1VQM3

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vqm300
1VQ43 1Q7Y4 1VQO3 3CCV3 3CCJ3 3CCE3 1VQ63 1YJW3 1JJ22 3CCQ3 1QVG2 1VQN3 3CCS3 3CC43 1VQ73 1NJI4 3CD63 1YI23 3CCM3 1K9M4 1M1K4 1VQL3 2QA43 3CC23 1YJ93 1QVF2 1KQS2 1K8A4 3G713 3CCU3 1Q824 2OTJ3 3CMA3 1VQP3 3CCL3 3CCR3 3CC73 1S723 1VQ53 1VQK3 1YIT3 1Q864 1VQ83 1KD14 3CXC2 2OTL3 3G6E3 1YHQ3 3CPW2 1W2B2 1VQ93 3I563 1YIJ3 2QEX3 1N8R4 3CME3 3G4S3 1VQM3 3I553 1KC84 3OW22 1YJN3 1Q814 1K734 1M904
chains in the Genus database with same CATH superfamily
3F7SA 1JRQA 1HKXA 3NXJA 2ZL8A 4HVNA 1GMQA 3OV4A 2MF7A 4RNYA 3ZG5A 1BRJA 2P0XA 1BRSA 1RCKA 2F56A 3LH4A 3NQYA 2YFLB 1NJI4 3CD63 1I0VA 2CFLA 1Q7HA 3MSOA 1FW7A 2GSPA 1RDSA 2XSHB 4LYLB 6STDA 3WOFB 1BSAA 2AADA 1T3BA 1UGHI 4K61A 3DGYA 4L8PA 2CC3A 4AKYA 2RCDA 3ER7A 3K5TA 1NDOB 1RNTA 1IVXA 3NQZA 1OCVA 1BRIA 4R9LA 3LTCA 4ORLA 1VQ93 1JB4A 2QGUA 3F8HA 1RGFA 3D79A 1BNEA 3IJEB 4IT7A 3N9HA 4AKZA 5IEOA 3BNDA 3T8UA 1FGOA 4FCJA 1NO3A 4LGQA 3SLUA 4EC6A 5JPUA 1MWTA 2E2VA 3MG1A 4BL2A 1QVG2 4FCMA 1BNRA 3S67A 1IVUA 1U8CB 4NHFA 4WYKA 3ZG0A 4ZM8A 3EN8A 3SYUA 4R1KA 3CC23 1N5PA 4FMDA 1KQS2 1JZOA 2WOHA 1FGMA 1V58A 4IIAA 1KWIA 3Q1CA 2E2TA 5IG0A 4RNZA 1UCIA 2CHCA 3WA3A 1UUWB 1IU7A 1JBSA 1ROVA 1U5OA 1OGZA 1SJWA 1I2GA 1W2ZA 2OOVC 3FF2A 2CKFB 3NM7A 1RGGA 2SBLA 2K3DA 4L8OA 5GSPA 1GD4A 4N6TA 3DY5A 2RGQA 1KC84 5IW9A 1LNIA 1LXEA 4FMBA 1JB2A 1G96A 4FMAA 3NUVA 4HM3B 1G0TA 1STFI 3H3HA 4EXRA 1VQO3 1TIJA 3D9RA 4FMCA 3X40A 1RLSA 3GRDA 1FGTA 4HM6B 3CCM3 1A2PA 1WMOA 1BSDA 4HM8B 1O7HB 3V98A 9RNTA 2HMLB 4HM1B 4GB5A 2BU4A 3WDGB 2IMJA 1OACA 1VQK3 1OH0A 2W56A 4XDWA 2IYJA 3JUPA 2BHMA 4H61A 1FUSA 5BVBA 2F86B 4X2HA 1N8R4 1B2MA 3NX0A 4RBNA 3U1WA 6GSPA 1E3RA 2Z77A 3EJVA 1BU4A 1FZUA 2SARA 1FGRA 3DZLA 3HIIA 3NV0A 1TRPA 1OHOA 1N9JA 5I97A 1I0XA 1YJW3 2GBXB 3FSDA 3CCQ3 3N8BA 4J5KA 3MG2A 1JBTA 3JVCA 1M1K4 2B1XB 2QA43 1YVSA 2OQEA 1QAKA 4LZIA 1DMNA 3MKIA 3GAXA 2BO9B 2CK3H 4I4KA 3MHEA 4BIRA 1VQ53 1KSIA 1LOYA 2KF6A 2KCDA 1IQ8A 3DH2A 1R4YA 3RNTA 3UNLA 2CG0A 2HMKB 3Q3FA 2Y73A 1ISKA 3EB8A 1W00A 1Q814 4CJNA 4KFDA 5M18A 1FUWA 4J9AA 4R4KA 1BNSA 1NU3A 3CNMA 3PCSA 1AVLA 2INXA 1O7NB 2A15A 5BXQA 3D4AA 1DYUA 1X1YA 3J7Yd 1UCLA 2W0QA 2BMQB 2CFKA 2O3OA 5AYSC 3RGRA 1JNQA 1C7HA 4U13A 3G713 1NB5I 1BRNL 1SQWA 1WNHA 3D3LA 5AIFA 3TDGA 1QAFA 4HM4B 1RNBA 1MOLA 1VQQA 2WGQA 1X1XA 3CPW2 1GMPA 1B27A 3I563 1ASKA 2KF3A 1YIJ3 4J5GA 4N6UA 1RN1A 2CX1A 3NBBA 5AIHA 1JV2B 3BU4A 4BL3A 4WWUC 2ZHXB 5IF6A 3I0YA 1SIIA 2RNTA 2AAEA 1PYLA 3EE1A 2OCTA 4WYKB 2B24B 2LQVA 3VGNA 4HYZA 2Q07A 1TU5A 1IT8A 4KFFA 1MWRA 1HU9A 3PZWA 3K63A 1JB5A 1F8NA 2W9PA 5EQLA 3IPTA 4HAAA 1ZGXA 4NREA 1K8A4 3CCU3 1A2KA 1B2ZA 5RNTA 3WOEB 1RRLA 3BB9A 1V57A 4LSOA 5EEOA 3G8ZA 1K41A 1EUIC 4MJDA 1Q864 3G16A 1D6YA 4N6MA 1LRAA 2MC8A 4CCVA 3RDEA 7RNTA 4CPKA 1M9GA 5HGRA 3CME3 2C10A 1UCKA 2LYXA 1TFKA 3LTAA 3G4S3 4HM2B 3N54B 4BTXA 1I3FA 1N9EA 3PXMA 3DXOA 1IDPA 3Q2PA 3WODG 3SOYA 3X41A 1UUVB 3CCV3 5CF1A 2UX0A 1LQGC 1QALA 3BNEA 3HOHA 3MWZA 1D6ZA 1M1XB 3PGBA 3FCSB 3KN4A 1SARA 1B20A 1K9M4 1GOVA 1W7CA 1DVCA 1GY5A 1OGXA 3EF8A 1W5ZA 2WOFA 1N5HA 1I2FA 1AVKA 1RSNA 2W56B 3BNCA 3EBYA 2RSXA 1Q824 4N6OB 3B8LA 5D82A 3LYGA 1OF5A 3OWUA 2P05A 5CXOA 1K28A 3S29A 3URPA 2BIRA 2CX0A 3SEDA 5G1LA 1UUGB 1G02A 2C11A 1IV9A 1EKMA 2ML6A 3NV0B 1W4NA 4PEJA 1VQM3 1JBRA 5IEPA 1EA2A 3F7XA 1RGEA 1B2SA 4OVMA 1VZZA 2F99A 1W2B2 1RN4A 1B2XA 1TUHA 2P38A 2CIUA 2YFJB 3DGNA 3UB1A 1MGWA 5CF2A 5M19A 2H0IA 3CCS3 3DGMA 1TJDA 3LTDA 4QWTA 1BAOA 1QVF2 1W6GA 1OHPA 5ELUA 4EYCA 3WMDA 1SPUA 5LC7A 1I2EA 3SXXA 1T5YA 3CCR3 2F5WA 4TX4A 5G2GA 3LMLA 4R80A 1VQ83 2H0HA 3HZPA 2OTL3 1T2IA 1US1A 5EVHA 2QIYA 2UUGC 1TP6A 4KFEA 3U97A 1O7WB 1GYBA 3QRDA 4L7KA 2W03A 3AGNA 1RGHA 3LTBA 1FA3A 2XR8B 2C4BA 3KE7A 3FLJA 2CH9A 3M8CA 1DE3A 3B4OA 3EQQB 1C54A 1YNVX 1YGWA 3CCJ3 1ULJB 2XEPA 1BSBA 3K7CA 5FGOA 3SVAA 3F8XA 3LZAA 1VQ73 2GXFA 2UGIA 3S5CA 3V92A 1W6CA 1EEJA 4JF8A 1BUJA 1R4CA 3DMCA 5CK6A 5D81A 3VSYA 5FW5A 4WP5A 2YX9A 1BNGA 1LOXA 5KP4A 1BGSA 2K54A 2F4YA 1FUTA 1CH0A 4STDA 1NWWA 3CMA3 3GZYB 1OUNA 2GBWB 2M7OA 2XF3A 3Q90A 3X42A 4EBGA 1CYUA 3FGYA 2GEYA 1WQLB 3F40A 4O2HA 2IY2A 2GU3A 3RGAA 1IQYA 3UJMA 5DREA 5AYRB 1I3IA 2HMJB 1GOUA 2KRTA 3PCRA 1S5AA 1VQ43 1GD3A 4MMYB 3D5GA 2XSOB 3O8YA 1BOXA 1LVNA 1BSEA 3CCE3 3E99A 3ECFA 1UDII 3FKAA 3EC9A 2CFGA 1EQKA 2P09A 5AEWB 8RNTA 5AIIA 5BU4A 3WR2A 1FGQA 4MEIA 3KSPA 3BNBA 3ROBA 1RRHA 1VQP3 1CQSA 4HBRA 3X3YA 2ZDJA 3OWSA 1JN5A 1KD14 1IT7A 1O7MB 1ZO2A 1GY7A 5LC6A 5BIRA 3H51A 3V99A 4HJLB 1GMRA 2CWUA 4KT3B 4N6NB 2CWTA 1DVDA 2W04A 3D5IA 1YVBI 4XB5A 2Z6BA 2L4VA 3KFQC 5CLKA 2CFDA 1X1UA 3F14A 4O3VA 4BTWA 1M904 4I5QA 1BNJA 2KXGA 3JUOA 1RGCA 2RBIA 1Q9EA 2GEXA 3BIRA 3GSPA 1BUQA 1Z1SA 4H3UA 1IVWA 1OF5B 1NNVA 1YJ93 5JBSA 3LXUX 3A5EA 3T8NA 2RFRA 2F5MA 1LOWA 3FZWA 3T0UA 3FG4A 2OTJ3 1UI8A 3ZFZA 2W9QA 1WMNA 2D42A 4HKVB 1B2UA 5STDA 1BVIA 5HOHA 1A90A 1JKGA 4HZBB 4XM4A 3CU3A 1BRHA 1QMAA 4GSPA 1MWSA 2BNGA 2CFWA 2PZVA 4EV2A 1I70A 1PFPA 1X1WA 3LOYA 4RNTA 3AMOB 1J2BA 1RHLA 7STDA 1JZDA 3HIGA 5D83A 2V1LA 3JUMA 3QK9A 1SIHA 1B21A 3L0RA 1VQ63 4Q53A 1HZ1A 2OOVA 3IMAB 2WO0A 2Z7AA 4FCZA 1JJ22 3CC43 2H0GA 2IUJA 2JQ5A 4G1MB 4GHOA 5IG3A 3B4PA 4R9KA 3VF1A 1WTHA 4LMIA 1ULIB 1WMPA 2XGLA 1TFOA 5A0OB 2HMOB 1BIRA 3AHWA 4X2OA 3OX9A 3PS8A 1DETA 3KCHA 1T2HA 3LT9A 3PYJA 1A2VA 1DMQA 4K90B 5IG5A 2OWPA 3UL6A 3GZXB 4MMZB 1YJN3 1RN7A 2Y74A 1CYVA 2ZA4A 2KF5A 3LT8A 3EBTA 4HM0B 1LOVA 1LQMB 1RJOA 4RZMA 3KKGA 1HYFA 3GZBA 1RTUA 2O9UX 3AGOA 1VQN3 3AMOA 2R4IA 3S28A 4WHAA 5TGNA 2HMNB 1NB3I 2XGNA 3EHCA 1TTOA 3BLZA 2XRXB 1Y4KA 1BSCA 1RGKA 1RCLA 3K0ZA 5KP1A 1S723 3ALAA 3F9SA 3GZRA 1Q42A 2JDIH 3SX1A 4HZ9B 4CDLA 5JPPA 3CXC2 3NHXA 1YHQ3 1RGAA 3AHSA 3DGOA 3WA2X 1RGLA 2L1SA 4KVHA 3X3XA 5IERA 3EX9A 5KP3A 2CWVA 2PNCA 1GSPA 2CG1A 1A67A 4BU4A 3X3ZA 5G1KA 4EW5A 4FR9A 3K9MC 3HK4A 4GL6A 4OUQA 2E2UA 1I8VA 4O02B 2BMRB 1GOYA 1UCJA 4N6LA 5IG4A 2IUKA 3STDA 2ML5A 3JUNA 1UI7A 3MPHA 1JN5B 1PU4A 1D6UA 4LEHA 5AEUB 1BRGA 4K1UA 1TRQA 2FGTA 2J8XB 3CCL3 4DKIA 1IK3A 2STDA 4XDVA 4EV5A 1OHSA 3FF0A 4AEQA 5IENA 2HMMB 1BNFA 2CW9A 3EN1B 1AR0A 1EG9B 3G0KA 4N6V0 3WHOA 1V74A 2XH9A 2QEX3 3KSED 4HM5B 3HI7A 1FYSA 1QJGA 1Q40B 2F98A 2BMOB 1PY3A 1AV4A 1CEWI 1Q7Y4 2KAAA 1OPYA 1IVVA 3A76A 3HX8A 2W6JH 1W01A 2I9WA 2YFIB 5ELJA 1IV7A 3CPOA 6RNTA 1BANA 1MWUA 3DGLA 3DM8A 1AQZA 1YI23 1IYYA 3KZTA 1VQL3 1W6YA 1STDA 3MG3A 5AI1A 1ZS7A 1IQXA 1LNHA 1E97A 4XBYA 2WGOA 1JKGB 2R41A 3OWYA 2FNQA 2BT3A 4KZ1A 3CC73 4IPBA 1UGIA 1W02A 3NBJA 1ROAA 3KIIA 1RKYA 1YIT3 1AY7A 3G6E3 3NM2A 1YGEA 2K0MA 3B7CA 3DUKA 1BRKA 3SOAA 1O7GB 3GWRA 3S27A 3JUQA 3I553 3OW22 2KF4A 2IA7A 2Z76A 2GU1A 5M1AA 4O8SA 4BTYA 2OQEC 5DRVA 4XBTA 2XFTA 4K1VA 3UL5A 1N8QA 1Q40A 3FH1A 4HOHA 1MGRA 4N3VA 1ZX2A 4JRFA 7GSPA 4ILFA 3CNXA 1RMSA 2P0MA 1BNIA 1O7PB 2FXTA 2XFSA 4NPBA 1L5GB 4XBXA 5AIGA 3OXAA 1GY6A 1E3VA 4MMXB 4OK0A 1B3SA 8CHOA 4HM7B 2D1WA 4WFOA 4J8TA 2W2CA 1MNLA 1GS3A 3FG3A 3MYTA 2HOHA 3NBRA 1UW1A 1K734 1DMMA 3FG1A
chains in the Genus database with same CATH topology
3F7SA 1JRQA 1HKXA 3NXJA 2ZL8A 4HVNA 4AEQA 3OV4A 2MF7A 4RNYA 2P0XA 3LH4A 3NQYA 2YFLB 1NJI4 3CD63 2CFLA 3MSOA 6STDA 2XSHB 3WOFB 4K61A 4L8PA 2CC3A 2RCDA 3ER7A 3K5TA 1NDOB 1IVXA 3NQZA 1OCVA 4R9LA 3LTCA 4ORLA 1VQ93 1JB4A 2QGUA 3F8HA 3IJEB 4IT7A 3N9HA 4AKZA 5IEOA 3BNDA 3T8UA 1FGOA 4FCJA 1NO3A 4LGQA 3SLUA 4EC6A 5JPUA 2E2VA 3MG1A 1QVG2 4FCMA 3S67A 1IVUA 1U8CB 4NHFA 4WYKA 4ZM8A 3EN8A 4R1KA 3CC23 1N5PA 4FMDA 1KQS2 3V98A 2WOHA 1FGMA 4IIAA 5IG0A 1KWIA 3Q1CA 2E2TA 4RNZA 2CHCA 3WA3A 1UUWB 1IU7A 1ROVA 1U5OA 1OGZA 2OOVC 1SJWA 1W2ZA 3FF2A 3NM7A 2CKFB 3PCRA 1W2B2 2SBLA 4L8OA 1GD4A 4N6TA 3DY5A 2RGQA 1KC84 5IW9A 1LXEA 4FMBA 1G96A 1JB2A 4FMAA 3NUVA 4HM3B 1STFI 3H3HA 4EXRA 1VQO3 1TIJA 3D9RA 4FMCA 3X40A 3GRDA 1FGTA 4HM6B 3CCM3 1WMOA 4HM8B 1O7HB 2HMLB 4HM1B 4GB5A 3WDGB 2IMJA 1OACA 1VQK3 1OH0A 2W56A 4XDWA 3JUPA 2BHMA 4H61A 5BVBA 2F86B 4X2HA 1N8R4 3NX0A 4RBNA 3U1WA 1E3RA 2Z77A 3EJVA 1FGRA 3DZLA 3HIIA 3NV0A 1OHOA 1N9JA 5I97A 1YJW3 2GBXB 3FSDA 3CCQ3 3N8BA 3MG2A 3JVCA 1M1K4 2B1XB 2QA43 2OQEA 1QAKA 4LZIA 1DMNA 3MKIA 3GAXA 2BO9B 2CK3H 4I4KA 3MHEA 1VQ53 1KSIA 2KCDA 1IQ8A 3UNLA 2CG0A 2HMKB 2Y73A 1ISKA 3EB8A 1W00A 1Q814 4KFDA 1FUWA 4J9AA 4R4KA 3PCSA 1NU3A 3CNMA 1AVLA 2INXA 1O7NB 2A15A 5BXQA 1DYUA 3J7Yd 2W0QA 2BMQB 2CFKA 2O3OA 5AYSC 3RGRA 1JNQA 1C7HA 4U13A 3G713 1NB5I 1SQWA 1WNHA 3D3LA 5AIFA 3TDGA 1QAFA 4HM4B 1MOLA 2WGQA 3CPW2 3I563 1YIJ3 1ASKA 4N6UA 5AIHA 3NBBA 1JV2B 4WWUC 5IF6A 3I0YA 1SIIA 3EE1A 2OCTA 4WYKB 2B24B 2LQVA 3VGNA 4HYZA 2Q07A 1TU5A 1IT8A 4KFFA 1HU9A 3PZWA 3K63A 1JB5A 1F8NA 2W9PA 5EQLA 3IPTA 4NREA 1K8A4 3CCU3 1A2KA 3WOEB 1RRLA 3BB9A 4LSOA 5EEOA 3G8ZA 1K41A 4MJDA 1Q864 3G16A 1D6YA 4N6MA 2MC8A 4CCVA 3RDEA 1M9GA 5HGRA 3CME3 2C10A 2LYXA 3LTAA 1TFKA 3G4S3 4HM2B 3N54B 4BTXA 1N9EA 3PXMA 3DXOA 1IDPA 3Q2PA 3WODG 3SOYA 3X41A 1UUVB 3CCV3 5CF1A 2UX0A 1QALA 3BNEA 3MWZA 1D6ZA 1M1XB 3PGBA 3FCSB 3KN4A 1K9M4 1W7CA 1DVCA 1GY5A 1OGXA 3EF8A 1W5ZA 2WOFA 1N5HA 3BNCA 1AVKA 3EBYA 2W56B 1Q824 2RSXA 4N6OB 3B8LA 5D82A 3LYGA 1OF5A 3OWUA 2P05A 5CXOA 1K28A 3S29A 3SEDA 2ML6A 2C11A 1IV9A 1EKMA 3NV0B 1W4NA 4PEJA 1VQM3 5IEPA 1EA2A 3F7XA 4OVMA 1VZZA 2F99A 2P38A 1TUHA 3UB1A 2CIUA 2YFJB 3DGNA 5CF2A 3CCS3 3DGMA 3LTDA 4QWTA 1QVF2 1W6GA 1OHPA 5ELUA 4EYCA 3WMDA 1SPUA 5LC7A 3SXXA 1T5YA 3CCR3 4TX4A 5G2GA 3LMLA 4R80A 1VQ83 3HZPA 2OTL3 1US1A 5EVHA 2QIYA 1TP6A 4KFEA 3U97A 1O7WB 1GYBA 3QRDA 4L7KA 2W03A 3LTBA 1FA3A 2XR8B 3KE7A 3FLJA 2CH9A 3M8CA 3B4OA 3EQQB 3CCJ3 1ULJB 2XEPA 3K7CA 5FGOA 3SVAA 3F8XA 3LZAA 1VQ73 2GXFA 3S5CA 3V92A 1W6CA 4JF8A 1R4CA 3DMCA 5CK6A 5D81A 3VSYA 5FW5A 4WP5A 2YX9A 1LOXA 5KP4A 2K54A 4STDA 3CMA3 1NWWA 3GZYB 1OUNA 2GBWB 2M7OA 2XF3A 3Q90A 3X42A 4EBGA 1CYUA 3FGYA 2GEYA 1WQLB 3F40A 4O2HA 2GU3A 3RGAA 1IQYA 3UJMA 5DREA 5AYRB 2HMJB 1VQ43 2KRTA 1S5AA 1GD3A 4MMYB 3O8YA 2XSOB 1LVNA 3CCE3 3E99A 3ECFA 3FKAA 3EC9A 2CFGA 1EQKA 2P09A 5AEWB 5AIIA 1FGQA 4MEIA 3KSPA 3BNBA 3ROBA 1RRHA 1VQP3 1CQSA 4HBRA 3X3YA 2ZDJA 3OWSA 1JN5A 1KD14 1IT7A 1O7MB 1ZO2A 1GY7A 5LC6A 3H51A 3V99A 4HJLB 2CWUA 4N6NB 2CWTA 1DVDA 2W04A 1YVBI 4XB5A 2Z6BA 2L4VA 3KFQC 5CLKA 2CFDA 3F14A 4O3VA 4BTWA 1M904 2KXGA 3JUOA 2GEXA 1BUQA 1Z1SA 4H3UA 1IVWA 1OF5B 1YJ93 5JBSA 3LXUX 3T8NA 2RFRA 3FZWA 3T0UA 3FG4A 2OTJ3 1UI8A 2W9QA 1WMNA 2D42A 4HKVB 5STDA 1A90A 1JKGA 4HZBB 4XM4A 3CU3A 1QMAA 2BNGA 2CFWA 2PZVA 4EV2A 1PFPA 3LOYA 1J2BA 3AMOB 7STDA 3HIGA 5D83A 2V1LA 3JUMA 3QK9A 1SIHA 3L0RA 1VQ63 4Q53A 2OOVA 3IMAB 2WO0A 2Z7AA 4FCZA 1JJ22 3CC43 2IUJA 2JQ5A 4G1MB 5IG3A 3B4PA 4R9KA 3VF1A 1WTHA 4LMIA 1ULIB 1WMPA 2XGLA 1TFOA 5A0OB 2HMOB 4X2OA 3OX9A 3PS8A 3LT9A 3PYJA 1A2VA 1DMQA 4K90B 5IG5A 2OWPA 3UL6A 3GZXB 4MMZB 1YJN3 1RN7A 2Y74A 1CYVA 3LT8A 3EBTA 4HM0B 1RJOA 4RZMA 3KKGA 3GZBA 2O9UX 1VQN3 3AMOA 2R4IA 3S28A 4WHAA 5TGNA 2HMNB 1NB3I 2XGNA 3EHCA 3BLZA 2XRXB 1Y4KA 3K0ZA 5KP1A 1S723 3ALAA 3F9SA 3GZRA 1Q42A 2JDIH 3SX1A 4HZ9B 4CDLA 5JPPA 3CXC2 3NHXA 1YHQ3 3DGOA 3WA2X 3X3XA 4KVHA 5IERA 1A67A 3EX9A 5KP3A 2CWVA 2PNCA 2CG1A 3X3ZA 4FR9A 3K9MC 3HK4A 4GL6A 4OUQA 2E2UA 4O02B 2BMRB 4N6LA 5IG4A 2IUKA 3STDA 2ML5A 3JUNA 1UI7A 3MPHA 1JN5B 1PU4A 1D6UA 4LEHA 5AEUB 4K1UA 2FGTA 3CCL3 1IK3A 2STDA 4XDVA 4EV5A 1OHSA 3FF0A 5IENA 2HMMB 2CW9A 3EN1B 3G0KA 1AR0A 1EG9B 4N6V0 4AKYA 2QEX3 1V74A 2XH9A 3KSED 4HM5B 3HI7A 1QJGA 1Q40B 2F98A 2BMOB 1AV4A 1CEWI 1Q7Y4 1OPYA 1IVVA 3A76A 3HX8A 2W6JH 1W01A 2I9WA 2YFIB 5ELJA 1IV7A 3CPOA 3DGLA 3DM8A 1YI23 3KZTA 1VQL3 1W6YA 1STDA 3MG3A 5AI1A 1IQXA 1LNHA 1E97A 4XBYA 2WGOA 1JKGB 3OWYA 2FNQA 2BT3A 4KZ1A 3CC73 4IPBA 1W02A 3NBJA 1ROAA 3KIIA 1RKYA 1YIT3 3G6E3 3NM2A 1YGEA 2K0MA 3B7CA 3DUKA 3SOAA 1O7GB 3GWRA 3S27A 3JUQA 3I553 3OW22 2IA7A 2Z76A 2GU1A 4O8SA 4BTYA 2OQEC 5DRVA 4XBTA 2XFTA 4K1VA 3UL5A 1N8QA 1Q40A 3FH1A 4N3VA 1ZX2A 4JRFA 3CNXA 2P0MA 1O7PB 2FXTA 2XFSA 1L5GB 4XBXA 5AIGA 3OXAA 1GY6A 1E3VA 4MMXB 4OK0A 8CHOA 4HM7B 2D1WA 4WFOA 4J8TA 2W2CA 1MNLA 1GS3A 3FG3A 3MYTA 3NBRA 1UW1A 1K734 1DMMA 3FG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 3;  1Q7Y 4;  1VQO 3;  3CCV 3;  3CCJ 3;  3CCE 3;  1VQ6 3;  1YJW 3;  1JJ2 2;  3CCQ 3;  1QVG 2;  1VQN 3;  3CCS 3;  3CC4 3;  1VQ7 3;  1NJI 4;  3CD6 3;  1YI2 3;  3CCM 3;  1K9M 4;  1M1K 4;  1VQL 3;  2QA4 3;  3CC2 3;  1YJ9 3;  1QVF 2;  1KQS 2;  1K8A 4;  3G71 3;  3CCU 3;  1Q82 4;  2OTJ 3;  3CMA 3;  1VQP 3;  3CCL 3;  3CCR 3;  3CC7 3;  1S72 3;  1VQ5 3;  1VQK 3;  1YIT 3;  1Q86 4;  1VQ8 3;  1KD1 4;  3CXC 2;  2OTL 3;  3G6E 3;  1YHQ 3;  3CPW 2;  1W2B 2;  1VQ9 3;  3I56 3;  1YIJ 3;  2QEX 3;  1N8R 4;  3CME 3;  3G4S 3;  1VQM 3;  3I55 3;  1KC8 4;  3OW2 2;  1YJN 3;  1Q81 4;  1K73 4;  1M90 4; 
#chains in the Genus database with same CATH topology
 3F7S A;  1JRQ A;  1HKX A;  3NXJ A;  2ZL8 A;  4HVN A;  1GMQ A;  3OV4 A;  2MF7 A;  4RNY A;  3ZG5 A;  1BRJ A;  2P0X A;  1BRS A;  1RCK A;  2F56 A;  3LH4 A;  3NQY A;  2YFL B;  1NJI 4;  3CD6 3;  1I0V A;  2CFL A;  1Q7H A;  3MSO A;  1FW7 A;  2GSP A;  1RDS A;  2XSH B;  4LYL B;  6STD A;  3WOF B;  1BSA A;  2AAD A;  1T3B A;  1UGH I;  4K61 A;  3DGY A;  4L8P A;  2CC3 A;  4AKY A;  2RCD A;  3ER7 A;  3K5T A;  1NDO B;  1RNT A;  1IVX A;  3NQZ A;  1OCV A;  1BRI A;  4R9L A;  3LTC A;  4ORL A;  1VQ9 3;  1JB4 A;  2QGU A;  3F8H A;  1RGF A;  3D79 A;  1BNE A;  3IJE B;  4IT7 A;  3N9H A;  4AKZ A;  5IEO A;  3BND A;  3T8U A;  1FGO A;  4FCJ A;  1NO3 A;  4LGQ A;  3SLU A;  4EC6 A;  5JPU A;  1MWT A;  2E2V A;  3MG1 A;  4BL2 A;  1QVG 2;  4FCM A;  1BNR A;  3S67 A;  1IVU A;  1U8C B;  4NHF A;  4WYK A;  3ZG0 A;  4ZM8 A;  3EN8 A;  3SYU A;  4R1K A;  3CC2 3;  1N5P A;  4FMD A;  1KQS 2;  1JZO A;  2WOH A;  1FGM A;  1V58 A;  4IIA A;  1KWI A;  3Q1C A;  2E2T A;  5IG0 A;  4RNZ A;  1UCI A;  2CHC A;  3WA3 A;  1UUW B;  1IU7 A;  1JBS A;  1ROV A;  1U5O A;  1OGZ A;  1SJW A;  1I2G A;  1W2Z A;  2OOV C;  3FF2 A;  2CKF B;  3NM7 A;  1RGG A;  2SBL A;  2K3D A;  4L8O A;  5GSP A;  1GD4 A;  4N6T A;  3DY5 A;  2RGQ A;  1KC8 4;  5IW9 A;  1LNI A;  1LXE A;  4FMB A;  1JB2 A;  1G96 A;  4FMA A;  3NUV A;  4HM3 B;  1G0T A;  1STF I;  3H3H A;  4EXR A;  1VQO 3;  1TIJ A;  3D9R A;  4FMC A;  3X40 A;  1RLS A;  3GRD A;  1FGT A;  4HM6 B;  3CCM 3;  1A2P A;  1WMO A;  1BSD A;  4HM8 B;  1O7H B;  3V98 A;  9RNT A;  2HML B;  4HM1 B;  4GB5 A;  2BU4 A;  3WDG B;  2IMJ A;  1OAC A;  1VQK 3;  1OH0 A;  2W56 A;  4XDW A;  2IYJ A;  3JUP A;  2BHM A;  4H61 A;  1FUS A;  5BVB A;  2F86 B;  4X2H A;  1N8R 4;  1B2M A;  3NX0 A;  4RBN A;  3U1W A;  6GSP A;  1E3R A;  2Z77 A;  3EJV A;  1BU4 A;  1FZU A;  2SAR A;  1FGR A;  3DZL A;  3HII A;  3NV0 A;  1TRP A;  1OHO A;  1N9J A;  5I97 A;  1I0X A;  1YJW 3;  2GBX B;  3FSD A;  3CCQ 3;  3N8B A;  4J5K A;  3MG2 A;  1JBT A;  3JVC A;  1M1K 4;  2B1X B;  2QA4 3;  1YVS A;  2OQE A;  1QAK A;  4LZI A;  1DMN A;  3MKI A;  3GAX A;  2BO9 B;  2CK3 H;  4I4K A;  3MHE A;  4BIR A;  1VQ5 3;  1KSI A;  1LOY A;  2KF6 A;  2KCD A;  1IQ8 A;  3DH2 A;  1R4Y A;  3RNT A;  3UNL A;  2CG0 A;  2HMK B;  3Q3F A;  2Y73 A;  1ISK A;  3EB8 A;  1W00 A;  1Q81 4;  4CJN A;  4KFD A;  5M18 A;  1FUW A;  4J9A A;  4R4K A;  1BNS A;  1NU3 A;  3CNM A;  3PCS A;  1AVL A;  2INX A;  1O7N B;  2A15 A;  5BXQ A;  3D4A A;  1DYU A;  1X1Y A;  3J7Y d;  1UCL A;  2W0Q A;  2BMQ B;  2CFK A;  2O3O A;  5AYS C;  3RGR A;  1JNQ A;  1C7H A;  4U13 A;  3G71 3;  1NB5 I;  1BRN L;  1SQW A;  1WNH A;  3D3L A;  5AIF A;  3TDG A;  1QAF A;  4HM4 B;  1RNB A;  1MOL A;  1VQQ A;  2WGQ A;  1X1X A;  3CPW 2;  1GMP A;  1B27 A;  3I56 3;  1ASK A;  2KF3 A;  1YIJ 3;  4J5G A;  4N6U A;  1RN1 A;  2CX1 A;  3NBB A;  5AIH A;  1JV2 B;  3BU4 A;  4BL3 A;  4WWU C;  2ZHX B;  5IF6 A;  3I0Y A;  1SII A;  2RNT A;  2AAE A;  1PYL A;  3EE1 A;  2OCT A;  4WYK B;  2B24 B;  2LQV A;  3VGN A;  4HYZ A;  2Q07 A;  1TU5 A;  1IT8 A;  4KFF A;  1MWR A;  1HU9 A;  3PZW A;  3K63 A;  1JB5 A;  1F8N A;  2W9P A;  5EQL A;  3IPT A;  4HAA A;  1ZGX A;  4NRE A;  1K8A 4;  3CCU 3;  1A2K A;  1B2Z A;  5RNT A;  3WOE B;  1RRL A;  3BB9 A;  1V57 A;  4LSO A;  5EEO A;  3G8Z A;  1K41 A;  1EUI C;  4MJD A;  1Q86 4;  3G16 A;  1D6Y A;  4N6M A;  1LRA A;  2MC8 A;  4CCV A;  3RDE A;  7RNT A;  4CPK A;  1M9G A;  5HGR A;  3CME 3;  2C10 A;  1UCK A;  2LYX A;  1TFK A;  3LTA A;  3G4S 3;  4HM2 B;  3N54 B;  4BTX A;  1I3F A;  1N9E A;  3PXM A;  3DXO A;  1IDP A;  3Q2P A;  3WOD G;  3SOY A;  3X41 A;  1UUV B;  3CCV 3;  5CF1 A;  2UX0 A;  1LQG C;  1QAL A;  3BNE A;  3HOH A;  3MWZ A;  1D6Z A;  1M1X B;  3PGB A;  3FCS B;  3KN4 A;  1SAR A;  1B20 A;  1K9M 4;  1GOV A;  1W7C A;  1DVC A;  1GY5 A;  1OGX A;  3EF8 A;  1W5Z A;  2WOF A;  1N5H A;  1I2F A;  1AVK A;  1RSN A;  2W56 B;  3BNC A;  3EBY A;  2RSX A;  1Q82 4;  4N6O B;  3B8L A;  5D82 A;  3LYG A;  1OF5 A;  3OWU A;  2P05 A;  5CXO A;  1K28 A;  3S29 A;  3URP A;  2BIR A;  2CX0 A;  3SED A;  5G1L A;  1UUG B;  1G02 A;  2C11 A;  1IV9 A;  1EKM A;  2ML6 A;  3NV0 B;  1W4N A;  4PEJ A;  1VQM 3;  1JBR A;  5IEP A;  1EA2 A;  3F7X A;  1RGE A;  1B2S A;  4OVM A;  1VZZ A;  2F99 A;  1W2B 2;  1RN4 A;  1B2X A;  1TUH A;  2P38 A;  2CIU A;  2YFJ B;  3DGN A;  3UB1 A;  1MGW A;  5CF2 A;  5M19 A;  2H0I A;  3CCS 3;  3DGM A;  1TJD A;  3LTD A;  4QWT A;  1BAO A;  1QVF 2;  1W6G A;  1OHP A;  5ELU A;  4EYC A;  3WMD A;  1SPU A;  5LC7 A;  1I2E A;  3SXX A;  1T5Y A;  3CCR 3;  2F5W A;  4TX4 A;  5G2G A;  3LML A;  4R80 A;  1VQ8 3;  2H0H A;  3HZP A;  2OTL 3;  1T2I A;  1US1 A;  5EVH A;  2QIY A;  2UUG C;  1TP6 A;  4KFE A;  3U97 A;  1O7W B;  1GYB A;  3QRD A;  4L7K A;  2W03 A;  3AGN A;  1RGH A;  3LTB A;  1FA3 A;  2XR8 B;  2C4B A;  3KE7 A;  3FLJ A;  2CH9 A;  3M8C A;  1DE3 A;  3B4O A;  3EQQ B;  1C54 A;  1YNV X;  1YGW A;  3CCJ 3;  1ULJ B;  2XEP A;  1BSB A;  3K7C A;  5FGO A;  3SVA A;  3F8X A;  3LZA A;  1VQ7 3;  2GXF A;  2UGI A;  3S5C A;  3V92 A;  1W6C A;  1EEJ A;  4JF8 A;  1BUJ A;  1R4C A;  3DMC A;  5CK6 A;  5D81 A;  3VSY A;  5FW5 A;  4WP5 A;  2YX9 A;  1BNG A;  1LOX A;  5KP4 A;  1BGS A;  2K54 A;  2F4Y A;  1FUT A;  1CH0 A;  4STD A;  1NWW A;  3CMA 3;  3GZY B;  1OUN A;  2GBW B;  2M7O A;  2XF3 A;  3Q90 A;  3X42 A;  4EBG A;  1CYU A;  3FGY A;  2GEY A;  1WQL B;  3F40 A;  4O2H A;  2IY2 A;  2GU3 A;  3RGA A;  1IQY A;  3UJM A;  5DRE A;  5AYR B;  1I3I A;  2HMJ B;  1GOU A;  2KRT A;  3PCR A;  1S5A A;  1VQ4 3;  1GD3 A;  4MMY B;  3D5G A;  2XSO B;  3O8Y A;  1BOX A;  1LVN A;  1BSE A;  3CCE 3;  3E99 A;  3ECF A;  1UDI I;  3FKA A;  3EC9 A;  2CFG A;  1EQK A;  2P09 A;  5AEW B;  8RNT A;  5AII A;  5BU4 A;  3WR2 A;  1FGQ A;  4MEI A;  3KSP A;  3BNB A;  3ROB A;  1RRH A;  1VQP 3;  1CQS A;  4HBR A;  3X3Y A;  2ZDJ A;  3OWS A;  1JN5 A;  1KD1 4;  1IT7 A;  1O7M B;  1ZO2 A;  1GY7 A;  5LC6 A;  5BIR A;  3H51 A;  3V99 A;  4HJL B;  1GMR A;  2CWU A;  4KT3 B;  4N6N B;  2CWT A;  1DVD A;  2W04 A;  3D5I A;  1YVB I;  4XB5 A;  2Z6B A;  2L4V A;  3KFQ C;  5CLK A;  2CFD A;  1X1U A;  3F14 A;  4O3V A;  4BTW A;  1M90 4;  4I5Q A;  1BNJ A;  2KXG A;  3JUO A;  1RGC A;  2RBI A;  1Q9E A;  2GEX A;  3BIR A;  3GSP A;  1BUQ A;  1Z1S A;  4H3U A;  1IVW A;  1OF5 B;  1NNV A;  1YJ9 3;  5JBS A;  3LXU X;  3A5E A;  3T8N A;  2RFR A;  2F5M A;  1LOW A;  3FZW A;  3T0U A;  3FG4 A;  2OTJ 3;  1UI8 A;  3ZFZ A;  2W9Q A;  1WMN A;  2D42 A;  4HKV B;  1B2U A;  5STD A;  1BVI A;  5HOH A;  1A90 A;  1JKG A;  4HZB B;  4XM4 A;  3CU3 A;  1BRH A;  1QMA A;  4GSP A;  1MWS A;  2BNG A;  2CFW A;  2PZV A;  4EV2 A;  1I70 A;  1PFP A;  1X1W A;  3LOY A;  4RNT A;  3AMO B;  1J2B A;  1RHL A;  7STD A;  1JZD A;  3HIG A;  5D83 A;  2V1L A;  3JUM A;  3QK9 A;  1SIH A;  1B21 A;  3L0R A;  1VQ6 3;  4Q53 A;  1HZ1 A;  2OOV A;  3IMA B;  2WO0 A;  2Z7A A;  4FCZ A;  1JJ2 2;  3CC4 3;  2H0G A;  2IUJ A;  2JQ5 A;  4G1M B;  4GHO A;  5IG3 A;  3B4P A;  4R9K A;  3VF1 A;  1WTH A;  4LMI A;  1ULI B;  1WMP A;  2XGL A;  1TFO A;  5A0O B;  2HMO B;  1BIR A;  3AHW A;  4X2O A;  3OX9 A;  3PS8 A;  1DET A;  3KCH A;  1T2H A;  3LT9 A;  3PYJ A;  1A2V A;  1DMQ A;  4K90 B;  5IG5 A;  2OWP A;  3UL6 A;  3GZX B;  4MMZ B;  1YJN 3;  1RN7 A;  2Y74 A;  1CYV A;  2ZA4 A;  2KF5 A;  3LT8 A;  3EBT A;  4HM0 B;  1LOV A;  1LQM B;  1RJO A;  4RZM A;  3KKG A;  1HYF A;  3GZB A;  1RTU A;  2O9U X;  3AGO A;  1VQN 3;  3AMO A;  2R4I A;  3S28 A;  4WHA A;  5TGN A;  2HMN B;  1NB3 I;  2XGN A;  3EHC A;  1TTO A;  3BLZ A;  2XRX B;  1Y4K A;  1BSC A;  1RGK A;  1RCL A;  3K0Z A;  5KP1 A;  1S72 3;  3ALA A;  3F9S A;  3GZR A;  1Q42 A;  2JDI H;  3SX1 A;  4HZ9 B;  4CDL A;  5JPP A;  3CXC 2;  3NHX A;  1YHQ 3;  1RGA A;  3AHS A;  3DGO A;  3WA2 X;  1RGL A;  2L1S A;  4KVH A;  3X3X A;  5IER A;  3EX9 A;  5KP3 A;  2CWV A;  2PNC A;  1GSP A;  2CG1 A;  1A67 A;  4BU4 A;  3X3Z A;  5G1K A;  4EW5 A;  4FR9 A;  3K9M C;  3HK4 A;  4GL6 A;  4OUQ A;  2E2U A;  1I8V A;  4O02 B;  2BMR B;  1GOY A;  1UCJ A;  4N6L A;  5IG4 A;  2IUK A;  3STD A;  2ML5 A;  3JUN A;  1UI7 A;  3MPH A;  1JN5 B;  1PU4 A;  1D6U A;  4LEH A;  5AEU B;  1BRG A;  4K1U A;  1TRQ A;  2FGT A;  2J8X B;  3CCL 3;  4DKI A;  1IK3 A;  2STD A;  4XDV A;  4EV5 A;  1OHS A;  3FF0 A;  4AEQ A;  5IEN A;  2HMM B;  1BNF A;  2CW9 A;  3EN1 B;  1AR0 A;  1EG9 B;  3G0K A;  4N6V 0;  3WHO A;  1V74 A;  2XH9 A;  2QEX 3;  3KSE D;  4HM5 B;  3HI7 A;  1FYS A;  1QJG A;  1Q40 B;  2F98 A;  2BMO B;  1PY3 A;  1AV4 A;  1CEW I;  1Q7Y 4;  2KAA A;  1OPY A;  1IVV A;  3A76 A;  3HX8 A;  2W6J H;  1W01 A;  2I9W A;  2YFI B;  5ELJ A;  1IV7 A;  3CPO A;  6RNT A;  1BAN A;  1MWU A;  3DGL A;  3DM8 A;  1AQZ A;  1YI2 3;  1IYY A;  3KZT A;  1VQL 3;  1W6Y A;  1STD A;  3MG3 A;  5AI1 A;  1ZS7 A;  1IQX A;  1LNH A;  1E97 A;  4XBY A;  2WGO A;  1JKG B;  2R41 A;  3OWY A;  2FNQ A;  2BT3 A;  4KZ1 A;  3CC7 3;  4IPB A;  1UGI A;  1W02 A;  3NBJ A;  1ROA A;  3KII A;  1RKY A;  1YIT 3;  1AY7 A;  3G6E 3;  3NM2 A;  1YGE A;  2K0M A;  3B7C A;  3DUK A;  1BRK A;  3SOA A;  1O7G B;  3GWR A;  3S27 A;  3JUQ A;  3I55 3;  3OW2 2;  2KF4 A;  2IA7 A;  2Z76 A;  2GU1 A;  5M1A A;  4O8S A;  4BTY A;  2OQE C;  5DRV A;  4XBT A;  2XFT A;  4K1V A;  3UL5 A;  1N8Q A;  1Q40 A;  3FH1 A;  4HOH A;  1MGR A;  4N3V A;  1ZX2 A;  4JRF A;  7GSP A;  4ILF A;  3CNX A;  1RMS A;  2P0M A;  1BNI A;  1O7P B;  2FXT A;  2XFS A;  4NPB A;  1L5G B;  4XBX A;  5AIG A;  3OXA A;  1GY6 A;  1E3V A;  4MMX B;  4OK0 A;  1B3S A;  8CHO A;  4HM7 B;  2D1W A;  4WFO A;  4J8T A;  2W2C A;  1MNL A;  1GS3 A;  3FG3 A;  3MYT A;  2HOH A;  3NBR A;  1UW1 A;  1K73 4;  1DMM A;  3FG1 A; 
#chains in the Genus database with same CATH homology
 3F7S A;  1JRQ A;  1HKX A;  3NXJ A;  2ZL8 A;  4HVN A;  4AEQ A;  3OV4 A;  2MF7 A;  4RNY A;  2P0X A;  3LH4 A;  3NQY A;  2YFL B;  1NJI 4;  3CD6 3;  2CFL A;  3MSO A;  6STD A;  2XSH B;  3WOF B;  4K61 A;  4L8P A;  2CC3 A;  2RCD A;  3ER7 A;  3K5T A;  1NDO B;  1IVX A;  3NQZ A;  1OCV A;  4R9L A;  3LTC A;  4ORL A;  1VQ9 3;  1JB4 A;  2QGU A;  3F8H A;  3IJE B;  4IT7 A;  3N9H A;  4AKZ A;  5IEO A;  3BND A;  3T8U A;  1FGO A;  4FCJ A;  1NO3 A;  4LGQ A;  3SLU A;  4EC6 A;  5JPU A;  2E2V A;  3MG1 A;  1QVG 2;  4FCM A;  3S67 A;  1IVU A;  1U8C B;  4NHF A;  4WYK A;  4ZM8 A;  3EN8 A;  4R1K A;  3CC2 3;  1N5P A;  4FMD A;  1KQS 2;  3V98 A;  2WOH A;  1FGM A;  4IIA A;  5IG0 A;  1KWI A;  3Q1C A;  2E2T A;  4RNZ A;  2CHC A;  3WA3 A;  1UUW B;  1IU7 A;  1ROV A;  1U5O A;  1OGZ A;  2OOV C;  1SJW A;  1W2Z A;  3FF2 A;  3NM7 A;  2CKF B;  3PCR A;  1W2B 2;  2SBL A;  4L8O A;  1GD4 A;  4N6T A;  3DY5 A;  2RGQ A;  1KC8 4;  5IW9 A;  1LXE A;  4FMB A;  1G96 A;  1JB2 A;  4FMA A;  3NUV A;  4HM3 B;  1STF I;  3H3H A;  4EXR A;  1VQO 3;  1TIJ A;  3D9R A;  4FMC A;  3X40 A;  3GRD A;  1FGT A;  4HM6 B;  3CCM 3;  1WMO A;  4HM8 B;  1O7H B;  2HML B;  4HM1 B;  4GB5 A;  3WDG B;  2IMJ A;  1OAC A;  1VQK 3;  1OH0 A;  2W56 A;  4XDW A;  3JUP A;  2BHM A;  4H61 A;  5BVB A;  2F86 B;  4X2H A;  1N8R 4;  3NX0 A;  4RBN A;  3U1W A;  1E3R A;  2Z77 A;  3EJV A;  1FGR A;  3DZL A;  3HII A;  3NV0 A;  1OHO A;  1N9J A;  5I97 A;  1YJW 3;  2GBX B;  3FSD A;  3CCQ 3;  3N8B A;  3MG2 A;  3JVC A;  1M1K 4;  2B1X B;  2QA4 3;  2OQE A;  1QAK A;  4LZI A;  1DMN A;  3MKI A;  3GAX A;  2BO9 B;  2CK3 H;  4I4K A;  3MHE A;  1VQ5 3;  1KSI A;  2KCD A;  1IQ8 A;  3UNL A;  2CG0 A;  2HMK B;  2Y73 A;  1ISK A;  3EB8 A;  1W00 A;  1Q81 4;  4KFD A;  1FUW A;  4J9A A;  4R4K A;  3PCS A;  1NU3 A;  3CNM A;  1AVL A;  2INX A;  1O7N B;  2A15 A;  5BXQ A;  1DYU A;  3J7Y d;  2W0Q A;  2BMQ B;  2CFK A;  2O3O A;  5AYS C;  3RGR A;  1JNQ A;  1C7H A;  4U13 A;  3G71 3;  1NB5 I;  1SQW A;  1WNH A;  3D3L A;  5AIF A;  3TDG A;  1QAF A;  4HM4 B;  1MOL A;  2WGQ A;  3CPW 2;  3I56 3;  1YIJ 3;  1ASK A;  4N6U A;  5AIH A;  3NBB A;  1JV2 B;  4WWU C;  5IF6 A;  3I0Y A;  1SII A;  3EE1 A;  2OCT A;  4WYK B;  2B24 B;  2LQV A;  3VGN A;  4HYZ A;  2Q07 A;  1TU5 A;  1IT8 A;  4KFF A;  1HU9 A;  3PZW A;  3K63 A;  1JB5 A;  1F8N A;  2W9P A;  5EQL A;  3IPT A;  4NRE A;  1K8A 4;  3CCU 3;  1A2K A;  3WOE B;  1RRL A;  3BB9 A;  4LSO A;  5EEO A;  3G8Z A;  1K41 A;  4MJD A;  1Q86 4;  3G16 A;  1D6Y A;  4N6M A;  2MC8 A;  4CCV A;  3RDE A;  1M9G A;  5HGR A;  3CME 3;  2C10 A;  2LYX A;  3LTA A;  1TFK A;  3G4S 3;  4HM2 B;  3N54 B;  4BTX A;  1N9E A;  3PXM A;  3DXO A;  1IDP A;  3Q2P A;  3WOD G;  3SOY A;  3X41 A;  1UUV B;  3CCV 3;  5CF1 A;  2UX0 A;  1QAL A;  3BNE A;  3MWZ A;  1D6Z A;  1M1X B;  3PGB A;  3FCS B;  3KN4 A;  1K9M 4;  1W7C A;  1DVC A;  1GY5 A;  1OGX A;  3EF8 A;  1W5Z A;  2WOF A;  1N5H A;  3BNC A;  1AVK A;  3EBY A;  2W56 B;  1Q82 4;  2RSX A;  4N6O B;  3B8L A;  5D82 A;  3LYG A;  1OF5 A;  3OWU A;  2P05 A;  5CXO A;  1K28 A;  3S29 A;  3SED A;  2ML6 A;  2C11 A;  1IV9 A;  1EKM A;  3NV0 B;  1W4N A;  4PEJ A;  1VQM 3;  5IEP A;  1EA2 A;  3F7X A;  4OVM A;  1VZZ A;  2F99 A;  2P38 A;  1TUH A;  3UB1 A;  2CIU A;  2YFJ B;  3DGN A;  5CF2 A;  3CCS 3;  3DGM A;  3LTD A;  4QWT A;  1QVF 2;  1W6G A;  1OHP A;  5ELU A;  4EYC A;  3WMD A;  1SPU A;  5LC7 A;  3SXX A;  1T5Y A;  3CCR 3;  4TX4 A;  5G2G A;  3LML A;  4R80 A;  1VQ8 3;  3HZP A;  2OTL 3;  1US1 A;  5EVH A;  2QIY A;  1TP6 A;  4KFE A;  3U97 A;  1O7W B;  1GYB A;  3QRD A;  4L7K A;  2W03 A;  3LTB A;  1FA3 A;  2XR8 B;  3KE7 A;  3FLJ A;  2CH9 A;  3M8C A;  3B4O A;  3EQQ B;  3CCJ 3;  1ULJ B;  2XEP A;  3K7C A;  5FGO A;  3SVA A;  3F8X A;  3LZA A;  1VQ7 3;  2GXF A;  3S5C A;  3V92 A;  1W6C A;  4JF8 A;  1R4C A;  3DMC A;  5CK6 A;  5D81 A;  3VSY A;  5FW5 A;  4WP5 A;  2YX9 A;  1LOX A;  5KP4 A;  2K54 A;  4STD A;  3CMA 3;  1NWW A;  3GZY B;  1OUN A;  2GBW B;  2M7O A;  2XF3 A;  3Q90 A;  3X42 A;  4EBG A;  1CYU A;  3FGY A;  2GEY A;  1WQL B;  3F40 A;  4O2H A;  2GU3 A;  3RGA A;  1IQY A;  3UJM A;  5DRE A;  5AYR B;  2HMJ B;  1VQ4 3;  2KRT A;  1S5A A;  1GD3 A;  4MMY B;  3O8Y A;  2XSO B;  1LVN A;  3CCE 3;  3E99 A;  3ECF A;  3FKA A;  3EC9 A;  2CFG A;  1EQK A;  2P09 A;  5AEW B;  5AII A;  1FGQ A;  4MEI A;  3KSP A;  3BNB A;  3ROB A;  1RRH A;  1VQP 3;  1CQS A;  4HBR A;  3X3Y A;  2ZDJ A;  3OWS A;  1JN5 A;  1KD1 4;  1IT7 A;  1O7M B;  1ZO2 A;  1GY7 A;  5LC6 A;  3H51 A;  3V99 A;  4HJL B;  2CWU A;  4N6N B;  2CWT A;  1DVD A;  2W04 A;  1YVB I;  4XB5 A;  2Z6B A;  2L4V A;  3KFQ C;  5CLK A;  2CFD A;  3F14 A;  4O3V A;  4BTW A;  1M90 4;  2KXG A;  3JUO A;  2GEX A;  1BUQ A;  1Z1S A;  4H3U A;  1IVW A;  1OF5 B;  1YJ9 3;  5JBS A;  3LXU X;  3T8N A;  2RFR A;  3FZW A;  3T0U A;  3FG4 A;  2OTJ 3;  1UI8 A;  2W9Q A;  1WMN A;  2D42 A;  4HKV B;  5STD A;  1A90 A;  1JKG A;  4HZB B;  4XM4 A;  3CU3 A;  1QMA A;  2BNG A;  2CFW A;  2PZV A;  4EV2 A;  1PFP A;  3LOY A;  1J2B A;  3AMO B;  7STD A;  3HIG A;  5D83 A;  2V1L A;  3JUM A;  3QK9 A;  1SIH A;  3L0R A;  1VQ6 3;  4Q53 A;  2OOV A;  3IMA B;  2WO0 A;  2Z7A A;  4FCZ A;  1JJ2 2;  3CC4 3;  2IUJ A;  2JQ5 A;  4G1M B;  5IG3 A;  3B4P A;  4R9K A;  3VF1 A;  1WTH A;  4LMI A;  1ULI B;  1WMP A;  2XGL A;  1TFO A;  5A0O B;  2HMO B;  4X2O A;  3OX9 A;  3PS8 A;  3LT9 A;  3PYJ A;  1A2V A;  1DMQ A;  4K90 B;  5IG5 A;  2OWP A;  3UL6 A;  3GZX B;  4MMZ B;  1YJN 3;  1RN7 A;  2Y74 A;  1CYV A;  3LT8 A;  3EBT A;  4HM0 B;  1RJO A;  4RZM A;  3KKG A;  3GZB A;  2O9U X;  1VQN 3;  3AMO A;  2R4I A;  3S28 A;  4WHA A;  5TGN A;  2HMN B;  1NB3 I;  2XGN A;  3EHC A;  3BLZ A;  2XRX B;  1Y4K A;  3K0Z A;  5KP1 A;  1S72 3;  3ALA A;  3F9S A;  3GZR A;  1Q42 A;  2JDI H;  3SX1 A;  4HZ9 B;  4CDL A;  5JPP A;  3CXC 2;  3NHX A;  1YHQ 3;  3DGO A;  3WA2 X;  3X3X A;  4KVH A;  5IER A;  1A67 A;  3EX9 A;  5KP3 A;  2CWV A;  2PNC A;  2CG1 A;  3X3Z A;  4FR9 A;  3K9M C;  3HK4 A;  4GL6 A;  4OUQ A;  2E2U A;  4O02 B;  2BMR B;  4N6L A;  5IG4 A;  2IUK A;  3STD A;  2ML5 A;  3JUN A;  1UI7 A;  3MPH A;  1JN5 B;  1PU4 A;  1D6U A;  4LEH A;  5AEU B;  4K1U A;  2FGT A;  3CCL 3;  1IK3 A;  2STD A;  4XDV A;  4EV5 A;  1OHS A;  3FF0 A;  5IEN A;  2HMM B;  2CW9 A;  3EN1 B;  3G0K A;  1AR0 A;  1EG9 B;  4N6V 0;  4AKY A;  2QEX 3;  1V74 A;  2XH9 A;  3KSE D;  4HM5 B;  3HI7 A;  1QJG A;  1Q40 B;  2F98 A;  2BMO B;  1AV4 A;  1CEW I;  1Q7Y 4;  1OPY A;  1IVV A;  3A76 A;  3HX8 A;  2W6J H;  1W01 A;  2I9W A;  2YFI B;  5ELJ A;  1IV7 A;  3CPO A;  3DGL A;  3DM8 A;  1YI2 3;  3KZT A;  1VQL 3;  1W6Y A;  1STD A;  3MG3 A;  5AI1 A;  1IQX A;  1LNH A;  1E97 A;  4XBY A;  2WGO A;  1JKG B;  3OWY A;  2FNQ A;  2BT3 A;  4KZ1 A;  3CC7 3;  4IPB A;  1W02 A;  3NBJ A;  1ROA A;  3KII A;  1RKY A;  1YIT 3;  3G6E 3;  3NM2 A;  1YGE A;  2K0M A;  3B7C A;  3DUK A;  3SOA A;  1O7G B;  3GWR A;  3S27 A;  3JUQ A;  3I55 3;  3OW2 2;  2IA7 A;  2Z76 A;  2GU1 A;  4O8S A;  4BTY A;  2OQE C;  5DRV A;  4XBT A;  2XFT A;  4K1V A;  3UL5 A;  1N8Q A;  1Q40 A;  3FH1 A;  4N3V A;  1ZX2 A;  4JRF A;  3CNX A;  2P0M A;  1O7P B;  2FXT A;  2XFS A;  1L5G B;  4XBX A;  5AIG A;  3OXA A;  1GY6 A;  1E3V A;  4MMX B;  4OK0 A;  8CHO A;  4HM7 B;  2D1W A;  4WFO A;  4J8T A;  2W2C A;  1MNL A;  1GS3 A;  3FG3 A;  3MYT A;  3NBR A;  1UW1 A;  1K73 4;  1DMM A;  3FG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...