA 1W6GA 1NWWA 1B21A 2GBWB 2KCDA 2Z7AA 2ZHXB 3NX0A 1VZZA 3A76A 3F14A 3L0RA 1A2VA 4R4KA 3PCRA 3EBYA 5EQLA 1N5HA 1DETA 1BSDA 2AAEA 3MG2A 4N6UA 3M8CA 1ZO2A 3QK9A 1PY3A 4RNZA 4GHOA 1DE3A 2CFWA 5G1LA 7GSPA 2GXFA 1MWRA 2P0MA 3CNMA 2RSXA 3F9SA 5AYRB 3BLZA 3OXAA 1FGOA 2CFLA 1JB5A 3AMOB 2H0GA 2R41A 1IQYA 3MG3A 2XSHB 2F99A 3G0KA 3MG1A 3KSED 1CYVA 2JDIH 1IV9A 1AY7A 1MOLA 1RRLA 3TDGA 1W6CA 1Y4KA 1BSAA 1X1WA 3HIGA 5LC7A 4EV5A 1VQP3 5IERA 1B2XA 3K0ZA 4EYCA 4GL6A 4HBRA 1T5YA 1TTOA 2AADA 1DMMA 3RGRA 3NXJA 4DKIA 4LYLB 1D6ZA 1O7PB 1YIT3 1CQSA 2HMOB 3MSOA 3LTCA 2CWUA 2HMLB 3DGMA 4AEQA 2CIUA 3EB8A 3FSDA 3OV4A 2K54A 1UCKA 1JN5A 3D5IA 2BO9B 3GSPA 3CC43 3JUQA 4BTXA 3NQYA 4BTWA 1K41A 4HOHA 1FUTA 1W2ZA 2CX1A 3GWRA 1RGLA 2XFSA 3QRDA 3AGOA 1X1YA 1GMQA 5FGOA 5KP3A 2F5MA 1IT8A 1LRAA 2BHMA 3DGOA 1W02A 3S29A 3CNXA 2RBIA 3DH2A 2BNGA 2MC8A 2B1XB 3MPHA 5BVBA 1RN1A 1YGWA 3JUOA 4BIRA 1RSNA 3I563 3Q1CA 4EBGA 2LQVA 3G16A 2Q07A 1OH0A 2E2UA 5AEUB 3CCV3 8RNTA 3H51A 3NHXA 3CCM3 2OTL3 2CK3H 5EEOA 3CXC2 2C11A 1G96A 3Q2PA 1QMAA 2SBLA 3HK4A 1OF5A 3ECFA 3T8UA 4HM2B 1HZ1A 2CG0A 2HMMB 1OGXA 2A15A 1YGEA 2IMJA 2IUJA 1TIJA 1LQGC 3EF8A 8CHOA 2F5WA 7STDA 1BUJA 5ELUA 1VQ73 2KAAA 3D5GA 2CG1A 1JJ22 1K28A 3CMA3 3BU4A 2B24B 3F7SA 3KFQC 2H0IA 3CC23 2UX0A 1HKXA 1RNTA 1BNSA 3HX8A 1TP6A 3K5TA 3AGNA 3JUMA 2F86B 1LOYA 2Z77A 3EQQB 5LC6A 3OW22 4GB5A 1FGTA 1QAFA 2P09A 1M1K4 1W00A 3CPW2 1A2PA 4BTYA 3I553 5AEWB 1J2BA 3AHSA 3WOFB 3OX9A 1LOVA 4ORLA 1AV4A 3OWSA 1WMOA 3GZBA 1UUVB 1JN5B 2WOHA 3B4PA 3HIIA 3DXOA 5CXOA 3BB9A 3WA2X 1JV2B 3EE1A 3EJVA 5ELJA 4OUQA 2CWTA 1UGIA 4J5GA 1RGGA 9RNTA 1T2HA 3X42A 4CJNA 5DREA 1AR0A 1RNBA 1W5ZA 5AYSC 1BAOA 2RNTA 1BNRA 3FF0A 4HM3B 3JUPA 3T8NA 1IVWA 4FCMA 1WTHA 2M7OA 1MWTA 2BU4A 2YX9A 2F56A 3D3LA 4HM4B 1AVLA 1Q42A 1BOXA 1NNVA 1STDA 2W9PA 4HZ9B 4FMAA 3U97A 1GS3A 1GY5A 1C7HA 2HOHA 2K0MA 3EN8A 1E3VA 3F40A 3MHEA 3UB1A 4BL3A 1EUIC 1ZGXA 3FGYA 1FYSA 4IT7A 2STDA 2GBXB 4LZIA 1B20A 3RDEA 1BIRA 3PYJA 4N6TA 2RGQA 3LT9A 3CCL3 1JBTA 1U8CB 2V1LA 1BRSA 1RCKA 4N3VA 4EW5A 1LNIA 1OCVA 3A5EA 5IEOA 1Q824 1GOUA 2OWPA 1GOVA 3CCU3 1RTUA 4R9LA 1YIJ3 1NDOB 4J8TA 1I2GA 4R80A 1KSIA 1FUSA 3I0YA 1KWIA 2BT3A 2GEYA 4K1UA 4LMIA 5STDA 4BU4A 2QIYA 3B7CA 3NQZA 1MWUA 1BUQA 3OWYA 4I5QA 4FMCA 1I0VA 3F8XA 4BL2A 3PS8A 3LTBA 2OQEC 3EX9A 3K63A 2SARA 3KCHA 2CWVA 3N54B 4HZBB 4NREA 4U13A 1O7GB 3T0UA 1QVG2 3JVCA 1I2FA 2OOVC 2XH9A 1BRIA 3GZXB 3HOHA 6RNTA 1FUWA 3SEDA 1TRPA 2W0QA 3LYGA 4RNTA 1O7NB 2CC3A 1IT7A 4HJLB 1VQ93 4XBXA 1CEWI 1BVIA 3U1WA 3WDGB 1UUGB 1JB2A 1N9JA 1W6YA 1FGRA 2GU1A 5M19A 4L8OA 1LOXA 1G02A 5D81A 3NBJA 2C4BA 4HM0B 3WR2A 4N6NB 1VQK3 1V58A 5IENA 1W2B2 3EHCA 4K61A 3LMLA 3K9MC 3LT8A 2IY2A 2P38A 1BNIA 2C10A 3EC9A 5IG4A 5HGRA 1YHQ3 3S5CA 1RMSA 2XSOB 1RCLA 1A2KA 1VQQA 3UL6A 2E2VA 2F4YA 3S67A 1Q7Y4 1W7CA 1AQZA 2QEX3 3FF2A 5AIIA 3E99A 2BMQB 4CCVA 1NJI4 3CCJ3 3BNBA 1RJOA 1I0XA 3LZAA 1JBRA 5JPPA 4J9AA 5IG5A 1VQM3 2CFKA 2XFTA 5AI1A 2INXA 1JKGA 2GEXA 1JRQA 4WP5A 4XM4A 1IYYA 2LYXA 3IJEB 1JBSA 1U5OA 4CPKA 4MMXB 1N8QA 3G6E3 4HM5B 1SPUA 5IG0A 1BGSA 1Q40B 1GMPA 1GYBA 1V57A 2XF3A 1TJDA 1RRHA 5CLKA 2ZDJA 5RNTA 3FKAA 2FXTA 1SQWA 1WMPA 1UCLA 3CD63 4EXRA 4HAAA 1I8VA 2IUKA 3Q3FA 3BIRA 1DVCA 1X1UA 3NM2A 3GRDA 4H3UA 3LXUX 1M904 2K3DA 2Z6BA 1E3RA 3ROBA 1EKMA 3D9RA 4HKVB 1MWSA 4I4KA 2UUGC 4RBNA 2ZL8A 5HOHA 3SYUA 4X2HA 3GZYB 3ZFZA 2WOFA 1UUWB 3FG4A 1BNFA 2IA7A 2KF5A 4KT3B 1K734 1OPYA 1SIIA 5DRVA 4STDA 1ULIB 1FA3A 3KSPA 4JF8A 1S5AA 2CW9A 1K8A4 5JBSA 3SXXA 4XBYA 2O3OA 1N9EA 2O9UX 1LVNA 2ML5A 3B4OA 1GY6A 1PFPA 3DGLA 3LTAA 1UCJA 3HZPA 3PXMA 3CCQ3 1EEJA 2YFLB 4FMBA 2GU3A 4WHAA 3CCE3 3LTDA 1BRGA 1LQMB 1Q9EA 4N6V0 3D4AA 1EG9B 1KQS2 4WFOA 4N6LA 5AIFA 2CHCA 1I70A 2YFJB 3F7XA 2GSPA 3WMDA 1VQN3 1QALA 3Q90A 4R9KA 3SX1A 1TUHA 1NO3A 3DMCA 4H61A 1BRJA 4EV2A 2W56A 1WQLB 2XRXB 1YNVX 4KZ1A 3X3YA 1JKGB 2IYJA 1IK3A 2CKFB 1DMQA 2HMNB 1K9M4 1Z1SA 1RGAA 1GMRA 1RGEA 1IVXA 3IPTA 3ZG5A 4NHFA 1SARA 2OCTA 1LXEA 5G1KA 3X3ZA 1DYUA 2OTJ3 2E2TA 3B8LA 3CPOA 2J8XB 3MWZA 2XGNA 3N8BA 1N8R4 2P0XA 1RGCA 1UI8A 2KF4A 1L5GB 1IVVA 1ASKA 1WNHA 3VSYA 3FCSB 1W4NA 1UCIA 1V74A 1STFI 4OVMA 1M1XB 2R4IA 4IIAA 2JQ5A 2XEPA 3NBRA 1B3SA 1I3IA 1LOWA 1SJWA 2WGQA 1UW1A 1QAKA 1UDII 3OWUA 5JPUA 4XDVA 2BIRA 1OHOA 2BMRB 2RCDA 4ZM8A 7RNTA 5IW9A 4KVHA 1Q40A 1D6UA 5CF1A 2W2CA 3CU3A 3GZRA 2MF7A 2FNQA 2XR8B 3MKIA 1LNHA 4FMDA 3PGBA 3V99A 1RN7A 2WO0A 3DM8A 3KKGA
chains in the Genus database with same CATH topology
5TGNA 3SLUA 2PZVA 4R1KA 3UJMA 3EN1B 3VF1A 4HM1B 1QJGA 4K1VA 4FCJA 1A90A 1NB3I 4JRFA 3DGNA 1VQL3 4MJDA 3UNLA 3CME3 3VGNA 2WGOA 1TFOA 3S27A 1FGMA 2W56B 5G2GA 4G1MB 3X3XA 1S723 3UL5A 5BXQA 1IU7A 4MMZB 3J7Yd 1TU5A 3FZWA 4HYZA 1W01A 3KN4A 3KIIA 4KFEA 2W9QA 3ALAA 2XGLA 3X41A 3ER7A 3FG3A 3JUNA 2KXGA 4IPBA 1F8NA 1PU4A 3CCR3 2BMOB 2Y74A 4N6OB 5FW5A 1DMNA 1KC84 3NV0A 2W03A 4FCZA 1ZX2A 4MMYB 1VQ53 3SVAA 4O2HA 3V98A 3CC73 1OUNA 4KFDA 2D1WA 4CDLA 1SIHA 2HMKB 4TX4A 4N6MA 6STDA 3WOEB 1VQO3 3FH1A 3H3HA 3LH4A 5IG3A 1UI7A 5KP1A 3G713 5AIGA 3CCS3 1QVF2 3WA3A 3G8ZA 4WYKA 1A67A 3RGAA 4XB5A 3F8HA 1HU9A 2QA43 3V92A 2RFRA 1NU3A 2P05A 4HM8B 5A0OB 1US1A 2FGTA 2Y73A 3IMAB 3KE7A 2W6JH 3PZWA 1IV7A 1ISKA 3STDA 1E97A 1Q864 4LEHA 1ROVA 3X40A 2HMJB 2KRTA 1GY7A 2QGUA 4PEJA 2OQEA 3EBTA 4O02B 1KD14 4MEIA 1RKYA 1OACA 2OOVA 1IDPA 3NUVA 3DZLA 4RZMA 1NB5I 4RNYA 3K7CA 1VQ63 1MNLA 5D83A 4L7KA 4L8PA 5CK6A 3BNCA 1R4CA 4QWTA 3HI7A 3NV0B 1VQ43 3O8YA 3FG1A 1YVBI 3BNEA 4OK0A 4XBTA 3LOYA 3FLJA 4KFFA 1IQXA 1WMNA 4K90B 3BNDA 3AMOA 2PNCA 1YJ93 1OHPA 2CFGA 1YI23 4EC6A 4XDWA 3GAXA 1Q814 4HVNA 3N9HA 2I9WA 5KP4A 1O7HB 2L4VA 1FGQA 4FR9A 1ROAA 1JJ22 5AIHA 5IF6A 2YFIB 3DUKA 5I97A 1EQKA 1YJW3 2W04A 1IVUA 4WWUC 4WYKB 5EVHA 1D6YA 1ULJB 4AKYA 1JB4A 1OGZA 1EA2A 1TFKA 5CF2A 4HM6B 3NM7A 4Q53A 1CYUA 4LGQA 4LSOA 4O8SA 4HM7B 3WODG 1N5PA 3MYTA 1O7WB 1GD4A 1M9GA 1DVDA 5IEPA 4X2OA 1JNQA 1VQ83 3G4S3 1OF5B 3PCSA 3KZTA 3S28A 2F98A 2CH9A 1OHSA 1AVKA 1GD3A 3SOAA 3SOYA 2ML6A 2Z76A 4O3VA 1IQ8A 4AKZA 1YJN3 2CFDA 1O7MB 2D42A 3NBBA 5D82A 3DY5A 1W6GA 1NWWA 2GBWB 2KCDA 2Z7AA 3NX0A 4R4KA 1VZZA 3A76A 3F14A 3L0RA 1A2VA 3PCRA 3EBYA 5EQLA 1N5HA 3MG2A 4N6UA 3M8CA 1ZO2A 3QK9A 4RNZA 2CFWA 2GXFA 2P0MA 3CNMA 2RSXA 3F9SA 5AYRB 3BLZA 3OXAA 1FGOA 2CFLA 1JB5A 3AMOB 1IQYA 3MG3A 2XSHB 2F99A 3G0KA 3MG1A 3KSED 1CYVA 2JDIH 1IV9A 1MOLA 3TDGA 1RRLA 1VQP3 1W6CA 1Y4KA 3HIGA 5LC7A 4EV5A 5IERA 3K0ZA 4EYCA 4GL6A 4HBRA 1T5YA 3RGRA 1DMMA 3NXJA 1D6ZA 1O7PB 1YIT3 1CQSA 2HMOB 3MSOA 3LTCA 2CWUA 2HMLB 3DGMA 4AEQA 2CIUA 3EB8A 3FSDA 3OV4A 2K54A 1JN5A 3CC43 2BO9B 3JUQA 4BTXA 3NQYA 4BTWA 1K41A 1W2ZA 3GWRA 2XFSA 3QRDA 5FGOA 5KP3A 3DGOA 1IT8A 2BHMA 1W02A 3S29A 3CNXA 2BNGA 2MC8A 2B1XB 3MPHA 5BVBA 3JUOA 3I563 3Q1CA 4EBGA 2LQVA 3G16A 2Q07A 1OH0A 2E2UA 5AEUB 3CCV3 3H51A 3NHXA 3CCM3 2OTL3 2CK3H 5EEOA 3CXC2 2C11A 1G96A 3Q2PA 1QMAA 2SBLA 3HK4A 1OF5A 3ECFA 3T8UA 4HM2B 2CG0A 2HMMB 1OGXA 2A15A 1YGEA 2IMJA 2IUJA 1TIJA 3EF8A 8CHOA 7STDA 5ELUA 1VQ73 2CG1A 3CMA3 1K28A 2B24B 3F7SA 3KFQC 3CC23 2UX0A 1HKXA 3HX8A 1TP6A 3K5TA 3JUMA 2F86B 2Z77A 3EQQB 5LC6A 3OW22 4GB5A 1FGTA 1QAFA 2P09A 1M1K4 1W00A 3CPW2 4BTYA 1J2BA 3I553 5AEWB 3WOFB 3OX9A 4ORLA 1AV4A 3OWSA 1WMOA 3GZBA 1UUVB 1JN5B 2WOHA 3B4PA 3HIIA 3DXOA 5CXOA 3BB9A 3WA2X 1JV2B 3EE1A 3EJVA 5ELJA 4OUQA 2CWTA 3X42A 5DREA 1AR0A 1W5ZA 5AYSC 3FF0A 4HM3B 3JUPA 3T8NA 1IVWA 4FCMA 1WTHA 2M7OA 2YX9A 3D3LA 4HM4B 1AVLA 1Q42A 1STDA 2W9PA 4HZ9B 4FMAA 3U97A 1GS3A 1GY5A 1C7HA 2K0MA 3EN8A 3F40A 1E3VA 3MHEA 3UB1A 3FGYA 4IT7A 2STDA 2GBXB 4LZIA 3RDEA 3PYJA 4N6TA 2RGQA 3LT9A 3CCL3 1U8CB 2V1LA 4N3VA 1OCVA 5IEOA 1Q824 2OWPA 3CCU3 4R9LA 1YIJ3 1NDOB 4J8TA 4R80A 1KSIA 3I0YA 1KWIA 2BT3A 2GEYA 4K1UA 4LMIA 5STDA 2QIYA 3B7CA 3NQZA 1BUQA 3OWYA 4FMCA 3F8XA 3PS8A 3LTBA 2OQEC 3EX9A 3K63A 3N54B 4HZBB 2CWVA 4U13A 3T0UA 4NREA 1QVG2 1O7GB 3JVCA 2OOVC 2XH9A 1FUWA 3GZXB 3SEDA 2W0QA 3LYGA 1O7NB 2CC3A 1IT7A 4HJLB 1VQ93 4XBXA 1CEWI 3U1WA 3WDGB 1JB2A 1N9JA 1W6YA 1FGRA 2GU1A 4L8OA 1LOXA 5D81A 3NBJA 4HM0B 4N6NB 1VQK3 5IENA 1W2B2 3EHCA 4K61A 3LMLA 3K9MC 3LT8A 2P38A 2C10A 3EC9A 5IG4A 5HGRA 1YHQ3 3S5CA 2XSOB 1A2KA 3UL6A 2E2VA 3S67A 1Q7Y4 1W7CA 2QEX3 3FF2A 5AIIA 3E99A 2BMQB 4CCVA 1NJI4 3CCJ3 3BNBA 1RJOA 3LZAA 5JPPA 4J9AA 5IG5A 1VQM3 2CFKA 2XFTA 5AI1A 2INXA 1JKGA 2GEXA 1JRQA 4WP5A 4XM4A 2LYXA 3IJEB 1U5OA 4MMXB 1N8QA 3G6E3 4HM5B 1SPUA 5IG0A 1Q40B 1GYBA 2XF3A 1RRHA 5CLKA 2ZDJA 3FKAA 2FXTA 1SQWA 1WMPA 3CD63 4EXRA 2IUKA 1DVCA 3NM2A 3GRDA 4H3UA 3LXUX 1M904 2Z6BA 1E3RA 3ROBA 1EKMA 3D9RA 4HKVB 4I4KA 4RBNA 2ZL8A 4X2HA 3GZYB 2WOFA 1UUWB 3FG4A 2IA7A 1K734 1OPYA 1SIIA 5DRVA 4STDA 1ULIB 1FA3A 3KSPA 4JF8A 1S5AA 2CW9A 1K8A4 5JBSA 3SXXA 4XBYA 2O3OA 1N9EA 2O9UX 1LVNA 2ML5A 3B4OA 1GY6A 1PFPA 3DGLA 3LTAA 3PXMA 3HZPA 3CCQ3 2YFLB 4FMBA 2GU3A 4WHAA 3CCE3 3LTDA 4N6V0 1EG9B 1KQS2 4WFOA 4N6LA 5AIFA 2CHCA 2YFJB 3F7XA 3WMDA 1VQN3 1QALA 3Q90A 4R9KA 3SX1A 1TUHA 1NO3A 3DMCA 4H61A 4EV2A 2W56A 1WQLB 2XRXB 4KZ1A 3X3YA 1JKGB 1IK3A 2CKFB 1DMQA 2HMNB 1K9M4 1Z1SA 1IVXA 3IPTA 4NHFA 3X3ZA 2OCTA 1LXEA 2OTJ3 1DYUA 2E2TA 3B8LA 3CPOA 3MWZA 2XGNA 3N8BA 1N8R4 2P0XA 1UI8A 1L5GB 1IVVA 1ASKA 1WNHA 3VSYA 3FCSB 1W4NA 1V74A 1STFI 4OVMA 1M1XB 2R4IA 4IIAA 2JQ5A 2XEPA 3NBRA 1SJWA 2WGQA 1UW1A 1QAKA 3OWUA 5JPUA 4XDVA 2BMRB 1OHOA 2RCDA 4ZM8A 5IW9A 4KVHA 1Q40A 1D6UA 5CF1A 2W2CA 3CU3A 3GZRA 2MF7A 2FNQA 2XR8B 3MKIA 1LNHA 4FMDA 3PGBA 3V99A 1RN7A 2WO0A 3DM8A 3KKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R 4;  2QA4 3;  2QEX 3;  1VQ6 3;  1KC8 4;  1VQ9 3;  1KQS 2;  1Q82 4;  3CC2 3;  1NJI 4;  3CCJ 3;  1M90 4;  3I56 3;  1VQ5 3;  3CCU 3;  1YIJ 3;  3CC7 3;  1YIT 3;  1VQ4 3;  1VQN 3;  1VQM 3;  3OW2 2;  1VQL 3;  3CCV 3;  1M1K 4;  3CME 3;  3CPW 2;  3CCM 3;  3I55 3;  2OTL 3;  1VQK 3;  1Q86 4;  3CXC 2;  1W2B 2;  1K73 4;  3CC4 3;  1S72 3;  1K9M 4;  3G6E 3;  1YJ9 3;  1YI2 3;  1VQO 3;  1VQ8 3;  3G4S 3;  1K8A 4;  1Q81 4;  3G71 3;  3CCS 3;  1YHQ 3;  1QVG 2;  1QVF 2;  1KD1 4;  1JJ2 2;  2OTJ 3;  1Q7Y 4;  3CCL 3;  3CCQ 3;  1VQ7 3;  1YJN 3;  3CCE 3;  3CD6 3;  1YJW 3;  3CCR 3;  3CMA 3;  1VQP 3; 
#chains in the Genus database with same CATH topology
 5TGN A;  3SLU A;  2PZV A;  4R1K A;  3UJM A;  3EN1 B;  3VF1 A;  5M1A A;  4HM1 B;  1QJG A;  1R4Y A;  4K1V A;  4FCJ A;  3RNT A;  1A90 A;  1NB3 I;  4JRF A;  3DGN A;  1MGW A;  1VQL 3;  1B2S A;  4MJD A;  3UNL A;  3CME 3;  3VGN A;  2WGO A;  1TFO A;  3S27 A;  1FGM A;  2W56 B;  5G2G A;  4G1M B;  3X3X A;  1S72 3;  3UL5 A;  5BXQ A;  1IU7 A;  4MMZ B;  3J7Y d;  1TU5 A;  1BRK A;  1ZS7 A;  3FZW A;  1TRQ A;  4HYZ A;  1W01 A;  3KN4 A;  3KII A;  4KFE A;  1RGH A;  2W9Q A;  1T3B A;  3ALA A;  2XGL A;  3X41 A;  3ER7 A;  3FG3 A;  3JUN A;  2KXG A;  4IPB A;  1F8N A;  1PU4 A;  3CCR 3;  2BMO B;  2Y74 A;  4N6O B;  5FW5 A;  1DMN A;  1KC8 4;  1B27 A;  3NV0 A;  2W03 A;  4FCZ A;  1ZX2 A;  1BSC A;  4MMY B;  1VQ5 3;  3SVA A;  4O2H A;  3V98 A;  5BIR A;  3CC7 3;  1OUN A;  4KFD A;  2D1W A;  2CX0 A;  4CDL A;  1SIH A;  2HMK B;  1YVS A;  6GSP A;  4TX4 A;  1BU4 A;  4NPB A;  3ZG0 A;  4N6M A;  6STD A;  1BRH A;  3WOE B;  1VQO 3;  5M18 A;  3FH1 A;  3H3H A;  3LH4 A;  5IG3 A;  1BSB A;  1UI7 A;  5KP1 A;  3G71 3;  5AIG A;  3CCS 3;  1FW7 A;  1QVF 2;  4J5K A;  3WA3 A;  3AHW A;  3G8Z A;  4WYK A;  2UGI A;  5BU4 A;  1A67 A;  3RGA A;  4XB5 A;  1FZU A;  2ZA4 A;  3F8H A;  1HYF A;  1HU9 A;  2QA4 3;  3V92 A;  1JZD A;  2RFR A;  1NU3 A;  2P05 A;  4HM8 B;  5A0O B;  1US1 A;  2FGT A;  2Y73 A;  3IMA B;  3KE7 A;  1UGH I;  2W6J H;  3D79 A;  3PZW A;  1IV7 A;  1BNJ A;  1GOY A;  1ISK A;  3STD A;  1E97 A;  1Q86 4;  1I2E A;  4LEH A;  1ROV A;  3X40 A;  1MGR A;  2HMJ B;  2KRT A;  1GY7 A;  2QGU A;  4PEJ A;  2OQE A;  2KF3 A;  1GSP A;  3EBT A;  4O02 B;  1KD1 4;  4MEI A;  1RKY A;  1OAC A;  2OOV A;  1IDP A;  3NUV A;  3DZL A;  4RZM A;  1B2M A;  1RLS A;  1NB5 I;  4RNY A;  3K7C A;  1VQ6 3;  1MNL A;  5D83 A;  4L7K A;  4L8P A;  5CK6 A;  1BSE A;  3BNC A;  1R4C A;  4QWT A;  3HI7 A;  3NV0 B;  1VQ4 3;  3O8Y A;  3FG1 A;  1YVB I;  3BNE A;  4OK0 A;  4XBT A;  3LOY A;  3FLJ A;  4KFF A;  1IQX A;  1WMN A;  1BRN L;  1G0T A;  4K90 B;  3BND A;  3AMO A;  2PNC A;  1YJ9 3;  1OHP A;  2CFG A;  1YI2 3;  4EC6 A;  4XDW A;  1I3F A;  1BAN A;  3GAX A;  1Q81 4;  1PYL A;  4HVN A;  3N9H A;  2I9W A;  5KP4 A;  1O7H B;  2L4V A;  1BNG A;  1FGQ A;  1ROA A;  3DGY A;  4FR9 A;  5AIH A;  3SOY A;  1Q7H A;  4ILF A;  5IF6 A;  2YFI B;  3DUK A;  5I97 A;  1EQK A;  1YJW 3;  1IVU A;  2H0H A;  2W04 A;  4WWU C;  4WYK B;  5EVH A;  1D6Y A;  1C54 A;  1RGF A;  1ULJ B;  5GSP A;  1RHL A;  4AKY A;  1JB4 A;  1OGZ A;  1EA2 A;  1TFK A;  5CF2 A;  4HM6 B;  1JZO A;  3NM7 A;  4Q53 A;  1CYU A;  4LGQ A;  1BNE A;  4LSO A;  4O8S A;  4HM7 B;  3WOD G;  4GSP A;  2L1S A;  1RN4 A;  3WHO A;  1N5P A;  3MYT A;  1O7W B;  1GD4 A;  1M9G A;  1DVD A;  5IEP A;  4X2O A;  1JNQ A;  1T2I A;  1VQ8 3;  1B2Z A;  3G4S 3;  1OF5 B;  3PCS A;  3KZT A;  3S28 A;  2F98 A;  1B2U A;  2CH9 A;  3URP A;  1RGK A;  1CH0 A;  1AVK A;  1GD3 A;  1OHS A;  3SOA A;  2ML6 A;  2Z76 A;  4O3V A;  1IQ8 A;  1X1X A;  4AKZ A;  1YJN 3;  2CFD A;  1O7M B;  2D42 A;  3NBB A;  2KF6 A;  5D82 A;  3DY5 A;  1RDS A;  1W6G A;  1NWW A;  1B21 A;  2GBW B;  2KCD A;  2Z7A A;  2ZHX B;  3NX0 A;  1VZZ A;  3A76 A;  3F14 A;  3L0R A;  1A2V A;  4R4K A;  3PCR A;  3EBY A;  5EQL A;  1N5H A;  1DET A;  1BSD A;  2AAE A;  3MG2 A;  4N6U A;  3M8C A;  1ZO2 A;  3QK9 A;  1PY3 A;  4RNZ A;  4GHO A;  1DE3 A;  2CFW A;  5G1L A;  7GSP A;  2GXF A;  1MWR A;  2P0M A;  3CNM A;  2RSX A;  3F9S A;  5AYR B;  3BLZ A;  3OXA A;  1FGO A;  2CFL A;  1JB5 A;  3AMO B;  2H0G A;  2R41 A;  1IQY A;  3MG3 A;  2XSH B;  2F99 A;  3G0K A;  3MG1 A;  3KSE D;  1CYV A;  2JDI H;  1IV9 A;  1AY7 A;  1MOL A;  1RRL A;  3TDG A;  1W6C A;  1Y4K A;  1BSA A;  1X1W A;  3HIG A;  5LC7 A;  4EV5 A;  1VQP 3;  5IER A;  1B2X A;  3K0Z A;  4EYC A;  4GL6 A;  4HBR A;  1T5Y A;  1TTO A;  2AAD A;  1DMM A;  3RGR A;  3NXJ A;  4DKI A;  4LYL B;  1D6Z A;  1O7P B;  1YIT 3;  1CQS A;  2HMO B;  3MSO A;  3LTC A;  2CWU A;  2HML B;  3DGM A;  4AEQ A;  2CIU A;  3EB8 A;  3FSD A;  3OV4 A;  2K54 A;  1UCK A;  1JN5 A;  3D5I A;  2BO9 B;  3GSP A;  3CC4 3;  3JUQ A;  4BTX A;  3NQY A;  4BTW A;  1K41 A;  4HOH A;  1FUT A;  1W2Z A;  2CX1 A;  3GWR A;  1RGL A;  2XFS A;  3QRD A;  3AGO A;  1X1Y A;  1GMQ A;  5FGO A;  5KP3 A;  2F5M A;  1IT8 A;  1LRA A;  2BHM A;  3DGO A;  1W02 A;  3S29 A;  3CNX A;  2RBI A;  3DH2 A;  2BNG A;  2MC8 A;  2B1X B;  3MPH A;  5BVB A;  1RN1 A;  1YGW A;  3JUO A;  4BIR A;  1RSN A;  3I56 3;  3Q1C A;  4EBG A;  2LQV A;  3G16 A;  2Q07 A;  1OH0 A;  2E2U A;  5AEU B;  3CCV 3;  8RNT A;  3H51 A;  3NHX A;  3CCM 3;  2OTL 3;  2CK3 H;  5EEO A;  3CXC 2;  2C11 A;  1G96 A;  3Q2P A;  1QMA A;  2SBL A;  3HK4 A;  1OF5 A;  3ECF A;  3T8U A;  4HM2 B;  1HZ1 A;  2CG0 A;  2HMM B;  1OGX A;  2A15 A;  1YGE A;  2IMJ A;  2IUJ A;  1TIJ A;  1LQG C;  3EF8 A;  8CHO A;  2F5W A;  7STD A;  1BUJ A;  5ELU A;  1VQ7 3;  2KAA A;  3D5G A;  2CG1 A;  1JJ2 2;  1K28 A;  3CMA 3;  3BU4 A;  2B24 B;  3F7S A;  3KFQ C;  2H0I A;  3CC2 3;  2UX0 A;  1HKX A;  1RNT A;  1BNS A;  3HX8 A;  1TP6 A;  3K5T A;  3AGN A;  3JUM A;  2F86 B;  1LOY A;  2Z77 A;  3EQQ B;  5LC6 A;  3OW2 2;  4GB5 A;  1FGT A;  1QAF A;  2P09 A;  1M1K 4;  1W00 A;  3CPW 2;  1A2P A;  4BTY A;  3I55 3;  5AEW B;  1J2B A;  3AHS A;  3WOF B;  3OX9 A;  1LOV A;  4ORL A;  1AV4 A;  3OWS A;  1WMO A;  3GZB A;  1UUV B;  1JN5 B;  2WOH A;  3B4P A;  3HII A;  3DXO A;  5CXO A;  3BB9 A;  3WA2 X;  1JV2 B;  3EE1 A;  3EJV A;  5ELJ A;  4OUQ A;  2CWT A;  1UGI A;  4J5G A;  1RGG A;  9RNT A;  1T2H A;  3X42 A;  4CJN A;  5DRE A;  1AR0 A;  1RNB A;  1W5Z A;  5AYS C;  1BAO A;  2RNT A;  1BNR A;  3FF0 A;  4HM3 B;  3JUP A;  3T8N A;  1IVW A;  4FCM A;  1WTH A;  2M7O A;  1MWT A;  2BU4 A;  2YX9 A;  2F56 A;  3D3L A;  4HM4 B;  1AVL A;  1Q42 A;  1BOX A;  1NNV A;  1STD A;  2W9P A;  4HZ9 B;  4FMA A;  3U97 A;  1GS3 A;  1GY5 A;  1C7H A;  2HOH A;  2K0M A;  3EN8 A;  1E3V A;  3F40 A;  3MHE A;  3UB1 A;  4BL3 A;  1EUI C;  1ZGX A;  3FGY A;  1FYS A;  4IT7 A;  2STD A;  2GBX B;  4LZI A;  1B20 A;  3RDE A;  1BIR A;  3PYJ A;  4N6T A;  2RGQ A;  3LT9 A;  3CCL 3;  1JBT A;  1U8C B;  2V1L A;  1BRS A;  1RCK A;  4N3V A;  4EW5 A;  1LNI A;  1OCV A;  3A5E A;  5IEO A;  1Q82 4;  1GOU A;  2OWP A;  1GOV A;  3CCU 3;  1RTU A;  4R9L A;  1YIJ 3;  1NDO B;  4J8T A;  1I2G A;  4R80 A;  1KSI A;  1FUS A;  3I0Y A;  1KWI A;  2BT3 A;  2GEY A;  4K1U A;  4LMI A;  5STD A;  4BU4 A;  2QIY A;  3B7C A;  3NQZ A;  1MWU A;  1BUQ A;  3OWY A;  4I5Q A;  4FMC A;  1I0V A;  3F8X A;  4BL2 A;  3PS8 A;  3LTB A;  2OQE C;  3EX9 A;  3K63 A;  2SAR A;  3KCH A;  2CWV A;  3N54 B;  4HZB B;  4NRE A;  4U13 A;  1O7G B;  3T0U A;  1QVG 2;  3JVC A;  1I2F A;  2OOV C;  2XH9 A;  1BRI A;  3GZX B;  3HOH A;  6RNT A;  1FUW A;  3SED A;  1TRP A;  2W0Q A;  3LYG A;  4RNT A;  1O7N B;  2CC3 A;  1IT7 A;  4HJL B;  1VQ9 3;  4XBX A;  1CEW I;  1BVI A;  3U1W A;  3WDG B;  1UUG B;  1JB2 A;  1N9J A;  1W6Y A;  1FGR A;  2GU1 A;  5M19 A;  4L8O A;  1LOX A;  1G02 A;  5D81 A;  3NBJ A;  2C4B A;  4HM0 B;  3WR2 A;  4N6N B;  1VQK 3;  1V58 A;  5IEN A;  1W2B 2;  3EHC A;  4K61 A;  3LML A;  3K9M C;  3LT8 A;  2IY2 A;  2P38 A;  1BNI A;  2C10 A;  3EC9 A;  5IG4 A;  5HGR A;  1YHQ 3;  3S5C A;  1RMS A;  2XSO B;  1RCL A;  1A2K A;  1VQQ A;  3UL6 A;  2E2V A;  2F4Y A;  3S67 A;  1Q7Y 4;  1W7C A;  1AQZ A;  2QEX 3;  3FF2 A;  5AII A;  3E99 A;  2BMQ B;  4CCV A;  1NJI 4;  3CCJ 3;  3BNB A;  1RJO A;  1I0X A;  3LZA A;  1JBR A;  5JPP A;  4J9A A;  5IG5 A;  1VQM 3;  2CFK A;  2XFT A;  5AI1 A;  2INX A;  1JKG A;  2GEX A;  1JRQ A;  4WP5 A;  4XM4 A;  1IYY A;  2LYX A;  3IJE B;  1JBS A;  1U5O A;  4CPK A;  4MMX B;  1N8Q A;  3G6E 3;  4HM5 B;  1SPU A;  5IG0 A;  1BGS A;  1Q40 B;  1GMP A;  1GYB A;  1V57 A;  2XF3 A;  1TJD A;  1RRH A;  5CLK A;  2ZDJ A;  5RNT A;  3FKA A;  2FXT A;  1SQW A;  1WMP A;  1UCL A;  3CD6 3;  4EXR A;  4HAA A;  1I8V A;  2IUK A;  3Q3F A;  3BIR A;  1DVC A;  1X1U A;  3NM2 A;  3GRD A;  4H3U A;  3LXU X;  1M90 4;  2K3D A;  2Z6B A;  1E3R A;  3ROB A;  1EKM A;  3D9R A;  4HKV B;  1MWS A;  4I4K A;  2UUG C;  4RBN A;  2ZL8 A;  5HOH A;  3SYU A;  4X2H A;  3GZY B;  3ZFZ A;  2WOF A;  1UUW B;  3FG4 A;  1BNF A;  2IA7 A;  2KF5 A;  4KT3 B;  1K73 4;  1OPY A;  1SII A;  5DRV A;  4STD A;  1ULI B;  1FA3 A;  3KSP A;  4JF8 A;  1S5A A;  2CW9 A;  1K8A 4;  5JBS A;  3SXX A;  4XBY A;  2O3O A;  1N9E A;  2O9U X;  1LVN A;  2ML5 A;  3B4O A;  1GY6 A;  1PFP A;  3DGL A;  3LTA A;  1UCJ A;  3HZP A;  3PXM A;  3CCQ 3;  1EEJ A;  2YFL B;  4FMB A;  2GU3 A;  4WHA A;  3CCE 3;  3LTD A;  1BRG A;  1LQM B;  1Q9E A;  4N6V 0;  3D4A A;  1EG9 B;  1KQS 2;  4WFO A;  4N6L A;  5AIF A;  2CHC A;  1I70 A;  2YFJ B;  3F7X A;  2GSP A;  3WMD A;  1VQN 3;  1QAL A;  3Q90 A;  4R9K A;  3SX1 A;  1TUH A;  1NO3 A;  3DMC A;  4H61 A;  1BRJ A;  4EV2 A;  2W56 A;  1WQL B;  2XRX B;  1YNV X;  4KZ1 A;  3X3Y A;  1JKG B;  2IYJ A;  1IK3 A;  2CKF B;  1DMQ A;  2HMN B;  1K9M 4;  1Z1S A;  1RGA A;  1GMR A;  1RGE A;  1IVX A;  3IPT A;  3ZG5 A;  4NHF A;  1SAR A;  2OCT A;  1LXE A;  5G1K A;  3X3Z A;  1DYU A;  2OTJ 3;  2E2T A;  3B8L A;  3CPO A;  2J8X B;  3MWZ A;  2XGN A;  3N8B A;  1N8R 4;  2P0X A;  1RGC A;  1UI8 A;  2KF4 A;  1L5G B;  1IVV A;  1ASK A;  1WNH A;  3VSY A;  3FCS B;  1W4N A;  1UCI A;  1V74 A;  1STF I;  4OVM A;  1M1X B;  2R4I A;  4IIA A;  2JQ5 A;  2XEP A;  3NBR A;  1B3S A;  1I3I A;  1LOW A;  1SJW A;  2WGQ A;  1UW1 A;  1QAK A;  1UDI I;  3OWU A;  5JPU A;  4XDV A;  2BIR A;  1OHO A;  2BMR B;  2RCD A;  4ZM8 A;  7RNT A;  5IW9 A;  4KVH A;  1Q40 A;  1D6U A;  5CF1 A;  2W2C A;  3CU3 A;  3GZR A;  2MF7 A;  2FNQ A;  2XR8 B;  3MKI A;  1LNH A;  4FMD A;  3PGB A;  3V99 A;  1RN7 A;  2WO0 A;  3DM8 A;  3KKG A; 
#chains in the Genus database with same CATH homology
 5TGN A;  3SLU A;  2PZV A;  4R1K A;  3UJM A;  3EN1 B;  3VF1 A;  4HM1 B;  1QJG A;  4K1V A;  4FCJ A;  1A90 A;  1NB3 I;  4JRF A;  3DGN A;  1VQL 3;  4MJD A;  3UNL A;  3CME 3;  3VGN A;  2WGO A;  1TFO A;  3S27 A;  1FGM A;  2W56 B;  5G2G A;  4G1M B;  3X3X A;  1S72 3;  3UL5 A;  5BXQ A;  1IU7 A;  4MMZ B;  3J7Y d;  1TU5 A;  3FZW A;  4HYZ A;  1W01 A;  3KN4 A;  3KII A;  4KFE A;  2W9Q A;  3ALA A;  2XGL A;  3X41 A;  3ER7 A;  3FG3 A;  3JUN A;  2KXG A;  4IPB A;  1F8N A;  1PU4 A;  3CCR 3;  2BMO B;  2Y74 A;  4N6O B;  5FW5 A;  1DMN A;  1KC8 4;  3NV0 A;  2W03 A;  4FCZ A;  1ZX2 A;  4MMY B;  1VQ5 3;  3SVA A;  4O2H A;  3V98 A;  3CC7 3;  1OUN A;  4KFD A;  2D1W A;  4CDL A;  1SIH A;  2HMK B;  4TX4 A;  4N6M A;  6STD A;  3WOE B;  1VQO 3;  3FH1 A;  3H3H A;  3LH4 A;  5IG3 A;  1UI7 A;  5KP1 A;  3G71 3;  5AIG A;  3CCS 3;  1QVF 2;  3WA3 A;  3G8Z A;  4WYK A;  1A67 A;  3RGA A;  4XB5 A;  3F8H A;  1HU9 A;  2QA4 3;  3V92 A;  2RFR A;  1NU3 A;  2P05 A;  4HM8 B;  5A0O B;  1US1 A;  2FGT A;  2Y73 A;  3IMA B;  3KE7 A;  2W6J H;  3PZW A;  1IV7 A;  1ISK A;  3STD A;  1E97 A;  1Q86 4;  4LEH A;  1ROV A;  3X40 A;  2HMJ B;  2KRT A;  1GY7 A;  2QGU A;  4PEJ A;  2OQE A;  3EBT A;  4O02 B;  1KD1 4;  4MEI A;  1RKY A;  1OAC A;  2OOV A;  1IDP A;  3NUV A;  3DZL A;  4RZM A;  1NB5 I;  4RNY A;  3K7C A;  1VQ6 3;  1MNL A;  5D83 A;  4L7K A;  4L8P A;  5CK6 A;  3BNC A;  1R4C A;  4QWT A;  3HI7 A;  3NV0 B;  1VQ4 3;  3O8Y A;  3FG1 A;  1YVB I;  3BNE A;  4OK0 A;  4XBT A;  3LOY A;  3FLJ A;  4KFF A;  1IQX A;  1WMN A;  4K90 B;  3BND A;  3AMO A;  2PNC A;  1YJ9 3;  1OHP A;  2CFG A;  1YI2 3;  4EC6 A;  4XDW A;  3GAX A;  1Q81 4;  4HVN A;  3N9H A;  2I9W A;  5KP4 A;  1O7H B;  2L4V A;  1FGQ A;  4FR9 A;  1ROA A;  1JJ2 2;  5AIH A;  5IF6 A;  2YFI B;  3DUK A;  5I97 A;  1EQK A;  1YJW 3;  2W04 A;  1IVU A;  4WWU C;  4WYK B;  5EVH A;  1D6Y A;  1ULJ B;  4AKY A;  1JB4 A;  1OGZ A;  1EA2 A;  1TFK A;  5CF2 A;  4HM6 B;  3NM7 A;  4Q53 A;  1CYU A;  4LGQ A;  4LSO A;  4O8S A;  4HM7 B;  3WOD G;  1N5P A;  3MYT A;  1O7W B;  1GD4 A;  1M9G A;  1DVD A;  5IEP A;  4X2O A;  1JNQ A;  1VQ8 3;  3G4S 3;  1OF5 B;  3PCS A;  3KZT A;  3S28 A;  2F98 A;  2CH9 A;  1OHS A;  1AVK A;  1GD3 A;  3SOA A;  3SOY A;  2ML6 A;  2Z76 A;  4O3V A;  1IQ8 A;  4AKZ A;  1YJN 3;  2CFD A;  1O7M B;  2D42 A;  3NBB A;  5D82 A;  3DY5 A;  1W6G A;  1NWW A;  2GBW B;  2KCD A;  2Z7A A;  3NX0 A;  4R4K A;  1VZZ A;  3A76 A;  3F14 A;  3L0R A;  1A2V A;  3PCR A;  3EBY A;  5EQL A;  1N5H A;  3MG2 A;  4N6U A;  3M8C A;  1ZO2 A;  3QK9 A;  4RNZ A;  2CFW A;  2GXF A;  2P0M A;  3CNM A;  2RSX A;  3F9S A;  5AYR B;  3BLZ A;  3OXA A;  1FGO A;  2CFL A;  1JB5 A;  3AMO B;  1IQY A;  3MG3 A;  2XSH B;  2F99 A;  3G0K A;  3MG1 A;  3KSE D;  1CYV A;  2JDI H;  1IV9 A;  1MOL A;  3TDG A;  1RRL A;  1VQP 3;  1W6C A;  1Y4K A;  3HIG A;  5LC7 A;  4EV5 A;  5IER A;  3K0Z A;  4EYC A;  4GL6 A;  4HBR A;  1T5Y A;  3RGR A;  1DMM A;  3NXJ A;  1D6Z A;  1O7P B;  1YIT 3;  1CQS A;  2HMO B;  3MSO A;  3LTC A;  2CWU A;  2HML B;  3DGM A;  4AEQ A;  2CIU A;  3EB8 A;  3FSD A;  3OV4 A;  2K54 A;  1JN5 A;  3CC4 3;  2BO9 B;  3JUQ A;  4BTX A;  3NQY A;  4BTW A;  1K41 A;  1W2Z A;  3GWR A;  2XFS A;  3QRD A;  5FGO A;  5KP3 A;  3DGO A;  1IT8 A;  2BHM A;  1W02 A;  3S29 A;  3CNX A;  2BNG A;  2MC8 A;  2B1X B;  3MPH A;  5BVB A;  3JUO A;  3I56 3;  3Q1C A;  4EBG A;  2LQV A;  3G16 A;  2Q07 A;  1OH0 A;  2E2U A;  5AEU B;  3CCV 3;  3H51 A;  3NHX A;  3CCM 3;  2OTL 3;  2CK3 H;  5EEO A;  3CXC 2;  2C11 A;  1G96 A;  3Q2P A;  1QMA A;  2SBL A;  3HK4 A;  1OF5 A;  3ECF A;  3T8U A;  4HM2 B;  2CG0 A;  2HMM B;  1OGX A;  2A15 A;  1YGE A;  2IMJ A;  2IUJ A;  1TIJ A;  3EF8 A;  8CHO A;  7STD A;  5ELU A;  1VQ7 3;  2CG1 A;  3CMA 3;  1K28 A;  2B24 B;  3F7S A;  3KFQ C;  3CC2 3;  2UX0 A;  1HKX A;  3HX8 A;  1TP6 A;  3K5T A;  3JUM A;  2F86 B;  2Z77 A;  3EQQ B;  5LC6 A;  3OW2 2;  4GB5 A;  1FGT A;  1QAF A;  2P09 A;  1M1K 4;  1W00 A;  3CPW 2;  4BTY A;  1J2B A;  3I55 3;  5AEW B;  3WOF B;  3OX9 A;  4ORL A;  1AV4 A;  3OWS A;  1WMO A;  3GZB A;  1UUV B;  1JN5 B;  2WOH A;  3B4P A;  3HII A;  3DXO A;  5CXO A;  3BB9 A;  3WA2 X;  1JV2 B;  3EE1 A;  3EJV A;  5ELJ A;  4OUQ A;  2CWT A;  3X42 A;  5DRE A;  1AR0 A;  1W5Z A;  5AYS C;  3FF0 A;  4HM3 B;  3JUP A;  3T8N A;  1IVW A;  4FCM A;  1WTH A;  2M7O A;  2YX9 A;  3D3L A;  4HM4 B;  1AVL A;  1Q42 A;  1STD A;  2W9P A;  4HZ9 B;  4FMA A;  3U97 A;  1GS3 A;  1GY5 A;  1C7H A;  2K0M A;  3EN8 A;  3F40 A;  1E3V A;  3MHE A;  3UB1 A;  3FGY A;  4IT7 A;  2STD A;  2GBX B;  4LZI A;  3RDE A;  3PYJ A;  4N6T A;  2RGQ A;  3LT9 A;  3CCL 3;  1U8C B;  2V1L A;  4N3V A;  1OCV A;  5IEO A;  1Q82 4;  2OWP A;  3CCU 3;  4R9L A;  1YIJ 3;  1NDO B;  4J8T A;  4R80 A;  1KSI A;  3I0Y A;  1KWI A;  2BT3 A;  2GEY A;  4K1U A;  4LMI A;  5STD A;  2QIY A;  3B7C A;  3NQZ A;  1BUQ A;  3OWY A;  4FMC A;  3F8X A;  3PS8 A;  3LTB A;  2OQE C;  3EX9 A;  3K63 A;  3N54 B;  4HZB B;  2CWV A;  4U13 A;  3T0U A;  4NRE A;  1QVG 2;  1O7G B;  3JVC A;  2OOV C;  2XH9 A;  1FUW A;  3GZX B;  3SED A;  2W0Q A;  3LYG A;  1O7N B;  2CC3 A;  1IT7 A;  4HJL B;  1VQ9 3;  4XBX A;  1CEW I;  3U1W A;  3WDG B;  1JB2 A;  1N9J A;  1W6Y A;  1FGR A;  2GU1 A;  4L8O A;  1LOX A;  5D81 A;  3NBJ A;  4HM0 B;  4N6N B;  1VQK 3;  5IEN A;  1W2B 2;  3EHC A;  4K61 A;  3LML A;  3K9M C;  3LT8 A;  2P38 A;  2C10 A;  3EC9 A;  5IG4 A;  5HGR A;  1YHQ 3;  3S5C A;  2XSO B;  1A2K A;  3UL6 A;  2E2V A;  3S67 A;  1Q7Y 4;  1W7C A;  2QEX 3;  3FF2 A;  5AII A;  3E99 A;  2BMQ B;  4CCV A;  1NJI 4;  3CCJ 3;  3BNB A;  1RJO A;  3LZA A;  5JPP A;  4J9A A;  5IG5 A;  1VQM 3;  2CFK A;  2XFT A;  5AI1 A;  2INX A;  1JKG A;  2GEX A;  1JRQ A;  4WP5 A;  4XM4 A;  2LYX A;  3IJE B;  1U5O A;  4MMX B;  1N8Q A;  3G6E 3;  4HM5 B;  1SPU A;  5IG0 A;  1Q40 B;  1GYB A;  2XF3 A;  1RRH A;  5CLK A;  2ZDJ A;  3FKA A;  2FXT A;  1SQW A;  1WMP A;  3CD6 3;  4EXR A;  2IUK A;  1DVC A;  3NM2 A;  3GRD A;  4H3U A;  3LXU X;  1M90 4;  2Z6B A;  1E3R A;  3ROB A;  1EKM A;  3D9R A;  4HKV B;  4I4K A;  4RBN A;  2ZL8 A;  4X2H A;  3GZY B;  2WOF A;  1UUW B;  3FG4 A;  2IA7 A;  1K73 4;  1OPY A;  1SII A;  5DRV A;  4STD A;  1ULI B;  1FA3 A;  3KSP A;  4JF8 A;  1S5A A;  2CW9 A;  1K8A 4;  5JBS A;  3SXX A;  4XBY A;  2O3O A;  1N9E A;  2O9U X;  1LVN A;  2ML5 A;  3B4O A;  1GY6 A;  1PFP A;  3DGL A;  3LTA A;  3PXM A;  3HZP A;  3CCQ 3;  2YFL B;  4FMB A;  2GU3 A;  4WHA A;  3CCE 3;  3LTD A;  4N6V 0;  1EG9 B;  1KQS 2;  4WFO A;  4N6L A;  5AIF A;  2CHC A;  2YFJ B;  3F7X A;  3WMD A;  1VQN 3;  1QAL A;  3Q90 A;  4R9K A;  3SX1 A;  1TUH A;  1NO3 A;  3DMC A;  4H61 A;  4EV2 A;  2W56 A;  1WQL B;  2XRX B;  4KZ1 A;  3X3Y A;  1JKG B;  1IK3 A;  2CKF B;  1DMQ A;  2HMN B;  1K9M 4;  1Z1S A;  1IVX A;  3IPT A;  4NHF A;  3X3Z A;  2OCT A;  1LXE A;  2OTJ 3;  1DYU A;  2E2T A;  3B8L A;  3CPO A;  3MWZ A;  2XGN A;  3N8B A;  1N8R 4;  2P0X A;  1UI8 A;  1L5G B;  1IVV A;  1ASK A;  1WNH A;  3VSY A;  3FCS B;  1W4N A;  1V74 A;  1STF I;  4OVM A;  1M1X B;  2R4I A;  4IIA A;  2JQ5 A;  2XEP A;  3NBR A;  1SJW A;  2WGQ A;  1UW1 A;  1QAK A;  3OWU A;  5JPU A;  4XDV A;  2BMR B;  1OHO A;  2RCD A;  4ZM8 A;  5IW9 A;  4KVH A;  1Q40 A;  1D6U A;  5CF1 A;  2W2C A;  3CU3 A;  3GZR A;  2MF7 A;  2FNQ A;  2XR8 B;  3MKI A;  1LNH A;  4FMD A;  3PGB A;  3V99 A;  1RN7 A;  2WO0 A;  3DM8 A;  3KKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...