1VQMI

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqmI00
1FOYA 2E36A 5GADJ 3PIPF 1MMSA 3PIOF 1VQ4I 2ZJRF 3CCSI 3I56I 1VQLI 1VQ6I 1VQPI 2H8WA 4V19K 1YI2I 2QEXI 1VQ8I 2OTLI 5DM6F 3G71I 2ZJQF 1YIJI 5DM7F 5GAGJ 3CCQI 2QA4I 1VQMI 1YJ9I 5GAHJ 1YJNI 4IOAF 3CC4I 3CC7I 3CMEI 2OTJI 3J7YJ 2ZJPF 2E35A 3CD6I 3CCVI 3I55I 1Y39A 3CCEI 5GAEJ 1VQ7I 2NXNB 3CCJI 3G6EI 3G4SI 3CCMI 3CCUI 3CC2I 1YJWI 1VQNI 3CF5F 1YHQI 1VQKI 1VQ5I 1FOWA 4IO9F 3CJTB 4UY8I 5JVGF 2K3FA 2FOWA 1HC8A 1YITI 1VQOI 1QA6A 3J7ZI 3CCRI 1FOXA 3CCLI 1ACIA 1VQ9I 3DLLF 1S72I 3CMAI 4IOCF 2E34A 2JQ7A
chains in the Genus database with same CATH superfamily
2PI0A 5HS8A 2VXDA 5FFXA 1OCOH 3DQVC 2HR3A 4EJVA 1RESA 4HA8A 3CMYA 3LFUA 2O8XA 3QAHA 2K9LA 1RNLA 3ZRGA 1B72A 3KEOA 2GLOA 1ZR2A 4F7ZA 2XB0X 4NC8A 5FKMA 4DYRA 1W7PA 1X3UA 1FYMA 5D4SA 3PFIA 2VKVA 1R1VA 5BOXA 2ECBA 5D5UB 1I1SA 2DA4A 3FX3A 3I58A 2ZJ2A 5C44J 2EFNA 3N4MA 2HS5A 3J7AO 4M9ZA 3TO6A 4N4NB 2W00A 1E3PA 2L4AA 2RQQA 4ANJA 3OYIA 2KPMA 4Y52J 4PJMA 1MH3A 1SD7A 2CO5A 2M87A 3ASOH 3VYRB 3RZDJ 4B47A 2O6GE 4EATA 2DCEA 2VBWA 4NQWA 2RREA 2HNHA 2H6CA 2WC2A 3WTZA 1YRNB 2V9VA 3Q3SA 5EG0A 2QA4I 4KMFA 4XBFA 2VIXA 4G9YA 4ZYDA 2FU4A 1R1TA 5DEQA 4IXAA 2JRMA 5EEGA 1ULYA 3TDUC 2RN7A 1OR7C 3OYNA 3EYIA 1I5ZA 4XM3A 1LB2A 2HKOA 2ZNYA 3ERED 4L5JA 1SVLA 3D1NI 3IC7A 2PMUA 3DBLB 2OJED 1U5TA 1D0XA 2VKDA 3MCZA 1FYLA 5FLVA 3GTGJ 3DKXA 1YW9A 3OV8A 3NRVA 1G59A 4M3EA 4AM3A 2DODA 4LGWA 2HWVA 2FRHA 3SZPA 1YW8A 2EA4A 2VQHA 1B6AA 3OYAA 3GZ5A 2MGQA 3SYTA 3OYBA 4L18B 3S2HJ 4RAZA 4C3HJ 3F0CA 1AA7A 1MBFA 2V9KA 1MD0A 3L2WA 4ZTFA 2JJ7A 3HOXJ 1IRFA 3PUBA 2FQ4A 2W82A 5FROA 4JK1X 4Y13A 4HV5A 3JRAA 3BG9A 1TBXA 5BQTA 3FMRA 4PJNA 2LF7A 1Z7LA 3FXOA 1K7AA 3BQYA 2E2JJ 3U1DA 3E6DA 3JRHA 1RPWA 4XLHA 5ERIA 5K7FA 2Z33A 1LDJA 4M73A 1TL8A 3I4NJ 1K78A 5H6QA 4C30A 1I27A 5KHDA 3CMAI 1YTYA 4I99C 5LGUA 2F4IA 3RYRA 1H88C 5HS9A 5FJ8J 2EFQA 1UFMA 4PJ0C 1MBJA 4PGGA 3GUDA 1XD7A 4C3JJ 4CGZA 3BPVA 4XK4A 2XGDA 4AIJA 2K9QA 4U0WA 4E7IA 5E79C 5LHHA 4BE1A 2MD0A 4HW0A 4ZDLA 1VTNC 3MKLA 2JA6J 4L0YB 1K61A 3ZCOA 1I6XA 1R71A 3C2HA 1NTCA 1R4NB 4U7BA 2YR2A 1SVMA 2KL4A 3FKIJ 3B6AA 2EA2A 5C3EJ 1YX3A 1YO5C 4HF0A 2ME0A 4JYKA 4ESJA 3RI4A 2XAHA 1MJBA 2ZJQF 1FBQA 3CP2A 1HXDA 1S7OA 3B02A 3C3WA 1ETWA 3CUOA 4AC0A 1DGWY 3A0BC 2Z3YA 2JZYA 3GWZA 1KQ9A 2HDDA 1KA8A 5HNHA 2GIVA 5HDKA 3KLNA 4LLNA 3K2AA 5B3SH 2R7UA 4LLLA 5CVVA 3BJ6A 2CV1A 1SMYF 1D1BA 1UHWA 2QQBA 2DA3A 1ZGWA 3K9TA 4KIGA 4U7DA 3GXOA 1ZLKA 2HGCA 1FIAA 3K4CA 3OY9A 4MQ9F 2L54A 3NWTA 3GTQJ 3K70D 3L2RA 2K4BA 4AUXA 2BY3A 3HJEA 3VOEA 5M3MJ 2CQNA 3KE2A 2R7WA 1X2NA 5IY5H 2R7QA 1BOBA 4GXOA 5F27A 2GM4A 2DDAA 4G7OF 3K4LA 1XSDA 4QWQA 3HOVJ 4IHVA 3LSTA 3LSKA 2E1CA 3E5XA 2ZMEB 2R5YB 1VI0A 3BZKA 5FKKA 5LHGA 5FRNA 1JUMA 3BJAA 1R6RA 4RS8A 2DMPA 4KMUX 5HDNA 4M6VA 2DPDA 4NC7A 3H35A 1MMGA 1LQ1A 1O3RA 5EDNA 2VJ4A 1ZKGA 1Q1HA 2HTSA 3ZMUA 3M1EA 2DAOA 1YHQI 3DLAA 1QBJA 2JUCA 2V1UA 2QBYB 1OCPA 5J8CA 5L3BA 1YYVA 1IDZA 3BROA 2K3FA 2DBBA 4KN4X 2EB7A 1HKQA 3DV8A 1VQOI 5DUKA 2FNPA 2OBPA 1S7EA 3I64A 2E7WA 2CFXA 4RGXA 2VKHA 2JA7J 1PUEE 3R4KA 2DMNA 1SFOJ 4IKFA 2HVRA 1FOYA 3MKYB 1JKOC 4EQQA 1TQPA 2JUGA 2V4JC 3GF2A 3O3KA 1S6LA 5GADJ 3C18A 3OSGA 2L02A 4DZJA 4R8HA 5D5WB 4OIRF 2LY2A 1B72B 4U88A 1IUYA 2K3PA 3IH2A 4W97A 3WE3A 1W7PB 2VI6A 5JFRA 2QSHX 2D2WA 1Y0UA 4QIWN 4B3AA 3D0SA 1J9IA 1P7IA 1BR2A 5J4YA 1ZARA 2A05A 2GZWA 1O57A 2M34A 3A1YA 3IKVA 2KDOA 2VB6A 2FBIA 3ZOBA 4WCGA 2LKPA 1ZHFA 3OS2A 2Z2SB 2CMPA 2DQRA 3E6BA 3IRRA 4JX6A 4XKBA 2O0YA 3GTKJ 3S2WA 2ID6A 2JN6A 4BHPA 1FPQA 1YIJI 3PO2J 2L7KA 1YQAA 4XKCA 3WTYC 1TZLA 2CWEA 3QP5A 1QNTA 2EH3A 3ML6A 2IEKA 3H36A 4I7HA 5GAGJ 3CCQI 1P2FA 5EG0B 1W1WE 4M74A 1YOVB 3HYIA 3BY6A 4RAGA 5DDGA 1W36C 2VASA 1HSJA 4PCQA 5LRRA 3AL0B 1AOYA 3CJNA 2IW5A 1MJAA 4ENNA 3Q9VA 4P1WA 1IRZA 3HTUA 2GQQA 2PN6A 3SQNA 3CC7I 1GT0C 3L9FA 1V5GA 3WE2A 4UUVA 2IGNA 2RV8A 4EM2A 3J7AY 3FKJA 2X0LA 3KEYA 5ILUA 1OYIA 3BTCA 5BNGA 2KISA 3U1KA 5E20A 4NHJA 1KYWA 2I5UA 1TWGJ 3HOUJ 2XPUA 2Y30A 1T95A 1FYKA 2BGCA 3SZTA 4CO8A 1Z21A 2F48A 1JUSA 4DYQA 3Q0VA 3ZQ7A 5JHUA 1VQ7I 2CU7A 3HOTA 2CG4A 3OL3A 4B48A 3GFMA 1BC8C 2G7HA 3J81Z 3CC2I 1JGSA 2CJJA 2MYSA 3I9V2 1VQKI 1FOWA 1QRYA 4E7HA 1XG1A 3RIRA 4J01A 2CW0F 1OCCH 3BT9A 1HW2A 3I4PA 3I54A 1VF9A 3IUOA 1U8RA 4BGDA 1K78B 3KP2A 3CCRI 4RM2A 3AG4H 4ZZDA 2M30A 4C2TA 2NYXA 1Y56A 1S72I 2LBFA 2TCTA 3W2WA 2E1NA 2QWWA 3FBIB 3HEFA 2DXIA 4ZC3A 2E36A 2M0MA 2A3SA 3PIPF 5IP6A 1R5ID 1MBKA 1BR4A 2XPVA 3BCBA 3BR3A 2GWRA 2OCEA 3O2PE 3GZNB 5ICGA 1HDDC 5AIPA 1GLNA 1IW7F 5F08A 2DA5A 4UB6C 5DUIA 1TW3A 2OA4A 4V19K 1MH4A 2NVQJ 5KAIC 4KT5C 4EGZA 4HNUA 1JJ8C 1UHSA 2YS9A 4ZDPA 1VQ8I 4ESFA 1G2HA 3FMSA 2OTLI 3FK6A 5E1XA 1SANA 1DPRA 1X58A 1IV6A 3ZN1A 1HW1A 2CW7A 2KT0A 2M7AA 4EJOA 1LKXA 4HYEA 5FGMA 1WJFA 2VE8A 3KYCB 1LNWA 4E7ZA 4BJ5C 5LEJA 2JK3A 2KIUA 1R36A 5BMZA 4E7LA 2CH0A 3NWSA 3S15J 4XLFA 2CQXA 1XDSA 3WTSC 2XV4S 5J1UA 4ZYGA 1P4XA 3DFGA 4ITVA 2R0QC 2E71A 1I39A 3OYGA 1IAWA 1EF4A 2DFEA 4FQGA 4CCNA 2XDVA 1APLC 1JI8A 2KIMA 2HPIA 3QOPA 1OFCX 2JSCA 5F1RA 3IWZA 3V7RA 2DTZA 4BJ6C 4CZZA 3J81K 3GTOJ 5D6FA 1IN4A 4ZYHA 3DXJF 1BI3A 3TDZC 1IGNA 3ROUA 4CHUA 2M1BA 1IXRC 3F21A 2LF8A 2QKLB 4MHGA 3WGIA 2WWYA 4RLFA 3AKZA 2IGMA 1XMXA 5J1RA 3MN2A 1FY7A 1XPXA 2M7BA 2VLAA 2M9HA 1X4OA 2HFHA 2A61A 5HNFA 1I50J 2VBYA 2JWTA 5J3LA 1VQ5I 5F0HA 3KP4A 1IN8A 3HRTA 3DP7A 2B0LA 3B73A 1Z6TA 5HLHA 4UY8I 4ZZLA 2ZO4A 5HLGA 4A3BJ 2DJNA 1Z3XA 2B63J 2PQ8A 3P9CA 3V8JA 3CDHA 4BKXA 4Z6YA 4II2A 2COBA 4ESBA 1I1GA 1S5LC 1KQ0A 1FWZA 1S7AA 3ZMSA 1RR8C 3N97A 2PJPA 1ZQ3P 2XB5A 2XPWA 2F2EA 4H0EA 1ETVA 2ZXIA 4BQQA 2BY0A 4HRIA 1Y8QB 5LEKA 4HDVA 2DA2A 2HXIA 3DBHB 3PSIA 4ZH4F 2AS5F 5LGNA 4ENMA 2BVMA 2EJRA 2LP0A 2KRHA 1SFKA 1UZCA 1RUNA 2XUBA 3MEXA 1ZELA 4DQ2A 3QODA 3HHHA 4CH7A 1OISA 1GVJA 1QHGA 2Y0SA 1OKRA 4NB5A 4BDZA 5FD5A 2DOAA 3TL4X 3HKZN 1HKTA 2CRGA 3LSIA 1TLHB 4YEJA 4YIRX 1ZRFA 4BNCA 4DGWB 1E3OC 4II3A 5D6EA 3SFZA 3ZN0A 1K6OA 3TBIA 2WAQA 2Y75A 5DM6F 2NVYJ 1MMAA 2CQ7A 1XB4A 3Q5FA 4A3JJ 2KFDA 4JOMA 2NVUB 5B5EC 2MFZA 2W25A 4BEHA 2FQ3A 1H89C 4IRHA 2A5YB 1CF7A 1WJDA 3K4NA 1R49A 2MABA 1NG6A 2DMQA 2QKMB 3WU0A 2UXXA 4UUTA 3I53A 4S0HB 3V4GA 2CV2A 5D4RA 2X4HA 1K6YA 1Z3YA 4HOBA 2F5DA 4XKWA 3JTGA 4D1QA 2FNAA 3BG3A 3KETA 3QYFA 1SD5A 3F22A 3QPLA 3DU6A 5E3LA 4CUGA 2E2IJ 2VL8A 4IF4A 1S8NA 2IP2A 2BXZA 4EM1A 3AAFA 5CLSA 3T0YA 3MMYB 3IP4B 3OYKA 3LSMA 1Y39A 4P5OA 1RETA 5EEHA 1ZRCA 5L3FA 2NS8A 1X1CA 4M9SA 3L2QA 2A6TA 3HUGA 2P6SA 4DYCA 1TNSA 4OU0A 1XSVA 3TOBA 2XKOA 3REOA 3G1LA 1XCBA 3OL4A 2B7EA 1DP3A 4IJAA 3FF5A 3WTWC 3SEZA 3QQAA 4DBQA 3K10A 3BWGA 2DMTA 3F8FA 2D5VA 1XCVA 4D5CA 2LBFB 2OCCH 4DBRA 1IC8A 1VQ9I 3IHUA 5ILVA 3HDDA 5KCMA 3ULQB 2EFOA 3O8GA 5D5XB 3PNTA 2A69F 2YX4A 3EYYA 1K83J 3BTIA 3PIOF 3QWLA 1WH5A 1OCRH 5GPAA 2LYCA 5H20A 1MBGA 3QYBA 3I4MJ 5JHFA 2FXAA 2EZLA 1ENHA 1FZPB 1QZYA 1RR7A 3VYTB 1VQLI 3KLOA 4U87A 4XICA 2X48A 1RI7A 2Y0SN 1Y8RB 4I2OA 3HC7A 5FKOA 4RAFA 2KJBA 5E3MA 4KISA 2HOEA 5CVJA 4P55A 1JT0A 2E5NA 1TWHJ 2CYYA 1ZLJA 2L3DA 3HGGA 2VKEA 4RB0A 1R00A 4PSXA 2UWMA 2L0KA 4YFKF 2DK8A 2AHQA 5M5WJ 3JW4A 2IRFG 2O3FA 4MO7A 1ZK8A 3WG9A 3CUQA 5B1BH 4FCYA 1U6GA 2OF7A 3C7JA 1ERDA 3K70C 5HDGA 4XRFA 1XS9A 2WV0A 4HG2A 1VQMI 5HLTA 4DJAA 1GHCA 1REPC 2DYSH 1YJNI 3DWLE 1LDDA 2P81A 4M3DA 3ZMDA 2EILH 1SFXA 4PDKA 1GVDA 2XGCA 1X2MA 4OAZA 4UV8A 3ZGKA 1DUXC 3A4CA 1OCZH 3RQIA 1T38A 4X0GA 4NBQA 4JQFA 1C0WA 3RPQA 3NARA 2H8RA 1EH8A 4PJLA 4ON0A 4CICA 2R7VA 3VSKA 4ZTJA 1G3SA 3FXUA 1IXCA 5ICCA 4IQ4A 1VFCA 4A3LJ 4XL9A 1QVUA 2LDUA 1ITYA 5TJJA 4C9YA 1SVOA 1HLVA 4L9TA 3BR1A 1FX7A 3S8PA 1BIAA 1Z0XA 2PMZN 3TEDA 5IOYA 3QRFF 5E1WA 3OYLA 2IS1A 3ECOA 2IJLA 5HLIA 1T33A 5IP7J 3TO7A 4FE7A 2P5KA 3W2AA 1L0OC 4A3MJ 4MTEA 4FX0A 3BR5A 4IRGA 5EGOA 2J5OA 3H5AA 3J7ZI 2IGKA 4YG2F 5BPIA 2EK5A 1USTA 4L9JA 1PP7U 3J80Z 1X1DA 1ZG1A 2L2OA 4F3QA 2M4GA 1J5YA 1G3YA 3BQZA 4LK0F 3GFJA 3RPUD 1MMSA 4YFXF 2V1NA 2HZTA 1AHDP 2K27A 3E5QA 4R79A 3PJRA 2LG4A 4JBAA 3M3YJ 4G6TB 3F23A 4HNVA 1Z7UA 5K5QA 3LSPA 4KDPA 2HOAA 2LRDA 4B1RA 3KX2A 2Z99A 3BZCA 2DK5A 2X85A 1LE8A 1QZZA 1HSTA 1LUJB 4XOPA 2LK2A 2AQFA 1P4WA 1YI2I 2P7VB 3CQZJ 1OPCA 1A6IA 2IA0A 1N78A 3L2VA 3RKYA 4U0YA 3HOSA 2R7RA 2EIKH 3TO9A 4OIQF 4HNTA 3M1CA 4DNCA 2R92J 2X6WA 4BEHB 3HRMA 5TRDA 3AFHA 3GFIA 3W3CA 2IS6A 1CF7B 2YU9J 4O5VA 4LG0A 1EV7A 5B66C 5F0CA 3ZQCA 1B9NA 3D5SC 2K02A 3DEWA 1BOAA 4RGUA 1Q1VA 3BG5A 4FTHA 1LVKA 2LY9A 5K7ZA 5D5VB 4HLXA 5C4JJ 4LB5A 4D9JA 2AXLA 1NK2P 3PUFA 3L09A 3TKYA 2ETHA 4RB2C 4CSWA 2M45A 2WTEA 2IBDA 2L4MA 3A03A 1MSEC 5IT9Z 3JAMZ 3ZXSA 2BBYA 4F52A 2H09A 3PQJA 3LFKA 1RC9A 3BG6A 2Z9OA 4A3GJ 4E6KG 2NRAC 2GOMA 2L9VA 1XGNA 3MFKA 4E4HA 3PFYA 3HOWJ 2HU9A 2KZVA 1FOKA 3JCUC 2FSWA 2K85A 3KP6A 1WZ2A 4EMSA 5LHIA 4BH9A 3HUGB 3CO7C 1D5YA 2V26A 2CV0A 4OMYA 3T1BA 2HQNA 4BBRJ 2DOFA 4Y15A 3O8HA 5J47A 2BE5F 2ZBKA 3DF8A 3FXJA 1MBHA 2K4JA 1JJ6C 3I5UA 2VONA 5L3DA 2L9RA 2F5EA 1EKEA 3EUHC 5H2FC 1N75A 3J80K 3IAS2 4XN3A 1L3LA 2W84A 5JI6A 3JTHA 2PJRB 1JHHA 1X3WB 2FOWA 3FHNA 4F55A 2W7NA 1I6HJ 5DCFA 1YITI 2CFOA 2STTA 2J5PA 2L7FP 3CCLI 3ZQLA 2JSPA 2X1DA 1MIJA 2XHKA 5E3NA 3UKGA 1RKTA 4WX9A 3GBGA 4PJJA 1D3YA 2E34A 2V6EA 2DLLA 2XAFA 1O4XA 4CA0A 3HSEA 5F6FA 1VNDA 2L7ZA 2XIGA 3OYDA 4JP0A 3HB9A 3ZP5A 3DPUA 4PUSA 1BW5A 4JX4A 2BV6A 3DCFA 2BYVE 3H92A 4I98B 3DTEA 3LSRA 1DU0A 5AIQA 1HW5A 2QVOA 3AG2H 3FXQA 4A3IJ 5F04A 3ZQQA 2QLZA 2WA0A 4KJZA 2I10A 1R9TJ 4XOTA 2QEXI 3C2BA 3L2UA 1FJLA 4A6DA 1GUUA 2NVTJ 3CF2A 3G1MA 4OMZA 1ZH5A 2COMA 2W1OA 1P6RA 1S3JA 1YLFA 3DTIA 4MQVA 3SXYA 3BDDA 3V7SA 4M3BA 3OYFA 1EH7A 4Q47A 5J8FA 1OYYA 1HQCA 4J00A 1WPKA 1UMQA 2EZHA 4A3KJ 1ZGAA 2V1XA 2JMWA 3E97A 5KAFC 5IT9K 3CUQB 4HX8A 4V2FA 3JAMK 2YSRA 1E0EA 4BDYA 2OAZA 2FBHA 1WGXA 3TMOA 2V79A 2OQGA 3QP6A 4M6XA 1TNTA 2Y69H 5K1YA 2UV1A 2AO9A 1YJ9I 2E5ZA 4A93J 2ZMEC 1UELB 2P0WA 3U9GA 6PAXA 1DGRM 1UCRA 1YS7A 2DJIA 2M0CA 3A02A 2TRTA 2GIZA 4YRVA 2MH9A 4NQWB 4L0ZB 1I3AA 2WV1A 4LMYA 2IA1A 1AWCA 4BE0A 2XAJA 4BBSJ 4L9NA 1LFBA 5JLXA 4EV0A 1WRJA 3IV5A 2LREA 1KYZA 1ZG3A 1MDMA 2MW8A 1TQMA 2KKOA 5GTHC 2LD5A 3RQ4A 1IUFA 5C4XJ 3G3ZA 1ETQA 1TW2A 3QPTA 4QTRA 2VODA 3KEQA 3HHGA 4MFDA 2XVCA 1Z1DA 1A35A 4HEA2 1FP2A 1VQNI 4DZPA 4CCMA 2FD5A 1I3QJ 3CF5F 2Y31A 1MW7A 1S29A 1U5TB 2K9MA 1FTTA 2Y48A 1MGTA 3H0GJ 3A01A 1JKRC 4RBOA 3OOPA 5EGOB 3F8CA 2YU3A 3GTMJ 1Z05A 4WXHA 3HRUA 2AXTC 1D0ZA 1XX5A 4I76A 2P7CB 3TOAA 1IN7A 3CMMA 1HBXG 3JREA 4HX4A 5CQEA 3NEUA 2GA2A 4IOCF 2A07F 3MQ0A 3P7NA 2D45A 2H1KA 3ESWB 2LSOA 4DW6A 1U0JA 1D8JA 2K7LA 3RZOJ 3B6CA 4AIHA 4HDUA 4N4OB 4RLQA 3S16J 2P5LC 4I01A 2XGXA 2QM3A 2VN2A 3MZYA 3TW6A 2DT6A 1LE8B 3HGYA 3E1SA 3GYHX 2V6CA 4ENJA 2VE9A 4A0YA 3VSLA 4GO1A 2Q1ZB 3HOYJ 3M8EA 3H3UA 4HSRA 3BZ6A 4MNUA 3H3ZA 4GRIA 2MC3A 3AL0C 4KICA 1QQIA 3SDGA 3I71A 3GW2A 1BI2A 3H9GA 4XNFA 4XONA 1W4MA 2JVGA 2ZB9A 4LG0B 1JKPC 2KP6A 1IZ1A 1KU9A 1KU2A 4HX7A 4XKVA 1MBEA 3P9KA 3EQLF 1J2XA 3P5JA 1U5TC 5HVQC 2QQ9A 1DDNA 3TW7A 1HCRA 2DDBA 2JA5J 3WU2C 2EIJH 3T8RA 3LA2A 3CZ6A 1SD4A 1OJLA 5J6XA 1SAUA 4QPQA 3HM5A 3WU1B 4PFOA 2LY1A 1D0YA 3JRFA 1D1AA 2OTJI 1P4AA 3ECHA 3H9JA 3VEPA 2IA2A 2IXSA 2O8KA 2K5CA 1FIPA 4L5IA 2R7SA 3JSPA 3H5NA 5DS9A 1B9MA 1TT5B 4M3GA 3FXKA 3IH3A 3IRQA 3D5LA 3FIWA 1HOMA 2Q2EA 2ZXJA 1KONA 3LWFA 4D5FA 3FHZA 1YS6A 1BR1A 4KT6A 3R60A 2HDWA 4A3EJ 4CYCA 4BHCA 3CCEI 1A04A 1OR7A 4CCLA 3S3OA 3U2RA 1Y0NA 1WCMJ 1U2WA 4M71A 2HYJA 3MKZA 4N0BA 5FRMA 4B43A 4BACA 1SD6A 4QSHA 2X1CA 3COAC 1D5VA 2LC2A 2E1MB 4IO9F 2KZGA 4YELA 3VFZA 1G3TA 2R3SA 4PZJA 3SDBA 3U21A 2VUMJ 4WK8F 2VOPA 3OMYA 1IDYA 1BBYA 4PGHA 1MKMA 2DYRH 1J75A 2LR8A 3E6MA 1HC8A 4WXCA 4F91B 4S05A 3S3NA 1QA6A 4XLAA 4KYWA 3F8MA 4RB3C 5LFAA 1IN5A 2WY8Q 3BR2A 2ZC2A 3K1NA 4AD9A 1QZEA 3FBNB 4EM0B 2V1DA 2LLKA 1LVAA 3EDPA 1JHFA 2FMLA 4N9IA 5FKLA 3OS0A 2EWNA 3ZQIA 2G7UA 2W4SA 2ZJRF 3F8NA 5DD4A 1FNNA 4I02A 4MEYF 4G8XA 1A31A 1V55H 3EETA 3FISA 4BXFA 2DT7B 3GVAA 3WHBA 1G4DA 4A3FJ 4FX4A 4Y17A 4CCKA 2MA3A 3BTJA 3CDLA 5LD2C 4UVBA 2OZUA 5JR3A 1ZRDA 3ZQHA 1W36D 1ZR4A 3V8LA 2RQPA 2PLYA 1XGSA 2BW3A 3LQRA 5DM7F 1KQ8A 5DYMA 3FM3A 1FBUA 1H0MA 1X1BA 5BS6A 1V5EA 3DBRB 3HIFA 3F6OA 3H9QA 5F1JA 1K4SA 2W57A 4HLYA 2QQAA 3UR3C 4UVAA 2ZCWA 5CYVA 5CJ9A 2XF6A 3ZMVA 3QYEA 2P8TA 1OMIA 1E3HA 2TDXA 2LNBA 4IHSA 1A6QA 2ESNA 4YIFA 3RKXA 2E2HJ 2LFBA 3M9AA 2ZSHB 4R1HA 4BQOA 2ZJPF 1F5TA 2WB1A 4QPOA 2R7OA 2JA8J 1RKWA 3KZYA 1LEBA 3T8TA 1U3EM 3CD6I 4LJZF 4AWXB 1WJCA 1MDMB 1BM9A 4BYYA 3C2GA 2F5FA 2GXBA 1R7JA 2RC4A 2HI3A 1PDNC 5IYBJ 3DPLC 2OZ6A 3HPGA 1UB9A 5L3GA 2K9SA 2VJIA 4IL6C 1XC5A 2FE3A 3E5UA 3CCJI 2JPBA 1IN6A 3ERMA 2E7XA 2BHZA 5DTDA 1KU7A 2EZIA 1F1ZA 4LD5A 2HOSA 4KNYA 1YJWI 3CP8A 2MH2A 1J7KA 9ANTA 3TQNA 1GV5A 2H94A 4AVZA 2HQAA 3A01B 1RRJA 1RIOH 2L01A 1FSHA 2Z16A 4UNOA 2LTPA 4Y3OA 5HOOA 4IPAA 3VYSB 2I8DA 3K4MA 3R6SA 4EJUA 1RZ4A 1JE8A 1WQ2A 2R4GA 3BTLA 4LOCA 4M72A 1IF1A 2H6BA 2P4WA 1U9OA 3L1PA 3MAJA 3OYHA 2RAEA 2DOEA 1MSFC 1E2XA 1ZREA 2NS0A 2W24A 4FASD 2HVQA 1U9NA 2IT0A 2XKPA 2F4MB 1GV2A 3T5XA 2IGOA 1VZ0A 2EBIA 4A5MA 1ETXA 3CJQB 4HAMA 3PQKA 1V4RA 4MLOA 4LFUA 1N77A 2H8WA 5E17F 4RB1A 2H1LA 5A2QZ 2P5VA 4ABZA 3K1MA 1FLIA 2WAFA 1IJWC 1MNMC 1STZA 2HDCA 2VOOA 4IHTA 1NG7A 2STWA 1QPIA 4NUBA 2FMYA 3W6VA 2ZNZA 1NH3A 4F93B 5JVTA 4KFCA 3FXLA 3BR6A 3R0AA 1Z91A 3F8BA 2L7MP 3G1OA 2HPMA 4UHTA 2LMDA 1MMDA 2R5YA 4QLCU 2EQRA 3VODA 1J59A 2HOTA 2BHYA 3R0JA 4LG3A 4YIIA 4KITB 3QU3A 2OD5A 1PP8F 4IOAF 2XSDC 2QYOA 1EH6A 2O7OA 2DW4A 4HQMA 3HG9A 3KP5A 3VDXA 1ZN2A 1QVTA 1HKSA 2WAQN 3K7AJ 2QSFX 3W6JB 3DEEA 4UXNA 4KN7X 1XMAA 1W5CC 2N8GA 2DA1A 2XAQA 4BJTA 3JRDA 1OLTA 2E35A 2Q2EB 4XR6A 5DD8A 2C6YA 3CESA 2DU9A 2CUFA 4CYCB 3AG3H 5FLMJ 3GX4X 2H27A 4CCJA 1D8KA 2HZDA 1FP1D 2M3AA 4EJTA 3S1RJ 4HSTA 1POGA 1YX5A 3P9IA 3TP3A 2M4KA 3ZR8X 1ONVA 3VWBA 4AIDA 3QOEA 1IV8A 1F36A 4I09A 1E17A 2KIQA 1G8XA 3MKWB 1SAXA 2KLOA 3MZ8A 4J19A 2CUZA 2W85A 4GYIA 4IX7A 2DN0A 4ENKA 1BI0A 1P7JA 1ZGJA 3VYUB 2JQ7A 1JUPA 4RMNA 1WFXA 2Q8KA 3WGGA 4S04A 5A2QK 2CUJA 2CGPA 2JRTA 5B1AH 1ORKA 3OIPA 3FMQA 1ZTRA 3BPXA 1BL0A 4KIBA 3ZQGA 1T08B 1T0FA 4N9HA 1ETKA 2GBYA 4LIVA 2AQEA 2ICWG 4I0AA 2OV7A 3NAUA 2ELJA 3I59A 4OINF 1Y6IA 3V42A 3WTUC 4ZYEA 2CSOA 1ETYA 2ADUA 1HDPA 3L2CA 2XF7A 1EJ9A 5DCMA 2BW3B 3VPRA 1G3WA 3G71I 3ABKH 4OWRB 3FM5A 2P6TA 3LOCA 1K4TA 3PO3J 1H9GA 2B9SA 2HYGD 2FA5A 4ZJZA 3PL8A 4M6YA 2D1HA 2VQLA 3H5RA 5J1YA 4BQNA 2OPTA 1PJRA 1R5GA 2CW8A 3FK7A 4GYGA 4XRMA 1AU7A 1V5FA 3BR0A 3E3VA 4PK4A 5E18F 4C2UA 1UJ8A 4W1UA 5FO5A 1Z67A 2KJCA 3LSGA 2GOXB 2JA2A 4LIUA 5CVRA 4E7KA 3WHCA 2NOGA 1WWXA 2UXNA 4XN0A 3BCAA 2VPLA 3LAPA 4L9VA 1K79A 2ZFUA 4NNJA 5E3OA 3M8JA 4L5EA 4FT8A 1KZHA 2HYFA 1W0UA 1WSUA 3KYLA 5FLXZ 3OYMA 2OC6A 1R22A 2YUSA 2FJ1A 3DKWA 3OYCA 1N25A 3K4KA 1DU6A 5FFZA 4NC6A 1R4MB 2VQGA 4FE4A 1D1CA 1WJEA 1JTYA 4FISA 1HF0A 4IEJA 4RDUA 4OIOF 3JRIA 2A68F 2A6EF 3SJMA 1QO0D 2VBXA 1WJBA 3DU5A 4BS9A 2FEZA 1WVRA 2M8GX 1U8BA 2ME6A 3MZHA 3PNVA 2K40A 1R58A 3HSRA 2JTVA 4MEXF 1DQUA 1NK3P 3G73A 4P96A 2XRLA 4HZFA 1GDTA 3JRGA 1T98A 3LSJA 5KK1A 5M5YJ 4M3FA 1MJ9A 3M4OJ 2QENA 1XTAA 2GXGA 2IS4A 1BA5A 2X6XA 1TWAJ 3HRSA 2L9NA 2PG4A 1X1PA 1IXSB 2ID3A 3GTLJ 2RNGA 2Y9YA 5IYCJ 4CCOA 1TWFJ 2PMHA 3SFIA 5D8LB 3WTXC 3HPHA 1Z77A 3F9KA 3OOUA 4YFNF 4RA2A 1R5HA 1FMVA 2ZFWA 2R7DA 2CQQA 4D7MA 1WI9A 2WBMA 2F4OB 1TC3C 4HF1A 3GLXA 5TGTA 3W6KB 2WY7Q 1H8AC 3DKYA 5IP9J 5GTIC 5K7HA 3K1PA 3KYDB 1X19A 2VT3A 3S1NJ 1JXSA 2RDPA 4EGYA 4CZCA 2EPFA 2X1EA 4UV9A 2M8EA 5TISC 2X51A 2ISYA 4CYDA 3KPHA 5E1ZB 5FLXK 1WHUA 2X9DA 3FZVA 4ZYAA 4BE2A 1EA3A 1V54H 2ISZA 2R7TA 1FEXA 5H6RA 3A2KA 2QCOA 1Z6RA 4AYBA 1LEAA 4G7HF 3CDIA 4O6JA 3CC4I 4IHYA 2DFFA 3K0LA 2EIMH 1XMKA 1W5TA 1WJAA 3GMEA 4E7SA 3WTVC 2QQ8A 3ABTA 2Z5UA 3BOQA 1XDUA 4WF2A 3IWFA 2HXOA 4A12A 2IPQX 1QPMA 4B09A 3K4JA 3LL7A 4X1EA 1OCTC 2VC1A 3JRCA 3I55I 5LLQA 3RPUA 1BC7C 2QZ8A 2NNNA 1T39A 5D8KB 2BZTA 4GFBA 1S9HA 4AU7A 2YPRA 2DA7A 4XLEA 3HTSB 2A5WA 3MD2A 2ZXHA 1BIBA 2DI3A 2KHMA 3S3MA 1ON2A 1F43A 1LPQA 1O7LA 4AIKA 5LBQA 1B8IA 1UAAA 3Q0UA 5M3FJ 4Y33A 2NS7A 4BQAA 3S93A 1LFPA 1IRGA 2ZXWH 3EPZA 2NVXJ 2ECCA 4Q48A 1UHMA 1T8IA 3KZZA 3OIOA 2FOKA 4XORA 5HODA 1FTZA 1QHHD 3S14J 2ZKZA 4B44A 1W0TA 3OSFA 2XGEA 3S1MJ 3IKTA 2O03A 3O6BB 3L7WA 1FOXA 1SFEA 1ACIA 1ODDA 1JT6A 3S32A 2LVSA 2XAGA 3RKWA 2FX0A 3W2VA 4A5NA 4DOZA 3OS1A 2BVLA 4HQEA 5EF6A 1O3TA 3BG7A 5L3CA 1DPUA 3SHFA 1OQYA 4ASNA 2CUEA 4FETA 3HL2A 3CCSI 1P92A 2CS3A 3I56I 1VQ6I 2HKXA 1O3QA 5K5RA 4UUSA 1YIOA 3I59B 4BUPA 1VQPI 2QSGX 2NNYA 2F5CA 3CUQC 4Y4RA 1SC7A 5EZHA 3RSNA 4KA4A 1PUFA 2DA6A 5DCMB 1ZAOA 2ELKA 2OQRA 3RJPA 2ESHA 4B8XA 3AG1H 1DP7P 1B59A 3FXRA 3QU6A 1FT9A 2F6CA 1JGGA 3LNQA 1MMNA 5E8GA 2QUFA 2RGVA 1O3SA 2CQKA 4F92B 1W5SA 2L5QA 2HQRA 1ON1A 2NOJB 2O61A 2JVHA 3V8KA 2RKHA 1BJZA 3ABUA 5GAHJ 1F4KA 5IYDJ 1BW6A 2L9SA 4GCVA 4A69C 2UZKA 1GXQA 2R5ZA 2VBZA 5EJCA 2PBIA 5JLWA 4O3MA 2EV5A 1PVEA 4M9XA 4AYBN 4ZDOA 3CMEI 3L00A 4KIFA 1TP4A 1UG0A 1YW7A 3J7YJ 1SMTA 4XLCA 4OAYA 4EVIA 3LAJA 1A36A 3BJOA 1T0FC 2BEOA 3D5RC 2XSJC 4TV7A 5J40A 2K9NA 2VT2A 4BHBA 3DPTA 1Y1VJ 2G9WA 1XSXA 3RTRA 2NXNB 2VC0A 3OWTA 4BAYA 4XIDA 3G6EI 4XLPF 1MNDA 4JX5A 3G4SI 2LH9A 3PM1A 4XLNF 2DMUA 4BY7J 3CCMI 3GO5A 3CCUI 3WTTC 3IAM2 1YE9A 3G2BA 3QPHA 3JSOA 1BJAA 4MGRA 3RDIA 4XRSA 2A6HF 4XMYA 3S17J 2KDZA 4HV6A 1Z9CA 5BPDA 1V3FA 3OYEA 3M7GA 3HKZA 5J4VA 3WODF 2FF4A 4XSZF 5LRSA 4U0VA 4G7ZF 1U78A 1AKHA 1QGPA 3WG7H 1MZBA 1ZYRF 2PX9A 2XAUA 2EFPA 1WJ5A 2XC7A 3K4BA 4V2GA 3FWEA 3RCOA 3HXLA 1J0RA 3H3VK 5IOZA 5IPAA 5AONA 1X4PA 2KIFA 4RAYA 1P9QC 1FBSA 1M1EB 3EUAA 1YG2A 4IRIA 1XN7A 2D1VA 3HOZJ 5EYRA 4HF2A 2IVMA 3F3XA 1VQ4I 2MD5A 2DO7A 3KZIC 1X3ZB 1HA8A 4UVCA 3CLQA 3E0JB 2EV6A 2RNJA 2JT1A 1G6NA 2JPCA 3WGHA 4KUMA 3S1QJ 2VQCA 2E1OA 1PYVA 3M8FA 4LK1F 3ZMTA 4AVPA 1OYWA 3GFLA 2R93J 3HZJA 1QU3A 1WKMA 1KGSA 2LOOA 2VXZA 4BL0B 3E7LA 2O9LA 3Q0WA 3SEQA 1LDKB 3IH4A 3C1DA 2IAIA 5CPRB 5L3EA 3H0DA 4EEFG 4LB6B 4E7JA 3GEZA 2EINH 3OR1C 2DQLA 2E19A 3MWMA 1FSEA 2EZKA 1LFUP 4HBLA 4HPQA 4RGSA 3ABMH 3CLOA 4GDFA 4PSWA 5ILSA 4P9UA 1YRNA 3GLLA 3QPSA 5F64A 1USSA 2FBKA 2PEXA 2KRCA 2XRNA 3R61A 4I0BA 3V7CA 4I6ZA 3ONQA 5FKNA 4IZZA 2M5WA 2K86A 5KVRA 5CQGA 3SZGA 1JKQC 2EV0A 3PSFA 3JR9A 5ICFA 3FXMA 3CO6C 3FDYA 2O5RA 2DFIA 3HSFA 4MFEA 2Y9ZA 1NHAA 4P9FA 1B1BA 5IT3A 2VJ5A 1F9NA 2E1MC 4MIMA 3TGNA 3ZQFA 1FMWA 4C2MJ 3CCVI 3HBLA 2KQRA 3GTJJ 2DFHA 1ZG5A 2VJJA 1B8IB 3ISPA 1W7PD 4Y7NJ 3ZMZA 3ELKA 4G6DA 1WH7A 5GP9A 4A6EA 4XSXF 4UB8C 2QGUA 4MTDA 2DPUA 4LITA 4EJWA 4K2EA 2HTJA 5EEAA 3S2DJ 3RKQA 3CJTB 4IQJA 3LMMA 2MBFA 3BP8A 3KIOA 2LKXA 2ELHA 2FUG2 1TQIA 1O7FA 1TTYA 1TT0A 3NQOA 3F72A 4OIPF 2M2EA 1R23A 3ASNH 3OYJA 2V9PA 3M07A 2XROA 2BY2A 2ZSIB 3E6CC 2MLGA 3GZ6A 2BY1A 3EUKL 4A2UA 3F6VA 4XRSG 2GAUA 5FB2A 2GA1A 4DIQA 2KRFA 2X6YA 3EUHA 4PFPA 2E60A 3PNYA 2WAEA 3KCCA 3N05A 4A0XA 5FD6A 2BXYA 4IHXA 1X1AA 4D7NA 5E8IA 4UUSB 3Q9SA 4IVNA 3CCYA 3ABLH 1TWCJ 3GTPJ 4A3DJ 4WXDA 1RUOA 2Y2ZA 4FHTA 1GXPA 1PUFB 2HVSA 4G12A 5DV5A 1ETOA 2MSYA 2QF7A 3A0HC 2YX7A 3X2QH 4C3IJ 1SEUA 3H1CA 3TP0A 2Z1DA 2HEOA 2R7ZJ 4G94A 2MLKA 5F0FA 5LGTA 1SFUA 3ZPLA 5HS7A 2MC4A 1BI1A 3MVPA 1J09A 1YFHA 2Y0MA 2XASA 5EZGA 3KP3A 2UUZA 1BN5A 2LKSA 4B4CA 2PFBA 2R5ZB 4NDLA 3KP7A 4Q5SF 5CVUA 2OUMA 3DEUA 1H9TA 1T6SA 5GPCA 5KNLA 3LA3A 1IO2A 2PMZA 5K5OA 2NAZA 4E70A 1FC3A 4D0PA 4WWCA 4Q4ZF 2RVCA 5CKTA 2IS2A 1A5JA 2R7FA 2BOLA 3GCMA 4GGGA 3I0TA 3I3LA 4XQFA 2VPRA 4BXXJ 2Q0OA 3BLYA 1KU3A 3DTKA 3K6GA 1T2KA 3KFWX 1IG7A 5ED4A 2DT5A 4RM3A 4A3CJ 3K69A 4Z2YA 2PJRA 1WI3A 3CJRB 2GXAA 1T56A 1B4AA 2R7XA 2ZMEA 2X6OA 2EFWA 2OU2A 1CQTA 5GAEJ 2V7FA 3CTAA 3JRBA 3UNGC 4BY1J 4H4KC 4CDGA 4BU2A 1LJ9A 3IL2A 2WADA 2KMUA 1Y1WJ 4X6AJ 1XGMA 3LA7A 3OR2C 3OIQA 4BXUA 2G0EA 4CXFA 3BC8A 3LSHA 3VB2A 5M5XJ 2F5VA 4ETSA 1UG2A 2WB1N 4RGRA 3RYPA 1AKHB 5CVIA 5JVGF 1IRXA 4G6QA 3K2ZA 2QBYA 2MG4A 1XGOA 1R1UA 2XF5A 2DTRA 1MNEA 2W48A 3LQQA 1CGPA 4LLGF 5ICEA 2HQ5A 4A0ZA 4OOIA 3DLLF 4B3XA 1JTXA 4IHWA 2ACJA
chains in the Genus database with same CATH topology
1FOYA 2E36A 5GADJ 3PIPF 1MMSA 3PIOF 1VQ4I 2ZJRF 3CCSI 3I56I 1VQLI 1VQ6I 1VQPI 2H8WA 4V19K 1YI2I 2QEXI 1VQ8I 2OTLI 5DM6F 3G71I 2ZJQF 1YIJI 5DM7F 5GAGJ 3CCQI 2QA4I 1VQMI 1YJ9I 5GAHJ 1YJNI 4IOAF 3CC4I 3CC7I 3CMEI 2OTJI 3J7YJ 2ZJPF 2E35A 3CD6I 3CCVI 3I55I 1Y39A 3CCEI 5GAEJ 1VQ7I 2NXNB 3CCJI 3G6EI 3G4SI 3CCMI 3CCUI 3CC2I 1YJWI 1VQNI 3CF5F 1YHQI 1VQKI 1VQ5I 1FOWA 4IO9F 3CJTB 4UY8I 5JVGF 2K3FA 2FOWA 1HC8A 1YITI 1VQOI 1QA6A 3J7ZI 3CCRI 1FOXA 3CCLI 1ACIA 1VQ9I 3DLLF 1S72I 3CMAI 4IOCF 2E34A 2JQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOY A;  2E36 A;  5GAD J;  3PIP F;  1MMS A;  3PIO F;  1VQ4 I;  2ZJR F;  3CCS I;  3I56 I;  1VQL I;  1VQ6 I;  1VQP I;  2H8W A;  4V19 K;  1YI2 I;  2QEX I;  1VQ8 I;  2OTL I;  5DM6 F;  3G71 I;  2ZJQ F;  1YIJ I;  5DM7 F;  5GAG J;  3CCQ I;  2QA4 I;  1VQM I;  1YJ9 I;  5GAH J;  1YJN I;  4IOA F;  3CC4 I;  3CC7 I;  3CME I;  2OTJ I;  3J7Y J;  2ZJP F;  2E35 A;  3CD6 I;  3CCV I;  3I55 I;  1Y39 A;  3CCE I;  5GAE J;  1VQ7 I;  2NXN B;  3CCJ I;  3G6E I;  3G4S I;  3CCM I;  3CCU I;  3CC2 I;  1YJW I;  1VQN I;  3CF5 F;  1YHQ I;  1VQK I;  1VQ5 I;  1FOW A;  4IO9 F;  3CJT B;  4UY8 I;  5JVG F;  2K3F A;  2FOW A;  1HC8 A;  1YIT I;  1VQO I;  1QA6 A;  3J7Z I;  3CCR I;  1FOX A;  3CCL I;  1ACI A;  1VQ9 I;  3DLL F;  1S72 I;  3CMA I;  4IOC F;  2E34 A;  2JQ7 A; 
#chains in the Genus database with same CATH topology
 2PI0 A;  5HS8 A;  2VXD A;  5FFX A;  1OCO H;  3DQV C;  2HR3 A;  4EJV A;  1RES A;  4HA8 A;  3CMY A;  3LFU A;  2O8X A;  3QAH A;  2K9L A;  1RNL A;  3ZRG A;  1B72 A;  3KEO A;  2GLO A;  1ZR2 A;  4F7Z A;  2XB0 X;  4NC8 A;  5FKM A;  4DYR A;  1W7P A;  1X3U A;  1FYM A;  5D4S A;  3PFI A;  2VKV A;  1R1V A;  5BOX A;  2ECB A;  5D5U B;  1I1S A;  2DA4 A;  3FX3 A;  3I58 A;  2ZJ2 A;  5C44 J;  2EFN A;  3N4M A;  2HS5 A;  3J7A O;  4M9Z A;  3TO6 A;  4N4N B;  2W00 A;  1E3P A;  2L4A A;  2RQQ A;  4ANJ A;  3OYI A;  2KPM A;  4Y52 J;  4PJM A;  1MH3 A;  1SD7 A;  2CO5 A;  2M87 A;  3ASO H;  3VYR B;  3RZD J;  4B47 A;  2O6G E;  4EAT A;  2DCE A;  2VBW A;  4NQW A;  2RRE A;  2HNH A;  2H6C A;  2WC2 A;  3WTZ A;  1YRN B;  2V9V A;  3Q3S A;  5EG0 A;  2QA4 I;  4KMF A;  4XBF A;  2VIX A;  4G9Y A;  4ZYD A;  2FU4 A;  1R1T A;  5DEQ A;  4IXA A;  2JRM A;  5EEG A;  1ULY A;  3TDU C;  2RN7 A;  1OR7 C;  3OYN A;  3EYI A;  1I5Z A;  4XM3 A;  1LB2 A;  2HKO A;  2ZNY A;  3ERE D;  4L5J A;  1SVL A;  3D1N I;  3IC7 A;  2PMU A;  3DBL B;  2OJE D;  1U5T A;  1D0X A;  2VKD A;  3MCZ A;  1FYL A;  5FLV A;  3GTG J;  3DKX A;  1YW9 A;  3OV8 A;  3NRV A;  1G59 A;  4M3E A;  4AM3 A;  2DOD A;  4LGW A;  2HWV A;  2FRH A;  3SZP A;  1YW8 A;  2EA4 A;  2VQH A;  1B6A A;  3OYA A;  3GZ5 A;  2MGQ A;  3SYT A;  3OYB A;  4L18 B;  3S2H J;  4RAZ A;  4C3H J;  3F0C A;  1AA7 A;  1MBF A;  2V9K A;  1MD0 A;  3L2W A;  4ZTF A;  2JJ7 A;  3HOX J;  1IRF A;  3PUB A;  2FQ4 A;  2W82 A;  5FRO A;  4JK1 X;  4Y13 A;  4HV5 A;  3JRA A;  3BG9 A;  1TBX A;  5BQT A;  3FMR A;  4PJN A;  2LF7 A;  1Z7L A;  3FXO A;  1K7A A;  3BQY A;  2E2J J;  3U1D A;  3E6D A;  3JRH A;  1RPW A;  4XLH A;  5ERI A;  5K7F A;  2Z33 A;  1LDJ A;  4M73 A;  1TL8 A;  3I4N J;  1K78 A;  5H6Q A;  4C30 A;  1I27 A;  5KHD A;  3CMA I;  1YTY A;  4I99 C;  5LGU A;  2F4I A;  3RYR A;  1H88 C;  5HS9 A;  5FJ8 J;  2EFQ A;  1UFM A;  4PJ0 C;  1MBJ A;  4PGG A;  3GUD A;  1XD7 A;  4C3J J;  4CGZ A;  3BPV A;  4XK4 A;  2XGD A;  4AIJ A;  2K9Q A;  4U0W A;  4E7I A;  5E79 C;  5LHH A;  4BE1 A;  2MD0 A;  4HW0 A;  4ZDL A;  1VTN C;  3MKL A;  2JA6 J;  4L0Y B;  1K61 A;  3ZCO A;  1I6X A;  1R71 A;  3C2H A;  1NTC A;  1R4N B;  4U7B A;  2YR2 A;  1SVM A;  2KL4 A;  3FKI J;  3B6A A;  2EA2 A;  5C3E J;  1YX3 A;  1YO5 C;  4HF0 A;  2ME0 A;  4JYK A;  4ESJ A;  3RI4 A;  2XAH A;  1MJB A;  2ZJQ F;  1FBQ A;  3CP2 A;  1HXD A;  1S7O A;  3B02 A;  3C3W A;  1ETW A;  3CUO A;  4AC0 A;  1DGW Y;  3A0B C;  2Z3Y A;  2JZY A;  3GWZ A;  1KQ9 A;  2HDD A;  1KA8 A;  5HNH A;  2GIV A;  5HDK A;  3KLN A;  4LLN A;  3K2A A;  5B3S H;  2R7U A;  4LLL A;  5CVV A;  3BJ6 A;  2CV1 A;  1SMY F;  1D1B A;  1UHW A;  2QQB A;  2DA3 A;  1ZGW A;  3K9T A;  4KIG A;  4U7D A;  3GXO A;  1ZLK A;  2HGC A;  1FIA A;  3K4C A;  3OY9 A;  4MQ9 F;  2L54 A;  3NWT A;  3GTQ J;  3K70 D;  3L2R A;  2K4B A;  4AUX A;  2BY3 A;  3HJE A;  3VOE A;  5M3M J;  2CQN A;  3KE2 A;  2R7W A;  1X2N A;  5IY5 H;  2R7Q A;  1BOB A;  4GXO A;  5F27 A;  2GM4 A;  2DDA A;  4G7O F;  3K4L A;  1XSD A;  4QWQ A;  3HOV J;  4IHV A;  3LST A;  3LSK A;  2E1C A;  3E5X A;  2ZME B;  2R5Y B;  1VI0 A;  3BZK A;  5FKK A;  5LHG A;  5FRN A;  1JUM A;  3BJA A;  1R6R A;  4RS8 A;  2DMP A;  4KMU X;  5HDN A;  4M6V A;  2DPD A;  4NC7 A;  3H35 A;  1MMG A;  1LQ1 A;  1O3R A;  5EDN A;  2VJ4 A;  1ZKG A;  1Q1H A;  2HTS A;  3ZMU A;  3M1E A;  2DAO A;  1YHQ I;  3DLA A;  1QBJ A;  2JUC A;  2V1U A;  2QBY B;  1OCP A;  5J8C A;  5L3B A;  1YYV A;  1IDZ A;  3BRO A;  2K3F A;  2DBB A;  4KN4 X;  2EB7 A;  1HKQ A;  3DV8 A;  1VQO I;  5DUK A;  2FNP A;  2OBP A;  1S7E A;  3I64 A;  2E7W A;  2CFX A;  4RGX A;  2VKH A;  2JA7 J;  1PUE E;  3R4K A;  2DMN A;  1SFO J;  4IKF A;  2HVR A;  1FOY A;  3MKY B;  1JKO C;  4EQQ A;  1TQP A;  2JUG A;  2V4J C;  3GF2 A;  3O3K A;  1S6L A;  5GAD J;  3C18 A;  3OSG A;  2L02 A;  4DZJ A;  4R8H A;  5D5W B;  4OIR F;  2LY2 A;  1B72 B;  4U88 A;  1IUY A;  2K3P A;  3IH2 A;  4W97 A;  3WE3 A;  1W7P B;  2VI6 A;  5JFR A;  2QSH X;  2D2W A;  1Y0U A;  4QIW N;  4B3A A;  3D0S A;  1J9I A;  1P7I A;  1BR2 A;  5J4Y A;  1ZAR A;  2A05 A;  2GZW A;  1O57 A;  2M34 A;  3A1Y A;  3IKV A;  2KDO A;  2VB6 A;  2FBI A;  3ZOB A;  4WCG A;  2LKP A;  1ZHF A;  3OS2 A;  2Z2S B;  2CMP A;  2DQR A;  3E6B A;  3IRR A;  4JX6 A;  4XKB A;  2O0Y A;  3GTK J;  3S2W A;  2ID6 A;  2JN6 A;  4BHP A;  1FPQ A;  1YIJ I;  3PO2 J;  2L7K A;  1YQA A;  4XKC A;  3WTY C;  1TZL A;  2CWE A;  3QP5 A;  1QNT A;  2EH3 A;  3ML6 A;  2IEK A;  3H36 A;  4I7H A;  5GAG J;  3CCQ I;  1P2F A;  5EG0 B;  1W1W E;  4M74 A;  1YOV B;  3HYI A;  3BY6 A;  4RAG A;  5DDG A;  1W36 C;  2VAS A;  1HSJ A;  4PCQ A;  5LRR A;  3AL0 B;  1AOY A;  3CJN A;  2IW5 A;  1MJA A;  4ENN A;  3Q9V A;  4P1W A;  1IRZ A;  3HTU A;  2GQQ A;  2PN6 A;  3SQN A;  3CC7 I;  1GT0 C;  3L9F A;  1V5G A;  3WE2 A;  4UUV A;  2IGN A;  2RV8 A;  4EM2 A;  3J7A Y;  3FKJ A;  2X0L A;  3KEY A;  5ILU A;  1OYI A;  3BTC A;  5BNG A;  2KIS A;  3U1K A;  5E20 A;  4NHJ A;  1KYW A;  2I5U A;  1TWG J;  3HOU J;  2XPU A;  2Y30 A;  1T95 A;  1FYK A;  2BGC A;  3SZT A;  4CO8 A;  1Z21 A;  2F48 A;  1JUS A;  4DYQ A;  3Q0V A;  3ZQ7 A;  5JHU A;  1VQ7 I;  2CU7 A;  3HOT A;  2CG4 A;  3OL3 A;  4B48 A;  3GFM A;  1BC8 C;  2G7H A;  3J81 Z;  3CC2 I;  1JGS A;  2CJJ A;  2MYS A;  3I9V 2;  1VQK I;  1FOW A;  1QRY A;  4E7H A;  1XG1 A;  3RIR A;  4J01 A;  2CW0 F;  1OCC H;  3BT9 A;  1HW2 A;  3I4P A;  3I54 A;  1VF9 A;  3IUO A;  1U8R A;  4BGD A;  1K78 B;  3KP2 A;  3CCR I;  4RM2 A;  3AG4 H;  4ZZD A;  2M30 A;  4C2T A;  2NYX A;  1Y56 A;  1S72 I;  2LBF A;  2TCT A;  3W2W A;  2E1N A;  2QWW A;  3FBI B;  3HEF A;  2DXI A;  4ZC3 A;  2E36 A;  2M0M A;  2A3S A;  3PIP F;  5IP6 A;  1R5I D;  1MBK A;  1BR4 A;  2XPV A;  3BCB A;  3BR3 A;  2GWR A;  2OCE A;  3O2P E;  3GZN B;  5ICG A;  1HDD C;  5AIP A;  1GLN A;  1IW7 F;  5F08 A;  2DA5 A;  4UB6 C;  5DUI A;  1TW3 A;  2OA4 A;  4V19 K;  1MH4 A;  2NVQ J;  5KAI C;  4KT5 C;  4EGZ A;  4HNU A;  1JJ8 C;  1UHS A;  2YS9 A;  4ZDP A;  1VQ8 I;  4ESF A;  1G2H A;  3FMS A;  2OTL I;  3FK6 A;  5E1X A;  1SAN A;  1DPR A;  1X58 A;  1IV6 A;  3ZN1 A;  1HW1 A;  2CW7 A;  2KT0 A;  2M7A A;  4EJO A;  1LKX A;  4HYE A;  5FGM A;  1WJF A;  2VE8 A;  3KYC B;  1LNW A;  4E7Z A;  4BJ5 C;  5LEJ A;  2JK3 A;  2KIU A;  1R36 A;  5BMZ A;  4E7L A;  2CH0 A;  3NWS A;  3S15 J;  4XLF A;  2CQX A;  1XDS A;  3WTS C;  2XV4 S;  5J1U A;  4ZYG A;  1P4X A;  3DFG A;  4ITV A;  2R0Q C;  2E71 A;  1I39 A;  3OYG A;  1IAW A;  1EF4 A;  2DFE A;  4FQG A;  4CCN A;  2XDV A;  1APL C;  1JI8 A;  2KIM A;  2HPI A;  3QOP A;  1OFC X;  2JSC A;  5F1R A;  3IWZ A;  3V7R A;  2DTZ A;  4BJ6 C;  4CZZ A;  3J81 K;  3GTO J;  5D6F A;  1IN4 A;  4ZYH A;  3DXJ F;  1BI3 A;  3TDZ C;  1IGN A;  3ROU A;  4CHU A;  2M1B A;  1IXR C;  3F21 A;  2LF8 A;  2QKL B;  4MHG A;  3WGI A;  2WWY A;  4RLF A;  3AKZ A;  2IGM A;  1XMX A;  5J1R A;  3MN2 A;  1FY7 A;  1XPX A;  2M7B A;  2VLA A;  2M9H A;  1X4O A;  2HFH A;  2A61 A;  5HNF A;  1I50 J;  2VBY A;  2JWT A;  5J3L A;  1VQ5 I;  5F0H A;  3KP4 A;  1IN8 A;  3HRT A;  3DP7 A;  2B0L A;  3B73 A;  1Z6T A;  5HLH A;  4UY8 I;  4ZZL A;  2ZO4 A;  5HLG A;  4A3B J;  2DJN A;  1Z3X A;  2B63 J;  2PQ8 A;  3P9C A;  3V8J A;  3CDH A;  4BKX A;  4Z6Y A;  4II2 A;  2COB A;  4ESB A;  1I1G A;  1S5L C;  1KQ0 A;  1FWZ A;  1S7A A;  3ZMS A;  1RR8 C;  3N97 A;  2PJP A;  1ZQ3 P;  2XB5 A;  2XPW A;  2F2E A;  4H0E A;  1ETV A;  2ZXI A;  4BQQ A;  2BY0 A;  4HRI A;  1Y8Q B;  5LEK A;  4HDV A;  2DA2 A;  2HXI A;  3DBH B;  3PSI A;  4ZH4 F;  2AS5 F;  5LGN A;  4ENM A;  2BVM A;  2EJR A;  2LP0 A;  2KRH A;  1SFK A;  1UZC A;  1RUN A;  2XUB A;  3MEX A;  1ZEL A;  4DQ2 A;  3QOD A;  3HHH A;  4CH7 A;  1OIS A;  1GVJ A;  1QHG A;  2Y0S A;  1OKR A;  4NB5 A;  4BDZ A;  5FD5 A;  2DOA A;  3TL4 X;  3HKZ N;  1HKT A;  2CRG A;  3LSI A;  1TLH B;  4YEJ A;  4YIR X;  1ZRF A;  4BNC A;  4DGW B;  1E3O C;  4II3 A;  5D6E A;  3SFZ A;  3ZN0 A;  1K6O A;  3TBI A;  2WAQ A;  2Y75 A;  5DM6 F;  2NVY J;  1MMA A;  2CQ7 A;  1XB4 A;  3Q5F A;  4A3J J;  2KFD A;  4JOM A;  2NVU B;  5B5E C;  2MFZ A;  2W25 A;  4BEH A;  2FQ3 A;  1H89 C;  4IRH A;  2A5Y B;  1CF7 A;  1WJD A;  3K4N A;  1R49 A;  2MAB A;  1NG6 A;  2DMQ A;  2QKM B;  3WU0 A;  2UXX A;  4UUT A;  3I53 A;  4S0H B;  3V4G A;  2CV2 A;  5D4R A;  2X4H A;  1K6Y A;  1Z3Y A;  4HOB A;  2F5D A;  4XKW A;  3JTG A;  4D1Q A;  2FNA A;  3BG3 A;  3KET A;  3QYF A;  1SD5 A;  3F22 A;  3QPL A;  3DU6 A;  5E3L A;  4CUG A;  2E2I J;  2VL8 A;  4IF4 A;  1S8N A;  2IP2 A;  2BXZ A;  4EM1 A;  3AAF A;  5CLS A;  3T0Y A;  3MMY B;  3IP4 B;  3OYK A;  3LSM A;  1Y39 A;  4P5O A;  1RET A;  5EEH A;  1ZRC A;  5L3F A;  2NS8 A;  1X1C A;  4M9S A;  3L2Q A;  2A6T A;  3HUG A;  2P6S A;  4DYC A;  1TNS A;  4OU0 A;  1XSV A;  3TOB A;  2XKO A;  3REO A;  3G1L A;  1XCB A;  3OL4 A;  2B7E A;  1DP3 A;  4IJA A;  3FF5 A;  3WTW C;  3SEZ A;  3QQA A;  4DBQ A;  3K10 A;  3BWG A;  2DMT A;  3F8F A;  2D5V A;  1XCV A;  4D5C A;  2LBF B;  2OCC H;  4DBR A;  1IC8 A;  1VQ9 I;  3IHU A;  5ILV A;  3HDD A;  5KCM A;  3ULQ B;  2EFO A;  3O8G A;  5D5X B;  3PNT A;  2A69 F;  2YX4 A;  3EYY A;  1K83 J;  3BTI A;  3PIO F;  3QWL A;  1WH5 A;  1OCR H;  5GPA A;  2LYC A;  5H20 A;  1MBG A;  3QYB A;  3I4M J;  5JHF A;  2FXA A;  2EZL A;  1ENH A;  1FZP B;  1QZY A;  1RR7 A;  3VYT B;  1VQL I;  3KLO A;  4U87 A;  4XIC A;  2X48 A;  1RI7 A;  2Y0S N;  1Y8R B;  4I2O A;  3HC7 A;  5FKO A;  4RAF A;  2KJB A;  5E3M A;  4KIS A;  2HOE A;  5CVJ A;  4P55 A;  1JT0 A;  2E5N A;  1TWH J;  2CYY A;  1ZLJ A;  2L3D A;  3HGG A;  2VKE A;  4RB0 A;  1R00 A;  4PSX A;  2UWM A;  2L0K A;  4YFK F;  2DK8 A;  2AHQ A;  5M5W J;  3JW4 A;  2IRF G;  2O3F A;  4MO7 A;  1ZK8 A;  3WG9 A;  3CUQ A;  5B1B H;  4FCY A;  1U6G A;  2OF7 A;  3C7J A;  1ERD A;  3K70 C;  5HDG A;  4XRF A;  1XS9 A;  2WV0 A;  4HG2 A;  1VQM I;  5HLT A;  4DJA A;  1GHC A;  1REP C;  2DYS H;  1YJN I;  3DWL E;  1LDD A;  2P81 A;  4M3D A;  3ZMD A;  2EIL H;  1SFX A;  4PDK A;  1GVD A;  2XGC A;  1X2M A;  4OAZ A;  4UV8 A;  3ZGK A;  1DUX C;  3A4C A;  1OCZ H;  3RQI A;  1T38 A;  4X0G A;  4NBQ A;  4JQF A;  1C0W A;  3RPQ A;  3NAR A;  2H8R A;  1EH8 A;  4PJL A;  4ON0 A;  4CIC A;  2R7V A;  3VSK A;  4ZTJ A;  1G3S A;  3FXU A;  1IXC A;  5ICC A;  4IQ4 A;  1VFC A;  4A3L J;  4XL9 A;  1QVU A;  2LDU A;  1ITY A;  5TJJ A;  4C9Y A;  1SVO A;  1HLV A;  4L9T A;  3BR1 A;  1FX7 A;  3S8P A;  1BIA A;  1Z0X A;  2PMZ N;  3TED A;  5IOY A;  3QRF F;  5E1W A;  3OYL A;  2IS1 A;  3ECO A;  2IJL A;  5HLI A;  1T33 A;  5IP7 J;  3TO7 A;  4FE7 A;  2P5K A;  3W2A A;  1L0O C;  4A3M J;  4MTE A;  4FX0 A;  3BR5 A;  4IRG A;  5EGO A;  2J5O A;  3H5A A;  3J7Z I;  2IGK A;  4YG2 F;  5BPI A;  2EK5 A;  1UST A;  4L9J A;  1PP7 U;  3J80 Z;  1X1D A;  1ZG1 A;  2L2O A;  4F3Q A;  2M4G A;  1J5Y A;  1G3Y A;  3BQZ A;  4LK0 F;  3GFJ A;  3RPU D;  1MMS A;  4YFX F;  2V1N A;  2HZT A;  1AHD P;  2K27 A;  3E5Q A;  4R79 A;  3PJR A;  2LG4 A;  4JBA A;  3M3Y J;  4G6T B;  3F23 A;  4HNV A;  1Z7U A;  5K5Q A;  3LSP A;  4KDP A;  2HOA A;  2LRD A;  4B1R A;  3KX2 A;  2Z99 A;  3BZC A;  2DK5 A;  2X85 A;  1LE8 A;  1QZZ A;  1HST A;  1LUJ B;  4XOP A;  2LK2 A;  2AQF A;  1P4W A;  1YI2 I;  2P7V B;  3CQZ J;  1OPC A;  1A6I A;  2IA0 A;  1N78 A;  3L2V A;  3RKY A;  4U0Y A;  3HOS A;  2R7R A;  2EIK H;  3TO9 A;  4OIQ F;  4HNT A;  3M1C A;  4DNC A;  2R92 J;  2X6W A;  4BEH B;  3HRM A;  5TRD A;  3AFH A;  3GFI A;  3W3C A;  2IS6 A;  1CF7 B;  2YU9 J;  4O5V A;  4LG0 A;  1EV7 A;  5B66 C;  5F0C A;  3ZQC A;  1B9N A;  3D5S C;  2K02 A;  3DEW A;  1BOA A;  4RGU A;  1Q1V A;  3BG5 A;  4FTH A;  1LVK A;  2LY9 A;  5K7Z A;  5D5V B;  4HLX A;  5C4J J;  4LB5 A;  4D9J A;  2AXL A;  1NK2 P;  3PUF A;  3L09 A;  3TKY A;  2ETH A;  4RB2 C;  4CSW A;  2M45 A;  2WTE A;  2IBD A;  2L4M A;  3A03 A;  1MSE C;  5IT9 Z;  3JAM Z;  3ZXS A;  2BBY A;  4F52 A;  2H09 A;  3PQJ A;  3LFK A;  1RC9 A;  3BG6 A;  2Z9O A;  4A3G J;  4E6K G;  2NRA C;  2GOM A;  2L9V A;  1XGN A;  3MFK A;  4E4H A;  3PFY A;  3HOW J;  2HU9 A;  2KZV A;  1FOK A;  3JCU C;  2FSW A;  2K85 A;  3KP6 A;  1WZ2 A;  4EMS A;  5LHI A;  4BH9 A;  3HUG B;  3CO7 C;  1D5Y A;  2V26 A;  2CV0 A;  4OMY A;  3T1B A;  2HQN A;  4BBR J;  2DOF A;  4Y15 A;  3O8H A;  5J47 A;  2BE5 F;  2ZBK A;  3DF8 A;  3FXJ A;  1MBH A;  2K4J A;  1JJ6 C;  3I5U A;  2VON A;  5L3D A;  2L9R A;  2F5E A;  1EKE A;  3EUH C;  5H2F C;  1N75 A;  3J80 K;  3IAS 2;  4XN3 A;  1L3L A;  2W84 A;  5JI6 A;  3JTH A;  2PJR B;  1JHH A;  1X3W B;  2FOW A;  3FHN A;  4F55 A;  2W7N A;  1I6H J;  5DCF A;  1YIT I;  2CFO A;  2STT A;  2J5P A;  2L7F P;  3CCL I;  3ZQL A;  2JSP A;  2X1D A;  1MIJ A;  2XHK A;  5E3N A;  3UKG A;  1RKT A;  4WX9 A;  3GBG A;  4PJJ A;  1D3Y A;  2E34 A;  2V6E A;  2DLL A;  2XAF A;  1O4X A;  4CA0 A;  3HSE A;  5F6F A;  1VND A;  2L7Z A;  2XIG A;  3OYD A;  4JP0 A;  3HB9 A;  3ZP5 A;  3DPU A;  4PUS A;  1BW5 A;  4JX4 A;  2BV6 A;  3DCF A;  2BYV E;  3H92 A;  4I98 B;  3DTE A;  3LSR A;  1DU0 A;  5AIQ A;  1HW5 A;  2QVO A;  3AG2 H;  3FXQ A;  4A3I J;  5F04 A;  3ZQQ A;  2QLZ A;  2WA0 A;  4KJZ A;  2I10 A;  1R9T J;  4XOT A;  2QEX I;  3C2B A;  3L2U A;  1FJL A;  4A6D A;  1GUU A;  2NVT J;  3CF2 A;  3G1M A;  4OMZ A;  1ZH5 A;  2COM A;  2W1O A;  1P6R A;  1S3J A;  1YLF A;  3DTI A;  4MQV A;  3SXY A;  3BDD A;  3V7S A;  4M3B A;  3OYF A;  1EH7 A;  4Q47 A;  5J8F A;  1OYY A;  1HQC A;  4J00 A;  1WPK A;  1UMQ A;  2EZH A;  4A3K J;  1ZGA A;  2V1X A;  2JMW A;  3E97 A;  5KAF C;  5IT9 K;  3CUQ B;  4HX8 A;  4V2F A;  3JAM K;  2YSR A;  1E0E A;  4BDY A;  2OAZ A;  2FBH A;  1WGX A;  3TMO A;  2V79 A;  2OQG A;  3QP6 A;  4M6X A;  1TNT A;  2Y69 H;  5K1Y A;  2UV1 A;  2AO9 A;  1YJ9 I;  2E5Z A;  4A93 J;  2ZME C;  1UEL B;  2P0W A;  3U9G A;  6PAX A;  1DGR M;  1UCR A;  1YS7 A;  2DJI A;  2M0C A;  3A02 A;  2TRT A;  2GIZ A;  4YRV A;  2MH9 A;  4NQW B;  4L0Z B;  1I3A A;  2WV1 A;  4LMY A;  2IA1 A;  1AWC A;  4BE0 A;  2XAJ A;  4BBS J;  4L9N A;  1LFB A;  5JLX A;  4EV0 A;  1WRJ A;  3IV5 A;  2LRE A;  1KYZ A;  1ZG3 A;  1MDM A;  2MW8 A;  1TQM A;  2KKO A;  5GTH C;  2LD5 A;  3RQ4 A;  1IUF A;  5C4X J;  3G3Z A;  1ETQ A;  1TW2 A;  3QPT A;  4QTR A;  2VOD A;  3KEQ A;  3HHG A;  4MFD A;  2XVC A;  1Z1D A;  1A35 A;  4HEA 2;  1FP2 A;  1VQN I;  4DZP A;  4CCM A;  2FD5 A;  1I3Q J;  3CF5 F;  2Y31 A;  1MW7 A;  1S29 A;  1U5T B;  2K9M A;  1FTT A;  2Y48 A;  1MGT A;  3H0G J;  3A01 A;  1JKR C;  4RBO A;  3OOP A;  5EGO B;  3F8C A;  2YU3 A;  3GTM J;  1Z05 A;  4WXH A;  3HRU A;  2AXT C;  1D0Z A;  1XX5 A;  4I76 A;  2P7C B;  3TOA A;  1IN7 A;  3CMM A;  1HBX G;  3JRE A;  4HX4 A;  5CQE A;  3NEU A;  2GA2 A;  4IOC F;  2A07 F;  3MQ0 A;  3P7N A;  2D45 A;  2H1K A;  3ESW B;  2LSO A;  4DW6 A;  1U0J A;  1D8J A;  2K7L A;  3RZO J;  3B6C A;  4AIH A;  4HDU A;  4N4O B;  4RLQ A;  3S16 J;  2P5L C;  4I01 A;  2XGX A;  2QM3 A;  2VN2 A;  3MZY A;  3TW6 A;  2DT6 A;  1LE8 B;  3HGY A;  3E1S A;  3GYH X;  2V6C A;  4ENJ A;  2VE9 A;  4A0Y A;  3VSL A;  4GO1 A;  2Q1Z B;  3HOY J;  3M8E A;  3H3U A;  4HSR A;  3BZ6 A;  4MNU A;  3H3Z A;  4GRI A;  2MC3 A;  3AL0 C;  4KIC A;  1QQI A;  3SDG A;  3I71 A;  3GW2 A;  1BI2 A;  3H9G A;  4XNF A;  4XON A;  1W4M A;  2JVG A;  2ZB9 A;  4LG0 B;  1JKP C;  2KP6 A;  1IZ1 A;  1KU9 A;  1KU2 A;  4HX7 A;  4XKV A;  1MBE A;  3P9K A;  3EQL F;  1J2X A;  3P5J A;  1U5T C;  5HVQ C;  2QQ9 A;  1DDN A;  3TW7 A;  1HCR A;  2DDB A;  2JA5 J;  3WU2 C;  2EIJ H;  3T8R A;  3LA2 A;  3CZ6 A;  1SD4 A;  1OJL A;  5J6X A;  1SAU A;  4QPQ A;  3HM5 A;  3WU1 B;  4PFO A;  2LY1 A;  1D0Y A;  3JRF A;  1D1A A;  2OTJ I;  1P4A A;  3ECH A;  3H9J A;  3VEP A;  2IA2 A;  2IXS A;  2O8K A;  2K5C A;  1FIP A;  4L5I A;  2R7S A;  3JSP A;  3H5N A;  5DS9 A;  1B9M A;  1TT5 B;  4M3G A;  3FXK A;  3IH3 A;  3IRQ A;  3D5L A;  3FIW A;  1HOM A;  2Q2E A;  2ZXJ A;  1KON A;  3LWF A;  4D5F A;  3FHZ A;  1YS6 A;  1BR1 A;  4KT6 A;  3R60 A;  2HDW A;  4A3E J;  4CYC A;  4BHC A;  3CCE I;  1A04 A;  1OR7 A;  4CCL A;  3S3O A;  3U2R A;  1Y0N A;  1WCM J;  1U2W A;  4M71 A;  2HYJ A;  3MKZ A;  4N0B A;  5FRM A;  4B43 A;  4BAC A;  1SD6 A;  4QSH A;  2X1C A;  3COA C;  1D5V A;  2LC2 A;  2E1M B;  4IO9 F;  2KZG A;  4YEL A;  3VFZ A;  1G3T A;  2R3S A;  4PZJ A;  3SDB A;  3U21 A;  2VUM J;  4WK8 F;  2VOP A;  3OMY A;  1IDY A;  1BBY A;  4PGH A;  1MKM A;  2DYR H;  1J75 A;  2LR8 A;  3E6M A;  1HC8 A;  4WXC A;  4F91 B;  4S05 A;  3S3N A;  1QA6 A;  4XLA A;  4KYW A;  3F8M A;  4RB3 C;  5LFA A;  1IN5 A;  2WY8 Q;  3BR2 A;  2ZC2 A;  3K1N A;  4AD9 A;  1QZE A;  3FBN B;  4EM0 B;  2V1D A;  2LLK A;  1LVA A;  3EDP A;  1JHF A;  2FML A;  4N9I A;  5FKL A;  3OS0 A;  2EWN A;  3ZQI A;  2G7U A;  2W4S A;  2ZJR F;  3F8N A;  5DD4 A;  1FNN A;  4I02 A;  4MEY F;  4G8X A;  1A31 A;  1V55 H;  3EET A;  3FIS A;  4BXF A;  2DT7 B;  3GVA A;  3WHB A;  1G4D A;  4A3F J;  4FX4 A;  4Y17 A;  4CCK A;  2MA3 A;  3BTJ A;  3CDL A;  5LD2 C;  4UVB A;  2OZU A;  5JR3 A;  1ZRD A;  3ZQH A;  1W36 D;  1ZR4 A;  3V8L A;  2RQP A;  2PLY A;  1XGS A;  2BW3 A;  3LQR A;  5DM7 F;  1KQ8 A;  5DYM A;  3FM3 A;  1FBU A;  1H0M A;  1X1B A;  5BS6 A;  1V5E A;  3DBR B;  3HIF A;  3F6O A;  3H9Q A;  5F1J A;  1K4S A;  2W57 A;  4HLY A;  2QQA A;  3UR3 C;  4UVA A;  2ZCW A;  5CYV A;  5CJ9 A;  2XF6 A;  3ZMV A;  3QYE A;  2P8T A;  1OMI A;  1E3H A;  2TDX A;  2LNB A;  4IHS A;  1A6Q A;  2ESN A;  4YIF A;  3RKX A;  2E2H J;  2LFB A;  3M9A A;  2ZSH B;  4R1H A;  4BQO A;  2ZJP F;  1F5T A;  2WB1 A;  4QPO A;  2R7O A;  2JA8 J;  1RKW A;  3KZY A;  1LEB A;  3T8T A;  1U3E M;  3CD6 I;  4LJZ F;  4AWX B;  1WJC A;  1MDM B;  1BM9 A;  4BYY A;  3C2G A;  2F5F A;  2GXB A;  1R7J A;  2RC4 A;  2HI3 A;  1PDN C;  5IYB J;  3DPL C;  2OZ6 A;  3HPG A;  1UB9 A;  5L3G A;  2K9S A;  2VJI A;  4IL6 C;  1XC5 A;  2FE3 A;  3E5U A;  3CCJ I;  2JPB A;  1IN6 A;  3ERM A;  2E7X A;  2BHZ A;  5DTD A;  1KU7 A;  2EZI A;  1F1Z A;  4LD5 A;  2HOS A;  4KNY A;  1YJW I;  3CP8 A;  2MH2 A;  1J7K A;  9ANT A;  3TQN A;  1GV5 A;  2H94 A;  4AVZ A;  2HQA A;  3A01 B;  1RRJ A;  1RIO H;  2L01 A;  1FSH A;  2Z16 A;  4UNO A;  2LTP A;  4Y3O A;  5HOO A;  4IPA A;  3VYS B;  2I8D A;  3K4M A;  3R6S A;  4EJU A;  1RZ4 A;  1JE8 A;  1WQ2 A;  2R4G A;  3BTL A;  4LOC A;  4M72 A;  1IF1 A;  2H6B A;  2P4W A;  1U9O A;  3L1P A;  3MAJ A;  3OYH A;  2RAE A;  2DOE A;  1MSF C;  1E2X A;  1ZRE A;  2NS0 A;  2W24 A;  4FAS D;  2HVQ A;  1U9N A;  2IT0 A;  2XKP A;  2F4M B;  1GV2 A;  3T5X A;  2IGO A;  1VZ0 A;  2EBI A;  4A5M A;  1ETX A;  3CJQ B;  4HAM A;  3PQK A;  1V4R A;  4MLO A;  4LFU A;  1N77 A;  2H8W A;  5E17 F;  4RB1 A;  2H1L A;  5A2Q Z;  2P5V A;  4ABZ A;  3K1M A;  1FLI A;  2WAF A;  1IJW C;  1MNM C;  1STZ A;  2HDC A;  2VOO A;  4IHT A;  1NG7 A;  2STW A;  1QPI A;  4NUB A;  2FMY A;  3W6V A;  2ZNZ A;  1NH3 A;  4F93 B;  5JVT A;  4KFC A;  3FXL A;  3BR6 A;  3R0A A;  1Z91 A;  3F8B A;  2L7M P;  3G1O A;  2HPM A;  4UHT A;  2LMD A;  1MMD A;  2R5Y A;  4QLC U;  2EQR A;  3VOD A;  1J59 A;  2HOT A;  2BHY A;  3R0J A;  4LG3 A;  4YII A;  4KIT B;  3QU3 A;  2OD5 A;  1PP8 F;  4IOA F;  2XSD C;  2QYO A;  1EH6 A;  2O7O A;  2DW4 A;  4HQM A;  3HG9 A;  3KP5 A;  3VDX A;  1ZN2 A;  1QVT A;  1HKS A;  2WAQ N;  3K7A J;  2QSF X;  3W6J B;  3DEE A;  4UXN A;  4KN7 X;  1XMA A;  1W5C C;  2N8G A;  2DA1 A;  2XAQ A;  4BJT A;  3JRD A;  1OLT A;  2E35 A;  2Q2E B;  4XR6 A;  5DD8 A;  2C6Y A;  3CES A;  2DU9 A;  2CUF A;  4CYC B;  3AG3 H;  5FLM J;  3GX4 X;  2H27 A;  4CCJ A;  1D8K A;  2HZD A;  1FP1 D;  2M3A A;  4EJT A;  3S1R J;  4HST A;  1POG A;  1YX5 A;  3P9I A;  3TP3 A;  2M4K A;  3ZR8 X;  1ONV A;  3VWB A;  4AID A;  3QOE A;  1IV8 A;  1F36 A;  4I09 A;  1E17 A;  2KIQ A;  1G8X A;  3MKW B;  1SAX A;  2KLO A;  3MZ8 A;  4J19 A;  2CUZ A;  2W85 A;  4GYI A;  4IX7 A;  2DN0 A;  4ENK A;  1BI0 A;  1P7J A;  1ZGJ A;  3VYU B;  2JQ7 A;  1JUP A;  4RMN A;  1WFX A;  2Q8K A;  3WGG A;  4S04 A;  5A2Q K;  2CUJ A;  2CGP A;  2JRT A;  5B1A H;  1ORK A;  3OIP A;  3FMQ A;  1ZTR A;  3BPX A;  1BL0 A;  4KIB A;  3ZQG A;  1T08 B;  1T0F A;  4N9H A;  1ETK A;  2GBY A;  4LIV A;  2AQE A;  2ICW G;  4I0A A;  2OV7 A;  3NAU A;  2ELJ A;  3I59 A;  4OIN F;  1Y6I A;  3V42 A;  3WTU C;  4ZYE A;  2CSO A;  1ETY A;  2ADU A;  1HDP A;  3L2C A;  2XF7 A;  1EJ9 A;  5DCM A;  2BW3 B;  3VPR A;  1G3W A;  3G71 I;  3ABK H;  4OWR B;  3FM5 A;  2P6T A;  3LOC A;  1K4T A;  3PO3 J;  1H9G A;  2B9S A;  2HYG D;  2FA5 A;  4ZJZ A;  3PL8 A;  4M6Y A;  2D1H A;  2VQL A;  3H5R A;  5J1Y A;  4BQN A;  2OPT A;  1PJR A;  1R5G A;  2CW8 A;  3FK7 A;  4GYG A;  4XRM A;  1AU7 A;  1V5F A;  3BR0 A;  3E3V A;  4PK4 A;  5E18 F;  4C2U A;  1UJ8 A;  4W1U A;  5FO5 A;  1Z67 A;  2KJC A;  3LSG A;  2GOX B;  2JA2 A;  4LIU A;  5CVR A;  4E7K A;  3WHC A;  2NOG A;  1WWX A;  2UXN A;  4XN0 A;  3BCA A;  2VPL A;  3LAP A;  4L9V A;  1K79 A;  2ZFU A;  4NNJ A;  5E3O A;  3M8J A;  4L5E A;  4FT8 A;  1KZH A;  2HYF A;  1W0U A;  1WSU A;  3KYL A;  5FLX Z;  3OYM A;  2OC6 A;  1R22 A;  2YUS A;  2FJ1 A;  3DKW A;  3OYC A;  1N25 A;  3K4K A;  1DU6 A;  5FFZ A;  4NC6 A;  1R4M B;  2VQG A;  4FE4 A;  1D1C A;  1WJE A;  1JTY A;  4FIS A;  1HF0 A;  4IEJ A;  4RDU A;  4OIO F;  3JRI A;  2A68 F;  2A6E F;  3SJM A;  1QO0 D;  2VBX A;  1WJB A;  3DU5 A;  4BS9 A;  2FEZ A;  1WVR A;  2M8G X;  1U8B A;  2ME6 A;  3MZH A;  3PNV A;  2K40 A;  1R58 A;  3HSR A;  2JTV A;  4MEX F;  1DQU A;  1NK3 P;  3G73 A;  4P96 A;  2XRL A;  4HZF A;  1GDT A;  3JRG A;  1T98 A;  3LSJ A;  5KK1 A;  5M5Y J;  4M3F A;  1MJ9 A;  3M4O J;  2QEN A;  1XTA A;  2GXG A;  2IS4 A;  1BA5 A;  2X6X A;  1TWA J;  3HRS A;  2L9N A;  2PG4 A;  1X1P A;  1IXS B;  2ID3 A;  3GTL J;  2RNG A;  2Y9Y A;  5IYC J;  4CCO A;  1TWF J;  2PMH A;  3SFI A;  5D8L B;  3WTX C;  3HPH A;  1Z77 A;  3F9K A;  3OOU A;  4YFN F;  4RA2 A;  1R5H A;  1FMV A;  2ZFW A;  2R7D A;  2CQQ A;  4D7M A;  1WI9 A;  2WBM A;  2F4O B;  1TC3 C;  4HF1 A;  3GLX A;  5TGT A;  3W6K B;  2WY7 Q;  1H8A C;  3DKY A;  5IP9 J;  5GTI C;  5K7H A;  3K1P A;  3KYD B;  1X19 A;  2VT3 A;  3S1N J;  1JXS A;  2RDP A;  4EGY A;  4CZC A;  2EPF A;  2X1E A;  4UV9 A;  2M8E A;  5TIS C;  2X51 A;  2ISY A;  4CYD A;  3KPH A;  5E1Z B;  5FLX K;  1WHU A;  2X9D A;  3FZV A;  4ZYA A;  4BE2 A;  1EA3 A;  1V54 H;  2ISZ A;  2R7T A;  1FEX A;  5H6R A;  3A2K A;  2QCO A;  1Z6R A;  4AYB A;  1LEA A;  4G7H F;  3CDI A;  4O6J A;  3CC4 I;  4IHY A;  2DFF A;  3K0L A;  2EIM H;  1XMK A;  1W5T A;  1WJA A;  3GME A;  4E7S A;  3WTV C;  2QQ8 A;  3ABT A;  2Z5U A;  3BOQ A;  1XDU A;  4WF2 A;  3IWF A;  2HXO A;  4A12 A;  2IPQ X;  1QPM A;  4B09 A;  3K4J A;  3LL7 A;  4X1E A;  1OCT C;  2VC1 A;  3JRC A;  3I55 I;  5LLQ A;  3RPU A;  1BC7 C;  2QZ8 A;  2NNN A;  1T39 A;  5D8K B;  2BZT A;  4GFB A;  1S9H A;  4AU7 A;  2YPR A;  2DA7 A;  4XLE A;  3HTS B;  2A5W A;  3MD2 A;  2ZXH A;  1BIB A;  2DI3 A;  2KHM A;  3S3M A;  1ON2 A;  1F43 A;  1LPQ A;  1O7L A;  4AIK A;  5LBQ A;  1B8I A;  1UAA A;  3Q0U A;  5M3F J;  4Y33 A;  2NS7 A;  4BQA A;  3S93 A;  1LFP A;  1IRG A;  2ZXW H;  3EPZ A;  2NVX J;  2ECC A;  4Q48 A;  1UHM A;  1T8I A;  3KZZ A;  3OIO A;  2FOK A;  4XOR A;  5HOD A;  1FTZ A;  1QHH D;  3S14 J;  2ZKZ A;  4B44 A;  1W0T A;  3OSF A;  2XGE A;  3S1M J;  3IKT A;  2O03 A;  3O6B B;  3L7W A;  1FOX A;  1SFE A;  1ACI A;  1ODD A;  1JT6 A;  3S32 A;  2LVS A;  2XAG A;  3RKW A;  2FX0 A;  3W2V A;  4A5N A;  4DOZ A;  3OS1 A;  2BVL A;  4HQE A;  5EF6 A;  1O3T A;  3BG7 A;  5L3C A;  1DPU A;  3SHF A;  1OQY A;  4ASN A;  2CUE A;  4FET A;  3HL2 A;  3CCS I;  1P92 A;  2CS3 A;  3I56 I;  1VQ6 I;  2HKX A;  1O3Q A;  5K5R A;  4UUS A;  1YIO A;  3I59 B;  4BUP A;  1VQP I;  2QSG X;  2NNY A;  2F5C A;  3CUQ C;  4Y4R A;  1SC7 A;  5EZH A;  3RSN A;  4KA4 A;  1PUF A;  2DA6 A;  5DCM B;  1ZAO A;  2ELK A;  2OQR A;  3RJP A;  2ESH A;  4B8X A;  3AG1 H;  1DP7 P;  1B59 A;  3FXR A;  3QU6 A;  1FT9 A;  2F6C A;  1JGG A;  3LNQ A;  1MMN A;  5E8G A;  2QUF A;  2RGV A;  1O3S A;  2CQK A;  4F92 B;  1W5S A;  2L5Q A;  2HQR A;  1ON1 A;  2NOJ B;  2O61 A;  2JVH A;  3V8K A;  2RKH A;  1BJZ A;  3ABU A;  5GAH J;  1F4K A;  5IYD J;  1BW6 A;  2L9S A;  4GCV A;  4A69 C;  2UZK A;  1GXQ A;  2R5Z A;  2VBZ A;  5EJC A;  2PBI A;  5JLW A;  4O3M A;  2EV5 A;  1PVE A;  4M9X A;  4AYB N;  4ZDO A;  3CME I;  3L00 A;  4KIF A;  1TP4 A;  1UG0 A;  1YW7 A;  3J7Y J;  1SMT A;  4XLC A;  4OAY A;  4EVI A;  3LAJ A;  1A36 A;  3BJO A;  1T0F C;  2BEO A;  3D5R C;  2XSJ C;  4TV7 A;  5J40 A;  2K9N A;  2VT2 A;  4BHB A;  3DPT A;  1Y1V J;  2G9W A;  1XSX A;  3RTR A;  2NXN B;  2VC0 A;  3OWT A;  4BAY A;  4XID A;  3G6E I;  4XLP F;  1MND A;  4JX5 A;  3G4S I;  2LH9 A;  3PM1 A;  4XLN F;  2DMU A;  4BY7 J;  3CCM I;  3GO5 A;  3CCU I;  3WTT C;  3IAM 2;  1YE9 A;  3G2B A;  3QPH A;  3JSO A;  1BJA A;  4MGR A;  3RDI A;  4XRS A;  2A6H F;  4XMY A;  3S17 J;  2KDZ A;  4HV6 A;  1Z9C A;  5BPD A;  1V3F A;  3OYE A;  3M7G A;  3HKZ A;  5J4V A;  3WOD F;  2FF4 A;  4XSZ F;  5LRS A;  4U0V A;  4G7Z F;  1U78 A;  1AKH A;  1QGP A;  3WG7 H;  1MZB A;  1ZYR F;  2PX9 A;  2XAU A;  2EFP A;  1WJ5 A;  2XC7 A;  3K4B A;  4V2G A;  3FWE A;  3RCO A;  3HXL A;  1J0R A;  3H3V K;  5IOZ A;  5IPA A;  5AON A;  1X4P A;  2KIF A;  4RAY A;  1P9Q C;  1FBS A;  1M1E B;  3EUA A;  1YG2 A;  4IRI A;  1XN7 A;  2D1V A;  3HOZ J;  5EYR A;  4HF2 A;  2IVM A;  3F3X A;  1VQ4 I;  2MD5 A;  2DO7 A;  3KZI C;  1X3Z B;  1HA8 A;  4UVC A;  3CLQ A;  3E0J B;  2EV6 A;  2RNJ A;  2JT1 A;  1G6N A;  2JPC A;  3WGH A;  4KUM A;  3S1Q J;  2VQC A;  2E1O A;  1PYV A;  3M8F A;  4LK1 F;  3ZMT A;  4AVP A;  1OYW A;  3GFL A;  2R93 J;  3HZJ A;  1QU3 A;  1WKM A;  1KGS A;  2LOO A;  2VXZ A;  4BL0 B;  3E7L A;  2O9L A;  3Q0W A;  3SEQ A;  1LDK B;  3IH4 A;  3C1D A;  2IAI A;  5CPR B;  5L3E A;  3H0D A;  4EEF G;  4LB6 B;  4E7J A;  3GEZ A;  2EIN H;  3OR1 C;  2DQL A;  2E19 A;  3MWM A;  1FSE A;  2EZK A;  1LFU P;  4HBL A;  4HPQ A;  4RGS A;  3ABM H;  3CLO A;  4GDF A;  4PSW A;  5ILS A;  4P9U A;  1YRN A;  3GLL A;  3QPS A;  5F64 A;  1USS A;  2FBK A;  2PEX A;  2KRC A;  2XRN A;  3R61 A;  4I0B A;  3V7C A;  4I6Z A;  3ONQ A;  5FKN A;  4IZZ A;  2M5W A;  2K86 A;  5KVR A;  5CQG A;  3SZG A;  1JKQ C;  2EV0 A;  3PSF A;  3JR9 A;  5ICF A;  3FXM A;  3CO6 C;  3FDY A;  2O5R A;  2DFI A;  3HSF A;  4MFE A;  2Y9Z A;  1NHA A;  4P9F A;  1B1B A;  5IT3 A;  2VJ5 A;  1F9N A;  2E1M C;  4MIM A;  3TGN A;  3ZQF A;  1FMW A;  4C2M J;  3CCV I;  3HBL A;  2KQR A;  3GTJ J;  2DFH A;  1ZG5 A;  2VJJ A;  1B8I B;  3ISP A;  1W7P D;  4Y7N J;  3ZMZ A;  3ELK A;  4G6D A;  1WH7 A;  5GP9 A;  4A6E A;  4XSX F;  4UB8 C;  2QGU A;  4MTD A;  2DPU A;  4LIT A;  4EJW A;  4K2E A;  2HTJ A;  5EEA A;  3S2D J;  3RKQ A;  3CJT B;  4IQJ A;  3LMM A;  2MBF A;  3BP8 A;  3KIO A;  2LKX A;  2ELH A;  2FUG 2;  1TQI A;  1O7F A;  1TTY A;  1TT0 A;  3NQO A;  3F72 A;  4OIP F;  2M2E A;  1R23 A;  3ASN H;  3OYJ A;  2V9P A;  3M07 A;  2XRO A;  2BY2 A;  2ZSI B;  3E6C C;  2MLG A;  3GZ6 A;  2BY1 A;  3EUK L;  4A2U A;  3F6V A;  4XRS G;  2GAU A;  5FB2 A;  2GA1 A;  4DIQ A;  2KRF A;  2X6Y A;  3EUH A;  4PFP A;  2E60 A;  3PNY A;  2WAE A;  3KCC A;  3N05 A;  4A0X A;  5FD6 A;  2BXY A;  4IHX A;  1X1A A;  4D7N A;  5E8I A;  4UUS B;  3Q9S A;  4IVN A;  3CCY A;  3ABL H;  1TWC J;  3GTP J;  4A3D J;  4WXD A;  1RUO A;  2Y2Z A;  4FHT A;  1GXP A;  1PUF B;  2HVS A;  4G12 A;  5DV5 A;  1ETO A;  2MSY A;  2QF7 A;  3A0H C;  2YX7 A;  3X2Q H;  4C3I J;  1SEU A;  3H1C A;  3TP0 A;  2Z1D A;  2HEO A;  2R7Z J;  4G94 A;  2MLK A;  5F0F A;  5LGT A;  1SFU A;  3ZPL A;  5HS7 A;  2MC4 A;  1BI1 A;  3MVP A;  1J09 A;  1YFH A;  2Y0M A;  2XAS A;  5EZG A;  3KP3 A;  2UUZ A;  1BN5 A;  2LKS A;  4B4C A;  2PFB A;  2R5Z B;  4NDL A;  3KP7 A;  4Q5S F;  5CVU A;  2OUM A;  3DEU A;  1H9T A;  1T6S A;  5GPC A;  5KNL A;  3LA3 A;  1IO2 A;  2PMZ A;  5K5O A;  2NAZ A;  4E70 A;  1FC3 A;  4D0P A;  4WWC A;  4Q4Z F;  2RVC A;  5CKT A;  2IS2 A;  1A5J A;  2R7F A;  2BOL A;  3GCM A;  4GGG A;  3I0T A;  3I3L A;  4XQF A;  2VPR A;  4BXX J;  2Q0O A;  3BLY A;  1KU3 A;  3DTK A;  3K6G A;  1T2K A;  3KFW X;  1IG7 A;  5ED4 A;  2DT5 A;  4RM3 A;  4A3C J;  3K69 A;  4Z2Y A;  2PJR A;  1WI3 A;  3CJR B;  2GXA A;  1T56 A;  1B4A A;  2R7X A;  2ZME A;  2X6O A;  2EFW A;  2OU2 A;  1CQT A;  5GAE J;  2V7F A;  3CTA A;  3JRB A;  3UNG C;  4BY1 J;  4H4K C;  4CDG A;  4BU2 A;  1LJ9 A;  3IL2 A;  2WAD A;  2KMU A;  1Y1W J;  4X6A J;  1XGM A;  3LA7 A;  3OR2 C;  3OIQ A;  4BXU A;  2G0E A;  4CXF A;  3BC8 A;  3LSH A;  3VB2 A;  5M5X J;  2F5V A;  4ETS A;  1UG2 A;  2WB1 N;  4RGR A;  3RYP A;  1AKH B;  5CVI A;  5JVG F;  1IRX A;  4G6Q A;  3K2Z A;  2QBY A;  2MG4 A;  1XGO A;  1R1U A;  2XF5 A;  2DTR A;  1MNE A;  2W48 A;  3LQQ A;  1CGP A;  4LLG F;  5ICE A;  2HQ5 A;  4A0Z A;  4OOI A;  3DLL F;  4B3X A;  1JTX A;  4IHW A;  2ACJ A; 
#chains in the Genus database with same CATH homology
 1FOY A;  2E36 A;  5GAD J;  3PIP F;  1MMS A;  3PIO F;  1VQ4 I;  2ZJR F;  3CCS I;  3I56 I;  1VQL I;  1VQ6 I;  1VQP I;  2H8W A;  4V19 K;  1YI2 I;  2QEX I;  1VQ8 I;  2OTL I;  5DM6 F;  3G71 I;  2ZJQ F;  1YIJ I;  5DM7 F;  5GAG J;  3CCQ I;  2QA4 I;  1VQM I;  1YJ9 I;  5GAH J;  1YJN I;  4IOA F;  3CC4 I;  3CC7 I;  3CME I;  2OTJ I;  3J7Y J;  2ZJP F;  2E35 A;  3CD6 I;  3CCV I;  3I55 I;  1Y39 A;  3CCE I;  5GAE J;  1VQ7 I;  2NXN B;  3CCJ I;  3G6E I;  3G4S I;  3CCM I;  3CCU I;  3CC2 I;  1YJW I;  1VQN I;  3CF5 F;  1YHQ I;  1VQK I;  1VQ5 I;  1FOW A;  4IO9 F;  3CJT B;  4UY8 I;  5JVG F;  2K3F A;  2FOW A;  1HC8 A;  1YIT I;  1VQO I;  1QA6 A;  3J7Z I;  3CCR I;  1FOX A;  3CCL I;  1ACI A;  1VQ9 I;  3DLL F;  1S72 I;  3CMA I;  4IOC F;  2E34 A;  2JQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...