1VQMI

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqmI00
3G6EI 2FOWA 1S72I 3CF5F 1QA6A 1VQNI 1YJNI 1VQ4I 1Y39A 2QA4I 1YHQI 1VQ6I 2E34A 2E36A 3CCMI 1YJWI 3PIPF 3J7ZI 4IOAF 1YJ9I 2OTJI 3PIOF 3CCQI 1YIJI 5JVGF 2ZJRF 3I56I 3CD6I 1YITI 2QEXI 4IO9F 1HC8A 5GAEJ 1VQ7I 1VQKI 1ACIA 2NXNB 3CCVI 1VQPI 2OTLI 3CC2I 3CC7I 4UY8I 3G4SI 2ZJQF 3CCRI 1VQLI 5GADJ 5GAGJ 5GAHJ 3I55I 3CCSI 4V19K 2K3FA 5DM6F 3CCUI 1MMSA 3CCEI 3CMAI 1VQMI 1FOWA 3CC4I 3CMEI 3DLLF 1VQ5I 2H8WA 2ZJPF 5DM7F 1FOYA 3J7YJ 3G71I 4IOCF 1VQOI 1YI2I 3CCJI 1VQ9I 3CJTB 2JQ7A 1FOXA 2E35A 3CCLI 1VQ8I
chains in the Genus database with same CATH superfamily
2RKHA 2RV8A 5H6RA 4EM2A 1JI8A 5ILUA 5DEQA 3S3NA 3H36A 4OMZA 3RJPA 1BIAA 1R5HA 3PSIA 1S7AA 4C3HJ 3ZQLA 4IEJA 3H5RA 3FXJA 4XIDA 5FROA 3K9TA 3HHHA 5J3LA 1E2XA 3U9GA 2RGVA 2HOTA 1SAUA 3GEZA 3HOZJ 5KHDA 1I1GA 3VDXA 2EFNA 2MABA 2EBIA 4XR6A 1DGWY 3DQVC 2CO5A 3TOAA 2VT3A 3HZJA 4L5JA 1YS7A 2Y9YA 3WTSC 2EZKA 3DEUA 5AIPA 4AVPA 2PLYA 3DXJF 1D5VA 3E6MA 2X4HA 2QF7A 4BAYA 3AAFA 2HEOA 4OIPF 2XGDA 1YJ9I 4M73A 1ZN2A 3F23A 1A35A 1ERDA 3I4NJ 1QPIA 4LITA 3RKYA 3E7LA 1ON1A 2J5PA 1IJWC 5IT3A 2EZLA 2R92J 4KJZA 2VN2A 1ORKA 3H9QA 4ZTJA 4XRSG 4FASD 1WZ2A 2VKHA 3Q0VA 2M7AA 3S1NJ 1I50J 1FOYA 2XSJC 1MJBA 4M3DA 3CCLI 4CA0A 1KA8A 2FX0A 3G1OA 2E34A 4F93B 1LE8A 3HIFA 5L3EA 2OTJI 3BG6A 3HBLA 1XSXA 1ZRCA 3FM3A 5TISC 2QBYB 4UVBA 2BEOA 4NDLA 2FQ4A 2OD5A 2JT1A 2E5ZA 4M3EA 3U2RA 1J59A 3OSGA 4UB8C 3HSRA 5D4SA 3MEXA 3J7YJ 1Y56A 3FDYA 3BJ6A 3FX3A 3G2BA 2JUGA 2E35A 1I39A 4KIBA 1T39A 3F8NA 4Z2YA 1FSHA 2JUCA 3M1EA 2L3DA 1YHQI 1JUMA 3S16J 4H4KC 2KRHA 3BZCA 3QYEA 3BR6A 3L2CA 2PJRA 3UR3C 3L1PA 2DMPA 2CH0A 5F0HA 4PJMA 4UUTA 2H94A 3LSMA 5JHUA 3CLQA 2PMZN 3WTXC 1S6LA 2E60A 3SZGA 3U1DA 2EFWA 4U0YA 2V9PA 2L4MA 1K61A 3F6VA 1R00A 1ENHA 1FC3A 4UUSA 2V9KA 2XPWA 3KLNA 1SFXA 4QLCU 3PUBA 1UELB 3LA7A 2GXAA 1QVUA 4GRIA 1S7EA 1XC5A 2PMZA 5BNGA 2XDVA 1HQCA 1J5YA 1TTYA 1YW9A 2QENA 3GFIA 1S29A 1JT0A 4HRIA 2E1MB 1JTXA 1YRNB 5IPAA 3IHUA 5GAHJ 1FY7A 4HF2A 3S1RJ 2DDAA 3CZ6A 3CP8A 1Y0NA 2VJJA 2KDZA 4WXCA 2F4MB 2MGQA 2Z3YA 1XTAA 2B9SA 1WQ2A 3NQOA 2ELKA 1FMVA 2WAQA 2AQEA 4M72A 1D8KA 3N97A 1HSTA 4RGSA 4HA8A 3HXLA 3PFYA 5FKKA 3RSNA 1MMNA 1UZCA 4ZDOA 4KFCA 1LDJA 5LFAA 4EVIA 4A3MJ 3BR2A 2FBIA 4U0WA 3NWSA 2W57A 4AC0A 1RUOA 2ZFWA 2I5UA 2VXDA 4YIRX 1I6HJ 2NS7A 2W84A 4CCJA 2BVLA 1V3FA 5J40A 1NTCA 2PQ8A 3A2KA 4CICA 2JRTA 3FHZA 3BPXA 2P4WA 4QIWN 1PDNC 2LF7A 2RVCA 4YFXF 5E8GA 3GZNB 3ZQGA 3J80K 2NVTJ 4A3DJ 3M8JA 1LNWA 2IJLA 2MD5A 3BLYA 1PUEE 1H89C 2E1OA 4JOMA 2K86A 2AXTC 5FGMA 1WHUA 1G3TA 1SFUA 3LFKA 1BI1A 5D8KB 3RKQA 2K4JA 3SEQA 4F7ZA 5A2QZ 1WJDA 5FKLA 5KK1A 2CGPA 1TWCJ 2HVSA 4UNOA 4XLPF 2JWTA 2OCEA 2V1DA 1X1DA 2XRNA 5D8LB 4RLFA 1B9MA 1E0EA 2M34A 3F3XA 1ZARA 3A03A 1HC8A 3RPUD 1LJ9A 2Q0OA 1BJZA 3DPLC 4UVAA 3LAPA 4EGZA 2DQLA 2BY0A 1QHGA 1YX5A 4JBAA 4KN7X 2FXAA 2G9WA 4KITB 4FCYA 4TV7A 4KA4A 5E18F 2ZXWH 3EUHA 1W7PD 2XV4S 5D5WB 3LSIA 4MHGA 3BR1A 2JA5J 2PJPA 4XLCA 3GCMA 3DLAA 1RR8C 3T8TA 1YITI 3FXRA 5DCFA 3TO9A 1OISA 1T33A 2RN7A 5K5RA 2R5YA 1ETKA 4E7HA 3I0TA 1LEAA 3DCFA 3ZN1A 4BKXA 1GHCA 4L18B 3L00A 4IPAA 2XHKA 3K4JA 3FWEA 3RDIA 2KFDA 2QQBA 4CGZA 3C2HA 3ZGKA 2DPUA 1F43A 3C1DA 4CHUA 4DGWB 5ED4A 3P9CA 4M6VA 2E7WA 2LFBA 5DD8A 4F92B 1Y39A 1Z9CA 4ENJA 1IXRC 2OBPA 3ESWB 3MN2A 5HDNA 3ABUA 2VASA 2WY8Q 1KU3A 1RETA 5HS8A 5HLTA 4KUMA 1P6RA 2CV0A 1R5ID 1M1EB 1Y8RB 1ZELA 1K78A 1FBUA 2DI3A 5LD2C 3H0GJ 4U88A 1AWCA 2O3FA 2OPTA 5FKOA 4A0YA 2A61A 4BE1A 4NB5A 1ZG1A 1U5TB 1R9TJ 5CQEA 1V55H 2HYGD 2BHYA 2YPRA 4OMYA 2IS1A 2E2JJ 4LB5A 1YYVA 1XS9A 3CO7C 2XB0X 3TDZC 1LVAA 3HGGA 3MWMA 2QVOA 4ITVA 3T0YA 1V5GA 1Z05A 4YELA 1TQIA 3PNTA 2IGNA 2VC1A 3BZKA 4LG0B 1OYYA 2R93J 3FMSA 3VOEA 1FP1D 3T5XA 1RKTA 2MW8A 1UG0A 2EILH 2VJ4A 1YI2I 3C2GA 5LEKA 3DKXA 3LSJA 4G7HF 2Z16A 2GZWA 3IRRA 4ZYAA 2E2IJ 3F8BA 4RLQA 1LDKB 3WGHA 1ZREA 5B3SH 4O5VA 1MMDA 1ZG3A 5CPRB 3JTGA 5FD6A 3VWBA 3PSFA 1BA5A 3M9AA 2VB6A 3HPGA 3LFUA 2XPUA 4ENNA 3G1LA 4RGXA 4XOTA 2OF7A 5LHGA 3DP7A 4XK4A 5J1RA 3K4BA 4GGGA 1OMIA 3AG3H 5H6QA 3M7GA 4MO7A 4NQWA 2VE8A 1P4AA 2VE9A 1NH3A 1ZHFA 3CCSI 1S8NA 4G12A 2ZO4A 1Z67A 3EUAA 4IQ4A 3RPUA 2O0YA 5F1RA 4S05A 4BBSJ 3M8FA 3PQJA 1UAAA 1MSEC 1JUPA 3HB9A 1EF4A 2LLKA 3K2ZA 1D0YA 3K1NA 5J4VA 1HDDC 2DN0A 4A93J 1YQAA 1IRXA 1D8JA 3LSGA 3SDGA 2P81A 1BOBA 4AVZA 1W7PA 2K4BA 2ECBA 2R7DA 3TOBA 4F55A 4HEA2 2J5OA 2HQRA 2HTSA 1NK3P 3GTKJ 3DPUA 3B02A 3ZMTA 2L7FP 1X4OA 5FJ8J 3M07A 2A6HF 1WKMA 1WJCA 4HV6A 5F0CA 2R7XA 1RC9A 1H9TA 2KP6A 3IWFA 5KCMA 2M3AA 2MSYA 4D7MA 3L9FA 1R4NB 4CYDA 1Z0XA 1IRZA 4NBQA 5M3FJ 1CF7A 5JVGF 1ZQ3P 4JQFA 2QEXI 2I10A 1U8RA 3GZ5A 5CKTA 4AWXB 1OR7C 1EH7A 1EH6A 1G3YA 2ETHA 3BROA 3F9KA 3M8EA 2AS5F 2JA8J 3WU1B 1BW5A 1MDMA 3JTHA 1I3AA 1TW3A 2AO9A 2VOPA 1EH8A 2PFBA 1HBXG 3BWGA 4G6DA 3HL2A 4IHVA 2MLKA 1VF9A 2V1XA 2ZNZA 3NARA 3I3LA 3IH3A 3S17J 3QPHA 2FNPA 1K83J 3ZQQA 1OCTC 2DMQA 1SVLA 1HLVA 4UY8I 3BR5A 3TDUC 3BT9A 1UB9A 1O57A 4NUBA 3ZMDA 1Y0UA 4FETA 2H09A 1P9QC 4L9JA 2HWVA 3ZQIA 1IO2A 1W36C 3PM1A 5CVJA 3MZ8A 2FQ3A 5ILVA 2FD5A 2F5VA 3DWLE 5C4XJ 2IA0A 2LKSA 1ZTRA 3K1PA 4MTEA 3AG1H 5AONA 4OIOF 1F4KA 1T0FC 3FBIB 2DODA 2CUJA 4V19K 1LFPA 2DA1A 2DFFA 1OCOH 2M45A 2FMYA 2ZCWA 4B44A 2XSDC 2V1UA 1T98A 5LGUA 4OWRB 3WGGA 4F91B 3VPRA 4PFPA 3X2QH 4EJVA 3CF5F 1D0XA 2K02A 1SANA 1R4MB 5C4JJ 4NC7A 2R7UA 1YIJI 1YOVB 2KIQA 2QQAA 4LLNA 2HPIA 3P5JA 1ZAOA 1VQKI 2W85A 1OLTA 4CUGA 5E3NA 1J2XA 3BG3A 2VXZA 3LOCA 1Z7UA 2A05A 4MGRA 3LA2A 2D1VA 2JA6J 2L9NA 2VL8A 2LVSA 2ZMEA 3HRUA 3NAUA 2HOAA 5HDGA 2ESHA 1I1SA 4A6DA 4LFUA 2DFIA 2UXXA 3FBNB 4D5CA 2Z2SB 2KJCA 3VYTB 4IQJA 2IS2A 1GV5A 4LK0F 4CCNA 5LGNA 1FYLA 4BJ6C 2H27A 1XMAA 1VQ6I 2P6SA 1L0OC 3GWZA 1FLIA 4X1EA 9ANTA 2KJBA 1REPC 3R61A 2R0QC 1WI3A 3KP7A 1Z3YA 1VTNC 2O8XA 2GBYA 1TWHJ 4AU7A 3PFIA 2UXNA 3CCRI 3BC8A 1SFKA 4N4NB 3B6AA 5DCMB 3S3MA 2LYCA 3GFJA 1XD7A 2V26A 3CP2A 4AIJA 5F08A 1JKRC 1K78B 3H3UA 4HSTA 4RM3A 4L5IA 4AIDA 1ZG5A 1BI2A 3IWZA 1QZZA 1MH3A 1XGOA 3UKGA 2D5VA 2A69F 2O9LA 4ZTFA 4G94A 4I6ZA 3H3VK 4I09A 4RB3C 3S8PA 4A12A 2KIUA 5EZGA 3J81Z 1QO0D 2GWRA 1XCVA 2UUZA 5K5QA 3HG9A 1IG7A 1MMAA 2HVQA 2YR2A 3HHGA 2NS0A 2Y9ZA 2DT6A 4I7HA 2DJIA 4U87A 2X51A 2BE5F 3KE2A 2IEKA 3JR9A 2QCOA 4A3KJ 2Y0MA 4CYCA 2MA3A 1FT9A 2Q2EB 1VQ4I 4XORA 1U78A 3I59A 1B1BA 2L7ZA 1STZA 1X58A 2FOKA 4YFKF 4GDFA 2W00A 2K7LA 4XLEA 4Y13A 2EINH 4IZZA 3P9IA 4BE2A 3WGIA 1D0ZA 1ETWA 4HPQA 3I5UA 4QPQA 4M71A 2CQKA 2LREA 1TNTA 4ASNA 3Q0WA 1RKWA 4Y33A 1JXSA 3OYJA 3D5SC 3QOPA 1QHHD 2VQCA 4KICA 3TO7A 1J9IA 1QGPA 4M74A 1ETYA 2P5LC 1B9NA 2HDCA 2A68F 3H35A 1DP7P 2IA2A 3ZQHA 1WH5A 3TL4X 4KIGA 5BPDA 3EYIA 2NVUB 4AIHA 2BXZA 2H6BA 1FIPA 5CLSA 1VZ0A 1XDSA 4PGGA 4KMFA 2VLAA 1R6RA 4F3QA 4EM0B 1LFBA 2L01A 3CJRB 5A2QK 3OYMA 2NVXJ 5CQGA 2G7HA 5D5UB 4EEFG 3DEWA 3BR3A 3NRVA 2E5NA 1X1AA 3O8GA 5ICFA 1S72I 2EV0A 2QQ8A 1BN5A 2M8EA 2QQ9A 3OL4A 2IT0A 4P1WA 4M3BA 2HKOA 1R58A 3IH2A 2CUZA 1A36A 3RTRA 3FKJA 4IHSA 1DDNA 1VQ7I 4PJLA 2W25A 2DPDA 1O7LA 4WXDA 2VQGA 3ZR8X 1U0JA 3KP5A 1PYVA 3VSLA 1TBXA 4WX9A 2KZVA 2RC4A 2EH3A 3KCCA 1DP3A 1XCBA 3LNQA 4BQAA 4R79A 2RNJA 2BZTA 2P8TA 5DYMA 5J47A 2CRGA 1ZR4A 1F9NA 4BUPA 4HW0A 5IT9K 1UMQA 1O3TA 1P92A 1IXCA 3H0DA 1SVMA 4HQMA 2QWWA 4E4HA 3IKTA 1TW2A 5L3GA 2W24A 3G4SI 2MBFA 1U6GA 3KIOA 3S15J 2YS9A 3EUKL 1HXDA 3TO6A 3CMAI 2XASA 2RREA 4DYQA 3GFLA 3JCUC 2UZKA 4PUSA 1X1CA 2KLOA 4OIRF 4ZYHA 2HFHA 4XLFA 5LHHA 2HDWA 1NHAA 1B72A 2XPVA 5EF6A 1LQ1A 1J75A 4XN3A 3FXKA 5BPIA 5E1WA 2NXNB 1K6YA 1X3ZB 4RS8A 2DT5A 3LSRA 2XAUA 3HC7A 2ICWG 5L3BA 3LSTA 4IJAA 4Q4ZF 2EPFA 4A5NA 2AHQA 4EJWA 4GCVA 4M9ZA 1SAXA 1IW7F 5H20A 1BR2A 2DK5A 1MDMB 4JX6A 3HSFA 2ELJA 2HPMA 3MAJA 3JAMZ 5TGTA 2VIXA 1KQ9A 3V7RA 4CO8A 1YTYA 1ZKGA 4PK4A 3GO5A 4HV5A 2H1LA 3N05A 3OOUA 3PIOF 1P7JA 2FA5A 1A04A 3ZQ7A 3FHNA 1R36A 1R71A 2LF8A 4W97A 1OCZH 2DMUA 3I59B 5EYRA 3CCVI 1I6XA 3MVPA 2FU4A 4HDVA 4A0XA 4BGDA 4YG2F 4XL9A 2LKPA 1SMTA 1SMYF 1W5TA 5F04A 3TBIA 1ZRDA 4L0ZB 2PI0A 3TMOA 3RQ4A 2DMNA 3I64A 5IYBJ 5K1YA 4GYIA 3QQAA 2CQ7A 1HSJA 1FTZA 2EFPA 4HDUA 4OAYA 1B6AA 3TW7A 1HW5A 3CCMI 3E5UA 1MBKA 1LVKA 1FPQA 3RIRA 4S04A 3DV8A 3TP0A 2FRHA 3SFIA 1OJLA 3BTJA 3GUDA 4Q47A 4M3GA 3K4LA 3S3OA 3IL2A 4BNCA 5HNHA 3DFGA 3CCEI 4AYBA 2XAHA 2GAUA 3G71I 3FKIJ 2CYYA 2X6WA 1D5YA 1JE8A 4HYEA 1OCRH 2MH2A 3HKZN 2OU2A 1N78A 1MBJA 2HI3A 2JVHA 4LG3A 3HOWJ 3TQNA 3E3VA 3DKYA 3I56I 4QWQA 4ESBA 2W48A 2D1HA 2L9SA 5KVRA 1LFUP 3HJEA 3KLOA 1LKXA 2VBXA 1IN6A 3RZOJ 2JPBA 3E5XA 2F5FA 1FTTA 3ZPLA 1MJ9A 2DXIA 3NWTA 2FF4A 5GP9A 2DYRH 2LR8A 2PX9A 3KFWX 3R0AA 5ICGA 2QGUA 1A6IA 1U9OA 3GBGA 3ZP5A 1XDUA 2DJNA 1DUXC 3VB2A 3PL8A 2Z33A 1YLFA 5F1JA 4RAFA 3KYLA 3B73A 2NNNA 3HOUJ 2GIZA 2XGCA 1G8XA 2HS5A 3CCQI 1ZYRF 5KNLA 3MZHA 4E7IA 3F0CA 1F36A 1XMXA 3P9KA 3Q5FA 5IT9Z 4E7ZA 3WTYC 3BTLA 2NYXA 4BXXJ 2EQRA 2M4GA 3SXYA 3G1MA 3KZIC 3K69A 1FOWA 2JTVA 3CUQA 5HLHA 4B48A 3OYCA 2D45A 2PN6A 5CVIA 3BQYA 4PJ0C 4W1UA 1K6OA 4A3GJ 2NVQJ 4A3LJ 1ZLJA 4BHBA 1PP7U 5LRSA 3RKWA 1W5CC 4LLGF 2ME6A 2CG4A 2HQ5A 3IUOA 1IAWA 4H0EA 2KPMA 2LY1A 3QWLA 1FWZA 2YU9J 1YW8A 2XAJA 1VI0A 3FXQA 2CW0F 3QPLA 2Q2EA 1ZGWA 2NOGA 1H9GA 4DYCA 2RQQA 4ZDPA 3OYKA 4B3AA 4HF1A 2UWMA 2ISYA 3Q9VA 3BDDA 4BQNA 4A3BJ 3Q3SA 4I02A 2IAIA 3VFZA 4DBRA 2LK2A 3CJNA 3V8LA 1X3WB 5JI6A 2DFHA 1YFHA 4UVCA 3ZRGA 1Y6IA 2GA1A 1AHDP 3JRDA 4I01A 4J00A 3RPQA 5LLQA 4MFDA 2MH9A 2OA4A 1OQYA 3OS1A 2EZIA 2L9VA 2JA7J 3HPHA 3CESA 4IX7A 4FISA 4BACA 4E6KG 5E79C 1Q1VA 3VEPA 1MBFA 1BR4A 3OY9A 1KYZA 2QSFX 3M4OJ 3S14J 3CJTB 2IP2A 2M1BA 4IXAA 3W2VA 5E8IA 3JRAA 4A3IJ 4BE0A 1TZLA 4JYKA 1XMKA 2QA4I 1WGXA 3RZDJ 3WTVC 1KYWA 4RB1A 1XGNA 2HQNA 1YE9A 2VPLA 1OFCX 1TQPA 5ICCA 2EK5A 2OC6A 2O6GE 2VI6A 4XOPA 1KQ8A 1MKMA 3EPZA 2M7BA 1H8AC 2KT0A 3VYSB 2K3FA 5IY5H 3OYFA 4K2EA 1HKTA 2DOFA 2MD0A 1ETVA 2VBZA 3I58A 3JRCA 1FOXA 2HVRA 3CF2A 3E6CC 4B8XA 3HOVJ 4G8XA 1HA8A 3H9JA 4XN0A 1GVJA 2ZJ2A 1GXPA 2A5YB 2VKEA 3V8KA 2X1EA 4RAZA 4D0PA 1UCRA 5H2FC 1J0RA 2BVMA 5GAEJ 5BS6A 3KP6A 3QAHA 4QPOA 5FKMA 3HYIA 3F21A 1P2FA 2FMLA 3KEYA 4HX8A 2D2WA 5FD5A 5HLGA 1ODDA 2LMDA 3W6KB 5M5WJ 3AL0C 2FOWA 3LA3A 2CQNA 1TWGJ 2DFEA 5HVQC 2DYSH 2HOEA 2WTEA 4LD5A 1O3SA 5TJJA 1ITYA 1WJ5A 4UV8A 1F5TA 4D5FA 1W36D 4JX4A 4XRSA 3O3KA 1UHWA 3DU5A 2HYFA 1MJAA 2C6YA 2DA2A 1YG2A 1XPXA 3K4MA 3MZYA 4O3MA 4V2FA 3GLLA 3FF5A 1I3QJ 4XBFA 4A5MA 3QRFF 2H8WA 4EJOA 2AXLA 4E7LA 1DGRM 4J19A 3R6SA 2WV0A 2K27A 4LB6B 3RYPA 2EV6A 3OIPA 1PUFB 3KETA 5M5XJ 3E5QA 2K9MA 4D1QA 4LIUA 4EJUA 4FX4A 4RAYA 2L2OA 2WBMA 4OINF 4NC8A 4DW6A 3CC2I 5JLXA 4HNVA 1G6NA 4A2UA 2CFXA 5E20A 4BJ5C 3LAJA 3V7CA 4WXHA 2QM3A 3L09A 3ZOBA 2ZJPF 1OYIA 3MKLA 4OAZA 2XKOA 4N9IA 5M5YJ 2DT7B 3CDIA 1E3OC 2PJRB 1FBQA 1TLHB 1FNNA 2M87A 1EKEA 1MW7A 1U5TC 2ESNA 2CJJA 2IGOA 4XRFA 3HTSB 2NS8A 1KGSA 3WG9A 3A1YA 3KYDB 3J7ZI 4LGWA 1WRJA 3MKYB 4CZZA 5GPCA 4PGHA 1V54H 3RI4A 4LJZF 2KMUA 3SHFA 2F5EA 3OYDA 3HUGA 4IKFA 3BR0A 1FP2A 2LOOA 2A5WA 2QLZA 3DF8A 4OU0A 4RMNA 3HOTA 4BS9A 4LOCA 1WH7A 2CV2A 4AM3A 1EA3A 2DLLA 4KISA 1T6SA 4CYCB 1KU7A 1ONVA 4ZC3A 4L9NA 1RESA 1X1BA 3BG5A 1IF1A 1D1CA 3DTKA 2COBA 1T56A 2R5YB 1GDTA 2X6OA 1QRYA 4PFOA 4ABZA 2F48A 3SYTA 5J1UA 1AKHA 3ELKA 3ZQFA 2QBYA 2F6CA 2ZMEB 3IV5A 3I54A 4G6QA 4PCQA 2RAEA 3H5AA 2R5ZA 3OSFA 5BQTA 2XRLA 5LRRA 1HOMA 4IRIA 4RBOA 2KL4A 1BI0A 4N0BA 4WF2A 4DNCA 3ZMVA 1AKHB 4EATA 4UV9A 3CUQB 2JQ7A 3OMYA 3JRBA 2VONA 4RAGA 4I2OA 2KQRA 1VQNI 1YJNI 4BXUA 2OQRA 1IXSB 1TWFJ 3ECHA 5FKNA 3GYHX 1FSEA 3QYFA 1FOKA 3WE3A 3FM5A 3RQIA 3O8HA 5J4YA 2Q8KA 3K2AA 1RUNA 4PJNA 1E3PA 3L2QA 1SC7A 5GTHC 3GTQJ 2P5VA 4IL6C 4KDPA 2R5ZB 2LH9A 3DPTA 3EDPA 4NNJA 3DTIA 1QVTA 5HLIA 3K1MA 4ESFA 1LDDA 2BHZA 2JMWA 2ZBKA 3LSHA 4P9UA 3F22A 1WJFA 3K7AJ 5FLXK 2IS6A 4DBQA 2BBYA 3KP2A 3COAC 3VSKA 2DOEA 2K9SA 3JRIA 2WAFA 2ELHA 3PUFA 2YX7A 3CTAA 4FT8A 1MH4A 2VT2A 4HZFA 2DAOA 3QODA 1QZEA 3BQZA 2GOMA 4ZYGA 4DIQA 4AUXA 3WTUC 2CV1A 2R7QA 1Y8QB 4P5OA 2Y31A 2CW8A 2M0MA 1T8IA 3JSOA 2GXGA 2BW3A 3K4CA 2F5CA 2AQFA 1WSUA 2OJED 1U5TA 3BZ6A 2KHMA 2DQRA 2P0WA 2R7FA 3E97A 1JTYA 1ZLKA 3GMEA 1MNEA 1ETOA 2NVYJ 4BXFA 2DU9A 2VOOA 1MD0A 1YJWI 3KZYA 4RA2A 1HKQA 2QKLB 3ONQA 3L2UA 1RI7A 1MMGA 4B47A 2LC2A 3ISPA 2LRDA 3OYLA 4XKBA 1XB4A 3HRTA 2R7VA 3O6BB 4M6YA 4Y7NJ 2EIKH 2ZXJA 3C2BA 4C30A 4LIVA 3SDBA 5F27A 2P5KA 1BBYA 3JRHA 5JVTA 1QA6A 2LDUA 2KIMA 2MFZA 2JA2A 4JX5A 5EJCA 1DPUA 1ZK8A 3HGYA 3MFKA 2HR3A 5IYDJ 4MEYF 1FEXA 5B66C 2HGCA 2HQAA 5CVVA 5HS7A 2CSOA 2JJ7A 4II2A 4ESJA 2BY3A 2V7FA 1MGTA 2WAQN 1S9HA 4LMYA 4JP0A 2VKVA 3CQZJ 1N75A 4BQQA 3OS2A 3LQRA 4BY7J 4GYGA 4L9TA 3DLLF 1X2NA 3LMMA 1XN7A 2R4GA 4AD9A 1WVRA 2DTRA 2IRFG 1OYWA 4AYBN 2QZ8A 3T8RA 3OR2C 4CCOA 2M30A 1PP8F 5CYVA 4IRHA 2ZNYA 1XGMA 3MKWB 4I98B 2L7KA 3C3WA 3GTOJ 2OQGA 1F1ZA 5DDGA 3V8JA 1SFEA 3R60A 3ZN0A 1O4XA 3DKWA 2M8GX 3OYGA 1Q1HA 4ENMA 3K4KA 3WG7H 1Y1WJ 2K85A 3VYRB 4BH9A 1BR1A 4RM2A 3HRSA 3H1CA 3ABLH 1MNDA 5TRDA 1USSA 1VQ9I 1QU3A 5K7FA 4A69C 2EJRA 4GO1A 4G9YA 1N25A 2VQHA 1ULYA 4XNFA 5EEHA 4MEXF 2IA1A 3ZQCA 3BG9A 4D7NA 4NC6A 4HQEA 1B4AA 1WI9A 1IV6A 2BOLA 4ZH4F 5J8FA 2V9VA 3QP5A 4KN4X 4XSZF 2FBKA 2M9HA 1E3HA 3V7SA 4M9XA 3MQ0A 3ABKH 5JHFA 2DTZA 2OZ6A 2R7SA 3WHBA 2NOJB 2HKXA 2LNBA 1SEUA 2R7TA 3F72A 2DA3A 5D5XB 3G6EI 5IP9J 3TEDA 2X1CA 3HOYJ 4LG0A 3KP3A 3KZZA 3JRFA 1IN8A 1YIOA 4MQ9F 1KU9A 4XKVA 3LSPA 4DJAA 2TDXA 1TP4A 2H1KA 1JJ8C 3QU3A 3PNVA 1K7AA 1J7KA 2ZXHA 3R4KA 1OR7A 4FTHA 3ZXSA 4A3JJ 1JJ6C 2UV1A 1VNDA 3DU6A 5FO5A 3GVAA 4HSRA 4E70A 2RQPA 1AA7A 5GADJ 3K0LA 4ZZDA 4MTDA 2KRCA 1G3WA 4XM3A 3OYBA 2IGKA 2CMPA 5EEGA 3KP4A 5CVRA 4PSWA 2HOSA 3U21A 5KAIC 1X2MA 1HF0A 3UNGC 1HCRA 1XX5A 3SZPA 3GTPJ 1NG7A 1SD7A 4KT5C 2VODA 2EFQA 1BIBA 3F8MA 3WODF 5EDNA 2G7UA 3Q0UA 4Z6YA 3SQNA 2ACJA 2R7ZJ 5LBQA 3S2DJ 2K9QA 2DMTA 3OYAA 3ZMZA 3GZ6A 2ZSIB 5DTDA 2HTJA 2HNHA 4X6AJ 1D1BA 2KDOA 1T38A 4IVNA 3TP3A 4UUSB 2A07F 3PO2J 2XROA 1EV7A 4C3IJ 4HNTA 3GTGJ 2E1MC 3A0HC 2L9RA 1S5LC 1TT5B 3SEZA 2B63J 4EJTA 4CZCA 2W4SA 3BCBA 3QPTA 1CF7B 3CJQB 3D5RC 2HYJA 1JGGA 3S1QJ 4HNUA 3M3YJ 3PNYA 2TCTA 3G73A 2CQXA 2VUMJ 3OIQA 3GF2A 2DA7A 4CXFA 2LBFB 2Q1ZB 3ABTA 4Y17A 1SD4A 2P6TA 4I99C 3GTLJ 1JHHA 3BJAA 4RGUA 2ZFUA 2M0CA 5C3EJ 1IRGA 3FXUA 2V79A 1K4TA 5LHIA 2DO7A 4B43A 4B4CA 2E7XA 1RPWA 2ZXIA 1GT0C 2XF5A 1ZGJA 4A3FJ 2LG4A 3VODA 1LE8B 3RYRA 3GTMJ 1U2WA 2DK8A 5F64A 3FIWA 4MFEA 2WB1A 2HXOA 2X6YA 2P7CB 4Y4RA 2Y69H 3WTZA 4C2MJ 1ACIA 2LKXA 2WY7Q 3E0JB 1E17A 3FXLA 2JK3A 1VQLI 3AFHA 1UG2A 2EIMH 2ME0A 4UUVA 3A01A 1NG6A 1MBGA 2PEXA 5DM6F 4BU2A 1VQMI 1SFOJ 1H0MA 4OIQF 2CU7A 4FE4A 3HEFA 3CMYA 1R1TA 4HLXA 3JAMK 2X0LA 3BY6A 2FSWA 1DQUA 2XGEA 3FMQA 2IGMA 3W6VA 2DA4A 3WU0A 2ZC2A 2WA0A 3NEUA 2FEZA 3C18A 3GTJJ 4BEHA 1AU7A 2KZGA 4IF4A 1FJLA 1R7JA 2JVGA 4HAMA 3K70D 2WC2A 3KEQA 1VFCA 2PBIA 3EQLF 1XSDA 3Q9SA 4JK1X 3DBHB 4C3JJ 2W1OA 5JLWA 5EGOA 2CQQA 3WE2A 1BL0A 4ZDLA 2IW5A 5FFXA 4BEHB 5LEJA 1JKOC 5DM7F 2EA4A 5B1AH 2VC0A 3FXMA 4BY1J 2W7NA 3QPSA 4XONA 5EG0B 2FUG2 3ASOH 2BY1A 4PJJA 4YEJA 4S0HB 3I9V2 2X1DA 4V2GA 2IBDA 2LP0A 1P4XA 4YRVA 1GVDA 4XLHA 2IPQX 2K9LA 2F4IA 1IUFA 5LGTA 3F8CA 4U7DA 1RNLA 1G59A 1HW1A 4RB2C 2PMUA 1MMSA 1RZ4A 5B5EC 4MLOA 2Y48A 3L2VA 2O5RA 4II3A 3F6OA 3U1KA 3D1NI 2LD5A 2CFOA 3S32A 5E3MA 4R1HA 4PSXA 4GXOA 2JN6A 5GPAA 5KAFC 1A5JA 3FXOA 2OUMA 3LQQA 2DCEA 1QQIA 1X1PA 1W4MA 2L5QA 3GW2A 1X19A 5EEAA 2VQLA 4IHTA 4R8HA 3L2WA 3BP8A 1BOAA 1JUSA 3E1SA 1IRFA 1FBSA 1U9NA 1XSVA 2X9DA 1V5FA 2L54A 4CCMA 2L02A 2ZSHB 4EMSA 1MIJA 2PMHA 1YS6A 1A6QA 4IRGA 3CCJI 4ZYEA 1I5ZA 4YIIA 4BYYA 2QSGX 4IHWA 3SZTA 2CUFA 3H9GA 2BXYA 1MNMC 5IYCJ 1TT0A 2BW3B 3S93A 2XUBA 4XKCA 1W0TA 5JR3A 1B8IA 2YX4A 2IS4A 4A3EJ 4FQGA 4HF0A 3ASNH 1R1VA 5EZHA 5CJ9A 4B3XA 1MSFC 1C0WA 2F2EA 2WAEA 3CC4I 1WFXA 3T1BA 2Z1DA 4PDKA 1LB2A 3OYIA 5K5OA 4A3CJ 4QTRA 4Q5SF 1GXQA 1CGPA 3S2HJ 2CW7A 5EGOB 2STTA 3PIPF 2VKDA 2V4JC 3IAS2 4G7ZF 1CQTA 3JRGA 1Z3XA 3S1MJ 1H88C 3GX4X 1FZPB 1DPRA 6PAXA 3MD2A 4D9JA 3JREA 2ZJQF 2ZB9A 4HX7A 4KNYA 1UFMA 2V6CA 4DYRA 3EYYA 2Z9OA 4F52A 2EB7A 2E2HJ 5BOXA 1LEBA 2EFOA 4X0GA 5E3OA 2EA2A 2YU3A 1J09A 3LWFA 3L2RA 1AOYA 1TNSA 1IGNA 1Z7LA 2JZYA 5ILSA 1W7PB 2HU9A 2XF7A 5D5VB 4EV0A 2XGXA 4AIKA 1Z1DA 2L4AA 1JGSA 3J7AO 5HDKA 1WJEA 2ADUA 4IO9F 1G2HA 3I4MJ 2KKOA 3J80Z 3HKZA 4WK8F 2OTLI 1JKQC 3AL0B 1IV8A 3I55I 5ERIA 4B1RA 4BDYA 4XRMA 4CSWA 2GLOA 3FZVA 1R23A 3K4NA 1T0FA 4HBLA 3CUOA 2JSPA 2PG4A 3V42A 3E6BA 2VBWA 5DD4A 1OPCA 2O7OA 2NAZA 3EUHC 1S7OA 3D0SA 1L3LA 2E1NA 4P96A 1OCCH 2F4OB 4IOAF 3IH4A 1KONA 3CD6I 2NNYA 1O3QA 1B59A 1YW7A 2ISZA 1HW2A 2K40A 4CH7A 3WU2C 1IN7A 2I8DA 2B7EA 1R22A 3OIOA 3ROUA 1LPQA 1JT6A 3CMMA 1D1AA 2FBHA 1U8BA 4KIFA 1YX3A 2CWEA 4UB6C 4ON0A 1T08B 2GIVA 2MC3A 3BCAA 1SVOA 1VQ8I 3GXOA 3CO6C 3OYHA 3WTWC 4FHTA 2Y30A 5E1XA 1GUUA 5JFRA 3W3CA 2BY2A 1IN4A 1OKRA 1V5EA 3OOPA 1QZYA 2RDPA 2Z5UA 2X48A 3OS0A 2HXIA 1TWAJ 3PQKA 4BHCA 1FIAA 5FFZA 2V1NA 5IP7J 4HX4A 1P4WA 2DW4A 3FK7A 3K6GA 2QUFA 2JPCA 4WCGA 1B72B 2EWNA 2XVCA 3D5LA 1G3SA 2H6CA 3R0JA 4ANJA 5ICEA 1Y1VJ 3RCOA 5L3FA 1R49A 5FRNA 2A6TA 2R7WA 1DU6A 1QNTA 4G6TB 1HKSA 3A4CA 4GFBA 3FMRA 5IP6A 3GFMA 1MBEA 4XICA 2EZHA 2XAFA 1RIOH 4A6EA 3BTCA 3H3ZA 1VQ5I 2O03A 5J8CA 1BC7C 2R3SA 4HG2A 4ETSA 3N4MA 2ZMEC 5FRMA 3IP4B 5K7ZA 5DV5A 1BM9A 2GOXB 1QBJA 2V6EA 3IKVA 5J1YA 4LLLA 3GLXA 1Z77A 2O61A 3CDLA 4Y52J 2XAQA 2EIJH 3CC7I 1IC8A 2WADA 3M1CA 2KRFA 3IRQA 4QSHA 1ZH5A 3A01B 3ZMUA 5C44J 3F8FA 2VJ5A 3CMEI 4P55A 3OYEA 5HOOA 1JHFA 2KIFA 2TRTA 4XSXF 3HDDA 4XLAA 4YFNF 5IOZA 3HRMA 2CS3A 2E71A 1K79A 2VJIA 2E1CA 4Q48A 3VYUB 1R5GA 3KPHA 2BGCA 2RNGA 4M9SA 1Z91A 4MIMA 5HODA 5DUIA 3O2PE 3CLOA 4YIFA 4XQFA 1UJ8A 5DUKA 4XMYA 1I27A 5J6XA 1WJBA 1FYKA 1N77A 3G3ZA 2K9NA 3QU6A 3KYCB 3BPVA 3C7JA 4EGYA 3B6CA 3CCUI 2FE3A 5DS9A 4WWCA 4M6XA 4NQWB 1BJAA 3QOEA 2QYOA 1HDPA 4BJTA 1ZR2A 2BV6A 4J01A 1FYMA 2Y0SN 3REOA 5FB2A 3V4GA 2EV5A 1IZ1A 4E7SA 2WB1N 2YSRA 2XIGA 3L7WA 4ZJZA 4PZJA 3DBRB 5HS9A 2MG4A 1YO5C 2KISA 3DTEA 2JSCA 3TKYA 2STWA 1IN5A 1WJAA 1YRNA 4C2UA 2DOAA 4ZYDA 2OCCH 2HDDA 5L3DA 3FK6A 1BW6A 3ML6A 2F5DA 4IOCF 4I76A 5D6EA 4DOZA 4CDGA 1GV2A 4E7JA 3BOQA 3IC7A 1KQ0A 4O6JA 5E1ZB 2ID6A 1P7IA 4P9FA 2M5WA 1XGSA 3W6JB 3JSPA 1WPKA 1GLNA 1TQMA 1KU2A 2JRMA 1APLC 1S3JA 1MBHA 3H92A 2ZJRF 2O8KA 4I0BA 5AIQA 4KYWA 4IHXA 5EG0A 1USTA 4OOIA 5BMZA 1IUYA 1IDZA 1FMWA 4CCLA 2DDBA 1XG1A 2MLGA 3WTTC 1U3EM 2N8GA 3I53A 1R1UA 1MZBA 1W0UA 5IOYA 1TL8A 3K70C 2BYVE 2R7RA 1W5SA 4XLNF 4UHTA 5GTIC 1RRJA 2X6XA 2L7MP 3TGNA 3K10A 2A3SA 3A02A 2M4KA 1ON2A 1UHMA 5D4RA 2P7VB 3I4PA 3KX2A 3ABMH 5DCMA 4BHPA 4BDZA 2Y2ZA 4ZZLA 3DBLB 1VQPI 4N9HA 3IAM2 3BTIA 1X4PA 4I0AA 3CCYA 4CCKA 4M3FA 4E7KA 1O3RA 1PVEA 4Y3OA 4MNUA 1Z6RA 2IXSA 4L5EA 2XAGA 3RKXA 2A6EF 3HTUA 3MKZA 3LL7A 2MYSA 4N4OB 2X85A 3ECOA 2XB5A 3JW4A 2LY9A 4NHJA 3P7NA 2K3PA 3OV8A 4HOBA 3CUQC 2OZUA 1ETQA 1WCMJ 3HOSA 4U7BA 1RR7A 2FJ1A 1TC3C 2NRAC 2XKPA 3SFZA 4HLYA 2QSHX 1D3YA 2FNAA 2VPRA 2Z99A 2MC4A 5E3LA 1BC8C 4ENKA 5K7HA 2LY2A 1PJRA 2COMA 2ID3A 2LSOA 3AG4H 5CVUA 3ERMA 3J81K 1VQOI 1ETXA 3MCZA 1A31A 2LBFA 3PO3J 2OAZA 2LTPA 4BBRJ 2WV1A 2R7OA 5D6FA 2GM4A 4C2TA 2YUSA 3EETA 3HUGB 1Z6TA 1QPMA 4A0ZA 3ERED 3TW6A 5E17F 2VBYA 2HZDA 2Y0SA 1Z21A 2B0LA 2WWYA 4RB0A 4BL0B 3HM5A 3A0BC 5F0FA 1JKPC 3QYBA 3ZMSA 4IHYA 5B1BH 1X3UA 2QKMB 3BJOA 2OV7A 1T2KA 1KZHA 4UXNA 4DZJA 2CUEA 4EM1A 4FX0A 4LK1F 1EJ9A 4FE7A 3AKZA 2ECCA 4G7OF 1IDYA 2DBBA 4B09A 1WWXA 3ZCOA 2E36A 4KT6A 4BQOA 3KEOA 3S2WA 5F6FA 1B8IB 1V4RA 5L3CA 3W2WA 4L0YB 3DEEA 4Y15A 5FLXZ 2H8RA 2E19A 4U0VA 5FLMJ 1O7FA 2GA2A 5GAGJ 2HZTA 2W82A 4RDUA 4EQQA 3MMYB 1PUFA 1BI3A 3QP6A 3OYNA 2IVMA 3BG7A 4KMUX 3CDHA 4RGRA 2ZKZA 3SJMA 3I71A 3OL3A 2K5CA 4C9YA 4MQVA 2M2EA 1SD5A 2DA6A 3J7AY 1ZGAA 3E6DA 3HOXJ 1FX7A 1ZRFA 1T95A 2XF6A 2L0KA 4L9VA 4XKWA 2GXBA 4DQ2A 3FISA 2Y75A 1G4DA 2G0EA 1LUJB 1POGA 5M3MJ 3OWTA 1SD6A 3H5NA 5HNFA 3LSKA 1K4SA 1OCPA 3W2AA 3HSEA 3AG2H 1NK2P 1W1WE 4DZPA 1DU0A 2GQQA 2XC7A 3OR1C 3PJRA 2DA5A 5FLVA 3WHCA 1UHSA 3ULQB
chains in the Genus database with same CATH topology
3G6EI 2FOWA 1S72I 3CF5F 1QA6A 1VQNI 1YJNI 1VQ4I 1Y39A 2QA4I 1YHQI 1VQ6I 2E34A 2E36A 3CCMI 1YJWI 3PIPF 3J7ZI 4IOAF 1YJ9I 2OTJI 3PIOF 3CCQI 1YIJI 5JVGF 2ZJRF 3I56I 3CD6I 1YITI 2QEXI 4IO9F 1HC8A 5GAEJ 1VQ7I 1VQKI 1ACIA 2NXNB 3CCVI 1VQPI 2OTLI 3CC2I 3CC7I 4UY8I 3G4SI 2ZJQF 3CCRI 1VQLI 5GADJ 5GAGJ 5GAHJ 3I55I 3CCSI 4V19K 2K3FA 5DM6F 3CCUI 1MMSA 3CCEI 3CMAI 1VQMI 1FOWA 3CC4I 3CMEI 3DLLF 1VQ5I 2H8WA 2ZJPF 5DM7F 1FOYA 3J7YJ 3G71I 4IOCF 1VQOI 1YI2I 3CCJI 1VQ9I 3CJTB 2JQ7A 1FOXA 2E35A 3CCLI 1VQ8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E I;  2FOW A;  1S72 I;  3CF5 F;  1QA6 A;  1VQN I;  1YJN I;  1VQ4 I;  1Y39 A;  2QA4 I;  1YHQ I;  1VQ6 I;  2E34 A;  2E36 A;  3CCM I;  1YJW I;  3PIP F;  3J7Z I;  4IOA F;  1YJ9 I;  2OTJ I;  3PIO F;  3CCQ I;  1YIJ I;  5JVG F;  2ZJR F;  3I56 I;  3CD6 I;  1YIT I;  2QEX I;  4IO9 F;  1HC8 A;  5GAE J;  1VQ7 I;  1VQK I;  1ACI A;  2NXN B;  3CCV I;  1VQP I;  2OTL I;  3CC2 I;  3CC7 I;  4UY8 I;  3G4S I;  2ZJQ F;  3CCR I;  1VQL I;  5GAD J;  5GAG J;  5GAH J;  3I55 I;  3CCS I;  4V19 K;  2K3F A;  5DM6 F;  3CCU I;  1MMS A;  3CCE I;  3CMA I;  1VQM I;  1FOW A;  3CC4 I;  3CME I;  3DLL F;  1VQ5 I;  2H8W A;  2ZJP F;  5DM7 F;  1FOY A;  3J7Y J;  3G71 I;  4IOC F;  1VQO I;  1YI2 I;  3CCJ I;  1VQ9 I;  3CJT B;  2JQ7 A;  1FOX A;  2E35 A;  3CCL I;  1VQ8 I; 
#chains in the Genus database with same CATH topology
 2RKH A;  2RV8 A;  5H6R A;  4EM2 A;  1JI8 A;  5ILU A;  5DEQ A;  3S3N A;  3H36 A;  4OMZ A;  3RJP A;  1BIA A;  1R5H A;  3PSI A;  1S7A A;  4C3H J;  3ZQL A;  4IEJ A;  3H5R A;  3FXJ A;  4XID A;  5FRO A;  3K9T A;  3HHH A;  5J3L A;  1E2X A;  3U9G A;  2RGV A;  2HOT A;  1SAU A;  3GEZ A;  3HOZ J;  5KHD A;  1I1G A;  3VDX A;  2EFN A;  2MAB A;  2EBI A;  4XR6 A;  1DGW Y;  3DQV C;  2CO5 A;  3TOA A;  2VT3 A;  3HZJ A;  4L5J A;  1YS7 A;  2Y9Y A;  3WTS C;  2EZK A;  3DEU A;  5AIP A;  4AVP A;  2PLY A;  3DXJ F;  1D5V A;  3E6M A;  2X4H A;  2QF7 A;  4BAY A;  3AAF A;  2HEO A;  4OIP F;  2XGD A;  1YJ9 I;  4M73 A;  1ZN2 A;  3F23 A;  1A35 A;  1ERD A;  3I4N J;  1QPI A;  4LIT A;  3RKY A;  3E7L A;  1ON1 A;  2J5P A;  1IJW C;  5IT3 A;  2EZL A;  2R92 J;  4KJZ A;  2VN2 A;  1ORK A;  3H9Q A;  4ZTJ A;  4XRS G;  4FAS D;  1WZ2 A;  2VKH A;  3Q0V A;  2M7A A;  3S1N J;  1I50 J;  1FOY A;  2XSJ C;  1MJB A;  4M3D A;  3CCL I;  4CA0 A;  1KA8 A;  2FX0 A;  3G1O A;  2E34 A;  4F93 B;  1LE8 A;  3HIF A;  5L3E A;  2OTJ I;  3BG6 A;  3HBL A;  1XSX A;  1ZRC A;  3FM3 A;  5TIS C;  2QBY B;  4UVB A;  2BEO A;  4NDL A;  2FQ4 A;  2OD5 A;  2JT1 A;  2E5Z A;  4M3E A;  3U2R A;  1J59 A;  3OSG A;  4UB8 C;  3HSR A;  5D4S A;  3MEX A;  3J7Y J;  1Y56 A;  3FDY A;  3BJ6 A;  3FX3 A;  3G2B A;  2JUG A;  2E35 A;  1I39 A;  4KIB A;  1T39 A;  3F8N A;  4Z2Y A;  1FSH A;  2JUC A;  3M1E A;  2L3D A;  1YHQ I;  1JUM A;  3S16 J;  4H4K C;  2KRH A;  3BZC A;  3QYE A;  3BR6 A;  3L2C A;  2PJR A;  3UR3 C;  3L1P A;  2DMP A;  2CH0 A;  5F0H A;  4PJM A;  4UUT A;  2H94 A;  3LSM A;  5JHU A;  3CLQ A;  2PMZ N;  3WTX C;  1S6L A;  2E60 A;  3SZG A;  3U1D A;  2EFW A;  4U0Y A;  2V9P A;  2L4M A;  1K61 A;  3F6V A;  1R00 A;  1ENH A;  1FC3 A;  4UUS A;  2V9K A;  2XPW A;  3KLN A;  1SFX A;  4QLC U;  3PUB A;  1UEL B;  3LA7 A;  2GXA A;  1QVU A;  4GRI A;  1S7E A;  1XC5 A;  2PMZ A;  5BNG A;  2XDV A;  1HQC A;  1J5Y A;  1TTY A;  1YW9 A;  2QEN A;  3GFI A;  1S29 A;  1JT0 A;  4HRI A;  2E1M B;  1JTX A;  1YRN B;  5IPA A;  3IHU A;  5GAH J;  1FY7 A;  4HF2 A;  3S1R J;  2DDA A;  3CZ6 A;  3CP8 A;  1Y0N A;  2VJJ A;  2KDZ A;  4WXC A;  2F4M B;  2MGQ A;  2Z3Y A;  1XTA A;  2B9S A;  1WQ2 A;  3NQO A;  2ELK A;  1FMV A;  2WAQ A;  2AQE A;  4M72 A;  1D8K A;  3N97 A;  1HST A;  4RGS A;  4HA8 A;  3HXL A;  3PFY A;  5FKK A;  3RSN A;  1MMN A;  1UZC A;  4ZDO A;  4KFC A;  1LDJ A;  5LFA A;  4EVI A;  4A3M J;  3BR2 A;  2FBI A;  4U0W A;  3NWS A;  2W57 A;  4AC0 A;  1RUO A;  2ZFW A;  2I5U A;  2VXD A;  4YIR X;  1I6H J;  2NS7 A;  2W84 A;  4CCJ A;  2BVL A;  1V3F A;  5J40 A;  1NTC A;  2PQ8 A;  3A2K A;  4CIC A;  2JRT A;  3FHZ A;  3BPX A;  2P4W A;  4QIW N;  1PDN C;  2LF7 A;  2RVC A;  4YFX F;  5E8G A;  3GZN B;  3ZQG A;  3J80 K;  2NVT J;  4A3D J;  3M8J A;  1LNW A;  2IJL A;  2MD5 A;  3BLY A;  1PUE E;  1H89 C;  2E1O A;  4JOM A;  2K86 A;  2AXT C;  5FGM A;  1WHU A;  1G3T A;  1SFU A;  3LFK A;  1BI1 A;  5D8K B;  3RKQ A;  2K4J A;  3SEQ A;  4F7Z A;  5A2Q Z;  1WJD A;  5FKL A;  5KK1 A;  2CGP A;  1TWC J;  2HVS A;  4UNO A;  4XLP F;  2JWT A;  2OCE A;  2V1D A;  1X1D A;  2XRN A;  5D8L B;  4RLF A;  1B9M A;  1E0E A;  2M34 A;  3F3X A;  1ZAR A;  3A03 A;  1HC8 A;  3RPU D;  1LJ9 A;  2Q0O A;  1BJZ A;  3DPL C;  4UVA A;  3LAP A;  4EGZ A;  2DQL A;  2BY0 A;  1QHG A;  1YX5 A;  4JBA A;  4KN7 X;  2FXA A;  2G9W A;  4KIT B;  4FCY A;  4TV7 A;  4KA4 A;  5E18 F;  2ZXW H;  3EUH A;  1W7P D;  2XV4 S;  5D5W B;  3LSI A;  4MHG A;  3BR1 A;  2JA5 J;  2PJP A;  4XLC A;  3GCM A;  3DLA A;  1RR8 C;  3T8T A;  1YIT I;  3FXR A;  5DCF A;  3TO9 A;  1OIS A;  1T33 A;  2RN7 A;  5K5R A;  2R5Y A;  1ETK A;  4E7H A;  3I0T A;  1LEA A;  3DCF A;  3ZN1 A;  4BKX A;  1GHC A;  4L18 B;  3L00 A;  4IPA A;  2XHK A;  3K4J A;  3FWE A;  3RDI A;  2KFD A;  2QQB A;  4CGZ A;  3C2H A;  3ZGK A;  2DPU A;  1F43 A;  3C1D A;  4CHU A;  4DGW B;  5ED4 A;  3P9C A;  4M6V A;  2E7W A;  2LFB A;  5DD8 A;  4F92 B;  1Y39 A;  1Z9C A;  4ENJ A;  1IXR C;  2OBP A;  3ESW B;  3MN2 A;  5HDN A;  3ABU A;  2VAS A;  2WY8 Q;  1KU3 A;  1RET A;  5HS8 A;  5HLT A;  4KUM A;  1P6R A;  2CV0 A;  1R5I D;  1M1E B;  1Y8R B;  1ZEL A;  1K78 A;  1FBU A;  2DI3 A;  5LD2 C;  3H0G J;  4U88 A;  1AWC A;  2O3F A;  2OPT A;  5FKO A;  4A0Y A;  2A61 A;  4BE1 A;  4NB5 A;  1ZG1 A;  1U5T B;  1R9T J;  5CQE A;  1V55 H;  2HYG D;  2BHY A;  2YPR A;  4OMY A;  2IS1 A;  2E2J J;  4LB5 A;  1YYV A;  1XS9 A;  3CO7 C;  2XB0 X;  3TDZ C;  1LVA A;  3HGG A;  3MWM A;  2QVO A;  4ITV A;  3T0Y A;  1V5G A;  1Z05 A;  4YEL A;  1TQI A;  3PNT A;  2IGN A;  2VC1 A;  3BZK A;  4LG0 B;  1OYY A;  2R93 J;  3FMS A;  3VOE A;  1FP1 D;  3T5X A;  1RKT A;  2MW8 A;  1UG0 A;  2EIL H;  2VJ4 A;  1YI2 I;  3C2G A;  5LEK A;  3DKX A;  3LSJ A;  4G7H F;  2Z16 A;  2GZW A;  3IRR A;  4ZYA A;  2E2I J;  3F8B A;  4RLQ A;  1LDK B;  3WGH A;  1ZRE A;  5B3S H;  4O5V A;  1MMD A;  1ZG3 A;  5CPR B;  3JTG A;  5FD6 A;  3VWB A;  3PSF A;  1BA5 A;  3M9A A;  2VB6 A;  3HPG A;  3LFU A;  2XPU A;  4ENN A;  3G1L A;  4RGX A;  4XOT A;  2OF7 A;  5LHG A;  3DP7 A;  4XK4 A;  5J1R A;  3K4B A;  4GGG A;  1OMI A;  3AG3 H;  5H6Q A;  3M7G A;  4MO7 A;  4NQW A;  2VE8 A;  1P4A A;  2VE9 A;  1NH3 A;  1ZHF A;  3CCS I;  1S8N A;  4G12 A;  2ZO4 A;  1Z67 A;  3EUA A;  4IQ4 A;  3RPU A;  2O0Y A;  5F1R A;  4S05 A;  4BBS J;  3M8F A;  3PQJ A;  1UAA A;  1MSE C;  1JUP A;  3HB9 A;  1EF4 A;  2LLK A;  3K2Z A;  1D0Y A;  3K1N A;  5J4V A;  1HDD C;  2DN0 A;  4A93 J;  1YQA A;  1IRX A;  1D8J A;  3LSG A;  3SDG A;  2P81 A;  1BOB A;  4AVZ A;  1W7P A;  2K4B A;  2ECB A;  2R7D A;  3TOB A;  4F55 A;  4HEA 2;  2J5O A;  2HQR A;  2HTS A;  1NK3 P;  3GTK J;  3DPU A;  3B02 A;  3ZMT A;  2L7F P;  1X4O A;  5FJ8 J;  3M07 A;  2A6H F;  1WKM A;  1WJC A;  4HV6 A;  5F0C A;  2R7X A;  1RC9 A;  1H9T A;  2KP6 A;  3IWF A;  5KCM A;  2M3A A;  2MSY A;  4D7M A;  3L9F A;  1R4N B;  4CYD A;  1Z0X A;  1IRZ A;  4NBQ A;  5M3F J;  1CF7 A;  5JVG F;  1ZQ3 P;  4JQF A;  2QEX I;  2I10 A;  1U8R A;  3GZ5 A;  5CKT A;  4AWX B;  1OR7 C;  1EH7 A;  1EH6 A;  1G3Y A;  2ETH A;  3BRO A;  3F9K A;  3M8E A;  2AS5 F;  2JA8 J;  3WU1 B;  1BW5 A;  1MDM A;  3JTH A;  1I3A A;  1TW3 A;  2AO9 A;  2VOP A;  1EH8 A;  2PFB A;  1HBX G;  3BWG A;  4G6D A;  3HL2 A;  4IHV A;  2MLK A;  1VF9 A;  2V1X A;  2ZNZ A;  3NAR A;  3I3L A;  3IH3 A;  3S17 J;  3QPH A;  2FNP A;  1K83 J;  3ZQQ A;  1OCT C;  2DMQ A;  1SVL A;  1HLV A;  4UY8 I;  3BR5 A;  3TDU C;  3BT9 A;  1UB9 A;  1O57 A;  4NUB A;  3ZMD A;  1Y0U A;  4FET A;  2H09 A;  1P9Q C;  4L9J A;  2HWV A;  3ZQI A;  1IO2 A;  1W36 C;  3PM1 A;  5CVJ A;  3MZ8 A;  2FQ3 A;  5ILV A;  2FD5 A;  2F5V A;  3DWL E;  5C4X J;  2IA0 A;  2LKS A;  1ZTR A;  3K1P A;  4MTE A;  3AG1 H;  5AON A;  4OIO F;  1F4K A;  1T0F C;  3FBI B;  2DOD A;  2CUJ A;  4V19 K;  1LFP A;  2DA1 A;  2DFF A;  1OCO H;  2M45 A;  2FMY A;  2ZCW A;  4B44 A;  2XSD C;  2V1U A;  1T98 A;  5LGU A;  4OWR B;  3WGG A;  4F91 B;  3VPR A;  4PFP A;  3X2Q H;  4EJV A;  3CF5 F;  1D0X A;  2K02 A;  1SAN A;  1R4M B;  5C4J J;  4NC7 A;  2R7U A;  1YIJ I;  1YOV B;  2KIQ A;  2QQA A;  4LLN A;  2HPI A;  3P5J A;  1ZAO A;  1VQK I;  2W85 A;  1OLT A;  4CUG A;  5E3N A;  1J2X A;  3BG3 A;  2VXZ A;  3LOC A;  1Z7U A;  2A05 A;  4MGR A;  3LA2 A;  2D1V A;  2JA6 J;  2L9N A;  2VL8 A;  2LVS A;  2ZME A;  3HRU A;  3NAU A;  2HOA A;  5HDG A;  2ESH A;  1I1S A;  4A6D A;  4LFU A;  2DFI A;  2UXX A;  3FBN B;  4D5C A;  2Z2S B;  2KJC A;  3VYT B;  4IQJ A;  2IS2 A;  1GV5 A;  4LK0 F;  4CCN A;  5LGN A;  1FYL A;  4BJ6 C;  2H27 A;  1XMA A;  1VQ6 I;  2P6S A;  1L0O C;  3GWZ A;  1FLI A;  4X1E A;  9ANT A;  2KJB A;  1REP C;  3R61 A;  2R0Q C;  1WI3 A;  3KP7 A;  1Z3Y A;  1VTN C;  2O8X A;  2GBY A;  1TWH J;  4AU7 A;  3PFI A;  2UXN A;  3CCR I;  3BC8 A;  1SFK A;  4N4N B;  3B6A A;  5DCM B;  3S3M A;  2LYC A;  3GFJ A;  1XD7 A;  2V26 A;  3CP2 A;  4AIJ A;  5F08 A;  1JKR C;  1K78 B;  3H3U A;  4HST A;  4RM3 A;  4L5I A;  4AID A;  1ZG5 A;  1BI2 A;  3IWZ A;  1QZZ A;  1MH3 A;  1XGO A;  3UKG A;  2D5V A;  2A69 F;  2O9L A;  4ZTF A;  4G94 A;  4I6Z A;  3H3V K;  4I09 A;  4RB3 C;  3S8P A;  4A12 A;  2KIU A;  5EZG A;  3J81 Z;  1QO0 D;  2GWR A;  1XCV A;  2UUZ A;  5K5Q A;  3HG9 A;  1IG7 A;  1MMA A;  2HVQ A;  2YR2 A;  3HHG A;  2NS0 A;  2Y9Z A;  2DT6 A;  4I7H A;  2DJI A;  4U87 A;  2X51 A;  2BE5 F;  3KE2 A;  2IEK A;  3JR9 A;  2QCO A;  4A3K J;  2Y0M A;  4CYC A;  2MA3 A;  1FT9 A;  2Q2E B;  1VQ4 I;  4XOR A;  1U78 A;  3I59 A;  1B1B A;  2L7Z A;  1STZ A;  1X58 A;  2FOK A;  4YFK F;  4GDF A;  2W00 A;  2K7L A;  4XLE A;  4Y13 A;  2EIN H;  4IZZ A;  3P9I A;  4BE2 A;  3WGI A;  1D0Z A;  1ETW A;  4HPQ A;  3I5U A;  4QPQ A;  4M71 A;  2CQK A;  2LRE A;  1TNT A;  4ASN A;  3Q0W A;  1RKW A;  4Y33 A;  1JXS A;  3OYJ A;  3D5S C;  3QOP A;  1QHH D;  2VQC A;  4KIC A;  3TO7 A;  1J9I A;  1QGP A;  4M74 A;  1ETY A;  2P5L C;  1B9N A;  2HDC A;  2A68 F;  3H35 A;  1DP7 P;  2IA2 A;  3ZQH A;  1WH5 A;  3TL4 X;  4KIG A;  5BPD A;  3EYI A;  2NVU B;  4AIH A;  2BXZ A;  2H6B A;  1FIP A;  5CLS A;  1VZ0 A;  1XDS A;  4PGG A;  4KMF A;  2VLA A;  1R6R A;  4F3Q A;  4EM0 B;  1LFB A;  2L01 A;  3CJR B;  5A2Q K;  3OYM A;  2NVX J;  5CQG A;  2G7H A;  5D5U B;  4EEF G;  3DEW A;  3BR3 A;  3NRV A;  2E5N A;  1X1A A;  3O8G A;  5ICF A;  1S72 I;  2EV0 A;  2QQ8 A;  1BN5 A;  2M8E A;  2QQ9 A;  3OL4 A;  2IT0 A;  4P1W A;  4M3B A;  2HKO A;  1R58 A;  3IH2 A;  2CUZ A;  1A36 A;  3RTR A;  3FKJ A;  4IHS A;  1DDN A;  1VQ7 I;  4PJL A;  2W25 A;  2DPD A;  1O7L A;  4WXD A;  2VQG A;  3ZR8 X;  1U0J A;  3KP5 A;  1PYV A;  3VSL A;  1TBX A;  4WX9 A;  2KZV A;  2RC4 A;  2EH3 A;  3KCC A;  1DP3 A;  1XCB A;  3LNQ A;  4BQA A;  4R79 A;  2RNJ A;  2BZT A;  2P8T A;  5DYM A;  5J47 A;  2CRG A;  1ZR4 A;  1F9N A;  4BUP A;  4HW0 A;  5IT9 K;  1UMQ A;  1O3T A;  1P92 A;  1IXC A;  3H0D A;  1SVM A;  4HQM A;  2QWW A;  4E4H A;  3IKT A;  1TW2 A;  5L3G A;  2W24 A;  3G4S I;  2MBF A;  1U6G A;  3KIO A;  3S15 J;  2YS9 A;  3EUK L;  1HXD A;  3TO6 A;  3CMA I;  2XAS A;  2RRE A;  4DYQ A;  3GFL A;  3JCU C;  2UZK A;  4PUS A;  1X1C A;  2KLO A;  4OIR F;  4ZYH A;  2HFH A;  4XLF A;  5LHH A;  2HDW A;  1NHA A;  1B72 A;  2XPV A;  5EF6 A;  1LQ1 A;  1J75 A;  4XN3 A;  3FXK A;  5BPI A;  5E1W A;  2NXN B;  1K6Y A;  1X3Z B;  4RS8 A;  2DT5 A;  3LSR A;  2XAU A;  3HC7 A;  2ICW G;  5L3B A;  3LST A;  4IJA A;  4Q4Z F;  2EPF A;  4A5N A;  2AHQ A;  4EJW A;  4GCV A;  4M9Z A;  1SAX A;  1IW7 F;  5H20 A;  1BR2 A;  2DK5 A;  1MDM B;  4JX6 A;  3HSF A;  2ELJ A;  2HPM A;  3MAJ A;  3JAM Z;  5TGT A;  2VIX A;  1KQ9 A;  3V7R A;  4CO8 A;  1YTY A;  1ZKG A;  4PK4 A;  3GO5 A;  4HV5 A;  2H1L A;  3N05 A;  3OOU A;  3PIO F;  1P7J A;  2FA5 A;  1A04 A;  3ZQ7 A;  3FHN A;  1R36 A;  1R71 A;  2LF8 A;  4W97 A;  1OCZ H;  2DMU A;  3I59 B;  5EYR A;  3CCV I;  1I6X A;  3MVP A;  2FU4 A;  4HDV A;  4A0X A;  4BGD A;  4YG2 F;  4XL9 A;  2LKP A;  1SMT A;  1SMY F;  1W5T A;  5F04 A;  3TBI A;  1ZRD A;  4L0Z B;  2PI0 A;  3TMO A;  3RQ4 A;  2DMN A;  3I64 A;  5IYB J;  5K1Y A;  4GYI A;  3QQA A;  2CQ7 A;  1HSJ A;  1FTZ A;  2EFP A;  4HDU A;  4OAY A;  1B6A A;  3TW7 A;  1HW5 A;  3CCM I;  3E5U A;  1MBK A;  1LVK A;  1FPQ A;  3RIR A;  4S04 A;  3DV8 A;  3TP0 A;  2FRH A;  3SFI A;  1OJL A;  3BTJ A;  3GUD A;  4Q47 A;  4M3G A;  3K4L A;  3S3O A;  3IL2 A;  4BNC A;  5HNH A;  3DFG A;  3CCE I;  4AYB A;  2XAH A;  2GAU A;  3G71 I;  3FKI J;  2CYY A;  2X6W A;  1D5Y A;  1JE8 A;  4HYE A;  1OCR H;  2MH2 A;  3HKZ N;  2OU2 A;  1N78 A;  1MBJ A;  2HI3 A;  2JVH A;  4LG3 A;  3HOW J;  3TQN A;  3E3V A;  3DKY A;  3I56 I;  4QWQ A;  4ESB A;  2W48 A;  2D1H A;  2L9S A;  5KVR A;  1LFU P;  3HJE A;  3KLO A;  1LKX A;  2VBX A;  1IN6 A;  3RZO J;  2JPB A;  3E5X A;  2F5F A;  1FTT A;  3ZPL A;  1MJ9 A;  2DXI A;  3NWT A;  2FF4 A;  5GP9 A;  2DYR H;  2LR8 A;  2PX9 A;  3KFW X;  3R0A A;  5ICG A;  2QGU A;  1A6I A;  1U9O A;  3GBG A;  3ZP5 A;  1XDU A;  2DJN A;  1DUX C;  3VB2 A;  3PL8 A;  2Z33 A;  1YLF A;  5F1J A;  4RAF A;  3KYL A;  3B73 A;  2NNN A;  3HOU J;  2GIZ A;  2XGC A;  1G8X A;  2HS5 A;  3CCQ I;  1ZYR F;  5KNL A;  3MZH A;  4E7I A;  3F0C A;  1F36 A;  1XMX A;  3P9K A;  3Q5F A;  5IT9 Z;  4E7Z A;  3WTY C;  3BTL A;  2NYX A;  4BXX J;  2EQR A;  2M4G A;  3SXY A;  3G1M A;  3KZI C;  3K69 A;  1FOW A;  2JTV A;  3CUQ A;  5HLH A;  4B48 A;  3OYC A;  2D45 A;  2PN6 A;  5CVI A;  3BQY A;  4PJ0 C;  4W1U A;  1K6O A;  4A3G J;  2NVQ J;  4A3L J;  1ZLJ A;  4BHB A;  1PP7 U;  5LRS A;  3RKW A;  1W5C C;  4LLG F;  2ME6 A;  2CG4 A;  2HQ5 A;  3IUO A;  1IAW A;  4H0E A;  2KPM A;  2LY1 A;  3QWL A;  1FWZ A;  2YU9 J;  1YW8 A;  2XAJ A;  1VI0 A;  3FXQ A;  2CW0 F;  3QPL A;  2Q2E A;  1ZGW A;  2NOG A;  1H9G A;  4DYC A;  2RQQ A;  4ZDP A;  3OYK A;  4B3A A;  4HF1 A;  2UWM A;  2ISY A;  3Q9V A;  3BDD A;  4BQN A;  4A3B J;  3Q3S A;  4I02 A;  2IAI A;  3VFZ A;  4DBR A;  2LK2 A;  3CJN A;  3V8L A;  1X3W B;  5JI6 A;  2DFH A;  1YFH A;  4UVC A;  3ZRG A;  1Y6I A;  2GA1 A;  1AHD P;  3JRD A;  4I01 A;  4J00 A;  3RPQ A;  5LLQ A;  4MFD A;  2MH9 A;  2OA4 A;  1OQY A;  3OS1 A;  2EZI A;  2L9V A;  2JA7 J;  3HPH A;  3CES A;  4IX7 A;  4FIS A;  4BAC A;  4E6K G;  5E79 C;  1Q1V A;  3VEP A;  1MBF A;  1BR4 A;  3OY9 A;  1KYZ A;  2QSF X;  3M4O J;  3S14 J;  3CJT B;  2IP2 A;  2M1B A;  4IXA A;  3W2V A;  5E8I A;  3JRA A;  4A3I J;  4BE0 A;  1TZL A;  4JYK A;  1XMK A;  2QA4 I;  1WGX A;  3RZD J;  3WTV C;  1KYW A;  4RB1 A;  1XGN A;  2HQN A;  1YE9 A;  2VPL A;  1OFC X;  1TQP A;  5ICC A;  2EK5 A;  2OC6 A;  2O6G E;  2VI6 A;  4XOP A;  1KQ8 A;  1MKM A;  3EPZ A;  2M7B A;  1H8A C;  2KT0 A;  3VYS B;  2K3F A;  5IY5 H;  3OYF A;  4K2E A;  1HKT A;  2DOF A;  2MD0 A;  1ETV A;  2VBZ A;  3I58 A;  3JRC A;  1FOX A;  2HVR A;  3CF2 A;  3E6C C;  4B8X A;  3HOV J;  4G8X A;  1HA8 A;  3H9J A;  4XN0 A;  1GVJ A;  2ZJ2 A;  1GXP A;  2A5Y B;  2VKE A;  3V8K A;  2X1E A;  4RAZ A;  4D0P A;  1UCR A;  5H2F C;  1J0R A;  2BVM A;  5GAE J;  5BS6 A;  3KP6 A;  3QAH A;  4QPO A;  5FKM A;  3HYI A;  3F21 A;  1P2F A;  2FML A;  3KEY A;  4HX8 A;  2D2W A;  5FD5 A;  5HLG A;  1ODD A;  2LMD A;  3W6K B;  5M5W J;  3AL0 C;  2FOW A;  3LA3 A;  2CQN A;  1TWG J;  2DFE A;  5HVQ C;  2DYS H;  2HOE A;  2WTE A;  4LD5 A;  1O3S A;  5TJJ A;  1ITY A;  1WJ5 A;  4UV8 A;  1F5T A;  4D5F A;  1W36 D;  4JX4 A;  4XRS A;  3O3K A;  1UHW A;  3DU5 A;  2HYF A;  1MJA A;  2C6Y A;  2DA2 A;  1YG2 A;  1XPX A;  3K4M A;  3MZY A;  4O3M A;  4V2F A;  3GLL A;  3FF5 A;  1I3Q J;  4XBF A;  4A5M A;  3QRF F;  2H8W A;  4EJO A;  2AXL A;  4E7L A;  1DGR M;  4J19 A;  3R6S A;  2WV0 A;  2K27 A;  4LB6 B;  3RYP A;  2EV6 A;  3OIP A;  1PUF B;  3KET A;  5M5X J;  3E5Q A;  2K9M A;  4D1Q A;  4LIU A;  4EJU A;  4FX4 A;  4RAY A;  2L2O A;  2WBM A;  4OIN F;  4NC8 A;  4DW6 A;  3CC2 I;  5JLX A;  4HNV A;  1G6N A;  4A2U A;  2CFX A;  5E20 A;  4BJ5 C;  3LAJ A;  3V7C A;  4WXH A;  2QM3 A;  3L09 A;  3ZOB A;  2ZJP F;  1OYI A;  3MKL A;  4OAZ A;  2XKO A;  4N9I A;  5M5Y J;  2DT7 B;  3CDI A;  1E3O C;  2PJR B;  1FBQ A;  1TLH B;  1FNN A;  2M87 A;  1EKE A;  1MW7 A;  1U5T C;  2ESN A;  2CJJ A;  2IGO A;  4XRF A;  3HTS B;  2NS8 A;  1KGS A;  3WG9 A;  3A1Y A;  3KYD B;  3J7Z I;  4LGW A;  1WRJ A;  3MKY B;  4CZZ A;  5GPC A;  4PGH A;  1V54 H;  3RI4 A;  4LJZ F;  2KMU A;  3SHF A;  2F5E A;  3OYD A;  3HUG A;  4IKF A;  3BR0 A;  1FP2 A;  2LOO A;  2A5W A;  2QLZ A;  3DF8 A;  4OU0 A;  4RMN A;  3HOT A;  4BS9 A;  4LOC A;  1WH7 A;  2CV2 A;  4AM3 A;  1EA3 A;  2DLL A;  4KIS A;  1T6S A;  4CYC B;  1KU7 A;  1ONV A;  4ZC3 A;  4L9N A;  1RES A;  1X1B A;  3BG5 A;  1IF1 A;  1D1C A;  3DTK A;  2COB A;  1T56 A;  2R5Y B;  1GDT A;  2X6O A;  1QRY A;  4PFO A;  4ABZ A;  2F48 A;  3SYT A;  5J1U A;  1AKH A;  3ELK A;  3ZQF A;  2QBY A;  2F6C A;  2ZME B;  3IV5 A;  3I54 A;  4G6Q A;  4PCQ A;  2RAE A;  3H5A A;  2R5Z A;  3OSF A;  5BQT A;  2XRL A;  5LRR A;  1HOM A;  4IRI A;  4RBO A;  2KL4 A;  1BI0 A;  4N0B A;  4WF2 A;  4DNC A;  3ZMV A;  1AKH B;  4EAT A;  4UV9 A;  3CUQ B;  2JQ7 A;  3OMY A;  3JRB A;  2VON A;  4RAG A;  4I2O A;  2KQR A;  1VQN I;  1YJN I;  4BXU A;  2OQR A;  1IXS B;  1TWF J;  3ECH A;  5FKN A;  3GYH X;  1FSE A;  3QYF A;  1FOK A;  3WE3 A;  3FM5 A;  3RQI A;  3O8H A;  5J4Y A;  2Q8K A;  3K2A A;  1RUN A;  4PJN A;  1E3P A;  3L2Q A;  1SC7 A;  5GTH C;  3GTQ J;  2P5V A;  4IL6 C;  4KDP A;  2R5Z B;  2LH9 A;  3DPT A;  3EDP A;  4NNJ A;  3DTI A;  1QVT A;  5HLI A;  3K1M A;  4ESF A;  1LDD A;  2BHZ A;  2JMW A;  2ZBK A;  3LSH A;  4P9U A;  3F22 A;  1WJF A;  3K7A J;  5FLX K;  2IS6 A;  4DBQ A;  2BBY A;  3KP2 A;  3COA C;  3VSK A;  2DOE A;  2K9S A;  3JRI A;  2WAF A;  2ELH A;  3PUF A;  2YX7 A;  3CTA A;  4FT8 A;  1MH4 A;  2VT2 A;  4HZF A;  2DAO A;  3QOD A;  1QZE A;  3BQZ A;  2GOM A;  4ZYG A;  4DIQ A;  4AUX A;  3WTU C;  2CV1 A;  2R7Q A;  1Y8Q B;  4P5O A;  2Y31 A;  2CW8 A;  2M0M A;  1T8I A;  3JSO A;  2GXG A;  2BW3 A;  3K4C A;  2F5C A;  2AQF A;  1WSU A;  2OJE D;  1U5T A;  3BZ6 A;  2KHM A;  2DQR A;  2P0W A;  2R7F A;  3E97 A;  1JTY A;  1ZLK A;  3GME A;  1MNE A;  1ETO A;  2NVY J;  4BXF A;  2DU9 A;  2VOO A;  1MD0 A;  1YJW I;  3KZY A;  4RA2 A;  1HKQ A;  2QKL B;  3ONQ A;  3L2U A;  1RI7 A;  1MMG A;  4B47 A;  2LC2 A;  3ISP A;  2LRD A;  3OYL A;  4XKB A;  1XB4 A;  3HRT A;  2R7V A;  3O6B B;  4M6Y A;  4Y7N J;  2EIK H;  2ZXJ A;  3C2B A;  4C30 A;  4LIV A;  3SDB A;  5F27 A;  2P5K A;  1BBY A;  3JRH A;  5JVT A;  1QA6 A;  2LDU A;  2KIM A;  2MFZ A;  2JA2 A;  4JX5 A;  5EJC A;  1DPU A;  1ZK8 A;  3HGY A;  3MFK A;  2HR3 A;  5IYD J;  4MEY F;  1FEX A;  5B66 C;  2HGC A;  2HQA A;  5CVV A;  5HS7 A;  2CSO A;  2JJ7 A;  4II2 A;  4ESJ A;  2BY3 A;  2V7F A;  1MGT A;  2WAQ N;  1S9H A;  4LMY A;  4JP0 A;  2VKV A;  3CQZ J;  1N75 A;  4BQQ A;  3OS2 A;  3LQR A;  4BY7 J;  4GYG A;  4L9T A;  3DLL F;  1X2N A;  3LMM A;  1XN7 A;  2R4G A;  4AD9 A;  1WVR A;  2DTR A;  2IRF G;  1OYW A;  4AYB N;  2QZ8 A;  3T8R A;  3OR2 C;  4CCO A;  2M30 A;  1PP8 F;  5CYV A;  4IRH A;  2ZNY A;  1XGM A;  3MKW B;  4I98 B;  2L7K A;  3C3W A;  3GTO J;  2OQG A;  1F1Z A;  5DDG A;  3V8J A;  1SFE A;  3R60 A;  3ZN0 A;  1O4X A;  3DKW A;  2M8G X;  3OYG A;  1Q1H A;  4ENM A;  3K4K A;  3WG7 H;  1Y1W J;  2K85 A;  3VYR B;  4BH9 A;  1BR1 A;  4RM2 A;  3HRS A;  3H1C A;  3ABL H;  1MND A;  5TRD A;  1USS A;  1VQ9 I;  1QU3 A;  5K7F A;  4A69 C;  2EJR A;  4GO1 A;  4G9Y A;  1N25 A;  2VQH A;  1ULY A;  4XNF A;  5EEH A;  4MEX F;  2IA1 A;  3ZQC A;  3BG9 A;  4D7N A;  4NC6 A;  4HQE A;  1B4A A;  1WI9 A;  1IV6 A;  2BOL A;  4ZH4 F;  5J8F A;  2V9V A;  3QP5 A;  4KN4 X;  4XSZ F;  2FBK A;  2M9H A;  1E3H A;  3V7S A;  4M9X A;  3MQ0 A;  3ABK H;  5JHF A;  2DTZ A;  2OZ6 A;  2R7S A;  3WHB A;  2NOJ B;  2HKX A;  2LNB A;  1SEU A;  2R7T A;  3F72 A;  2DA3 A;  5D5X B;  3G6E I;  5IP9 J;  3TED A;  2X1C A;  3HOY J;  4LG0 A;  3KP3 A;  3KZZ A;  3JRF A;  1IN8 A;  1YIO A;  4MQ9 F;  1KU9 A;  4XKV A;  3LSP A;  4DJA A;  2TDX A;  1TP4 A;  2H1K A;  1JJ8 C;  3QU3 A;  3PNV A;  1K7A A;  1J7K A;  2ZXH A;  3R4K A;  1OR7 A;  4FTH A;  3ZXS A;  4A3J J;  1JJ6 C;  2UV1 A;  1VND A;  3DU6 A;  5FO5 A;  3GVA A;  4HSR A;  4E70 A;  2RQP A;  1AA7 A;  5GAD J;  3K0L A;  4ZZD A;  4MTD A;  2KRC A;  1G3W A;  4XM3 A;  3OYB A;  2IGK A;  2CMP A;  5EEG A;  3KP4 A;  5CVR A;  4PSW A;  2HOS A;  3U21 A;  5KAI C;  1X2M A;  1HF0 A;  3UNG C;  1HCR A;  1XX5 A;  3SZP A;  3GTP J;  1NG7 A;  1SD7 A;  4KT5 C;  2VOD A;  2EFQ A;  1BIB A;  3F8M A;  3WOD F;  5EDN A;  2G7U A;  3Q0U A;  4Z6Y A;  3SQN A;  2ACJ A;  2R7Z J;  5LBQ A;  3S2D J;  2K9Q A;  2DMT A;  3OYA A;  3ZMZ A;  3GZ6 A;  2ZSI B;  5DTD A;  2HTJ A;  2HNH A;  4X6A J;  1D1B A;  2KDO A;  1T38 A;  4IVN A;  3TP3 A;  4UUS B;  2A07 F;  3PO2 J;  2XRO A;  1EV7 A;  4C3I J;  4HNT A;  3GTG J;  2E1M C;  3A0H C;  2L9R A;  1S5L C;  1TT5 B;  3SEZ A;  2B63 J;  4EJT A;  4CZC A;  2W4S A;  3BCB A;  3QPT A;  1CF7 B;  3CJQ B;  3D5R C;  2HYJ A;  1JGG A;  3S1Q J;  4HNU A;  3M3Y J;  3PNY A;  2TCT A;  3G73 A;  2CQX A;  2VUM J;  3OIQ A;  3GF2 A;  2DA7 A;  4CXF A;  2LBF B;  2Q1Z B;  3ABT A;  4Y17 A;  1SD4 A;  2P6T A;  4I99 C;  3GTL J;  1JHH A;  3BJA A;  4RGU A;  2ZFU A;  2M0C A;  5C3E J;  1IRG A;  3FXU A;  2V79 A;  1K4T A;  5LHI A;  2DO7 A;  4B43 A;  4B4C A;  2E7X A;  1RPW A;  2ZXI A;  1GT0 C;  2XF5 A;  1ZGJ A;  4A3F J;  2LG4 A;  3VOD A;  1LE8 B;  3RYR A;  3GTM J;  1U2W A;  2DK8 A;  5F64 A;  3FIW A;  4MFE A;  2WB1 A;  2HXO A;  2X6Y A;  2P7C B;  4Y4R A;  2Y69 H;  3WTZ A;  4C2M J;  1ACI A;  2LKX A;  2WY7 Q;  3E0J B;  1E17 A;  3FXL A;  2JK3 A;  1VQL I;  3AFH A;  1UG2 A;  2EIM H;  2ME0 A;  4UUV A;  3A01 A;  1NG6 A;  1MBG A;  2PEX A;  5DM6 F;  4BU2 A;  1VQM I;  1SFO J;  1H0M A;  4OIQ F;  2CU7 A;  4FE4 A;  3HEF A;  3CMY A;  1R1T A;  4HLX A;  3JAM K;  2X0L A;  3BY6 A;  2FSW A;  1DQU A;  2XGE A;  3FMQ A;  2IGM A;  3W6V A;  2DA4 A;  3WU0 A;  2ZC2 A;  2WA0 A;  3NEU A;  2FEZ A;  3C18 A;  3GTJ J;  4BEH A;  1AU7 A;  2KZG A;  4IF4 A;  1FJL A;  1R7J A;  2JVG A;  4HAM A;  3K70 D;  2WC2 A;  3KEQ A;  1VFC A;  2PBI A;  3EQL F;  1XSD A;  3Q9S A;  4JK1 X;  3DBH B;  4C3J J;  2W1O A;  5JLW A;  5EGO A;  2CQQ A;  3WE2 A;  1BL0 A;  4ZDL A;  2IW5 A;  5FFX A;  4BEH B;  5LEJ A;  1JKO C;  5DM7 F;  2EA4 A;  5B1A H;  2VC0 A;  3FXM A;  4BY1 J;  2W7N A;  3QPS A;  4XON A;  5EG0 B;  2FUG 2;  3ASO H;  2BY1 A;  4PJJ A;  4YEJ A;  4S0H B;  3I9V 2;  2X1D A;  4V2G A;  2IBD A;  2LP0 A;  1P4X A;  4YRV A;  1GVD A;  4XLH A;  2IPQ X;  2K9L A;  2F4I A;  1IUF A;  5LGT A;  3F8C A;  4U7D A;  1RNL A;  1G59 A;  1HW1 A;  4RB2 C;  2PMU A;  1MMS A;  1RZ4 A;  5B5E C;  4MLO A;  2Y48 A;  3L2V A;  2O5R A;  4II3 A;  3F6O A;  3U1K A;  3D1N I;  2LD5 A;  2CFO A;  3S32 A;  5E3M A;  4R1H A;  4PSX A;  4GXO A;  2JN6 A;  5GPA A;  5KAF C;  1A5J A;  3FXO A;  2OUM A;  3LQQ A;  2DCE A;  1QQI A;  1X1P A;  1W4M A;  2L5Q A;  3GW2 A;  1X19 A;  5EEA A;  2VQL A;  4IHT A;  4R8H A;  3L2W A;  3BP8 A;  1BOA A;  1JUS A;  3E1S A;  1IRF A;  1FBS A;  1U9N A;  1XSV A;  2X9D A;  1V5F A;  2L54 A;  4CCM A;  2L02 A;  2ZSH B;  4EMS A;  1MIJ A;  2PMH A;  1YS6 A;  1A6Q A;  4IRG A;  3CCJ I;  4ZYE A;  1I5Z A;  4YII A;  4BYY A;  2QSG X;  4IHW A;  3SZT A;  2CUF A;  3H9G A;  2BXY A;  1MNM C;  5IYC J;  1TT0 A;  2BW3 B;  3S93 A;  2XUB A;  4XKC A;  1W0T A;  5JR3 A;  1B8I A;  2YX4 A;  2IS4 A;  4A3E J;  4FQG A;  4HF0 A;  3ASN H;  1R1V A;  5EZH A;  5CJ9 A;  4B3X A;  1MSF C;  1C0W A;  2F2E A;  2WAE A;  3CC4 I;  1WFX A;  3T1B A;  2Z1D A;  4PDK A;  1LB2 A;  3OYI A;  5K5O A;  4A3C J;  4QTR A;  4Q5S F;  1GXQ A;  1CGP A;  3S2H J;  2CW7 A;  5EGO B;  2STT A;  3PIP F;  2VKD A;  2V4J C;  3IAS 2;  4G7Z F;  1CQT A;  3JRG A;  1Z3X A;  3S1M J;  1H88 C;  3GX4 X;  1FZP B;  1DPR A;  6PAX A;  3MD2 A;  4D9J A;  3JRE A;  2ZJQ F;  2ZB9 A;  4HX7 A;  4KNY A;  1UFM A;  2V6C A;  4DYR A;  3EYY A;  2Z9O A;  4F52 A;  2EB7 A;  2E2H J;  5BOX A;  1LEB A;  2EFO A;  4X0G A;  5E3O A;  2EA2 A;  2YU3 A;  1J09 A;  3LWF A;  3L2R A;  1AOY A;  1TNS A;  1IGN A;  1Z7L A;  2JZY A;  5ILS A;  1W7P B;  2HU9 A;  2XF7 A;  5D5V B;  4EV0 A;  2XGX A;  4AIK A;  1Z1D A;  2L4A A;  1JGS A;  3J7A O;  5HDK A;  1WJE A;  2ADU A;  4IO9 F;  1G2H A;  3I4M J;  2KKO A;  3J80 Z;  3HKZ A;  4WK8 F;  2OTL I;  1JKQ C;  3AL0 B;  1IV8 A;  3I55 I;  5ERI A;  4B1R A;  4BDY A;  4XRM A;  4CSW A;  2GLO A;  3FZV A;  1R23 A;  3K4N A;  1T0F A;  4HBL A;  3CUO A;  2JSP A;  2PG4 A;  3V42 A;  3E6B A;  2VBW A;  5DD4 A;  1OPC A;  2O7O A;  2NAZ A;  3EUH C;  1S7O A;  3D0S A;  1L3L A;  2E1N A;  4P96 A;  1OCC H;  2F4O B;  4IOA F;  3IH4 A;  1KON A;  3CD6 I;  2NNY A;  1O3Q A;  1B59 A;  1YW7 A;  2ISZ A;  1HW2 A;  2K40 A;  4CH7 A;  3WU2 C;  1IN7 A;  2I8D A;  2B7E A;  1R22 A;  3OIO A;  3ROU A;  1LPQ A;  1JT6 A;  3CMM A;  1D1A A;  2FBH A;  1U8B A;  4KIF A;  1YX3 A;  2CWE A;  4UB6 C;  4ON0 A;  1T08 B;  2GIV A;  2MC3 A;  3BCA A;  1SVO A;  1VQ8 I;  3GXO A;  3CO6 C;  3OYH A;  3WTW C;  4FHT A;  2Y30 A;  5E1X A;  1GUU A;  5JFR A;  3W3C A;  2BY2 A;  1IN4 A;  1OKR A;  1V5E A;  3OOP A;  1QZY A;  2RDP A;  2Z5U A;  2X48 A;  3OS0 A;  2HXI A;  1TWA J;  3PQK A;  4BHC A;  1FIA A;  5FFZ A;  2V1N A;  5IP7 J;  4HX4 A;  1P4W A;  2DW4 A;  3FK7 A;  3K6G A;  2QUF A;  2JPC A;  4WCG A;  1B72 B;  2EWN A;  2XVC A;  3D5L A;  1G3S A;  2H6C A;  3R0J A;  4ANJ A;  5ICE A;  1Y1V J;  3RCO A;  5L3F A;  1R49 A;  5FRN A;  2A6T A;  2R7W A;  1DU6 A;  1QNT A;  4G6T B;  1HKS A;  3A4C A;  4GFB A;  3FMR A;  5IP6 A;  3GFM A;  1MBE A;  4XIC A;  2EZH A;  2XAF A;  1RIO H;  4A6E A;  3BTC A;  3H3Z A;  1VQ5 I;  2O03 A;  5J8C A;  1BC7 C;  2R3S A;  4HG2 A;  4ETS A;  3N4M A;  2ZME C;  5FRM A;  3IP4 B;  5K7Z A;  5DV5 A;  1BM9 A;  2GOX B;  1QBJ A;  2V6E A;  3IKV A;  5J1Y A;  4LLL A;  3GLX A;  1Z77 A;  2O61 A;  3CDL A;  4Y52 J;  2XAQ A;  2EIJ H;  3CC7 I;  1IC8 A;  2WAD A;  3M1C A;  2KRF A;  3IRQ A;  4QSH A;  1ZH5 A;  3A01 B;  3ZMU A;  5C44 J;  3F8F A;  2VJ5 A;  3CME I;  4P55 A;  3OYE A;  5HOO A;  1JHF A;  2KIF A;  2TRT A;  4XSX F;  3HDD A;  4XLA A;  4YFN F;  5IOZ A;  3HRM A;  2CS3 A;  2E71 A;  1K79 A;  2VJI A;  2E1C A;  4Q48 A;  3VYU B;  1R5G A;  3KPH A;  2BGC A;  2RNG A;  4M9S A;  1Z91 A;  4MIM A;  5HOD A;  5DUI A;  3O2P E;  3CLO A;  4YIF A;  4XQF A;  1UJ8 A;  5DUK A;  4XMY A;  1I27 A;  5J6X A;  1WJB A;  1FYK A;  1N77 A;  3G3Z A;  2K9N A;  3QU6 A;  3KYC B;  3BPV A;  3C7J A;  4EGY A;  3B6C A;  3CCU I;  2FE3 A;  5DS9 A;  4WWC A;  4M6X A;  4NQW B;  1BJA A;  3QOE A;  2QYO A;  1HDP A;  4BJT A;  1ZR2 A;  2BV6 A;  4J01 A;  1FYM A;  2Y0S N;  3REO A;  5FB2 A;  3V4G A;  2EV5 A;  1IZ1 A;  4E7S A;  2WB1 N;  2YSR A;  2XIG A;  3L7W A;  4ZJZ A;  4PZJ A;  3DBR B;  5HS9 A;  2MG4 A;  1YO5 C;  2KIS A;  3DTE A;  2JSC A;  3TKY A;  2STW A;  1IN5 A;  1WJA A;  1YRN A;  4C2U A;  2DOA A;  4ZYD A;  2OCC H;  2HDD A;  5L3D A;  3FK6 A;  1BW6 A;  3ML6 A;  2F5D A;  4IOC F;  4I76 A;  5D6E A;  4DOZ A;  4CDG A;  1GV2 A;  4E7J A;  3BOQ A;  3IC7 A;  1KQ0 A;  4O6J A;  5E1Z B;  2ID6 A;  1P7I A;  4P9F A;  2M5W A;  1XGS A;  3W6J B;  3JSP A;  1WPK A;  1GLN A;  1TQM A;  1KU2 A;  2JRM A;  1APL C;  1S3J A;  1MBH A;  3H92 A;  2ZJR F;  2O8K A;  4I0B A;  5AIQ A;  4KYW A;  4IHX A;  5EG0 A;  1UST A;  4OOI A;  5BMZ A;  1IUY A;  1IDZ A;  1FMW A;  4CCL A;  2DDB A;  1XG1 A;  2MLG A;  3WTT C;  1U3E M;  2N8G A;  3I53 A;  1R1U A;  1MZB A;  1W0U A;  5IOY A;  1TL8 A;  3K70 C;  2BYV E;  2R7R A;  1W5S A;  4XLN F;  4UHT A;  5GTI C;  1RRJ A;  2X6X A;  2L7M P;  3TGN A;  3K10 A;  2A3S A;  3A02 A;  2M4K A;  1ON2 A;  1UHM A;  5D4R A;  2P7V B;  3I4P A;  3KX2 A;  3ABM H;  5DCM A;  4BHP A;  4BDZ A;  2Y2Z A;  4ZZL A;  3DBL B;  1VQP I;  4N9H A;  3IAM 2;  3BTI A;  1X4P A;  4I0A A;  3CCY A;  4CCK A;  4M3F A;  4E7K A;  1O3R A;  1PVE A;  4Y3O A;  4MNU A;  1Z6R A;  2IXS A;  4L5E A;  2XAG A;  3RKX A;  2A6E F;  3HTU A;  3MKZ A;  3LL7 A;  2MYS A;  4N4O B;  2X85 A;  3ECO A;  2XB5 A;  3JW4 A;  2LY9 A;  4NHJ A;  3P7N A;  2K3P A;  3OV8 A;  4HOB A;  3CUQ C;  2OZU A;  1ETQ A;  1WCM J;  3HOS A;  4U7B A;  1RR7 A;  2FJ1 A;  1TC3 C;  2NRA C;  2XKP A;  3SFZ A;  4HLY A;  2QSH X;  1D3Y A;  2FNA A;  2VPR A;  2Z99 A;  2MC4 A;  5E3L A;  1BC8 C;  4ENK A;  5K7H A;  2LY2 A;  1PJR A;  2COM A;  2ID3 A;  2LSO A;  3AG4 H;  5CVU A;  3ERM A;  3J81 K;  1VQO I;  1ETX A;  3MCZ A;  1A31 A;  2LBF A;  3PO3 J;  2OAZ A;  2LTP A;  4BBR J;  2WV1 A;  2R7O A;  5D6F A;  2GM4 A;  4C2T A;  2YUS A;  3EET A;  3HUG B;  1Z6T A;  1QPM A;  4A0Z A;  3ERE D;  3TW6 A;  5E17 F;  2VBY A;  2HZD A;  2Y0S A;  1Z21 A;  2B0L A;  2WWY A;  4RB0 A;  4BL0 B;  3HM5 A;  3A0B C;  5F0F A;  1JKP C;  3QYB A;  3ZMS A;  4IHY A;  5B1B H;  1X3U A;  2QKM B;  3BJO A;  2OV7 A;  1T2K A;  1KZH A;  4UXN A;  4DZJ A;  2CUE A;  4EM1 A;  4FX0 A;  4LK1 F;  1EJ9 A;  4FE7 A;  3AKZ A;  2ECC A;  4G7O F;  1IDY A;  2DBB A;  4B09 A;  1WWX A;  3ZCO A;  2E36 A;  4KT6 A;  4BQO A;  3KEO A;  3S2W A;  5F6F A;  1B8I B;  1V4R A;  5L3C A;  3W2W A;  4L0Y B;  3DEE A;  4Y15 A;  5FLX Z;  2H8R A;  2E19 A;  4U0V A;  5FLM J;  1O7F A;  2GA2 A;  5GAG J;  2HZT A;  2W82 A;  4RDU A;  4EQQ A;  3MMY B;  1PUF A;  1BI3 A;  3QP6 A;  3OYN A;  2IVM A;  3BG7 A;  4KMU X;  3CDH A;  4RGR A;  2ZKZ A;  3SJM A;  3I71 A;  3OL3 A;  2K5C A;  4C9Y A;  4MQV A;  2M2E A;  1SD5 A;  2DA6 A;  3J7A Y;  1ZGA A;  3E6D A;  3HOX J;  1FX7 A;  1ZRF A;  1T95 A;  2XF6 A;  2L0K A;  4L9V A;  4XKW A;  2GXB A;  4DQ2 A;  3FIS A;  2Y75 A;  1G4D A;  2G0E A;  1LUJ B;  1POG A;  5M3M J;  3OWT A;  1SD6 A;  3H5N A;  5HNF A;  3LSK A;  1K4S A;  1OCP A;  3W2A A;  3HSE A;  3AG2 H;  1NK2 P;  1W1W E;  4DZP A;  1DU0 A;  2GQQ A;  2XC7 A;  3OR1 C;  3PJR A;  2DA5 A;  5FLV A;  3WHC A;  1UHS A;  3ULQ B; 
#chains in the Genus database with same CATH homology
 3G6E I;  2FOW A;  1S72 I;  3CF5 F;  1QA6 A;  1VQN I;  1YJN I;  1VQ4 I;  1Y39 A;  2QA4 I;  1YHQ I;  1VQ6 I;  2E34 A;  2E36 A;  3CCM I;  1YJW I;  3PIP F;  3J7Z I;  4IOA F;  1YJ9 I;  2OTJ I;  3PIO F;  3CCQ I;  1YIJ I;  5JVG F;  2ZJR F;  3I56 I;  3CD6 I;  1YIT I;  2QEX I;  4IO9 F;  1HC8 A;  5GAE J;  1VQ7 I;  1VQK I;  1ACI A;  2NXN B;  3CCV I;  1VQP I;  2OTL I;  3CC2 I;  3CC7 I;  4UY8 I;  3G4S I;  2ZJQ F;  3CCR I;  1VQL I;  5GAD J;  5GAG J;  5GAH J;  3I55 I;  3CCS I;  4V19 K;  2K3F A;  5DM6 F;  3CCU I;  1MMS A;  3CCE I;  3CMA I;  1VQM I;  1FOW A;  3CC4 I;  3CME I;  3DLL F;  1VQ5 I;  2H8W A;  2ZJP F;  5DM7 F;  1FOY A;  3J7Y J;  3G71 I;  4IOC F;  1VQO I;  1YI2 I;  3CCJ I;  1VQ9 I;  3CJT B;  2JQ7 A;  1FOX A;  2E35 A;  3CCL I;  1VQ8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...