1VQM3

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vqm300
1VQK3 1VQ73 1YIT3 2OTJ3 1K8A4 3CME3 3CCL3 3OW22 1YI23 1KD14 3CPW2 3CCR3 2QA43 1YIJ3 1NJI4 3CCU3 1KQS2 1VQ53 3CC73 1S723 1M904 1K9M4 2QEX3 2OTL3 3CCV3 1M1K4 1VQP3 1K734 3CCS3 3CC23 3CCJ3 1W2B2 1YJ93 3G713 3CXC2 3CMA3 3CD63 1QVF2 1JJ22 1VQO3 3CCE3 1VQM3 1Q824 1QVG2 1YJW3 1KC84 1VQ63 1Q864 3G6E3 3CC43 3CCM3 3G4S3 3I563 1Q814 1VQL3 3I553 3CCQ3 1VQN3 1VQ43 1YHQ3 1Q7Y4 1VQ83 1N8R4 1VQ93 1YJN3
chains in the Genus database with same CATH superfamily
3OW22 1B3SA 1W02A 3N8BA 3CCR3 2RFRA 1IVUA 2BMQB 1KQS2 3LH4A 2ML5A 2B1XB 5DREA 1FUSA 2RSXA 5KP1A 4HM5B 3GSPA 1FYSA 2GU3A 1I2EA 1BNGA 2CWUA 2WOHA 4G1MB 2AAEA 3S27A 3WOFB 1CH0A 1IVVA 1GY6A 2KAAA 4K1VA 1W2B2 1EG9B 1E97A 1AY7A 2D42A 2LQVA 1CQSA 3MSOA 4HM6B 3ZG5A 2KXGA 3SOYA 1RKYA 1YJW3 5M19A 1AR0A 3BNEA 3K5TA 1CEWI 4I4KA 3CC43 1WMOA 4FMCA 4H61A 4L7KA 4XBTA 1S5AA 5STDA 1IU7A 3MWZA 1Q42A 3FZWA 3JUMA 3MYTA 2OOVA 4HZ9B 3G16A 4R9KA 1ASKA 3A76A 1B2MA 1BUQA 2GEXA 1YJN3 1YHQ3 2XGLA 3X3ZA 3SOAA 1IYYA 3D3LA 2W56A 1QALA 1RGAA 2F99A 1GOYA 3JVCA 3U1WA 1S723 3ECFA 2E2UA 2K0MA 3KSPA 4N6NB 1AVKA 2OTL3 3GZBA 5CF1A 3OWSA 2HOHA 4K1UA 3Q2PA 2FXTA 3EB8A 4O8SA 4RNYA 2CC3A 4H3UA 3RDEA 2JDIH 5EEOA 1EKMA 1PY3A 1X1YA 3RNTA 3DMCA 3X42A 2E2TA 3CCM3 1GY5A 1OUNA 4OUQA 2BO9B 1UCKA 1N5HA 4XBXA 1US1A 2STDA 3T8NA 1OHSA 2RBIA 3F8XA 1CYUA 3UJMA 3BNDA 1K41A 1BOXA 2F86B 1BRHA 3BU4A 3D5IA 4FR9A 4HM2B 1BANA 3D9RA 1UGIA 3GZXB 2F56A 2H0GA 3I0YA 1FZUA 3MPHA 5GSPA 4EBGA 5AYSC 2C10A 1X1WA 1LRAA 1RRHA 2XEPA 3CNMA 3KFQC 4XDWA 2A15A 4EXRA 2BU4A 4WHAA 3CC23 1B27A 1X1UA 4X2OA 1PU4A 2CK3H 3FSDA 2XR8B 3CXC2 1BVIA 1IT8A 3HI7A 3V98A 1JBSA 3CD63 2CKFB 1T2IA 2OOVC 4J5GA 1VQM3 2M7OA 3HX8A 1KC84 2ZDJA 1V74A 2HMOB 3Q3FA 5CLKA 1Q864 1C7HA 4BU4A 1IVXA 1LQMB 1VQL3 1HZ1A 4HZBB 1VQN3 4J9AA 1ZO2A 4IIAA 2W6JH 4ILFA 4X2HA 1VQ83 2KF3A 1RGLA 3PXMA 2ZHXB 4MMYB 1IQ8A 3SEDA 3X40A 3X41A 3CME3 3LOYA 2Z76A 3AGNA 5DRVA 3EF8A 4HBRA 2HMLB 4HKVB 1LOXA 3F9SA 4N6V0 2P38A 4AKZA 3EC9A 3FCSB 1RGHA 2GBXB 3RGAA 1ULJB 1I3IA 3BLZA 4FCJA 1NWWA 1BSAA 4JF8A 5IW9A 2XRXB 3PYJA 4GB5A 2CIUA 1QVG2 5IG3A 4KFEA 1GOVA 3GRDA 7RNTA 1B2UA 2GSPA 1BNJA 1IQXA 5JPUA 3RGRA 1JN5A 1RGKA 4BTYA 1JBTA 1VQ43 1V57A 1TRPA 1GY7A 1STDA 2KRTA 2XFTA 3CPOA 3LT8A 3STDA 5KP4A 3LTBA 1O7PB 4O02B 1BRKA 1WMNA 3JUQA 4FMAA 4PEJA 1JB2A 1EUIC 1DYUA 3MG3A 3AMOB 1JKGA 5G2GA 1K9M4 2V1LA 3UL5A 4CJNA 2BT3A 4WP5A 3UNLA 1K734 2CWVA 1TP6A 3GZYB 1YJ93 2Q07A 1N9JA 3CMA3 1W4NA 1W00A 2C4BA 6RNTA 3J7Yd 2Z6BA 2PNCA 2J8XB 3L0RA 3WDGB 1RHLA 3BNCA 3DH2A 3LYGA 3JUOA 5AI1A 3GZRA 5IENA 1WMPA 1R4YA 1W2ZA 3H51A 4WYKB 5HGRA 1FW7A 1U5OA 1BRNL 3WR2A 1CYVA 1N9EA 2IUKA 1IQYA 1IVWA 1GMRA 1I70A 1RN1A 1TTOA 3WOEB 5HOHA 3WA3A 4L8PA 3F7XA 3M8CA 2XH9A 3PGBA 2I9WA 3D4AA 1GD3A 1KD14 2W9QA 3KSED 2QA43 3LXUX 2H0IA 3ER7A 2R4IA 3PS8A 1RDSA 3H3HA 4CPKA 1FGQA 1SIHA 4LYLB 1T5YA 1QMAA 1FGRA 2O3OA 2OCTA 3DY5A 2P09A 3FG4A 1BRIA 1BSDA 2SARA 1M9GA 3K7CA 1ROAA 2FGTA 6STDA 8RNTA 2CH9A 1STFI 3B7CA 2YX9A 1WTHA 1YVSA 1L5GB 1D6ZA 4HYZA 5AIIA 2C11A 1B21A 3LMLA 3LZAA 5M1AA 1Q40B 1BNFA 1RGFA 2IA7A 3ROBA 1E3VA 2IY2A 1DMNA 3KIIA 5A0OB 3DGMA 1QAFA 5CF2A 3G0KA 2W03A 4J8TA 1O7GB 1PYLA 2AADA 1RRLA 1IK3A 2L4VA 3B4OA 3BB9A 3FF2A 4XB5A 3CCV3 4STDA 1UI8A 2F98A 4LEHA 4EW5A 3CCJ3 4IPBA 3S5CA 5AEUB 4AKYA 5EVHA 1I0XA 3NHXA 1JJ22 1RGGA 3FF0A 3V92A 3BNBA 2IMJA 5M18A 1B2XA 1NB3I 1Q40A 3F8HA 2CW9A 3X3XA 2W9PA 7STDA 3TDGA 2OWPA 3K63A 2R41A 1B20A 2E2VA 3N54B 4GSPA 1ROVA 4LSOA 4FMBA 4KFDA 3SYUA 1JZOA 2W2CA 3EE1A 4HAAA 2B24B 1YIT3 1DVCA 1RTUA 3K9MC 3DGLA 3JUNA 1MWSA 8CHOA 1TRQA 1UI7A 2XF3A 3UB1A 3CPW2 1HU9A 3G8ZA 5G1LA 3SLUA 2P0MA 2BNGA 4FMDA 3CC73 3FG1A 3V99A 1UGHI 4HM0B 4HM8B 1BNSA 4ORLA 1OHPA 2XSHB 1M1K4 1LNIA 1ZGXA 3CU3A 2Z77A 4MEIA 1UW1A 3LTCA 1A2PA 3EBTA 1SJWA 1LXEA 3S29A 1QVF2 1MWTA 1RNTA 5D83A 4BTWA 5IEPA 3HIIA 1KSIA 2KF5A 4EC6A 9RNTA 1G96A 3EN1B 4XBYA 3FG3A 4HM7B 4HM4B 3PCSA 1OH0A 3SXXA 1MWUA 5CXOA 1MGRA 2OTJ3 5IEOA 3CCL3 1NB5I 1FGMA 4KT3B 2W0QA 4L8OA 3SX1A 3WODG 2F5WA 1N5PA 1BSBA 3NBBA 1EEJA 1O7MB 1GMPA 2QGUA 2YFIB 1M904 4FCZA 1LOWA 2IYJA 2O9UX 1RSNA 3FLJA 4EV2A 5AEWB 3HOHA 1B2SA 1M1XB 1SQWA 1JBRA 3GWRA 5JBSA 1A90A 2GBWB 4Q53A 5ELUA 1VQ63 5BIRA 1IV9A 4N6LA 2F5MA 4XM4A 3NM7A 4NHFA 1DMMA 1U8CB 3EHCA 3KE7A 1T3BA 4BL2A 1V58A 5FW5A 2WOFA 3I553 1KWIA 1IV7A 3NUVA 1SPUA 1N8R4 1VQK3 5IG0A 4OK0A 2Y73A 1A2VA 1F8NA 1A67A 5TGNA 2F4YA 5AIGA 5KP3A 4NREA 2CWTA 1NJI4 1YGEA 3QRDA 1LVNA 1GS3A 1VQQA 3VSYA 1G0TA 2XSOB 1BUJA 3MG1A 1BNIA 2HMMB 5JPPA 3FGYA 2CFKA 4LZIA 3S67A 2LYXA 1UCLA 2RCDA 3G713 2CFGA 5AIHA 1AV4A 1TJDA 3G6E3 1I2GA 4KVHA 2CFWA 1AQZA 2SBLA 4OVMA 1QJGA 1O7WB 1D6UA 3NV0B 4R1KA 1TFOA 3GAXA 3LT9A 4FCMA 4K90B 4WWUC 5G1KA 1UCJA 3CNXA 2CFDA 2GU1A 3AMOA 4R9LA 3U97A 1BRJA 1UCIA 3EN8A 2W04A 3Q1CA 1GD4A 1O7NB 2KF6A 5D82A 3UL6A 1VQP3 4EV5A 4WFOA 3KCHA 2HMJB 1AVLA 1BNEA 4J5KA 1FGTA 5IF6A 2RGQA 1RNBA 3O8YA 2FNQA 3EX9A 4JRFA 1JV2B 3A5EA 3PZWA 1JRQA 3CCE3 5IERA 1Y4KA 1NNVA 4WYKA 1BRGA 1UUWB 1X1XA 4EYCA 4MJDA 2KF4A 3AHSA 1E3RA 3F7SA 4RNTA 3F14A 3MHEA 4RNZA 3NV0A 4HJLB 2H0HA 1RJOA 4GHOA 5AYRB 2HMKB 3EBYA 1I3FA 1YVBI 3MKIA 1K28A 1D6YA 1IDPA 2YFLB 3CCU3 2W56B 3D79A 1OHOA 4XDVA 4AEQA 1RMSA 3B4PA 3FKAA 2K54A 2ZA4A 1BSEA 1BSCA 4TX4A 2CG0A 1B2ZA 3WMDA 4HVNA 4IT7A 3ZG0A 4HM1B 4HM3B 2HMNB 1RLSA 2L1SA 3JUPA 2K3DA 4O3VA 5ELJA 1UUGB 1OGZA 3OWUA 2ML6A 2RNTA 1FGOA 1LQGC 3K0ZA 4I5QA 1Q7HA 4MMXB 5BXQA 1RCLA 2UGIA 1IT7A 1R4CA 1NU3A 2IUJA 1TUHA 3OV4A 1GSPA 2OQEA 1Q9EA 1RCKA 1VQ93 2INXA 3KN4A 2XFSA 4HOHA 5D81A 3NM2A 1YI23 2YFJB 3X3YA 1YNVX 2BIRA 1YIJ3 3LTDA 3HIGA 1VQ53 3AHWA 1A2KA 1DMQA 2QEX3 4U13A 2QIYA 1QAKA 1UUVB 4KFFA 3DGYA 4GL6A 1FA3A 3EJVA 1OCVA 1ULIB 3KKGA 3NXJA 1JB4A 1WNHA 1VQO3 1Q824 1MOLA 3T8UA 4CCVA 2BMOB 2CX0A 2UUGC 2PZVA 4NPBA 4R4KA 3SVAA 3I563 1J2BA 2WGOA 2WGQA 2KCDA 3CCQ3 1WQLB 4N3VA 1OF5B 1W6YA 5BU4A 6GSPA 2WO0A 7GSPA 1DE3A 3DXOA 2JQ5A 3BIRA 4DKIA 1RGCA 1GMQA 1W6CA 1MNLA 1RN7A 2BMRB 1BAOA 1PFPA 1MWRA 3NQZA 2BHMA 1VZZA 1MGWA 1FUTA 2CX1A 3DGNA 4N6OB 1ISKA 1W01A 4N6TA 2MC8A 3DZLA 2CG1A 4K61A 1GYBA 3AGOA 3T0UA 4CDLA 4RZMA 2OQEC 4QWTA 3IJEB 1RGEA 1EQKA 2UX0A 1DETA 1OF5A 1HKXA 1TIJA 4O2HA 1G02A 3QK9A 1JN5B 1JB5A 1O7HB 1W6GA 3IPTA 4ZM8A 1T2HA 1FUWA 1GOUA 1UDII 1HYFA 1RN4A 3HZPA 2P0XA 3DGOA 1W5ZA 5RNTA 1Z1SA 1ZS7A 1BNRA 1SIIA 1I0VA 3ALAA 4RBNA 1DVDA 2GXFA 1JKGB 1LNHA 1TU5A 1LOVA 2MF7A 5LC6A 1BGSA 3DUKA 5EQLA 4R80A 3D5GA 1EA2A 4BIRA 2Y74A 1C54A 5AIFA 3OX9A 3HK4A 5I97A 3IMAB 3VF1A 3NBRA 1SARA 3Q90A 2GEYA 2P05A 3G4S3 1JNQA 3FH1A 2XGNA 3DM8A 3N9HA 4LGQA 1VQ73 2CFLA 1K8A4 1BRSA 4N6UA 3NX0A 2ZL8A 3EQQB 5IG5A 2CHCA 5FGOA 3URPA 3WHOA 3KZTA 2D1WA 3B8LA 5LC7A 3E99A 3CCS3 3LTAA 4LMIA 1N8QA 3OXAA 4BL3A 1I2FA 4KZ1A 4MMZB 1YGWA 1LOYA 1OGXA 3NBJA 3NQYA 1JZDA 5CK6A 4BTXA 2Z7AA 1OACA 1W7CA 5BVBA 3WA2X 4N6MA 3MG2A 1BU4A 1NO3A 1ZX2A 1OPYA 3F40A 1TFKA 1I8VA 3OWYA 3PCRA 3S28A 1Q814 5IG4A 1NDOB 3VGNA 1Q7Y4 3ZFZA 1BIRA
chains in the Genus database with same CATH topology
3OW22 1W02A 3N8BA 3CCR3 2RFRA 1IVUA 2BMQB 1KQS2 3LH4A 2ML5A 2B1XB 5DREA 2RSXA 5KP1A 4HM5B 2GU3A 2WOHA 2CWUA 3S27A 4G1MB 3WOFB 1IVVA 1GY6A 1W2B2 4K1VA 1EG9B 1E97A 2LQVA 2D42A 3MSOA 1CQSA 4HM6B 2KXGA 3SOYA 1RKYA 1YJW3 1AR0A 3BNEA 3K5TA 1CEWI 4I4KA 3CC43 1WMOA 4FMCA 4H61A 4L7KA 4XBTA 1S5AA 5STDA 1IU7A 3MWZA 1Q42A 3FZWA 3JUMA 3MYTA 2OOVA 4HZ9B 3G16A 4R9KA 1ASKA 3A76A 1BUQA 2GEXA 1YJN3 1YHQ3 2XGLA 3X3ZA 3SOAA 3D3LA 2W56A 1QALA 2F99A 3JVCA 3U1WA 1S723 3ECFA 2E2UA 2K0MA 3KSPA 4N6NB 1AVKA 2OTL3 3GZBA 5CF1A 3OWSA 4K1UA 3Q2PA 2FXTA 3EB8A 4O8SA 4RNYA 2CC3A 4H3UA 3RDEA 2JDIH 5EEOA 1EKMA 3X42A 3DMCA 2E2TA 3CCM3 1GY5A 1OUNA 4OUQA 2BO9B 1N5HA 4XBXA 1US1A 2STDA 3T8NA 1OHSA 1CYUA 3F8XA 3UJMA 3BNDA 1K41A 2F86B 4FR9A 4HM2B 3D9RA 3I0YA 3GZXB 3MPHA 4EBGA 5AYSC 2C10A 1RRHA 2XEPA 3CNMA 3KFQC 4XDWA 2A15A 4EXRA 4WHAA 3CC23 4X2OA 1PU4A 2CK3H 3FSDA 2XR8B 3CXC2 3CD63 1IT8A 3HI7A 3V98A 2CKFB 2OOVC 1VQM3 1KC84 2M7OA 3HX8A 2ZDJA 1V74A 2HMOB 1Q864 5CLKA 1C7HA 1IVXA 1VQL3 4HZBB 1VQN3 4J9AA 1ZO2A 4IIAA 2W6JH 4X2HA 1VQ83 3PXMA 4MMYB 1IQ8A 3SEDA 3X40A 3X41A 3CME3 3LOYA 2Z76A 5DRVA 3EF8A 4HBRA 2HMLB 4HKVB 1LOXA 3F9SA 4N6V0 2P38A 4AKZA 3EC9A 3FCSB 2GBXB 3RGAA 1ULJB 3BLZA 4FCJA 1NWWA 4JF8A 5IW9A 2XRXB 3PYJA 4GB5A 2CIUA 1QVG2 5IG3A 4KFEA 3GRDA 1IQXA 5JPUA 3RGRA 1JN5A 4BTYA 1VQ43 3CPOA 1GY7A 2XFTA 1STDA 2KRTA 3LT8A 3STDA 5KP4A 3LTBA 1O7PB 4O02B 1WMNA 3JUQA 4FMAA 4PEJA 1JB2A 1DYUA 3MG3A 3AMOB 1JKGA 5G2GA 1K9M4 2V1LA 3UL5A 2BT3A 4WP5A 3UNLA 1K734 2CWVA 1TP6A 3GZYB 1YJ93 2Q07A 1N9JA 3CMA3 1W4NA 1W00A 3J7Yd 2Z6BA 2PNCA 3L0RA 3WDGB 3BNCA 3LYGA 5AI1A 3JUOA 5IENA 3GZRA 1WMPA 1W2ZA 5HGRA 3H51A 4WYKB 1U5OA 1CYVA 1N9EA 2IUKA 1IQYA 1IVWA 3WOEB 3WA3A 4L8PA 3F7XA 3M8CA 2XH9A 3PGBA 2I9WA 1GD3A 1KD14 2W9QA 3KSED 2QA43 3LXUX 3ER7A 2R4IA 3PS8A 3H3HA 1FGQA 1SIHA 1T5YA 1QMAA 1FGRA 2O3OA 2OCTA 3DY5A 2P09A 3FG4A 1M9GA 3K7CA 1ROAA 2FGTA 6STDA 2CH9A 1STFI 3B7CA 2YX9A 1WTHA 1L5GB 1D6ZA 4HYZA 5AIIA 2C11A 3LMLA 3LZAA 1Q40B 3ROBA 2IA7A 1E3VA 1DMNA 3KIIA 5A0OB 3DGMA 1QAFA 5CF2A 3G0KA 2W03A 4J8TA 1O7GB 1RRLA 1IK3A 2L4VA 3B4OA 3BB9A 3FF2A 4XB5A 3CCV3 4STDA 1UI8A 2F98A 4LEHA 3CCJ3 4IPBA 3S5CA 5AEUB 4AKYA 5EVHA 3NHXA 1JJ22 3FF0A 3V92A 3BNBA 2IMJA 1NB3I 1Q40A 3F8HA 2CW9A 3X3XA 2W9PA 7STDA 3TDGA 2OWPA 3K63A 3N54B 2E2VA 1ROVA 4LSOA 4FMBA 4KFDA 2W2CA 3EE1A 1YIT3 2B24B 1DVCA 3K9MC 3DGLA 3JUNA 8CHOA 3CPW2 1UI7A 2XF3A 3UB1A 1HU9A 3G8ZA 3SLUA 2P0MA 2BNGA 4FMDA 3CC73 3FG1A 3V99A 4HM8B 4HM0B 4ORLA 1OHPA 2XSHB 1M1K4 3CU3A 2Z77A 4MEIA 1UW1A 3LTCA 3EBTA 1SJWA 1LXEA 3S29A 1QVF2 5D83A 4BTWA 5IEPA 3HIIA 1KSIA 4EC6A 1G96A 3EN1B 4XBYA 3FG3A 4HM7B 4HM4B 3PCSA 1OH0A 3SXXA 5CXOA 2OTJ3 5IEOA 3CCL3 1NB5I 1FGMA 2W0QA 4L8OA 3SX1A 3WODG 1N5PA 3NBBA 1O7MB 2QGUA 2YFIB 1M904 4FCZA 2O9UX 4EV2A 3FLJA 5AEWB 1M1XB 1SQWA 3GWRA 5JBSA 1A90A 2GBWB 4Q53A 5ELUA 1VQ63 1IV9A 4N6LA 4XM4A 3NM7A 4NHFA 1DMMA 1U8CB 3EHCA 3KE7A 5FW5A 2WOFA 3I553 1KWIA 1IV7A 3NUVA 1SPUA 1N8R4 1VQK3 5IG0A 4OK0A 2Y73A 1A2VA 1F8NA 1A67A 5TGNA 5KP3A 5AIGA 1NJI4 4NREA 2CWTA 1YGEA 3QRDA 1LVNA 1GS3A 3VSYA 2XSOB 3MG1A 2HMMB 5JPPA 3FGYA 2CFKA 4LZIA 3S67A 2LYXA 2RCDA 3G713 2CFGA 5AIHA 1AV4A 3G6E3 4KVHA 2CFWA 2SBLA 4OVMA 1QJGA 1O7WB 1D6UA 3NV0B 4R1KA 1TFOA 3GAXA 3LT9A 4FCMA 4K90B 4WWUC 3CNXA 2CFDA 2GU1A 3AMOA 4R9LA 3U97A 3EN8A 2W04A 3Q1CA 1GD4A 1O7NB 5D82A 3UL6A 1VQP3 4EV5A 4WFOA 2HMJB 1AVLA 5IF6A 1FGTA 2RGQA 3O8YA 2FNQA 3EX9A 4JRFA 1JV2B 3PZWA 3CCE3 1JRQA 5IERA 1Y4KA 4WYKA 1UUWB 4EYCA 4MJDA 3F7SA 1E3RA 3F14A 3MHEA 4RNZA 3NV0A 4HJLB 1RJOA 5AYRB 2HMKB 3EBYA 1YVBI 3MKIA 1K28A 1D6YA 1IDPA 2YFLB 3CCU3 2W56B 4AEQA 1OHOA 4XDVA 3B4PA 3FKAA 2K54A 4TX4A 2CG0A 3WMDA 4HVNA 4IT7A 4HM1B 4HM3B 2HMNB 3JUPA 4O3VA 5ELJA 1OGZA 3OWUA 2ML6A 1FGOA 3K0ZA 4MMXB 5BXQA 1IT7A 1R4CA 1NU3A 2IUJA 1TUHA 3OV4A 2OQEA 1VQ93 2INXA 3KN4A 2XFSA 5D81A 3NM2A 1YI23 2YFJB 3X3YA 1YIJ3 3LTDA 3HIGA 1VQ53 1A2KA 1DMQA 2QEX3 4U13A 2QIYA 1QAKA 1UUVB 4KFFA 4GL6A 1FA3A 3EJVA 1OCVA 1ULIB 3KKGA 3NXJA 1JB4A 1WNHA 1VQO3 1Q824 1MOLA 3T8UA 4CCVA 2BMOB 3SVAA 2PZVA 4R4KA 3I563 1J2BA 2WGOA 2WGQA 2KCDA 3CCQ3 1WQLB 4N3VA 1OF5B 1W6YA 2WO0A 3DXOA 2JQ5A 1W6CA 1MNLA 1RN7A 2BMRB 1PFPA 3NQZA 2BHMA 1VZZA 3DGNA 4N6OB 1ISKA 1W01A 4N6TA 2MC8A 3DZLA 2CG1A 4K61A 1GYBA 3T0UA 4CDLA 4RZMA 2OQEC 4QWTA 3IJEB 1EQKA 2UX0A 1OF5A 1HKXA 1TIJA 4O2HA 3QK9A 1JN5B 1JB5A 1O7HB 1W6GA 3IPTA 4ZM8A 1FUWA 3HZPA 2P0XA 3DGOA 1W5ZA 1Z1SA 1SIIA 3ALAA 4RBNA 1DVDA 2GXFA 1JKGB 1LNHA 1TU5A 2MF7A 5LC6A 3DUKA 5EQLA 4R80A 1EA2A 2Y74A 5AIFA 3OX9A 3HK4A 5I97A 3IMAB 3VF1A 3NBRA 3Q90A 2GEYA 2P05A 3G4S3 1JNQA 3FH1A 2XGNA 3DM8A 3N9HA 4LGQA 1VQ73 2CFLA 1K8A4 4N6UA 3NX0A 2ZL8A 3EQQB 5IG5A 2CHCA 5FGOA 3KZTA 2D1WA 3B8LA 5LC7A 3E99A 3CCS3 3LTAA 4LMIA 1N8QA 3OXAA 4KZ1A 4MMZB 5CK6A 3NBJA 1OGXA 3NQYA 4BTXA 2Z7AA 1OACA 1W7CA 5BVBA 3WA2X 4N6MA 3MG2A 1NO3A 1ZX2A 1OPYA 3F40A 1TFKA 3OWYA 3S28A 3PCRA 1Q814 5IG4A 1NDOB 3VGNA 1Q7Y4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK 3;  1VQ7 3;  1YIT 3;  2OTJ 3;  1K8A 4;  3CME 3;  3CCL 3;  3OW2 2;  1YI2 3;  1KD1 4;  3CPW 2;  3CCR 3;  2QA4 3;  1YIJ 3;  1NJI 4;  3CCU 3;  1KQS 2;  1VQ5 3;  3CC7 3;  1S72 3;  1M90 4;  1K9M 4;  2QEX 3;  2OTL 3;  3CCV 3;  1M1K 4;  1VQP 3;  1K73 4;  3CCS 3;  3CC2 3;  3CCJ 3;  1W2B 2;  1YJ9 3;  3G71 3;  3CXC 2;  3CMA 3;  3CD6 3;  1QVF 2;  1JJ2 2;  1VQO 3;  3CCE 3;  1VQM 3;  1Q82 4;  1QVG 2;  1YJW 3;  1KC8 4;  1VQ6 3;  1Q86 4;  3G6E 3;  3CC4 3;  3CCM 3;  3G4S 3;  3I56 3;  1Q81 4;  1VQL 3;  3I55 3;  3CCQ 3;  1VQN 3;  1VQ4 3;  1YHQ 3;  1Q7Y 4;  1VQ8 3;  1N8R 4;  1VQ9 3;  1YJN 3; 
#chains in the Genus database with same CATH topology
 3OW2 2;  1B3S A;  1W02 A;  3N8B A;  3CCR 3;  2RFR A;  1IVU A;  2BMQ B;  1KQS 2;  3LH4 A;  2ML5 A;  2B1X B;  5DRE A;  1FUS A;  2RSX A;  5KP1 A;  4HM5 B;  3GSP A;  1FYS A;  2GU3 A;  1I2E A;  1BNG A;  2CWU A;  2WOH A;  4G1M B;  2AAE A;  3S27 A;  3WOF B;  1CH0 A;  1IVV A;  1GY6 A;  2KAA A;  4K1V A;  1W2B 2;  1EG9 B;  1E97 A;  1AY7 A;  2D42 A;  2LQV A;  1CQS A;  3MSO A;  4HM6 B;  3ZG5 A;  2KXG A;  3SOY A;  1RKY A;  1YJW 3;  5M19 A;  1AR0 A;  3BNE A;  3K5T A;  1CEW I;  4I4K A;  3CC4 3;  1WMO A;  4FMC A;  4H61 A;  4L7K A;  4XBT A;  1S5A A;  5STD A;  1IU7 A;  3MWZ A;  1Q42 A;  3FZW A;  3JUM A;  3MYT A;  2OOV A;  4HZ9 B;  3G16 A;  4R9K A;  1ASK A;  3A76 A;  1B2M A;  1BUQ A;  2GEX A;  1YJN 3;  1YHQ 3;  2XGL A;  3X3Z A;  3SOA A;  1IYY A;  3D3L A;  2W56 A;  1QAL A;  1RGA A;  2F99 A;  1GOY A;  3JVC A;  3U1W A;  1S72 3;  3ECF A;  2E2U A;  2K0M A;  3KSP A;  4N6N B;  1AVK A;  2OTL 3;  3GZB A;  5CF1 A;  3OWS A;  2HOH A;  4K1U A;  3Q2P A;  2FXT A;  3EB8 A;  4O8S A;  4RNY A;  2CC3 A;  4H3U A;  3RDE A;  2JDI H;  5EEO A;  1EKM A;  1PY3 A;  1X1Y A;  3RNT A;  3DMC A;  3X42 A;  2E2T A;  3CCM 3;  1GY5 A;  1OUN A;  4OUQ A;  2BO9 B;  1UCK A;  1N5H A;  4XBX A;  1US1 A;  2STD A;  3T8N A;  1OHS A;  2RBI A;  3F8X A;  1CYU A;  3UJM A;  3BND A;  1K41 A;  1BOX A;  2F86 B;  1BRH A;  3BU4 A;  3D5I A;  4FR9 A;  4HM2 B;  1BAN A;  3D9R A;  1UGI A;  3GZX B;  2F56 A;  2H0G A;  3I0Y A;  1FZU A;  3MPH A;  5GSP A;  4EBG A;  5AYS C;  2C10 A;  1X1W A;  1LRA A;  1RRH A;  2XEP A;  3CNM A;  3KFQ C;  4XDW A;  2A15 A;  4EXR A;  2BU4 A;  4WHA A;  3CC2 3;  1B27 A;  1X1U A;  4X2O A;  1PU4 A;  2CK3 H;  3FSD A;  2XR8 B;  3CXC 2;  1BVI A;  1IT8 A;  3HI7 A;  3V98 A;  1JBS A;  3CD6 3;  2CKF B;  1T2I A;  2OOV C;  4J5G A;  1VQM 3;  2M7O A;  3HX8 A;  1KC8 4;  2ZDJ A;  1V74 A;  2HMO B;  3Q3F A;  5CLK A;  1Q86 4;  1C7H A;  4BU4 A;  1IVX A;  1LQM B;  1VQL 3;  1HZ1 A;  4HZB B;  1VQN 3;  4J9A A;  1ZO2 A;  4IIA A;  2W6J H;  4ILF A;  4X2H A;  1VQ8 3;  2KF3 A;  1RGL A;  3PXM A;  2ZHX B;  4MMY B;  1IQ8 A;  3SED A;  3X40 A;  3X41 A;  3CME 3;  3LOY A;  2Z76 A;  3AGN A;  5DRV A;  3EF8 A;  4HBR A;  2HML B;  4HKV B;  1LOX A;  3F9S A;  4N6V 0;  2P38 A;  4AKZ A;  3EC9 A;  3FCS B;  1RGH A;  2GBX B;  3RGA A;  1ULJ B;  1I3I A;  3BLZ A;  4FCJ A;  1NWW A;  1BSA A;  4JF8 A;  5IW9 A;  2XRX B;  3PYJ A;  4GB5 A;  2CIU A;  1QVG 2;  5IG3 A;  4KFE A;  1GOV A;  3GRD A;  7RNT A;  1B2U A;  2GSP A;  1BNJ A;  1IQX A;  5JPU A;  3RGR A;  1JN5 A;  1RGK A;  4BTY A;  1JBT A;  1VQ4 3;  1V57 A;  1TRP A;  1GY7 A;  1STD A;  2KRT A;  2XFT A;  3CPO A;  3LT8 A;  3STD A;  5KP4 A;  3LTB A;  1O7P B;  4O02 B;  1BRK A;  1WMN A;  3JUQ A;  4FMA A;  4PEJ A;  1JB2 A;  1EUI C;  1DYU A;  3MG3 A;  3AMO B;  1JKG A;  5G2G A;  1K9M 4;  2V1L A;  3UL5 A;  4CJN A;  2BT3 A;  4WP5 A;  3UNL A;  1K73 4;  2CWV A;  1TP6 A;  3GZY B;  1YJ9 3;  2Q07 A;  1N9J A;  3CMA 3;  1W4N A;  1W00 A;  2C4B A;  6RNT A;  3J7Y d;  2Z6B A;  2PNC A;  2J8X B;  3L0R A;  3WDG B;  1RHL A;  3BNC A;  3DH2 A;  3LYG A;  3JUO A;  5AI1 A;  3GZR A;  5IEN A;  1WMP A;  1R4Y A;  1W2Z A;  3H51 A;  4WYK B;  5HGR A;  1FW7 A;  1U5O A;  1BRN L;  3WR2 A;  1CYV A;  1N9E A;  2IUK A;  1IQY A;  1IVW A;  1GMR A;  1I70 A;  1RN1 A;  1TTO A;  3WOE B;  5HOH A;  3WA3 A;  4L8P A;  3F7X A;  3M8C A;  2XH9 A;  3PGB A;  2I9W A;  3D4A A;  1GD3 A;  1KD1 4;  2W9Q A;  3KSE D;  2QA4 3;  3LXU X;  2H0I A;  3ER7 A;  2R4I A;  3PS8 A;  1RDS A;  3H3H A;  4CPK A;  1FGQ A;  1SIH A;  4LYL B;  1T5Y A;  1QMA A;  1FGR A;  2O3O A;  2OCT A;  3DY5 A;  2P09 A;  3FG4 A;  1BRI A;  1BSD A;  2SAR A;  1M9G A;  3K7C A;  1ROA A;  2FGT A;  6STD A;  8RNT A;  2CH9 A;  1STF I;  3B7C A;  2YX9 A;  1WTH A;  1YVS A;  1L5G B;  1D6Z A;  4HYZ A;  5AII A;  2C11 A;  1B21 A;  3LML A;  3LZA A;  5M1A A;  1Q40 B;  1BNF A;  1RGF A;  2IA7 A;  3ROB A;  1E3V A;  2IY2 A;  1DMN A;  3KII A;  5A0O B;  3DGM A;  1QAF A;  5CF2 A;  3G0K A;  2W03 A;  4J8T A;  1O7G B;  1PYL A;  2AAD A;  1RRL A;  1IK3 A;  2L4V A;  3B4O A;  3BB9 A;  3FF2 A;  4XB5 A;  3CCV 3;  4STD A;  1UI8 A;  2F98 A;  4LEH A;  4EW5 A;  3CCJ 3;  4IPB A;  3S5C A;  5AEU B;  4AKY A;  5EVH A;  1I0X A;  3NHX A;  1JJ2 2;  1RGG A;  3FF0 A;  3V92 A;  3BNB A;  2IMJ A;  5M18 A;  1B2X A;  1NB3 I;  1Q40 A;  3F8H A;  2CW9 A;  3X3X A;  2W9P A;  7STD A;  3TDG A;  2OWP A;  3K63 A;  2R41 A;  1B20 A;  2E2V A;  3N54 B;  4GSP A;  1ROV A;  4LSO A;  4FMB A;  4KFD A;  3SYU A;  1JZO A;  2W2C A;  3EE1 A;  4HAA A;  2B24 B;  1YIT 3;  1DVC A;  1RTU A;  3K9M C;  3DGL A;  3JUN A;  1MWS A;  8CHO A;  1TRQ A;  1UI7 A;  2XF3 A;  3UB1 A;  3CPW 2;  1HU9 A;  3G8Z A;  5G1L A;  3SLU A;  2P0M A;  2BNG A;  4FMD A;  3CC7 3;  3FG1 A;  3V99 A;  1UGH I;  4HM0 B;  4HM8 B;  1BNS A;  4ORL A;  1OHP A;  2XSH B;  1M1K 4;  1LNI A;  1ZGX A;  3CU3 A;  2Z77 A;  4MEI A;  1UW1 A;  3LTC A;  1A2P A;  3EBT A;  1SJW A;  1LXE A;  3S29 A;  1QVF 2;  1MWT A;  1RNT A;  5D83 A;  4BTW A;  5IEP A;  3HII A;  1KSI A;  2KF5 A;  4EC6 A;  9RNT A;  1G96 A;  3EN1 B;  4XBY A;  3FG3 A;  4HM7 B;  4HM4 B;  3PCS A;  1OH0 A;  3SXX A;  1MWU A;  5CXO A;  1MGR A;  2OTJ 3;  5IEO A;  3CCL 3;  1NB5 I;  1FGM A;  4KT3 B;  2W0Q A;  4L8O A;  3SX1 A;  3WOD G;  2F5W A;  1N5P A;  1BSB A;  3NBB A;  1EEJ A;  1O7M B;  1GMP A;  2QGU A;  2YFI B;  1M90 4;  4FCZ A;  1LOW A;  2IYJ A;  2O9U X;  1RSN A;  3FLJ A;  4EV2 A;  5AEW B;  3HOH A;  1B2S A;  1M1X B;  1SQW A;  1JBR A;  3GWR A;  5JBS A;  1A90 A;  2GBW B;  4Q53 A;  5ELU A;  1VQ6 3;  5BIR A;  1IV9 A;  4N6L A;  2F5M A;  4XM4 A;  3NM7 A;  4NHF A;  1DMM A;  1U8C B;  3EHC A;  3KE7 A;  1T3B A;  4BL2 A;  1V58 A;  5FW5 A;  2WOF A;  3I55 3;  1KWI A;  1IV7 A;  3NUV A;  1SPU A;  1N8R 4;  1VQK 3;  5IG0 A;  4OK0 A;  2Y73 A;  1A2V A;  1F8N A;  1A67 A;  5TGN A;  2F4Y A;  5AIG A;  5KP3 A;  4NRE A;  2CWT A;  1NJI 4;  1YGE A;  3QRD A;  1LVN A;  1GS3 A;  1VQQ A;  3VSY A;  1G0T A;  2XSO B;  1BUJ A;  3MG1 A;  1BNI A;  2HMM B;  5JPP A;  3FGY A;  2CFK A;  4LZI A;  3S67 A;  2LYX A;  1UCL A;  2RCD A;  3G71 3;  2CFG A;  5AIH A;  1AV4 A;  1TJD A;  3G6E 3;  1I2G A;  4KVH A;  2CFW A;  1AQZ A;  2SBL A;  4OVM A;  1QJG A;  1O7W B;  1D6U A;  3NV0 B;  4R1K A;  1TFO A;  3GAX A;  3LT9 A;  4FCM A;  4K90 B;  4WWU C;  5G1K A;  1UCJ A;  3CNX A;  2CFD A;  2GU1 A;  3AMO A;  4R9L A;  3U97 A;  1BRJ A;  1UCI A;  3EN8 A;  2W04 A;  3Q1C A;  1GD4 A;  1O7N B;  2KF6 A;  5D82 A;  3UL6 A;  1VQP 3;  4EV5 A;  4WFO A;  3KCH A;  2HMJ B;  1AVL A;  1BNE A;  4J5K A;  1FGT A;  5IF6 A;  2RGQ A;  1RNB A;  3O8Y A;  2FNQ A;  3EX9 A;  4JRF A;  1JV2 B;  3A5E A;  3PZW A;  1JRQ A;  3CCE 3;  5IER A;  1Y4K A;  1NNV A;  4WYK A;  1BRG A;  1UUW B;  1X1X A;  4EYC A;  4MJD A;  2KF4 A;  3AHS A;  1E3R A;  3F7S A;  4RNT A;  3F14 A;  3MHE A;  4RNZ A;  3NV0 A;  4HJL B;  2H0H A;  1RJO A;  4GHO A;  5AYR B;  2HMK B;  3EBY A;  1I3F A;  1YVB I;  3MKI A;  1K28 A;  1D6Y A;  1IDP A;  2YFL B;  3CCU 3;  2W56 B;  3D79 A;  1OHO A;  4XDV A;  4AEQ A;  1RMS A;  3B4P A;  3FKA A;  2K54 A;  2ZA4 A;  1BSE A;  1BSC A;  4TX4 A;  2CG0 A;  1B2Z A;  3WMD A;  4HVN A;  4IT7 A;  3ZG0 A;  4HM1 B;  4HM3 B;  2HMN B;  1RLS A;  2L1S A;  3JUP A;  2K3D A;  4O3V A;  5ELJ A;  1UUG B;  1OGZ A;  3OWU A;  2ML6 A;  2RNT A;  1FGO A;  1LQG C;  3K0Z A;  4I5Q A;  1Q7H A;  4MMX B;  5BXQ A;  1RCL A;  2UGI A;  1IT7 A;  1R4C A;  1NU3 A;  2IUJ A;  1TUH A;  3OV4 A;  1GSP A;  2OQE A;  1Q9E A;  1RCK A;  1VQ9 3;  2INX A;  3KN4 A;  2XFS A;  4HOH A;  5D81 A;  3NM2 A;  1YI2 3;  2YFJ B;  3X3Y A;  1YNV X;  2BIR A;  1YIJ 3;  3LTD A;  3HIG A;  1VQ5 3;  3AHW A;  1A2K A;  1DMQ A;  2QEX 3;  4U13 A;  2QIY A;  1QAK A;  1UUV B;  4KFF A;  3DGY A;  4GL6 A;  1FA3 A;  3EJV A;  1OCV A;  1ULI B;  3KKG A;  3NXJ A;  1JB4 A;  1WNH A;  1VQO 3;  1Q82 4;  1MOL A;  3T8U A;  4CCV A;  2BMO B;  2CX0 A;  2UUG C;  2PZV A;  4NPB A;  4R4K A;  3SVA A;  3I56 3;  1J2B A;  2WGO A;  2WGQ A;  2KCD A;  3CCQ 3;  1WQL B;  4N3V A;  1OF5 B;  1W6Y A;  5BU4 A;  6GSP A;  2WO0 A;  7GSP A;  1DE3 A;  3DXO A;  2JQ5 A;  3BIR A;  4DKI A;  1RGC A;  1GMQ A;  1W6C A;  1MNL A;  1RN7 A;  2BMR B;  1BAO A;  1PFP A;  1MWR A;  3NQZ A;  2BHM A;  1VZZ A;  1MGW A;  1FUT A;  2CX1 A;  3DGN A;  4N6O B;  1ISK A;  1W01 A;  4N6T A;  2MC8 A;  3DZL A;  2CG1 A;  4K61 A;  1GYB A;  3AGO A;  3T0U A;  4CDL A;  4RZM A;  2OQE C;  4QWT A;  3IJE B;  1RGE A;  1EQK A;  2UX0 A;  1DET A;  1OF5 A;  1HKX A;  1TIJ A;  4O2H A;  1G02 A;  3QK9 A;  1JN5 B;  1JB5 A;  1O7H B;  1W6G A;  3IPT A;  4ZM8 A;  1T2H A;  1FUW A;  1GOU A;  1UDI I;  1HYF A;  1RN4 A;  3HZP A;  2P0X A;  3DGO A;  1W5Z A;  5RNT A;  1Z1S A;  1ZS7 A;  1BNR A;  1SII A;  1I0V A;  3ALA A;  4RBN A;  1DVD A;  2GXF A;  1JKG B;  1LNH A;  1TU5 A;  1LOV A;  2MF7 A;  5LC6 A;  1BGS A;  3DUK A;  5EQL A;  4R80 A;  3D5G A;  1EA2 A;  4BIR A;  2Y74 A;  1C54 A;  5AIF A;  3OX9 A;  3HK4 A;  5I97 A;  3IMA B;  3VF1 A;  3NBR A;  1SAR A;  3Q90 A;  2GEY A;  2P05 A;  3G4S 3;  1JNQ A;  3FH1 A;  2XGN A;  3DM8 A;  3N9H A;  4LGQ A;  1VQ7 3;  2CFL A;  1K8A 4;  1BRS A;  4N6U A;  3NX0 A;  2ZL8 A;  3EQQ B;  5IG5 A;  2CHC A;  5FGO A;  3URP A;  3WHO A;  3KZT A;  2D1W A;  3B8L A;  5LC7 A;  3E99 A;  3CCS 3;  3LTA A;  4LMI A;  1N8Q A;  3OXA A;  4BL3 A;  1I2F A;  4KZ1 A;  4MMZ B;  1YGW A;  1LOY A;  1OGX A;  3NBJ A;  3NQY A;  1JZD A;  5CK6 A;  4BTX A;  2Z7A A;  1OAC A;  1W7C A;  5BVB A;  3WA2 X;  4N6M A;  3MG2 A;  1BU4 A;  1NO3 A;  1ZX2 A;  1OPY A;  3F40 A;  1TFK A;  1I8V A;  3OWY A;  3PCR A;  3S28 A;  1Q81 4;  5IG4 A;  1NDO B;  3VGN A;  1Q7Y 4;  3ZFZ A;  1BIR A; 
#chains in the Genus database with same CATH homology
 3OW2 2;  1W02 A;  3N8B A;  3CCR 3;  2RFR A;  1IVU A;  2BMQ B;  1KQS 2;  3LH4 A;  2ML5 A;  2B1X B;  5DRE A;  2RSX A;  5KP1 A;  4HM5 B;  2GU3 A;  2WOH A;  2CWU A;  3S27 A;  4G1M B;  3WOF B;  1IVV A;  1GY6 A;  1W2B 2;  4K1V A;  1EG9 B;  1E97 A;  2LQV A;  2D42 A;  3MSO A;  1CQS A;  4HM6 B;  2KXG A;  3SOY A;  1RKY A;  1YJW 3;  1AR0 A;  3BNE A;  3K5T A;  1CEW I;  4I4K A;  3CC4 3;  1WMO A;  4FMC A;  4H61 A;  4L7K A;  4XBT A;  1S5A A;  5STD A;  1IU7 A;  3MWZ A;  1Q42 A;  3FZW A;  3JUM A;  3MYT A;  2OOV A;  4HZ9 B;  3G16 A;  4R9K A;  1ASK A;  3A76 A;  1BUQ A;  2GEX A;  1YJN 3;  1YHQ 3;  2XGL A;  3X3Z A;  3SOA A;  3D3L A;  2W56 A;  1QAL A;  2F99 A;  3JVC A;  3U1W A;  1S72 3;  3ECF A;  2E2U A;  2K0M A;  3KSP A;  4N6N B;  1AVK A;  2OTL 3;  3GZB A;  5CF1 A;  3OWS A;  4K1U A;  3Q2P A;  2FXT A;  3EB8 A;  4O8S A;  4RNY A;  2CC3 A;  4H3U A;  3RDE A;  2JDI H;  5EEO A;  1EKM A;  3X42 A;  3DMC A;  2E2T A;  3CCM 3;  1GY5 A;  1OUN A;  4OUQ A;  2BO9 B;  1N5H A;  4XBX A;  1US1 A;  2STD A;  3T8N A;  1OHS A;  1CYU A;  3F8X A;  3UJM A;  3BND A;  1K41 A;  2F86 B;  4FR9 A;  4HM2 B;  3D9R A;  3I0Y A;  3GZX B;  3MPH A;  4EBG A;  5AYS C;  2C10 A;  1RRH A;  2XEP A;  3CNM A;  3KFQ C;  4XDW A;  2A15 A;  4EXR A;  4WHA A;  3CC2 3;  4X2O A;  1PU4 A;  2CK3 H;  3FSD A;  2XR8 B;  3CXC 2;  3CD6 3;  1IT8 A;  3HI7 A;  3V98 A;  2CKF B;  2OOV C;  1VQM 3;  1KC8 4;  2M7O A;  3HX8 A;  2ZDJ A;  1V74 A;  2HMO B;  1Q86 4;  5CLK A;  1C7H A;  1IVX A;  1VQL 3;  4HZB B;  1VQN 3;  4J9A A;  1ZO2 A;  4IIA A;  2W6J H;  4X2H A;  1VQ8 3;  3PXM A;  4MMY B;  1IQ8 A;  3SED A;  3X40 A;  3X41 A;  3CME 3;  3LOY A;  2Z76 A;  5DRV A;  3EF8 A;  4HBR A;  2HML B;  4HKV B;  1LOX A;  3F9S A;  4N6V 0;  2P38 A;  4AKZ A;  3EC9 A;  3FCS B;  2GBX B;  3RGA A;  1ULJ B;  3BLZ A;  4FCJ A;  1NWW A;  4JF8 A;  5IW9 A;  2XRX B;  3PYJ A;  4GB5 A;  2CIU A;  1QVG 2;  5IG3 A;  4KFE A;  3GRD A;  1IQX A;  5JPU A;  3RGR A;  1JN5 A;  4BTY A;  1VQ4 3;  3CPO A;  1GY7 A;  2XFT A;  1STD A;  2KRT A;  3LT8 A;  3STD A;  5KP4 A;  3LTB A;  1O7P B;  4O02 B;  1WMN A;  3JUQ A;  4FMA A;  4PEJ A;  1JB2 A;  1DYU A;  3MG3 A;  3AMO B;  1JKG A;  5G2G A;  1K9M 4;  2V1L A;  3UL5 A;  2BT3 A;  4WP5 A;  3UNL A;  1K73 4;  2CWV A;  1TP6 A;  3GZY B;  1YJ9 3;  2Q07 A;  1N9J A;  3CMA 3;  1W4N A;  1W00 A;  3J7Y d;  2Z6B A;  2PNC A;  3L0R A;  3WDG B;  3BNC A;  3LYG A;  5AI1 A;  3JUO A;  5IEN A;  3GZR A;  1WMP A;  1W2Z A;  5HGR A;  3H51 A;  4WYK B;  1U5O A;  1CYV A;  1N9E A;  2IUK A;  1IQY A;  1IVW A;  3WOE B;  3WA3 A;  4L8P A;  3F7X A;  3M8C A;  2XH9 A;  3PGB A;  2I9W A;  1GD3 A;  1KD1 4;  2W9Q A;  3KSE D;  2QA4 3;  3LXU X;  3ER7 A;  2R4I A;  3PS8 A;  3H3H A;  1FGQ A;  1SIH A;  1T5Y A;  1QMA A;  1FGR A;  2O3O A;  2OCT A;  3DY5 A;  2P09 A;  3FG4 A;  1M9G A;  3K7C A;  1ROA A;  2FGT A;  6STD A;  2CH9 A;  1STF I;  3B7C A;  2YX9 A;  1WTH A;  1L5G B;  1D6Z A;  4HYZ A;  5AII A;  2C11 A;  3LML A;  3LZA A;  1Q40 B;  3ROB A;  2IA7 A;  1E3V A;  1DMN A;  3KII A;  5A0O B;  3DGM A;  1QAF A;  5CF2 A;  3G0K A;  2W03 A;  4J8T A;  1O7G B;  1RRL A;  1IK3 A;  2L4V A;  3B4O A;  3BB9 A;  3FF2 A;  4XB5 A;  3CCV 3;  4STD A;  1UI8 A;  2F98 A;  4LEH A;  3CCJ 3;  4IPB A;  3S5C A;  5AEU B;  4AKY A;  5EVH A;  3NHX A;  1JJ2 2;  3FF0 A;  3V92 A;  3BNB A;  2IMJ A;  1NB3 I;  1Q40 A;  3F8H A;  2CW9 A;  3X3X A;  2W9P A;  7STD A;  3TDG A;  2OWP A;  3K63 A;  3N54 B;  2E2V A;  1ROV A;  4LSO A;  4FMB A;  4KFD A;  2W2C A;  3EE1 A;  1YIT 3;  2B24 B;  1DVC A;  3K9M C;  3DGL A;  3JUN A;  8CHO A;  3CPW 2;  1UI7 A;  2XF3 A;  3UB1 A;  1HU9 A;  3G8Z A;  3SLU A;  2P0M A;  2BNG A;  4FMD A;  3CC7 3;  3FG1 A;  3V99 A;  4HM8 B;  4HM0 B;  4ORL A;  1OHP A;  2XSH B;  1M1K 4;  3CU3 A;  2Z77 A;  4MEI A;  1UW1 A;  3LTC A;  3EBT A;  1SJW A;  1LXE A;  3S29 A;  1QVF 2;  5D83 A;  4BTW A;  5IEP A;  3HII A;  1KSI A;  4EC6 A;  1G96 A;  3EN1 B;  4XBY A;  3FG3 A;  4HM7 B;  4HM4 B;  3PCS A;  1OH0 A;  3SXX A;  5CXO A;  2OTJ 3;  5IEO A;  3CCL 3;  1NB5 I;  1FGM A;  2W0Q A;  4L8O A;  3SX1 A;  3WOD G;  1N5P A;  3NBB A;  1O7M B;  2QGU A;  2YFI B;  1M90 4;  4FCZ A;  2O9U X;  4EV2 A;  3FLJ A;  5AEW B;  1M1X B;  1SQW A;  3GWR A;  5JBS A;  1A90 A;  2GBW B;  4Q53 A;  5ELU A;  1VQ6 3;  1IV9 A;  4N6L A;  4XM4 A;  3NM7 A;  4NHF A;  1DMM A;  1U8C B;  3EHC A;  3KE7 A;  5FW5 A;  2WOF A;  3I55 3;  1KWI A;  1IV7 A;  3NUV A;  1SPU A;  1N8R 4;  1VQK 3;  5IG0 A;  4OK0 A;  2Y73 A;  1A2V A;  1F8N A;  1A67 A;  5TGN A;  5KP3 A;  5AIG A;  1NJI 4;  4NRE A;  2CWT A;  1YGE A;  3QRD A;  1LVN A;  1GS3 A;  3VSY A;  2XSO B;  3MG1 A;  2HMM B;  5JPP A;  3FGY A;  2CFK A;  4LZI A;  3S67 A;  2LYX A;  2RCD A;  3G71 3;  2CFG A;  5AIH A;  1AV4 A;  3G6E 3;  4KVH A;  2CFW A;  2SBL A;  4OVM A;  1QJG A;  1O7W B;  1D6U A;  3NV0 B;  4R1K A;  1TFO A;  3GAX A;  3LT9 A;  4FCM A;  4K90 B;  4WWU C;  3CNX A;  2CFD A;  2GU1 A;  3AMO A;  4R9L A;  3U97 A;  3EN8 A;  2W04 A;  3Q1C A;  1GD4 A;  1O7N B;  5D82 A;  3UL6 A;  1VQP 3;  4EV5 A;  4WFO A;  2HMJ B;  1AVL A;  5IF6 A;  1FGT A;  2RGQ A;  3O8Y A;  2FNQ A;  3EX9 A;  4JRF A;  1JV2 B;  3PZW A;  3CCE 3;  1JRQ A;  5IER A;  1Y4K A;  4WYK A;  1UUW B;  4EYC A;  4MJD A;  3F7S A;  1E3R A;  3F14 A;  3MHE A;  4RNZ A;  3NV0 A;  4HJL B;  1RJO A;  5AYR B;  2HMK B;  3EBY A;  1YVB I;  3MKI A;  1K28 A;  1D6Y A;  1IDP A;  2YFL B;  3CCU 3;  2W56 B;  4AEQ A;  1OHO A;  4XDV A;  3B4P A;  3FKA A;  2K54 A;  4TX4 A;  2CG0 A;  3WMD A;  4HVN A;  4IT7 A;  4HM1 B;  4HM3 B;  2HMN B;  3JUP A;  4O3V A;  5ELJ A;  1OGZ A;  3OWU A;  2ML6 A;  1FGO A;  3K0Z A;  4MMX B;  5BXQ A;  1IT7 A;  1R4C A;  1NU3 A;  2IUJ A;  1TUH A;  3OV4 A;  2OQE A;  1VQ9 3;  2INX A;  3KN4 A;  2XFS A;  5D81 A;  3NM2 A;  1YI2 3;  2YFJ B;  3X3Y A;  1YIJ 3;  3LTD A;  3HIG A;  1VQ5 3;  1A2K A;  1DMQ A;  2QEX 3;  4U13 A;  2QIY A;  1QAK A;  1UUV B;  4KFF A;  4GL6 A;  1FA3 A;  3EJV A;  1OCV A;  1ULI B;  3KKG A;  3NXJ A;  1JB4 A;  1WNH A;  1VQO 3;  1Q82 4;  1MOL A;  3T8U A;  4CCV A;  2BMO B;  3SVA A;  2PZV A;  4R4K A;  3I56 3;  1J2B A;  2WGO A;  2WGQ A;  2KCD A;  3CCQ 3;  1WQL B;  4N3V A;  1OF5 B;  1W6Y A;  2WO0 A;  3DXO A;  2JQ5 A;  1W6C A;  1MNL A;  1RN7 A;  2BMR B;  1PFP A;  3NQZ A;  2BHM A;  1VZZ A;  3DGN A;  4N6O B;  1ISK A;  1W01 A;  4N6T A;  2MC8 A;  3DZL A;  2CG1 A;  4K61 A;  1GYB A;  3T0U A;  4CDL A;  4RZM A;  2OQE C;  4QWT A;  3IJE B;  1EQK A;  2UX0 A;  1OF5 A;  1HKX A;  1TIJ A;  4O2H A;  3QK9 A;  1JN5 B;  1JB5 A;  1O7H B;  1W6G A;  3IPT A;  4ZM8 A;  1FUW A;  3HZP A;  2P0X A;  3DGO A;  1W5Z A;  1Z1S A;  1SII A;  3ALA A;  4RBN A;  1DVD A;  2GXF A;  1JKG B;  1LNH A;  1TU5 A;  2MF7 A;  5LC6 A;  3DUK A;  5EQL A;  4R80 A;  1EA2 A;  2Y74 A;  5AIF A;  3OX9 A;  3HK4 A;  5I97 A;  3IMA B;  3VF1 A;  3NBR A;  3Q90 A;  2GEY A;  2P05 A;  3G4S 3;  1JNQ A;  3FH1 A;  2XGN A;  3DM8 A;  3N9H A;  4LGQ A;  1VQ7 3;  2CFL A;  1K8A 4;  4N6U A;  3NX0 A;  2ZL8 A;  3EQQ B;  5IG5 A;  2CHC A;  5FGO A;  3KZT A;  2D1W A;  3B8L A;  5LC7 A;  3E99 A;  3CCS 3;  3LTA A;  4LMI A;  1N8Q A;  3OXA A;  4KZ1 A;  4MMZ B;  5CK6 A;  3NBJ A;  1OGX A;  3NQY A;  4BTX A;  2Z7A A;  1OAC A;  1W7C A;  5BVB A;  3WA2 X;  4N6M A;  3MG2 A;  1NO3 A;  1ZX2 A;  1OPY A;  3F40 A;  1TFK A;  3OWY A;  3S28 A;  3PCR A;  1Q81 4;  5IG4 A;  1NDO B;  3VGN A;  1Q7Y 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...