1VQMI

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1vqmI00
3PIOF 1VQ5I 1ACIA 1VQ6I 3CMAI 2NXNB 4IO9F 3I55I 5DM7F 4UY8I 1VQNI 3G6EI 3J7ZI 1YHQI 2JQ7A 1VQMI 1YJ9I 2H8WA 3J7YJ 1VQ9I 1Y39A 1VQPI 3CC4I 3CMEI 2E36A 2OTJI 3I56I 2E34A 3CCRI 1VQ4I 1VQOI 1FOWA 1HC8A 3CCLI 3CJTB 3CD6I 3CCJI 2K3FA 1VQLI 3CCSI 3PIPF 4IOCF 3CF5F 5GAEJ 3CC7I 1YJNI 2FOWA 3CCEI 1MMSA 3DLLF 2ZJPF 2ZJQF 3G71I 2OTLI 1FOYA 1QA6A 1YIJI 1VQKI 5JVGF 3CCVI 2ZJRF 2QA4I 5GAHJ 4IOAF 1VQ8I 4V19K 3CCUI 3CCMI 1YITI 5DM6F 5GADJ 3CC2I 3G4SI 1YJWI 1S72I 1FOXA 5GAGJ 2QEXI 1YI2I 2E35A 1VQ7I 3CCQI
chains in the Genus database with same CATH superfamily
3DLAA 2DQRA 4A3DJ 4MGRA 3NARA 4LB6B 2XV4S 3F6VA 4F7ZA 4UUSA 2BVLA 3K4CA 2OCEA 3BY6A 3CO6C 3BTLA 4G94A 4XK4A 3P9IA 3VOEA 1AA7A 3BLYA 5E3OA 3ZQFA 1YTYA 5E1WA 1S6LA 1QVUA 2R7WA 4PDKA 1UG0A 4G7ZF 1S5LC 2VE8A 5EF6A 3GTJJ 3OYMA 1V55H 4Z6YA 3CTAA 4XKWA 1BIBA 5J40A 1F4KA 3D5LA 1ON1A 2DPDA 4CCLA 1VQ9I 1IN7A 4A5MA 1XMXA 5ICFA 2DYRH 3UKGA 1TC3C 3JW4A 4KISA 3AG2H 1VQ4I 2KRCA 4BS9A 1HSTA 3OWTA 2V6CA 5TISC 4AYBN 2LDUA 4HQMA 4Y3OA 1WGXA 3WHCA 5IYBJ 4I02A 4A6EA 2I5UA 3FBIB 4L9JA 2VBWA 3U9GA 5D8KB 3H1CA 2GAUA 2LYCA 2W7NA 4V2GA 1V3FA 1LE8B 2Y48A 3QPLA 2Y69H 3AL0C 2EILH 5C4XJ 3BR3A 1POGA 4RM2A 4G6TB 2EB7A 1O3SA 2CW8A 2RC4A 3EUHC 1DDNA 4M9SA 4UHTA 1QU3A 2R92J 2M2EA 1SVMA 4O6JA 3ERMA 2F5EA 3HYIA 2FEZA 2LRDA 5DYMA 4DQ2A 5HDNA 2DFFA 1BI1A 4BBRJ 5C3EJ 1KU9A 3S1QJ 4OAZA 2RKHA 1IC8A 1IAWA 3C18A 3DWLE 4CCNA 5HVQC 1BOBA 2HXIA 2GOMA 1QHGA 4UVCA 2RAEA 2EFWA 3MVPA 4HLYA 1SAUA 5IYDJ 4A3BJ 4ZYHA 3OS2A 4HX8A 4BUPA 1WVRA 4C3IJ 2D2WA 4RGRA 4QTRA 5GAGJ 1EH6A 3SXYA 1ZYRF 4EV0A 4HLXA 4XN3A 3HEFA 4HBLA 1D8JA 1F36A 4Y52J 1YI2I 4LLNA 3J7AO 3BJ6A 1SFXA 4BY7J 2DA6A 3M07A 4MTEA 3OSGA 1XD7A 4P55A 3H0GJ 4KN4X 4AUXA 5F1JA 1H0MA 2Y0MA 2FOKA 3FMSA 4P9FA 4XLNF 4CCOA 3QQAA 1BN5A 2LBFA 2NOJB 4I99C 4RA2A 3R0AA 3R61A 4DZPA 4UY8I 1PVEA 3L9FA 4HEA2 1S7AA 1U3EM 4AU7A 2E60A 3VYUB 3DQVC 1K4TA 3OL3A 2HYFA 2BV6A 1BOAA 5LHGA 1BM9A 2RV8A 5D5XB 4C3JJ 4M6VA 4CCMA 3A01A 1EJ9A 1T6SA 3CMMA 5TJJA 1SD5A 2VKDA 4KIBA 2PMZA 1FY7A 5HS7A 4C9YA 2W25A 4LIVA 5D5UB 3BTIA 5LRRA 4J00A 1IXSB 4W1UA 2KRHA 4DYQA 1TTYA 1TWGJ 2IVMA 1KA8A 3HOXJ 4E7IA 4FE7A 2K7LA 2FBKA 5LGNA 2G7UA 5E3LA 3HB9A 2KDZA 1A36A 5EEAA 5FRMA 1D8KA 1HKQA 3DPLC 2MH9A 3SDGA 1E3HA 2GOXB 4RLFA 2VKEA 3BROA 3E7LA 2HOEA 4HW0A 2DA7A 1LFPA 4HYEA 5B1BH 5DEQA 4PGGA 3ZGKA 2LBFB 2VQHA 3BR1A 2K02A 4JOMA 4GGGA 1JTXA 3MD2A 4CCKA 1KZHA 1VZ0A 4HSTA 1IDYA 2R5YA 1BA5A 1ZG3A 2FJ1A 1QA6A 1EV7A 2YU3A 2R93J 4HNTA 2LG4A 2XRNA 3C1DA 4ITVA 4Y15A 5FJ8J 5D4SA 1GT0C 5L3FA 2TCTA 3HGYA 1FBSA 4EMSA 2DK8A 3A01B 1S29A 4A6DA 2QCOA 5FRNA 3I59A 2CO5A 3E6DA 1RIOH 2DI3A 2A07F 4MNUA 1RR8C 4FETA 3S1RJ 2W57A 3H9JA 4HDVA 1WPKA 3TO6A 1QBJA 3L2CA 2HGCA 1NG7A 4BQOA 4EM1A 3HOYJ 3GTLJ 4RM3A 3IWFA 3L2RA 5L3GA 1G4DA 4LG0A 5H2FC 3M8JA 5BNGA 4BJ5C 4EGYA 1LUJB 2HQRA 2M4GA 1VTNC 3ISPA 1D0YA 5F0CA 4DBRA 4P9UA 2NS0A 4RAZA 3MMYB 1T38A 1FBQA 3IL2A 4ZJZA 3GEZA 1IF1A 3WG7H 4NQWB 3LAPA 2LF7A 2YPRA 1K78A 4E70A 1U78A 3F0CA 4OOIA 3KP3A 3QAHA 2GXGA 3GF2A 4LK0F 4FASD 1YS6A 3CDLA 1FJLA 5IOYA 1MH4A 2XSDC 2OUMA 3P9CA 2JQ7A 3DTEA 4RMNA 3GTQJ 1UCRA 3LOCA 2E1NA 4NC8A 4EM0B 3ZMSA 2OPTA 5L3CA 3K4BA 2M34A 5EYRA 3HSFA 1VNDA 2BYVE 3I59B 4A3JJ 1G3WA 3BZKA 4ON0A 3HZJA 2PEXA 4N9HA 1OCCH 3FXMA 2KJCA 2V4JC 2ESNA 5K7ZA 2GIVA 4HV5A 1R1TA 3M1CA 4BJTA 4G7OF 2MA3A 2DCEA 3KEYA 4LG0B 2M5WA 5FFZA 3RZDJ 1EKEA 2HDWA 2L9NA 3OS1A 4ENMA 3RCOA 4LK1F 2E7XA 5F0FA 5EGOB 1I27A 2IA1A 2RNGA 2W24A 4UB8C 3GFLA 4MFEA 3L00A 4KNYA 2X85A 3CF5F 1XSXA 3S14J 4PFOA 3KLNA 3E97A 3G2BA 1R23A 3T5XA 4B8XA 3I4MJ 2ELKA 4AYBA 5FROA 1JTYA 2KMUA 3RPUA 3GFJA 4F52A 3LA2A 3LA3A 4UVAA 5LRSA 4BQQA 4LJZF 1BR2A 3KCCA 4IXAA 4U0VA 2FBIA 3FXRA 3K7AJ 2K3PA 2ZJPF 3G1LA 2QZ8A 2GWRA 4HV6A 1V5GA 1UZCA 4PJJA 5BPIA 1JKPC 2HZDA 4AIJA 1M1EB 2FMYA 4EJUA 3A03A 3OY9A 3ELKA 4KIGA 1XCVA 1A31A 3LSPA 1ZLJA 1K4SA 5HLHA 2HTJA 3T8RA 3ZR8X 1P4XA 5KNLA 2XGCA 2ZNYA 1BJAA 2R5ZB 5BMZA 2LLKA 3ZQLA 3JRBA 2EWNA 2O5RA 4J01A 4EM2A 2ZFUA 3HSEA 2NAZA 3Q0VA 1RR7A 3E5UA 2IGOA 5DD4A 2AXTC 2R0QC 3U1DA 1ZGWA 2EA2A 2W84A 3NWSA 3OSFA 1WCMJ 1DP3A 4IPAA 1O3QA 3J81K 2R7RA 1WHUA 1IGNA 5FD5A 2BVMA 3KP4A 3CCQI 4A0YA 2R4GA 1QHHD 3OYFA 2KJBA 4C2MJ 2H1KA 3PO3J 5F04A 4ZDLA 3MKWB 4IO9F 1RNLA 1O57A 3FDYA 1B9MA 4XICA 2QSGX 2O0YA 3NWTA 5FB2A 3RIRA 1GXPA 3RTRA 1B72A 2X1EA 1MZBA 1J2XA 2EFNA 2FBHA 4F3QA 1TNTA 1TT5B 2ID3A 2DFEA 2MYSA 4II2A 4WXDA 5LBQA 2QVOA 2JUCA 3OYNA 2Q2EB 2J5OA 4JK1X 3CMEI 1XS9A 2E5ZA 3SEQA 5E18F 5HNFA 4QIWN 1Z21A 2EIJH 3PL8A 4OMYA 1I1GA 2WY7Q 2IGMA 2QSHX 1YW7A 2NNYA 2PN6A 5J1RA 2DAOA 1ETQA 1TNSA 2JA2A 2V7FA 1OCTC 2K5CA 1LKXA 4DBQA 3CCJI 3HRTA 2XAQA 2PJPA 3EYIA 3A0HC 4N4NB 5CQEA 4M72A 2VPLA 2Y9ZA 2A68F 3MKLA 1MH3A 1YX5A 2F5FA 1JXSA 2FX0A 2QENA 5GP9A 5KHDA 1R1UA 3DEUA 4MEXF 4U7DA 3FXLA 1GV5A 3HRMA 5GAEJ 5J8CA 1QZYA 2H8RA 3C2GA 3KEQA 3E5XA 1WH7A 2VXZA 4BE1A 4UXNA 2A6EF 2F4IA 4LLLA 4IQJA 1WI3A 2HPMA 4DYRA 1SANA 4G6QA 2V6EA 2M4KA 2K4BA 3CUQA 1MNEA 1J7KA 3KP2A 1VQKI 2XGDA 3V8KA 1ZK8A 5JVGF 3K2ZA 3DFGA 5FD6A 1Z9CA 2E1CA 1QQIA 5D6FA 4XIDA 2L54A 5B66C 2OU2A 1FTZA 1L3LA 2XGXA 5LEJA 4B47A 1ZQ3P 4UV9A 2CV1A 3FHNA 2DFHA 2ZMEC 4M74A 4LB5A 2YS9A 2GZWA 3ML6A 3GX4X 4XNFA 2OQGA 3OIQA 2JRTA 2LY9A 5BOXA 1D1AA 4I6ZA 2DDAA 1VI0A 1X1DA 1HW5A 4FQGA 1LVAA 4BYYA 3G4SI 3JRGA 1OYYA 1YJWI 4PSWA 1FOXA 4XRSG 3S2WA 4O3MA 1EA3A 4BEHB 2FQ3A 2YU9J 4RB3C 1SFOJ 2OF7A 1N75A 3PSFA 2QKMB 1VQ5I 3IUOA 3N05A 5CKTA 1YRNA 1FSHA 1PJRA 3JTHA 4LMYA 3RKQA 2XAFA 3K4MA 3V42A 2DN0A 4B48A 3ESWB 2XB0X 3R60A 5C4JJ 3CLOA 3TEDA 2RN7A 3CJRB 1MBFA 1FYLA 3GZ6A 1USSA 3W2VA 3ECOA 3OYAA 1V54H 1YW9A 1HDDC 4QSHA 5C44J 5HNHA 2DMUA 2VN2A 1W0UA 1Y1WJ 3JAMZ 1R49A 1CF7A 5IT9K 4CYCA 3Q5FA 1YJ9I 1MKMA 4BY1J 1MDMA 2X6WA 2ZXIA 4YFXF 4PJ0C 2XPWA 2XSJC 1E3PA 3KIOA 2E36A 5EJCA 1T2KA 1O3TA 2E34A 3PM1A 3DTKA 4L18B 4OIRF 2K86A 2HWVA 2LVSA 2EZLA 3ZMTA 1NK3P 5DUIA 5LGTA 4ANJA 5L3BA 5LEKA 1ZREA 1SD6A 4EJOA 2H6CA 3TL4X 1ETYA 1OJLA 4JQFA 4MHGA 3K70D 2K85A 2HXOA 2AXLA 1WJDA 3HUGB 5M3MJ 2DU9A 3TOAA 3F8MA 2GIZA 2CWEA 2H94A 1OMIA 1WJ5A 4I76A 1GXQA 2KP6A 3I71A 4RLQA 3FK7A 3HOWJ 5AONA 2HU9A 3H3VK 1RI7A 3E0JB 3AKZA 2EPFA 2HDCA 2CQKA 2MGQA 1MMSA 4Y7NJ 1I6XA 1WFXA 5CVRA 1GHCA 1XTAA 3QPSA 3O6BB 5J47A 3WTTC 2LFBA 3OOUA 1MNMC 3ZN0A 1GLNA 4NUBA 1YIJI 1L0OC 4WWCA 3JRIA 3NRVA 4RAGA 3FF5A 4E7SA 1CF7B 4YRVA 5DUKA 4CYCB 1MDMB 4CO8A 2I8DA 3J81Z 5JVTA 4IX7A 1RESA 3FMRA 3J80K 2G9WA 4N4OB 4RDUA 1UAAA 4GCVA 4M9ZA 5F6FA 3E5QA 3QYBA 2KPMA 2CUEA 2CG4A 2KIFA 2QQBA 4FHTA 2WV0A 1MMNA 2Y0SN 1XPXA 1ONVA 1X1PA 3GUDA 4JYKA 5DCFA 1G3YA 3GTOJ 3CUOA 2CW0F 4EATA 1WWXA 2VQCA 1GVDA 1W0TA 1ZARA 4U0WA 3SZTA 1BW5A 2E2HJ 1Z6RA 1BR4A 3QYFA 4FX4A 1VQ7I 4M73A 4HX7A 4M3EA 1IV8A 2ZB9A 2GM4A 2DFIA 1V5FA 4D7NA 1KYWA 2F5VA 2XIGA 4KICA 3SQNA 2JJ7A 2ECCA 1X1CA 4S04A 2DT7B 5ILUA 4CHUA 2XF5A 4CZZA 2LKSA 4ZH4F 4A3FJ 1LEBA 4GRIA 1TWFJ 2XHKA 2OZUA 1TZLA 4L9TA 5J4YA 3FXQA 3MN2A 5E17F 1IZ1A 5E3NA 2MC3A 4OWRB 4XLPF 5ILSA 2DTZA 2MG4A 4P5OA 3KYDB 1AOYA 2K40A 3ZQHA 1JUPA 5ERIA 2MBFA 1ZAOA 2L7FP 2XB5A 3P9KA 1IV6A 1Z0XA 2LTPA 1LE8A 2OTJI 2RQQA 3MZ8A 2FXAA 1FX7A 5FLMJ 1QZZA 2IS4A 3LNQA 2CQXA 5M5YJ 1F43A 3K6GA 4CICA 4NDLA 4XRMA 5HLTA 5CJ9A 2CV0A 2WA0A 3KP5A 1XB4A 4M6YA 2PX9A 4HSRA 3KP7A 4H0EA 3GTGJ 1JI8A 2LY2A 1E3OC 4GYIA 5AIQA 3GO5A 4PCQA 5D4RA 3HBLA 5IPAA 2P5KA 1OLTA 2E19A 4BDYA 4Y13A 2MC4A 3MZHA 2DT5A 1WH5A 3L2UA 1DUXC 2Z3YA 5IP9J 3S2DJ 2L02A 1P6RA 4YEJA 3EUHA 2VODA 4A3LJ 5DD8A 1QPIA 2P6SA 3PQJA 3M4OJ 1LDDA 4IF4A 5GPAA 4U88A 3TDZC 3RPUD 1K6OA 1TWHJ 5K5RA 4CA0A 1K79A 2STTA 2F2EA 3FXOA 5JHUA 4XLAA 4M6XA 1ZLKA 1T33A 3W3CA 4BAYA 3HSRA 4JBAA 3MKYB 4HZFA 4IOAF 3ABTA 4D9JA 4B4CA 2QLZA 5B1AH 5L3DA 1YITI 4Q4ZF 4XRFA 2XPUA 1IJWC 5BQTA 3H3UA 5LGUA 4PJNA 4XM3A 4U87A 3ZOBA 1UELB 3BJOA 2Y9YA 4M9XA 5H6QA 2FNPA 3LL7A 4PGHA 2M30A 4DGWB 5DTDA 1ZHFA 3HRSA 2GXBA 3BPVA 4XQFA 1MNDA 3AL0B 5IT9Z 3OYGA 3SEZA 2QQ8A 3G73A 4BDZA 3HOVJ 2VBXA 1KGSA 3AFHA 1W5TA 2P81A 4JX4A 3BJAA 2HNHA 1I1SA 1QO0D 4ESFA 4X1EA 1BW6A 4L0ZB 2DPUA 2PJRB 1RUOA 3HDDA 1S7EA 2COBA 1HKSA 4DIQA 1OFCX 1HA8A 3AG3H 3TMOA 3WG9A 1XGNA 2FSWA 4I0BA 1JHHA 2KQRA 4AIKA 2CMPA 4XLFA 3L1PA 4A3MJ 2X6XA 1BC7C 3QP5A 5TRDA 3DPTA 2FD5A 4UVBA 4YFKF 2EINH 1Y8QB 2A6TA 1ZTRA 2XKOA 3OS0A 4L5JA 4WXHA 1DQUA 3E6CC 2UZKA 5HLGA 5FLVA 4K2EA 5A2QZ 4M3FA 1TW3A 4MIMA 3R0JA 1XX5A 1O7FA 4NNJA 2ZJ2A 3IH2A 4KT5C 4KITB 1W36D 3FHZA 2STWA 1ZRDA 3J80Z 2MLKA 2LOOA 1SFKA 1Q1VA 1U8RA 3GMEA 1JUSA 1SFUA 4B1RA 2M7AA 2NVYJ 2ZO4A 4L5EA 3W6VA 4Q5SF 2FNAA 2EFQA 3JTGA 1FC3A 1I39A 1WKMA 3L7WA 3WODF 4UNOA 1A6QA 4I2OA 3OMYA 4BHBA 2X48A 4CXFA 3CCVI 3ZXSA 2VB6A 2W4SA 1N77A 4HAMA 3W6KB 3H5AA 2AHQA 3OV8A 2DMQA 1X3UA 2DYSH 2OAZA 2EV6A 2E1MC 5E1ZB 3SZGA 3N4MA 1WJFA 2QQ9A 4XKBA 1T08B 5GTIC 1OYIA 3BOQA 3TP3A 4NQWA 1RC9A 3T8TA 1B9NA 2AO9A 2VOOA 3F72A 2EIKH 4RGXA 3F8CA 2BY1A 3EQLF 2GXAA 2B63J 3CO7C 3ULQB 3GFIA 3REOA 4AIDA 3E3VA 2D1HA 1O4XA 3GLXA 1AKHB 4YFNF 1VF9A 2M3AA 3VDXA 2Y0SA 3OR2C 2RVCA 1SD4A 1O7LA 1IUYA 1GVJA 2J5PA 1TLHB 3PFYA 4I7HA 1LNWA 2BW3B 4YELA 4MO7A 2ELHA 4HF0A 1OCZH 4XSXF 4MTDA 5D5VB 1Y56A 2M7BA 3OYKA 1RRJA 3JSPA 3VODA 1ETVA 2HQ5A 4A3KJ 3WE2A 1FMVA 2L2OA 5EGOA 3J7YJ 5IP7J 3KP6A 1OYWA 1HCRA 2KL4A 2GQQA 1D5YA 4IHTA 1OCPA 1FT9A 1QVTA 3I56I 4H4KC 4ZDPA 1EF4A 2LP0A 3QU3A 3T1BA 2DMPA 4OAYA 3B02A 4EJTA 3RQIA 2P7VB 3LSRA 3I4PA 4LIUA 1W5CC 2BE5F 5CLSA 5CQGA 3CCSI 2JTVA 4BXXJ 1K6YA 2KHMA 4NHJA 3GTPJ 4E4HA 2KISA 3EPZA 3V7SA 3WU1B 4N0BA 1U5TC 4A0XA 4GDFA 3W6JB 1FOKA 2HTSA 2V1UA 1SC7A 2MABA 3BQZA 4ZYGA 2R5ZA 4WF2A 1W7PB 3WTYC 2HOSA 1ZR4A 3RI4A 2BZTA 1HBXG 2CV2A 5FLXK 1ZGAA 1U9OA 3EYYA 5JHFA 2ETHA 3GXOA 1YW8A 1UFMA 1U5TB 3A02A 2KZVA 3BG6A 4LG3A 4RB2C 3HOSA 4HNVA 3PNVA 4AWXB 2L01A 3GBGA 3RDIA 4RB0A 3BWGA 3MCZA 4HQEA 3CCUI 2E2IJ 5ICCA 4AD9A 2A5WA 3COAC 4X6AJ 5LHHA 4LLGF 2XROA 4KUMA 2CW7A 4F92B 3PO2J 1DGWY 2EBIA 4J19A 2RQPA 5F64A 2ZKZA 3DKXA 4F55A 1G59A 3MKZA 1R22A 1JKOC 1HQCA 1XMKA 2WY8Q 1S7OA 3ZMDA 3LQRA 4FT8A 1AWCA 3TP0A 4HOBA 2OA4A 4U7BA 3GTMJ 2VUMJ 4ESJA 5M3FJ 4XONA 4BHCA 1B8IB 2P8TA 3WTZA 1H89C 1T0FC 3LSMA 2DA3A 3ONQA 3RKYA 4XLHA 4ESBA 4UUVA 4DJAA 2UXXA 1FMWA 2Q2EA 4ABZA 1BI0A 5FO5A 1VQ6I 3JSOA 2V9KA 3AAFA 2BY0A 4RS8A 1G2HA 1JUMA 3I55I 2P5LC 1ITYA 1FPQA 2WB1N 3CLQA 3MEXA 2RDPA 3WTUC 1TWAJ 3C2BA 1IUFA 4HF2A 4BQNA 2VBYA 1LFUP 2XPVA 4HRIA 4HG2A 1JGGA 1WJAA 4A3CJ 3F23A 3KYCB 2R7DA 2GA1A 1X4PA 3U1KA 3C3WA 3GYHX 1JJ8C 5E8IA 2HOTA 1H9GA 3K1NA 1C0WA 2JA8J 1IN5A 3DP7A 3K10A 4EJWA 5LD2C 2X9DA 4PJMA 3CJTB 1MSEC 3CD6I 3KX2A 3S16J 2MD0A 5CPRB 3ZQQA 2L4AA 4E7LA 4KMFA 3KZYA 4RGSA 4G8XA 5HS9A 1APLC 1W4MA 1VQLI 2R7UA 2W85A 1H8AC 3QOEA 4TV7A 4IOCF 3IHUA 2VJ5A 1ZGJA 4M71A 2WAQN 4IHYA 2KT0A 3SHFA 1ZH5A 1UG2A 3BQYA 3S32A 4PSXA 5ILVA 4EGZA 2M45A 3OIPA 1DGRM 2EV0A 2HOAA 2Q8KA 1HW1A 3O2PE 2DODA 4EQQA 3BCBA 3BG9A 2QQAA 4HX4A 2O61A 2COMA 4OIQF 4UV8A 2EIMH 1Z1DA 4Q48A 1WJBA 1YOVB 1WI9A 1FYKA 2XVCA 4IHXA 2P6TA 2UWMA 3P5JA 2KDOA 3WHBA 2QA4I 2ZMEA 2MFZA 5FGMA 3VWBA 3EUKL 3TOBA 3K4KA 2R7SA 1R58A 4BEHA 3FXUA 1VQ8I 2LF8A 5CVVA 1KQ0A 1IN8A 2K9LA 1ZKGA 2HQNA 2W1OA 3QU6A 3BG5A 3L2VA 3OYJA 3BCAA 3F22A 1XCBA 1YO5C 1XSVA 2EK5A 1OQYA 3VYSB 4LGWA 2HS5A 1B6AA 4IRGA 4N9IA 1V5EA 4A93J 4DOZA 1R00A 3HL2A 4M3BA 2D1VA 4JX6A 2LSOA 1ZG5A 5EEHA 2XRLA 1O3RA 3PFIA 3HKZN 1JKQC 3A0BC 2IJLA 4BACA 2ACJA 4E7JA 2KIMA 1Z05A 3M1EA 3HXLA 3QYEA 2JWTA 5B5EC 2BHYA 1I5ZA 1R1VA 2VIXA 1X4OA 4BXFA 2D5VA 5EEGA 2JA6J 3I53A 1QNTA 3C2HA 1XGSA 4CSWA 4JX5A 3G3ZA 3ZRGA 3OYEA 1D1BA 3I0TA 1ETKA 2ADUA 1X1BA 2M8EA 2Y31A 1ZELA 3GVAA 4D5FA 1A35A 5CVUA 3JRAA 3LSGA 1IW7F 1MMGA 2ZMEB 2ZSHB 3V8LA 3HUGA 5ICGA 2L7KA 2M0CA 1TQMA 3E6MA 3CCYA 3HG9A 3H92A 1IG7A 2WADA 2FUG2 5KAFC 2F4MB 3WU0A 3FBNB 3CCRI 2IS2A 2B9SA 1LVKA 1QGPA 4XR6A 4CYDA 3VYTB 3SJMA 3ZP5A 2OBPA 1HKTA 1U8BA 2HKXA 3ZQIA 2EZHA 2JMWA 5J3LA 2X6OA 2JA7J 5FLXZ 2DQLA 4G7HF 4C3HJ 1AHDP 3Q0UA 4QPQA 4MLOA 1EH7A 2QWWA 3HJEA 2M9HA 2R7XA 1JJ6C 4MQVA 4A2UA 5F1RA 1FSEA 4A5NA 5GPCA 2XDVA 2K9QA 3BR0A 3LSKA 5CYVA 3FKJA 1S9HA 4O5VA 4XBFA 3DKYA 1RKWA 2FQ4A 3CCEI 3Q0WA 3HRUA 4R8HA 3RKWA 4LITA 4RBOA 3R4KA 4CCJA 3NQOA 1REPC 4DNCA 2Z5UA 4EEFG 3I54A 2P7CB 1UB9A 1ULYA 3CJNA 5EZHA 3HIFA 1IDZA 1BR1A 2XAJA 2DMTA 5E1XA 2VJJA 4KYWA 4A3GJ 1ERDA 4M3GA 4I09A 2IA0A 2ELJA 5B3SH 4DZJA 2V1XA 3N97A 1P2FA 5BS6A 3S1MJ 3WTXC 3ABMH 4KA4A 4U0YA 3CCMI 2LREA 2OD5A 3IH4A 1R7JA 3MZYA 1N78A 3I4NJ 3M7GA 3DEWA 4G6DA 3TW7A 3S1NJ 1T39A 2QYOA 3O3KA 1CQTA 2ISZA 2EH3A 3RYRA 2N8GA 5FFXA 2V9VA 4KJZA 1SFEA 3DV8A 2X6YA 3FK6A 1S72I 3A4CA 1DPRA 1WQ2A 2PMZN 3SFZA 4L0YB 2ID6A 3IKTA 4BE2A 4BL0B 3S8PA 1LDJA 2E35A 2VASA 3PSIA 1DU6A 1P9QC 2IA2A 3K2AA 2CGPA 2WBMA 5D5WB 3K1MA 2DLLA 2VT3A 3FIWA 2WAFA 3CMAI 2NXNB 1B1BA 4GXOA 2NVUB 4GYGA 1K61A 2A3SA 1OKRA 2FE3A 2LNBA 3L09A 4D0PA 1LPQA 3ERED 1X1AA 4PFPA 3PUFA 4XKVA 1YHQI 2H1LA 2QKLB 1FYMA 2IS1A 1XMAA 4XKCA 1YFHA 2JSCA 2PQ8A 3QPTA 5EZGA 1F9NA 3WGGA 3OYLA 4IKFA 1Z91A 2BXYA 4Q47A 5D8LB 1U6GA 1I3AA 2K27A 4KIFA 2QM3A 1PUEE 1K83J 3IKVA 2DA2A 3A2KA 1IN4A 5IP6A 4KMUX 3BTCA 3F6OA 1H88C 1WRJA 5DV5A 2CJJA 2D45A 3S3NA 3MFKA 1SMTA 2LK2A 3CF2A 3QPHA 2K3FA 3S93A 5J4VA 2M0MA 2UXNA 1MBJA 1KQ8A 2ZXJA 5TGTA 2XAGA 1X19A 1YQAA 3GCMA 2YUSA 3KLOA 3JRDA 1WSUA 1TL8A 2F4OB 3B6CA 2XF7A 3S3OA 2H09A 1FIAA 2RNJA 4XLCA 1UHWA 3GW2A 3Q9SA 2CQQA 3FXJA 2LY1A 4UB6C 3CC7I 3OL4A 2R3SA 2L9VA 2FOWA 2VPRA 3H9GA 1IO2A 2XF6A 1UHMA 1G6NA 3DKWA 4IRHA 3DLLF 4I01A 2VONA 1OR7C 2JPCA 2WAQA 2ZJQF 3W2AA 3K9TA 2Q0OA 3K69A 1X58A 2EA4A 2OJED 1IRFA 3ZMUA 2Y30A 4L9VA 3LWFA 4DW6A 1A04A 2CFXA 2X0LA 3KPHA 2MD5A 5E79C 6PAXA 2JN6A 4QWQA 4D5CA 2AQFA 2JT1A 2CRGA 4FISA 1JT0A 1J5YA 2Y75A 5IT3A 3K4LA 4KT6A 2IPQX 1ENHA 1QZEA 1MMAA 1FP2A 4BU2A 1OCOH 3KYLA 1T8IA 3MWMA 2TRTA 3CC2I 2FMLA 5D6EA 3ECHA 2M87A 3IC7A 3OOPA 5IY5H 1BC8C 2LR8A 1YIOA 2PJRA 2ZXWH 2ZXHA 5ED4A 1TQIA 1XDSA 1OCRH 3SDBA 3BR6A 1KYZA 1X2NA 1D3YA 1KQ9A 1WJEA 2E1OA 3ZQ7A 5K1YA 3DU6A 3HOTA 1IRXA 1TBXA 3RQ4A 5F08A 3SYTA 3EDPA 2DA4A 4IVNA 5LHIA 1XSDA 1JT6A 5BPDA 2E5NA 3HKZA 3Q9VA 1PUFA 1X3WB 3GZ5A 1FP1D 1T56A 5DM7F 1IRGA 2F6CA 1VQNI 4F91B 3K4JA 4IJAA 4LOCA 5H6RA 5L3EA 5JR3A 3CMYA 1FZPB 3IRQA 1R71A 3DBLB 2IBDA 4IQ4A 3IWZA 3S3MA 1RUNA 2Z1DA 2HFHA 4XRSA 4UUSB 4LFUA 4I0AA 2KIUA 3TO7A 5HLIA 1FLIA 1OISA 1KU2A 2V79A 2XUBA 2JA5J 1YLFA 2ZFWA 4ZC3A 1MJBA 3TBIA 3Q3SA 4AVZA 4S0HB 2VLAA 1P92A 4BGDA 2BBYA 4Y33A 3K4NA 3KE2A 3ZMVA 4ENNA 3TW6A 3ZCOA 3LAJA 4YIIA 1GUUA 3DPUA 2DDBA 2R7OA 1TQPA 2ZSIB 5M5XJ 2VXDA 3JRCA 4ENJA 2HYJA 3F8FA 2HEOA 3LFKA 3LSJA 4C2TA 1ORKA 3ASNH 2A6HF 1P4AA 4XMYA 1OPCA 3WE3A 1PUFB 2IRFG 4RAYA 3WGIA 1LJ9A 1MJ9A 4OIOF 2DJIA 3JREA 1FOYA 2KLOA 4FTHA 4C30A 3GTKJ 2P4WA 2XAHA 2DBBA 2GBYA 2HVRA 2XASA 1TW2A 5AIPA 5GTHC 1J59A 4CGZA 4B3AA 3I9V2 1AKHA 4V19K 3OIOA 3BG7A 2CSOA 3I64A 2HVSA 2KKOA 3BR5A 3IAM2 1MSFC 2FA5A 3DBRB 2IEKA 3S17J 4I98B 1J75A 1ETXA 3UNGC 1J9IA 1PDNC 2BW3A 3TGNA 2MLGA 4ETSA 5FKMA 2WAEA 2HI3A 2PLYA 2CYYA 2YSRA 4HF1A 3BTJA 4RB1A 4WCGA 4EVIA 4IEJA 2V26A 3A1YA 2K9NA 4R1HA 1RETA 2M1BA 4ENKA 3RZOJ 4P96A 5HDGA 4D7MA 4R79A 5J6XA 1ZR2A 1KU3A 1PP7U 2NRAC 3HPGA 4B44A 1MD0A 1EH8A 3ZN1A 4NB5A 2RREA 4ZZDA 3GLLA 1Z3YA 3HC7A 3PNYA 4ZDOA 5DS9A 3H5NA 4E7HA 3PJRA 1T98A 4XL9A 1HF0A 2IGNA 4F93B 2LH9A 5EDNA 5ICEA 1FTTA 2HR3A 1MBEA 3BG3A 1ETWA 1Y0UA 2E1MB 3AG1H 4ZTJA 4II3A 2Z2SB 2KFDA 1XG1A 2H8WA 2M8GX 2HQAA 4D1QA 1VQPI 4FE4A 3CC4I 1W5SA 2JVGA 1P4WA 5FKNA 4ZYEA 3SZPA 2L5QA 4B09A 2HVQA 3BT9A 3SFIA 2CFOA 1Z67A 4AC0A 1HC8A 4E6KG 1NH3A 1STZA 4S05A 3IP4B 2ICWG 1W7PA 4BNCA 1YX3A 3V7RA 2VI6A 3K70C 2L9SA 2OCCH 4UUTA 1U5TA 1AU7A 1J0RA 4CH7A 3WTWC 2DA1A 3DXJF 2CH0A 2B7EA 3FKIJ 5K7FA 2DTRA 2QUFA 2XGEA 3G1MA 2YX7A 2ZNZA 4L5IA 2PG4A 4A69C 5E20A 1MGTA 2EZIA 3ZQCA 2CUFA 1ZG1A 5K5QA 9ANTA 1IXCA 3GFMA 5LFAA 1R4MB 5J1YA 1XC5A 1HSJA 2F5CA 2MSYA 3F8NA 1Z77A 2OTLI 4IHWA 2ZBKA 2CUJA 1UJ8A 2P0WA 3PUBA 4V2FA 1VFCA 3I5UA 1LFBA 3OR1C 3FX3A 5K5OA 1JE8A 1W1WE 1B8IA 2ESHA 3KZZA 3FWEA 2BY2A 2Z33A 5H20A 2QF7A 3RKXA 4PK4A 1E17A 2DXIA 1KU7A 3LSHA 1D0ZA 5HDKA 3D5SC 2IAIA 3QP6A 1BIAA 2JVHA 3LMMA 2O7OA 1YG2A 2LMDA 3TKYA 2R5YB 1U0JA 1SVLA 1X3ZB 5LLQA 2L9RA 4E7KA 4XN0A 3CESA 1B4AA 4Y4RA 1T0FA 2EZKA 4ZYDA 2DJNA 1Y8RB 4E7ZA 2NVXJ 1U2WA 2H6BA 3HOUJ 4BBSJ 4NC7A 5J1UA 1MIJA 2X1CA 4PJLA 1J09A 3ZMZA 3DU5A 2NOGA 1ACIA 1USTA 2L4MA 2OV7A 2PMUA 3RPQA 2VBZA 2HZTA 5M5WJ 1BBYA 2NS8A 3BZCA 3IV5A 1P7JA 4C2UA 1BI2A 2R7QA 3K1PA 4CDGA 4A12A 3JRHA 5F0HA 2VJ4A 1TP4A 3VPRA 3JAMK 1QRYA 4QPOA 4IHSA 4AM3A 2KRFA 3MAJA 2PMHA 1X2MA 3O8GA 4BE0A 1TWCJ 1VQMI 4X0GA 2ISYA 4G9YA 3UR3C 2A61A 3B6AA 2CUZA 2EJRA 4EJVA 3BR2A 1YS7A 1N25A 5K7HA 5JLWA 1K78B 2VJIA 5CVJA 1JGSA 3BDDA 1R4NB 4L9NA 1DP7P 2Z99A 4PZJA 4BXUA 3H0DA 3DF8A 1I3QJ 1IN6A 4IL6C 1ZRFA 3JR9A 2OC6A 1F5TA 1MW7A 2NNNA 1Q1HA 2E7WA 3BP8A 3PIPF 2QGUA 1KONA 1RPWA 3NEUA 2UV1A 2WWYA 2L3DA 1K7AA 2W82A 2O6GE 1QPMA 3OYDA 1BJZA 2VE9A 1FBUA 2A5YB 3HPHA 4XOTA 4B3XA 4ZYAA 1MBGA 3V4GA 1UMQA 3VB2A 2FF4A 4AVPA 2NS7A 3S2HJ 3EUAA 3T0YA 2B0LA 4WK8F 2VC1A 3LA7A 3QWLA 4IZZA 2K9SA 2NVTJ 2X51A 1Z6TA 4KN7X 1NHAA 3WTSC 1WJCA 2LKXA 2JK3A 2NVQJ 1ON2A 4A3EJ 2DOEA 4RAFA 4Z2YA 1G3TA 3WTVC 1SAXA 1JHFA 2XKPA 1LEAA 1U9NA 1XN7A 2CU7A 5GADJ 3OYHA 1JKRC 2HKOA 1ZRCA 3F21A 1D1CA 1RZ4A 3RJPA 3HM5A 1A5JA 2IGKA 3CZ6A 3IH3A 2PBIA 5JFRA 3IAS2 5F27A 3ROUA 2I10A 4W97A 1Z3XA 3WGHA 3LSIA 3LFUA 2LC2A 2X1DA 4NBQA 1E2XA 2EFOA 2F48A 1R36A 5J8FA 4ASNA 1YYVA 3D1NI 2L7ZA 2NYXA 2VL8A 3M8EA 1H9TA 3LSTA 2L0KA 2E2JJ 3NAUA 3D0SA 3G6EI 3V8JA 3GWZA 3RYPA 1D0XA 2PFBA 4IHVA 1Z7LA 2JPBA 2DMNA 1HDPA 3FM3A 1Y0NA 1ODDA 3DEEA 3CJQB 1HLVA 4HPQA 2CQNA 5KK1A 1MBKA 3E6BA 1S3JA 1LQ1A 3S15J 2QSFX 5DDGA 1I6HJ 1ZN2A 4XORA 2JRMA 2Z9OA 2EV5A 2JUGA 4BQAA 2VC0A 4YIRX 2PI0A 2BEOA 2H27A 3M3YJ 1FOWA 2A69F 2OZ6A 4KFCA 2FRHA 2YX4A 2IS6A 3K0LA 1B72B 2ZCWA 3ABLH 2ZC2A 2OQRA 3GZNB 2A05A 2GA2A 3KETA 3G1OA 4MEYF 4HA8A 3KEOA 3BC8A 1LDKB 2CQ7A 2O8XA 3F8BA 2R7VA 1UHSA 3HOZJ 2VT2A 3F9KA 3L2WA 2V1NA 3HTUA 1F1ZA 1R5GA 1W36C 3D5RC 2XAUA 1Y1VJ 2K9MA 1BI3A 4XLEA 2WTEA 2O9LA 1TT0A 1IXRC 5KCMA 1YJNI 1NG6A 1NK2P 2X4HA 2RGVA 3KFWX 3WU2C 1D5VA 2E71A 3I3LA 4OMZA 1GV2A 4CUGA 2YR2A 2G7HA 3HGGA 5DCMA 3VFZA 1GDTA 2BY3A 2DW4A 2O03A 3U2RA 2BGCA 3FZVA 3LQQA 3CUQC 3TDUC 1XDUA 3W2WA 1PP8F 2QBYA 2ZJRF 3QOPA 5GAHJ 4HNUA 2V9PA 3H3ZA 1SD7A 5IYCJ 2DA5A 1I50J 3CP2A 4M3DA 4WX9A 5CVIA 3CQZJ 3QRFF 5DM6F 3JRFA 2IT0A 1SMYF 3KZIC 2MW8A 3HHGA 4YIFA 3CUQB 3DCFA 3H36A 3H9QA 2Y2ZA 5IOZA 2LD5A 4P1WA 4MQ9F 4BH9A 2KZGA 2DO7A 3FISA 5KAIC 1T95A 3MQ0A 1CGPA 1HOMA 4A3IJ 2O3FA 1ETOA 2BXZA 5EG0A 2R7ZJ 2FU4A 3OYCA 1SVOA 2W48A 2XC7A 3OYBA 2EQRA 4JP0A 2QEXI 4ZTFA 5FKKA 3VYRB 1YE9A 2P5VA 3EETA 3H35A 3M8FA 1FEXA 3PIOF 1LB2A 5JI6A 3BPXA 2VQLA 1MJAA 2G0EA 3C7JA 3TQNA 4B43A 2VKVA 3DTIA 4AIHA 4FCYA 2MH2A 3DBHB 5HOOA 3QODA 5DCMB 5HS8A 1MMDA 4FX0A 3JCUC 2C6YA 1PYVA 1Z7UA 3J7AY 3J7ZI 1R9TJ 2QBYB 2VKHA 1G8XA 1XGOA 1Y39A 4GO1A 4DYCA 1P7IA 1Y6IA 3B73A 1YRNB 2IW5A 3TO9A 4IRIA 2ME6A 4GFBA 1R6RA 2R7TA 3HHHA 4OINF 1G3SA 1VQOI 3VEPA 1SEUA 3CDHA 5FKLA 3CCLI 2VQGA 4PUSA 1DPUA 3V7CA 2WV1A 5EG0B 5A2QK 4G12A 1R5HA 2L7MP 1S8NA 3PNTA 2JZYA 2DOAA 2BHZA 2Z16A 3CP8A 4ZZLA 1W7PD 3ABKH 3ZQGA 3HTSB 2WB1A 2LKPA 2ME0A 3E1SA 4BHPA 2HYGD 1OR7A 3M9AA 4RGUA 4OU0A 3ZPLA 4OIPF 2F5DA 1NTCA 2V1DA 2Q1ZB 2UUZA 2AQEA 2GLOA 2CS3A 2K4JA 4BJ6C 3X2QH 1B59A 2KIQA 5E3MA 3F3XA 2HDDA 1E0EA 3L2QA 3I58A 1HXDA 5JLXA 3O8HA 3G71I 1WZ2A 2VOPA 3IRRA 1R5ID 2IXSA 3H5RA 3U21A 2EFPA 5HODA 3OYIA 3R6SA 4HDUA 2JSPA 4KDPA 3ABUA 3CDIA 4MFDA 3VSKA 5E8GA 4A0ZA 2TDXA 3PQKA 5KVRA 2O8KA 1RKTA 1FNNA 1XGMA 1IRZA 5FKOA 3FMQA 3P7NA 1FIPA 4WXCA 4QLCU 2AS5F 1DU0A 3FM5A 2ECBA 4LD5A 4XSZF 3FXKA 3RSNA 4NC6A 3BZ6A 4YG2F 1HW2A 1V4RA 1FWZA 1MBHA 2DT6A 2IP2A 2WC2A 4CZCA 2DK5A 1A6IA 3VSLA 1BL0A 2W00A 4Y17A 3ASOH 4XOPA 2HPIA 2DOFA 4BKXA 2BOLA 3AG4H 2R7FA
chains in the Genus database with same CATH topology
3PIOF 1VQ5I 1ACIA 1VQ6I 3CMAI 2NXNB 4IO9F 3I55I 5DM7F 4UY8I 1VQNI 3G6EI 3J7ZI 1YHQI 2JQ7A 1VQMI 1YJ9I 2H8WA 3J7YJ 1VQ9I 1Y39A 1VQPI 3CC4I 3CMEI 2E36A 2OTJI 3I56I 2E34A 3CCRI 1VQ4I 1VQOI 1FOWA 1HC8A 3CCLI 3CJTB 3CD6I 3CCJI 2K3FA 1VQLI 3CCSI 3PIPF 4IOCF 3CF5F 5GAEJ 3CC7I 1YJNI 2FOWA 3CCEI 1MMSA 3DLLF 2ZJPF 2ZJQF 3G71I 2OTLI 1FOYA 1QA6A 1YIJI 1VQKI 5JVGF 3CCVI 2ZJRF 2QA4I 5GAHJ 4IOAF 1VQ8I 4V19K 3CCUI 3CCMI 1YITI 5DM6F 5GADJ 3CC2I 3G4SI 1YJWI 1S72I 1FOXA 5GAGJ 2QEXI 1YI2I 2E35A 1VQ7I 3CCQI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIO F;  1VQ5 I;  1ACI A;  1VQ6 I;  3CMA I;  2NXN B;  4IO9 F;  3I55 I;  5DM7 F;  4UY8 I;  1VQN I;  3G6E I;  3J7Z I;  1YHQ I;  2JQ7 A;  1VQM I;  1YJ9 I;  2H8W A;  3J7Y J;  1VQ9 I;  1Y39 A;  1VQP I;  3CC4 I;  3CME I;  2E36 A;  2OTJ I;  3I56 I;  2E34 A;  3CCR I;  1VQ4 I;  1VQO I;  1FOW A;  1HC8 A;  3CCL I;  3CJT B;  3CD6 I;  3CCJ I;  2K3F A;  1VQL I;  3CCS I;  3PIP F;  4IOC F;  3CF5 F;  5GAE J;  3CC7 I;  1YJN I;  2FOW A;  3CCE I;  1MMS A;  3DLL F;  2ZJP F;  2ZJQ F;  3G71 I;  2OTL I;  1FOY A;  1QA6 A;  1YIJ I;  1VQK I;  5JVG F;  3CCV I;  2ZJR F;  2QA4 I;  5GAH J;  4IOA F;  1VQ8 I;  4V19 K;  3CCU I;  3CCM I;  1YIT I;  5DM6 F;  5GAD J;  3CC2 I;  3G4S I;  1YJW I;  1S72 I;  1FOX A;  5GAG J;  2QEX I;  1YI2 I;  2E35 A;  1VQ7 I;  3CCQ I; 
#chains in the Genus database with same CATH topology
 3DLA A;  2DQR A;  4A3D J;  4MGR A;  3NAR A;  4LB6 B;  2XV4 S;  3F6V A;  4F7Z A;  4UUS A;  2BVL A;  3K4C A;  2OCE A;  3BY6 A;  3CO6 C;  3BTL A;  4G94 A;  4XK4 A;  3P9I A;  3VOE A;  1AA7 A;  3BLY A;  5E3O A;  3ZQF A;  1YTY A;  5E1W A;  1S6L A;  1QVU A;  2R7W A;  4PDK A;  1UG0 A;  4G7Z F;  1S5L C;  2VE8 A;  5EF6 A;  3GTJ J;  3OYM A;  1V55 H;  4Z6Y A;  3CTA A;  4XKW A;  1BIB A;  5J40 A;  1F4K A;  3D5L A;  1ON1 A;  2DPD A;  4CCL A;  1VQ9 I;  1IN7 A;  4A5M A;  1XMX A;  5ICF A;  2DYR H;  3UKG A;  1TC3 C;  3JW4 A;  4KIS A;  3AG2 H;  1VQ4 I;  2KRC A;  4BS9 A;  1HST A;  3OWT A;  2V6C A;  5TIS C;  4AYB N;  2LDU A;  4HQM A;  4Y3O A;  1WGX A;  3WHC A;  5IYB J;  4I02 A;  4A6E A;  2I5U A;  3FBI B;  4L9J A;  2VBW A;  3U9G A;  5D8K B;  3H1C A;  2GAU A;  2LYC A;  2W7N A;  4V2G A;  1V3F A;  1LE8 B;  2Y48 A;  3QPL A;  2Y69 H;  3AL0 C;  2EIL H;  5C4X J;  3BR3 A;  1POG A;  4RM2 A;  4G6T B;  2EB7 A;  1O3S A;  2CW8 A;  2RC4 A;  3EUH C;  1DDN A;  4M9S A;  4UHT A;  1QU3 A;  2R92 J;  2M2E A;  1SVM A;  4O6J A;  3ERM A;  2F5E A;  3HYI A;  2FEZ A;  2LRD A;  5DYM A;  4DQ2 A;  5HDN A;  2DFF A;  1BI1 A;  4BBR J;  5C3E J;  1KU9 A;  3S1Q J;  4OAZ A;  2RKH A;  1IC8 A;  1IAW A;  3C18 A;  3DWL E;  4CCN A;  5HVQ C;  1BOB A;  2HXI A;  2GOM A;  1QHG A;  4UVC A;  2RAE A;  2EFW A;  3MVP A;  4HLY A;  1SAU A;  5IYD J;  4A3B J;  4ZYH A;  3OS2 A;  4HX8 A;  4BUP A;  1WVR A;  4C3I J;  2D2W A;  4RGR A;  4QTR A;  5GAG J;  1EH6 A;  3SXY A;  1ZYR F;  4EV0 A;  4HLX A;  4XN3 A;  3HEF A;  4HBL A;  1D8J A;  1F36 A;  4Y52 J;  1YI2 I;  4LLN A;  3J7A O;  3BJ6 A;  1SFX A;  4BY7 J;  2DA6 A;  3M07 A;  4MTE A;  3OSG A;  1XD7 A;  4P55 A;  3H0G J;  4KN4 X;  4AUX A;  5F1J A;  1H0M A;  2Y0M A;  2FOK A;  3FMS A;  4P9F A;  4XLN F;  4CCO A;  3QQA A;  1BN5 A;  2LBF A;  2NOJ B;  4I99 C;  4RA2 A;  3R0A A;  3R61 A;  4DZP A;  4UY8 I;  1PVE A;  3L9F A;  4HEA 2;  1S7A A;  1U3E M;  4AU7 A;  2E60 A;  3VYU B;  3DQV C;  1K4T A;  3OL3 A;  2HYF A;  2BV6 A;  1BOA A;  5LHG A;  1BM9 A;  2RV8 A;  5D5X B;  4C3J J;  4M6V A;  4CCM A;  3A01 A;  1EJ9 A;  1T6S A;  3CMM A;  5TJJ A;  1SD5 A;  2VKD A;  4KIB A;  2PMZ A;  1FY7 A;  5HS7 A;  4C9Y A;  2W25 A;  4LIV A;  5D5U B;  3BTI A;  5LRR A;  4J00 A;  1IXS B;  4W1U A;  2KRH A;  4DYQ A;  1TTY A;  1TWG J;  2IVM A;  1KA8 A;  3HOX J;  4E7I A;  4FE7 A;  2K7L A;  2FBK A;  5LGN A;  2G7U A;  5E3L A;  3HB9 A;  2KDZ A;  1A36 A;  5EEA A;  5FRM A;  1D8K A;  1HKQ A;  3DPL C;  2MH9 A;  3SDG A;  1E3H A;  2GOX B;  4RLF A;  2VKE A;  3BRO A;  3E7L A;  2HOE A;  4HW0 A;  2DA7 A;  1LFP A;  4HYE A;  5B1B H;  5DEQ A;  4PGG A;  3ZGK A;  2LBF B;  2VQH A;  3BR1 A;  2K02 A;  4JOM A;  4GGG A;  1JTX A;  3MD2 A;  4CCK A;  1KZH A;  1VZ0 A;  4HST A;  1IDY A;  2R5Y A;  1BA5 A;  1ZG3 A;  2FJ1 A;  1QA6 A;  1EV7 A;  2YU3 A;  2R93 J;  4HNT A;  2LG4 A;  2XRN A;  3C1D A;  4ITV A;  4Y15 A;  5FJ8 J;  5D4S A;  1GT0 C;  5L3F A;  2TCT A;  3HGY A;  1FBS A;  4EMS A;  2DK8 A;  3A01 B;  1S29 A;  4A6D A;  2QCO A;  5FRN A;  3I59 A;  2CO5 A;  3E6D A;  1RIO H;  2DI3 A;  2A07 F;  4MNU A;  1RR8 C;  4FET A;  3S1R J;  2W57 A;  3H9J A;  4HDV A;  1WPK A;  3TO6 A;  1QBJ A;  3L2C A;  2HGC A;  1NG7 A;  4BQO A;  4EM1 A;  3HOY J;  3GTL J;  4RM3 A;  3IWF A;  3L2R A;  5L3G A;  1G4D A;  4LG0 A;  5H2F C;  3M8J A;  5BNG A;  4BJ5 C;  4EGY A;  1LUJ B;  2HQR A;  2M4G A;  1VTN C;  3ISP A;  1D0Y A;  5F0C A;  4DBR A;  4P9U A;  2NS0 A;  4RAZ A;  3MMY B;  1T38 A;  1FBQ A;  3IL2 A;  4ZJZ A;  3GEZ A;  1IF1 A;  3WG7 H;  4NQW B;  3LAP A;  2LF7 A;  2YPR A;  1K78 A;  4E70 A;  1U78 A;  3F0C A;  4OOI A;  3KP3 A;  3QAH A;  2GXG A;  3GF2 A;  4LK0 F;  4FAS D;  1YS6 A;  3CDL A;  1FJL A;  5IOY A;  1MH4 A;  2XSD C;  2OUM A;  3P9C A;  2JQ7 A;  3DTE A;  4RMN A;  3GTQ J;  1UCR A;  3LOC A;  2E1N A;  4NC8 A;  4EM0 B;  3ZMS A;  2OPT A;  5L3C A;  3K4B A;  2M34 A;  5EYR A;  3HSF A;  1VND A;  2BYV E;  3I59 B;  4A3J J;  1G3W A;  3BZK A;  4ON0 A;  3HZJ A;  2PEX A;  4N9H A;  1OCC H;  3FXM A;  2KJC A;  2V4J C;  2ESN A;  5K7Z A;  2GIV A;  4HV5 A;  1R1T A;  3M1C A;  4BJT A;  4G7O F;  2MA3 A;  2DCE A;  3KEY A;  4LG0 B;  2M5W A;  5FFZ A;  3RZD J;  1EKE A;  2HDW A;  2L9N A;  3OS1 A;  4ENM A;  3RCO A;  4LK1 F;  2E7X A;  5F0F A;  5EGO B;  1I27 A;  2IA1 A;  2RNG A;  2W24 A;  4UB8 C;  3GFL A;  4MFE A;  3L00 A;  4KNY A;  2X85 A;  3CF5 F;  1XSX A;  3S14 J;  4PFO A;  3KLN A;  3E97 A;  3G2B A;  1R23 A;  3T5X A;  4B8X A;  3I4M J;  2ELK A;  4AYB A;  5FRO A;  1JTY A;  2KMU A;  3RPU A;  3GFJ A;  4F52 A;  3LA2 A;  3LA3 A;  4UVA A;  5LRS A;  4BQQ A;  4LJZ F;  1BR2 A;  3KCC A;  4IXA A;  4U0V A;  2FBI A;  3FXR A;  3K7A J;  2K3P A;  2ZJP F;  3G1L A;  2QZ8 A;  2GWR A;  4HV6 A;  1V5G A;  1UZC A;  4PJJ A;  5BPI A;  1JKP C;  2HZD A;  4AIJ A;  1M1E B;  2FMY A;  4EJU A;  3A03 A;  3OY9 A;  3ELK A;  4KIG A;  1XCV A;  1A31 A;  3LSP A;  1ZLJ A;  1K4S A;  5HLH A;  2HTJ A;  3T8R A;  3ZR8 X;  1P4X A;  5KNL A;  2XGC A;  2ZNY A;  1BJA A;  2R5Z B;  5BMZ A;  2LLK A;  3ZQL A;  3JRB A;  2EWN A;  2O5R A;  4J01 A;  4EM2 A;  2ZFU A;  3HSE A;  2NAZ A;  3Q0V A;  1RR7 A;  3E5U A;  2IGO A;  5DD4 A;  2AXT C;  2R0Q C;  3U1D A;  1ZGW A;  2EA2 A;  2W84 A;  3NWS A;  3OSF A;  1WCM J;  1DP3 A;  4IPA A;  1O3Q A;  3J81 K;  2R7R A;  1WHU A;  1IGN A;  5FD5 A;  2BVM A;  3KP4 A;  3CCQ I;  4A0Y A;  2R4G A;  1QHH D;  3OYF A;  2KJB A;  4C2M J;  2H1K A;  3PO3 J;  5F04 A;  4ZDL A;  3MKW B;  4IO9 F;  1RNL A;  1O57 A;  3FDY A;  1B9M A;  4XIC A;  2QSG X;  2O0Y A;  3NWT A;  5FB2 A;  3RIR A;  1GXP A;  3RTR A;  1B72 A;  2X1E A;  1MZB A;  1J2X A;  2EFN A;  2FBH A;  4F3Q A;  1TNT A;  1TT5 B;  2ID3 A;  2DFE A;  2MYS A;  4II2 A;  4WXD A;  5LBQ A;  2QVO A;  2JUC A;  3OYN A;  2Q2E B;  2J5O A;  4JK1 X;  3CME I;  1XS9 A;  2E5Z A;  3SEQ A;  5E18 F;  5HNF A;  4QIW N;  1Z21 A;  2EIJ H;  3PL8 A;  4OMY A;  1I1G A;  2WY7 Q;  2IGM A;  2QSH X;  1YW7 A;  2NNY A;  2PN6 A;  5J1R A;  2DAO A;  1ETQ A;  1TNS A;  2JA2 A;  2V7F A;  1OCT C;  2K5C A;  1LKX A;  4DBQ A;  3CCJ I;  3HRT A;  2XAQ A;  2PJP A;  3EYI A;  3A0H C;  4N4N B;  5CQE A;  4M72 A;  2VPL A;  2Y9Z A;  2A68 F;  3MKL A;  1MH3 A;  1YX5 A;  2F5F A;  1JXS A;  2FX0 A;  2QEN A;  5GP9 A;  5KHD A;  1R1U A;  3DEU A;  4MEX F;  4U7D A;  3FXL A;  1GV5 A;  3HRM A;  5GAE J;  5J8C A;  1QZY A;  2H8R A;  3C2G A;  3KEQ A;  3E5X A;  1WH7 A;  2VXZ A;  4BE1 A;  4UXN A;  2A6E F;  2F4I A;  4LLL A;  4IQJ A;  1WI3 A;  2HPM A;  4DYR A;  1SAN A;  4G6Q A;  2V6E A;  2M4K A;  2K4B A;  3CUQ A;  1MNE A;  1J7K A;  3KP2 A;  1VQK I;  2XGD A;  3V8K A;  1ZK8 A;  5JVG F;  3K2Z A;  3DFG A;  5FD6 A;  1Z9C A;  2E1C A;  1QQI A;  5D6F A;  4XID A;  2L54 A;  5B66 C;  2OU2 A;  1FTZ A;  1L3L A;  2XGX A;  5LEJ A;  4B47 A;  1ZQ3 P;  4UV9 A;  2CV1 A;  3FHN A;  2DFH A;  2ZME C;  4M74 A;  4LB5 A;  2YS9 A;  2GZW A;  3ML6 A;  3GX4 X;  4XNF A;  2OQG A;  3OIQ A;  2JRT A;  2LY9 A;  5BOX A;  1D1A A;  4I6Z A;  2DDA A;  1VI0 A;  1X1D A;  1HW5 A;  4FQG A;  1LVA A;  4BYY A;  3G4S I;  3JRG A;  1OYY A;  1YJW I;  4PSW A;  1FOX A;  4XRS G;  3S2W A;  4O3M A;  1EA3 A;  4BEH B;  2FQ3 A;  2YU9 J;  4RB3 C;  1SFO J;  2OF7 A;  1N75 A;  3PSF A;  2QKM B;  1VQ5 I;  3IUO A;  3N05 A;  5CKT A;  1YRN A;  1FSH A;  1PJR A;  3JTH A;  4LMY A;  3RKQ A;  2XAF A;  3K4M A;  3V42 A;  2DN0 A;  4B48 A;  3ESW B;  2XB0 X;  3R60 A;  5C4J J;  3CLO A;  3TED A;  2RN7 A;  3CJR B;  1MBF A;  1FYL A;  3GZ6 A;  1USS A;  3W2V A;  3ECO A;  3OYA A;  1V54 H;  1YW9 A;  1HDD C;  4QSH A;  5C44 J;  5HNH A;  2DMU A;  2VN2 A;  1W0U A;  1Y1W J;  3JAM Z;  1R49 A;  1CF7 A;  5IT9 K;  4CYC A;  3Q5F A;  1YJ9 I;  1MKM A;  4BY1 J;  1MDM A;  2X6W A;  2ZXI A;  4YFX F;  4PJ0 C;  2XPW A;  2XSJ C;  1E3P A;  3KIO A;  2E36 A;  5EJC A;  1T2K A;  1O3T A;  2E34 A;  3PM1 A;  3DTK A;  4L18 B;  4OIR F;  2K86 A;  2HWV A;  2LVS A;  2EZL A;  3ZMT A;  1NK3 P;  5DUI A;  5LGT A;  4ANJ A;  5L3B A;  5LEK A;  1ZRE A;  1SD6 A;  4EJO A;  2H6C A;  3TL4 X;  1ETY A;  1OJL A;  4JQF A;  4MHG A;  3K70 D;  2K85 A;  2HXO A;  2AXL A;  1WJD A;  3HUG B;  5M3M J;  2DU9 A;  3TOA A;  3F8M A;  2GIZ A;  2CWE A;  2H94 A;  1OMI A;  1WJ5 A;  4I76 A;  1GXQ A;  2KP6 A;  3I71 A;  4RLQ A;  3FK7 A;  3HOW J;  5AON A;  2HU9 A;  3H3V K;  1RI7 A;  3E0J B;  3AKZ A;  2EPF A;  2HDC A;  2CQK A;  2MGQ A;  1MMS A;  4Y7N J;  1I6X A;  1WFX A;  5CVR A;  1GHC A;  1XTA A;  3QPS A;  3O6B B;  5J47 A;  3WTT C;  2LFB A;  3OOU A;  1MNM C;  3ZN0 A;  1GLN A;  4NUB A;  1YIJ I;  1L0O C;  4WWC A;  3JRI A;  3NRV A;  4RAG A;  3FF5 A;  4E7S A;  1CF7 B;  4YRV A;  5DUK A;  4CYC B;  1MDM B;  4CO8 A;  2I8D A;  3J81 Z;  5JVT A;  4IX7 A;  1RES A;  3FMR A;  3J80 K;  2G9W A;  4N4O B;  4RDU A;  1UAA A;  4GCV A;  4M9Z A;  5F6F A;  3E5Q A;  3QYB A;  2KPM A;  2CUE A;  2CG4 A;  2KIF A;  2QQB A;  4FHT A;  2WV0 A;  1MMN A;  2Y0S N;  1XPX A;  1ONV A;  1X1P A;  3GUD A;  4JYK A;  5DCF A;  1G3Y A;  3GTO J;  3CUO A;  2CW0 F;  4EAT A;  1WWX A;  2VQC A;  1GVD A;  1W0T A;  1ZAR A;  4U0W A;  3SZT A;  1BW5 A;  2E2H J;  1Z6R A;  1BR4 A;  3QYF A;  4FX4 A;  1VQ7 I;  4M73 A;  4HX7 A;  4M3E A;  1IV8 A;  2ZB9 A;  2GM4 A;  2DFI A;  1V5F A;  4D7N A;  1KYW A;  2F5V A;  2XIG A;  4KIC A;  3SQN A;  2JJ7 A;  2ECC A;  1X1C A;  4S04 A;  2DT7 B;  5ILU A;  4CHU A;  2XF5 A;  4CZZ A;  2LKS A;  4ZH4 F;  4A3F J;  1LEB A;  4GRI A;  1TWF J;  2XHK A;  2OZU A;  1TZL A;  4L9T A;  5J4Y A;  3FXQ A;  3MN2 A;  5E17 F;  1IZ1 A;  5E3N A;  2MC3 A;  4OWR B;  4XLP F;  5ILS A;  2DTZ A;  2MG4 A;  4P5O A;  3KYD B;  1AOY A;  2K40 A;  3ZQH A;  1JUP A;  5ERI A;  2MBF A;  1ZAO A;  2L7F P;  2XB5 A;  3P9K A;  1IV6 A;  1Z0X A;  2LTP A;  1LE8 A;  2OTJ I;  2RQQ A;  3MZ8 A;  2FXA A;  1FX7 A;  5FLM J;  1QZZ A;  2IS4 A;  3LNQ A;  2CQX A;  5M5Y J;  1F43 A;  3K6G A;  4CIC A;  4NDL A;  4XRM A;  5HLT A;  5CJ9 A;  2CV0 A;  2WA0 A;  3KP5 A;  1XB4 A;  4M6Y A;  2PX9 A;  4HSR A;  3KP7 A;  4H0E A;  3GTG J;  1JI8 A;  2LY2 A;  1E3O C;  4GYI A;  5AIQ A;  3GO5 A;  4PCQ A;  5D4R A;  3HBL A;  5IPA A;  2P5K A;  1OLT A;  2E19 A;  4BDY A;  4Y13 A;  2MC4 A;  3MZH A;  2DT5 A;  1WH5 A;  3L2U A;  1DUX C;  2Z3Y A;  5IP9 J;  3S2D J;  2L02 A;  1P6R A;  4YEJ A;  3EUH A;  2VOD A;  4A3L J;  5DD8 A;  1QPI A;  2P6S A;  3PQJ A;  3M4O J;  1LDD A;  4IF4 A;  5GPA A;  4U88 A;  3TDZ C;  3RPU D;  1K6O A;  1TWH J;  5K5R A;  4CA0 A;  1K79 A;  2STT A;  2F2E A;  3FXO A;  5JHU A;  4XLA A;  4M6X A;  1ZLK A;  1T33 A;  3W3C A;  4BAY A;  3HSR A;  4JBA A;  3MKY B;  4HZF A;  4IOA F;  3ABT A;  4D9J A;  4B4C A;  2QLZ A;  5B1A H;  5L3D A;  1YIT I;  4Q4Z F;  4XRF A;  2XPU A;  1IJW C;  5BQT A;  3H3U A;  5LGU A;  4PJN A;  4XM3 A;  4U87 A;  3ZOB A;  1UEL B;  3BJO A;  2Y9Y A;  4M9X A;  5H6Q A;  2FNP A;  3LL7 A;  4PGH A;  2M30 A;  4DGW B;  5DTD A;  1ZHF A;  3HRS A;  2GXB A;  3BPV A;  4XQF A;  1MND A;  3AL0 B;  5IT9 Z;  3OYG A;  3SEZ A;  2QQ8 A;  3G73 A;  4BDZ A;  3HOV J;  2VBX A;  1KGS A;  3AFH A;  1W5T A;  2P81 A;  4JX4 A;  3BJA A;  2HNH A;  1I1S A;  1QO0 D;  4ESF A;  4X1E A;  1BW6 A;  4L0Z B;  2DPU A;  2PJR B;  1RUO A;  3HDD A;  1S7E A;  2COB A;  1HKS A;  4DIQ A;  1OFC X;  1HA8 A;  3AG3 H;  3TMO A;  3WG9 A;  1XGN A;  2FSW A;  4I0B A;  1JHH A;  2KQR A;  4AIK A;  2CMP A;  4XLF A;  3L1P A;  4A3M J;  2X6X A;  1BC7 C;  3QP5 A;  5TRD A;  3DPT A;  2FD5 A;  4UVB A;  4YFK F;  2EIN H;  1Y8Q B;  2A6T A;  1ZTR A;  2XKO A;  3OS0 A;  4L5J A;  4WXH A;  1DQU A;  3E6C C;  2UZK A;  5HLG A;  5FLV A;  4K2E A;  5A2Q Z;  4M3F A;  1TW3 A;  4MIM A;  3R0J A;  1XX5 A;  1O7F A;  4NNJ A;  2ZJ2 A;  3IH2 A;  4KT5 C;  4KIT B;  1W36 D;  3FHZ A;  2STW A;  1ZRD A;  3J80 Z;  2MLK A;  2LOO A;  1SFK A;  1Q1V A;  1U8R A;  3GME A;  1JUS A;  1SFU A;  4B1R A;  2M7A A;  2NVY J;  2ZO4 A;  4L5E A;  3W6V A;  4Q5S F;  2FNA A;  2EFQ A;  3JTG A;  1FC3 A;  1I39 A;  1WKM A;  3L7W A;  3WOD F;  4UNO A;  1A6Q A;  4I2O A;  3OMY A;  4BHB A;  2X48 A;  4CXF A;  3CCV I;  3ZXS A;  2VB6 A;  2W4S A;  1N77 A;  4HAM A;  3W6K B;  3H5A A;  2AHQ A;  3OV8 A;  2DMQ A;  1X3U A;  2DYS H;  2OAZ A;  2EV6 A;  2E1M C;  5E1Z B;  3SZG A;  3N4M A;  1WJF A;  2QQ9 A;  4XKB A;  1T08 B;  5GTI C;  1OYI A;  3BOQ A;  3TP3 A;  4NQW A;  1RC9 A;  3T8T A;  1B9N A;  2AO9 A;  2VOO A;  3F72 A;  2EIK H;  4RGX A;  3F8C A;  2BY1 A;  3EQL F;  2GXA A;  2B63 J;  3CO7 C;  3ULQ B;  3GFI A;  3REO A;  4AID A;  3E3V A;  2D1H A;  1O4X A;  3GLX A;  1AKH B;  4YFN F;  1VF9 A;  2M3A A;  3VDX A;  2Y0S A;  3OR2 C;  2RVC A;  1SD4 A;  1O7L A;  1IUY A;  1GVJ A;  2J5P A;  1TLH B;  3PFY A;  4I7H A;  1LNW A;  2BW3 B;  4YEL A;  4MO7 A;  2ELH A;  4HF0 A;  1OCZ H;  4XSX F;  4MTD A;  5D5V B;  1Y56 A;  2M7B A;  3OYK A;  1RRJ A;  3JSP A;  3VOD A;  1ETV A;  2HQ5 A;  4A3K J;  3WE2 A;  1FMV A;  2L2O A;  5EGO A;  3J7Y J;  5IP7 J;  3KP6 A;  1OYW A;  1HCR A;  2KL4 A;  2GQQ A;  1D5Y A;  4IHT A;  1OCP A;  1FT9 A;  1QVT A;  3I56 I;  4H4K C;  4ZDP A;  1EF4 A;  2LP0 A;  3QU3 A;  3T1B A;  2DMP A;  4OAY A;  3B02 A;  4EJT A;  3RQI A;  2P7V B;  3LSR A;  3I4P A;  4LIU A;  1W5C C;  2BE5 F;  5CLS A;  5CQG A;  3CCS I;  2JTV A;  4BXX J;  1K6Y A;  2KHM A;  4NHJ A;  3GTP J;  4E4H A;  2KIS A;  3EPZ A;  3V7S A;  3WU1 B;  4N0B A;  1U5T C;  4A0X A;  4GDF A;  3W6J B;  1FOK A;  2HTS A;  2V1U A;  1SC7 A;  2MAB A;  3BQZ A;  4ZYG A;  2R5Z A;  4WF2 A;  1W7P B;  3WTY C;  2HOS A;  1ZR4 A;  3RI4 A;  2BZT A;  1HBX G;  2CV2 A;  5FLX K;  1ZGA A;  1U9O A;  3EYY A;  5JHF A;  2ETH A;  3GXO A;  1YW8 A;  1UFM A;  1U5T B;  3A02 A;  2KZV A;  3BG6 A;  4LG3 A;  4RB2 C;  3HOS A;  4HNV A;  3PNV A;  4AWX B;  2L01 A;  3GBG A;  3RDI A;  4RB0 A;  3BWG A;  3MCZ A;  4HQE A;  3CCU I;  2E2I J;  5ICC A;  4AD9 A;  2A5W A;  3COA C;  4X6A J;  5LHH A;  4LLG F;  2XRO A;  4KUM A;  2CW7 A;  4F92 B;  3PO2 J;  1DGW Y;  2EBI A;  4J19 A;  2RQP A;  5F64 A;  2ZKZ A;  3DKX A;  4F55 A;  1G59 A;  3MKZ A;  1R22 A;  1JKO C;  1HQC A;  1XMK A;  2WY8 Q;  1S7O A;  3ZMD A;  3LQR A;  4FT8 A;  1AWC A;  3TP0 A;  4HOB A;  2OA4 A;  4U7B A;  3GTM J;  2VUM J;  4ESJ A;  5M3F J;  4XON A;  4BHC A;  1B8I B;  2P8T A;  3WTZ A;  1H89 C;  1T0F C;  3LSM A;  2DA3 A;  3ONQ A;  3RKY A;  4XLH A;  4ESB A;  4UUV A;  4DJA A;  2UXX A;  1FMW A;  2Q2E A;  4ABZ A;  1BI0 A;  5FO5 A;  1VQ6 I;  3JSO A;  2V9K A;  3AAF A;  2BY0 A;  4RS8 A;  1G2H A;  1JUM A;  3I55 I;  2P5L C;  1ITY A;  1FPQ A;  2WB1 N;  3CLQ A;  3MEX A;  2RDP A;  3WTU C;  1TWA J;  3C2B A;  1IUF A;  4HF2 A;  4BQN A;  2VBY A;  1LFU P;  2XPV A;  4HRI A;  4HG2 A;  1JGG A;  1WJA A;  4A3C J;  3F23 A;  3KYC B;  2R7D A;  2GA1 A;  1X4P A;  3U1K A;  3C3W A;  3GYH X;  1JJ8 C;  5E8I A;  2HOT A;  1H9G A;  3K1N A;  1C0W A;  2JA8 J;  1IN5 A;  3DP7 A;  3K10 A;  4EJW A;  5LD2 C;  2X9D A;  4PJM A;  3CJT B;  1MSE C;  3CD6 I;  3KX2 A;  3S16 J;  2MD0 A;  5CPR B;  3ZQQ A;  2L4A A;  4E7L A;  4KMF A;  3KZY A;  4RGS A;  4G8X A;  5HS9 A;  1APL C;  1W4M A;  1VQL I;  2R7U A;  2W85 A;  1H8A C;  3QOE A;  4TV7 A;  4IOC F;  3IHU A;  2VJ5 A;  1ZGJ A;  4M71 A;  2WAQ N;  4IHY A;  2KT0 A;  3SHF A;  1ZH5 A;  1UG2 A;  3BQY A;  3S32 A;  4PSX A;  5ILV A;  4EGZ A;  2M45 A;  3OIP A;  1DGR M;  2EV0 A;  2HOA A;  2Q8K A;  1HW1 A;  3O2P E;  2DOD A;  4EQQ A;  3BCB A;  3BG9 A;  2QQA A;  4HX4 A;  2O61 A;  2COM A;  4OIQ F;  4UV8 A;  2EIM H;  1Z1D A;  4Q48 A;  1WJB A;  1YOV B;  1WI9 A;  1FYK A;  2XVC A;  4IHX A;  2P6T A;  2UWM A;  3P5J A;  2KDO A;  3WHB A;  2QA4 I;  2ZME A;  2MFZ A;  5FGM A;  3VWB A;  3EUK L;  3TOB A;  3K4K A;  2R7S A;  1R58 A;  4BEH A;  3FXU A;  1VQ8 I;  2LF8 A;  5CVV A;  1KQ0 A;  1IN8 A;  2K9L A;  1ZKG A;  2HQN A;  2W1O A;  3QU6 A;  3BG5 A;  3L2V A;  3OYJ A;  3BCA A;  3F22 A;  1XCB A;  1YO5 C;  1XSV A;  2EK5 A;  1OQY A;  3VYS B;  4LGW A;  2HS5 A;  1B6A A;  4IRG A;  4N9I A;  1V5E A;  4A93 J;  4DOZ A;  1R00 A;  3HL2 A;  4M3B A;  2D1V A;  4JX6 A;  2LSO A;  1ZG5 A;  5EEH A;  2XRL A;  1O3R A;  3PFI A;  3HKZ N;  1JKQ C;  3A0B C;  2IJL A;  4BAC A;  2ACJ A;  4E7J A;  2KIM A;  1Z05 A;  3M1E A;  3HXL A;  3QYE A;  2JWT A;  5B5E C;  2BHY A;  1I5Z A;  1R1V A;  2VIX A;  1X4O A;  4BXF A;  2D5V A;  5EEG A;  2JA6 J;  3I53 A;  1QNT A;  3C2H A;  1XGS A;  4CSW A;  4JX5 A;  3G3Z A;  3ZRG A;  3OYE A;  1D1B A;  3I0T A;  1ETK A;  2ADU A;  1X1B A;  2M8E A;  2Y31 A;  1ZEL A;  3GVA A;  4D5F A;  1A35 A;  5CVU A;  3JRA A;  3LSG A;  1IW7 F;  1MMG A;  2ZME B;  2ZSH B;  3V8L A;  3HUG A;  5ICG A;  2L7K A;  2M0C A;  1TQM A;  3E6M A;  3CCY A;  3HG9 A;  3H92 A;  1IG7 A;  2WAD A;  2FUG 2;  5KAF C;  2F4M B;  3WU0 A;  3FBN B;  3CCR I;  2IS2 A;  2B9S A;  1LVK A;  1QGP A;  4XR6 A;  4CYD A;  3VYT B;  3SJM A;  3ZP5 A;  2OBP A;  1HKT A;  1U8B A;  2HKX A;  3ZQI A;  2EZH A;  2JMW A;  5J3L A;  2X6O A;  2JA7 J;  5FLX Z;  2DQL A;  4G7H F;  4C3H J;  1AHD P;  3Q0U A;  4QPQ A;  4MLO A;  1EH7 A;  2QWW A;  3HJE A;  2M9H A;  2R7X A;  1JJ6 C;  4MQV A;  4A2U A;  5F1R A;  1FSE A;  4A5N A;  5GPC A;  2XDV A;  2K9Q A;  3BR0 A;  3LSK A;  5CYV A;  3FKJ A;  1S9H A;  4O5V A;  4XBF A;  3DKY A;  1RKW A;  2FQ4 A;  3CCE I;  3Q0W A;  3HRU A;  4R8H A;  3RKW A;  4LIT A;  4RBO A;  3R4K A;  4CCJ A;  3NQO A;  1REP C;  4DNC A;  2Z5U A;  4EEF G;  3I54 A;  2P7C B;  1UB9 A;  1ULY A;  3CJN A;  5EZH A;  3HIF A;  1IDZ A;  1BR1 A;  2XAJ A;  2DMT A;  5E1X A;  2VJJ A;  4KYW A;  4A3G J;  1ERD A;  4M3G A;  4I09 A;  2IA0 A;  2ELJ A;  5B3S H;  4DZJ A;  2V1X A;  3N97 A;  1P2F A;  5BS6 A;  3S1M J;  3WTX C;  3ABM H;  4KA4 A;  4U0Y A;  3CCM I;  2LRE A;  2OD5 A;  3IH4 A;  1R7J A;  3MZY A;  1N78 A;  3I4N J;  3M7G A;  3DEW A;  4G6D A;  3TW7 A;  3S1N J;  1T39 A;  2QYO A;  3O3K A;  1CQT A;  2ISZ A;  2EH3 A;  3RYR A;  2N8G A;  5FFX A;  2V9V A;  4KJZ A;  1SFE A;  3DV8 A;  2X6Y A;  3FK6 A;  1S72 I;  3A4C A;  1DPR A;  1WQ2 A;  2PMZ N;  3SFZ A;  4L0Y B;  2ID6 A;  3IKT A;  4BE2 A;  4BL0 B;  3S8P A;  1LDJ A;  2E35 A;  2VAS A;  3PSI A;  1DU6 A;  1P9Q C;  2IA2 A;  3K2A A;  2CGP A;  2WBM A;  5D5W B;  3K1M A;  2DLL A;  2VT3 A;  3FIW A;  2WAF A;  3CMA I;  2NXN B;  1B1B A;  4GXO A;  2NVU B;  4GYG A;  1K61 A;  2A3S A;  1OKR A;  2FE3 A;  2LNB A;  3L09 A;  4D0P A;  1LPQ A;  3ERE D;  1X1A A;  4PFP A;  3PUF A;  4XKV A;  1YHQ I;  2H1L A;  2QKL B;  1FYM A;  2IS1 A;  1XMA A;  4XKC A;  1YFH A;  2JSC A;  2PQ8 A;  3QPT A;  5EZG A;  1F9N A;  3WGG A;  3OYL A;  4IKF A;  1Z91 A;  2BXY A;  4Q47 A;  5D8L B;  1U6G A;  1I3A A;  2K27 A;  4KIF A;  2QM3 A;  1PUE E;  1K83 J;  3IKV A;  2DA2 A;  3A2K A;  1IN4 A;  5IP6 A;  4KMU X;  3BTC A;  3F6O A;  1H88 C;  1WRJ A;  5DV5 A;  2CJJ A;  2D45 A;  3S3N A;  3MFK A;  1SMT A;  2LK2 A;  3CF2 A;  3QPH A;  2K3F A;  3S93 A;  5J4V A;  2M0M A;  2UXN A;  1MBJ A;  1KQ8 A;  2ZXJ A;  5TGT A;  2XAG A;  1X19 A;  1YQA A;  3GCM A;  2YUS A;  3KLO A;  3JRD A;  1WSU A;  1TL8 A;  2F4O B;  3B6C A;  2XF7 A;  3S3O A;  2H09 A;  1FIA A;  2RNJ A;  4XLC A;  1UHW A;  3GW2 A;  3Q9S A;  2CQQ A;  3FXJ A;  2LY1 A;  4UB6 C;  3CC7 I;  3OL4 A;  2R3S A;  2L9V A;  2FOW A;  2VPR A;  3H9G A;  1IO2 A;  2XF6 A;  1UHM A;  1G6N A;  3DKW A;  4IRH A;  3DLL F;  4I01 A;  2VON A;  1OR7 C;  2JPC A;  2WAQ A;  2ZJQ F;  3W2A A;  3K9T A;  2Q0O A;  3K69 A;  1X58 A;  2EA4 A;  2OJE D;  1IRF A;  3ZMU A;  2Y30 A;  4L9V A;  3LWF A;  4DW6 A;  1A04 A;  2CFX A;  2X0L A;  3KPH A;  2MD5 A;  5E79 C;  6PAX A;  2JN6 A;  4QWQ A;  4D5C A;  2AQF A;  2JT1 A;  2CRG A;  4FIS A;  1JT0 A;  1J5Y A;  2Y75 A;  5IT3 A;  3K4L A;  4KT6 A;  2IPQ X;  1ENH A;  1QZE A;  1MMA A;  1FP2 A;  4BU2 A;  1OCO H;  3KYL A;  1T8I A;  3MWM A;  2TRT A;  3CC2 I;  2FML A;  5D6E A;  3ECH A;  2M87 A;  3IC7 A;  3OOP A;  5IY5 H;  1BC8 C;  2LR8 A;  1YIO A;  2PJR A;  2ZXW H;  2ZXH A;  5ED4 A;  1TQI A;  1XDS A;  1OCR H;  3SDB A;  3BR6 A;  1KYZ A;  1X2N A;  1D3Y A;  1KQ9 A;  1WJE A;  2E1O A;  3ZQ7 A;  5K1Y A;  3DU6 A;  3HOT A;  1IRX A;  1TBX A;  3RQ4 A;  5F08 A;  3SYT A;  3EDP A;  2DA4 A;  4IVN A;  5LHI A;  1XSD A;  1JT6 A;  5BPD A;  2E5N A;  3HKZ A;  3Q9V A;  1PUF A;  1X3W B;  3GZ5 A;  1FP1 D;  1T56 A;  5DM7 F;  1IRG A;  2F6C A;  1VQN I;  4F91 B;  3K4J A;  4IJA A;  4LOC A;  5H6R A;  5L3E A;  5JR3 A;  3CMY A;  1FZP B;  3IRQ A;  1R71 A;  3DBL B;  2IBD A;  4IQ4 A;  3IWZ A;  3S3M A;  1RUN A;  2Z1D A;  2HFH A;  4XRS A;  4UUS B;  4LFU A;  4I0A A;  2KIU A;  3TO7 A;  5HLI A;  1FLI A;  1OIS A;  1KU2 A;  2V79 A;  2XUB A;  2JA5 J;  1YLF A;  2ZFW A;  4ZC3 A;  1MJB A;  3TBI A;  3Q3S A;  4AVZ A;  4S0H B;  2VLA A;  1P92 A;  4BGD A;  2BBY A;  4Y33 A;  3K4N A;  3KE2 A;  3ZMV A;  4ENN A;  3TW6 A;  3ZCO A;  3LAJ A;  4YII A;  1GUU A;  3DPU A;  2DDB A;  2R7O A;  1TQP A;  2ZSI B;  5M5X J;  2VXD A;  3JRC A;  4ENJ A;  2HYJ A;  3F8F A;  2HEO A;  3LFK A;  3LSJ A;  4C2T A;  1ORK A;  3ASN H;  2A6H F;  1P4A A;  4XMY A;  1OPC A;  3WE3 A;  1PUF B;  2IRF G;  4RAY A;  3WGI A;  1LJ9 A;  1MJ9 A;  4OIO F;  2DJI A;  3JRE A;  1FOY A;  2KLO A;  4FTH A;  4C30 A;  3GTK J;  2P4W A;  2XAH A;  2DBB A;  2GBY A;  2HVR A;  2XAS A;  1TW2 A;  5AIP A;  5GTH C;  1J59 A;  4CGZ A;  4B3A A;  3I9V 2;  1AKH A;  4V19 K;  3OIO A;  3BG7 A;  2CSO A;  3I64 A;  2HVS A;  2KKO A;  3BR5 A;  3IAM 2;  1MSF C;  2FA5 A;  3DBR B;  2IEK A;  3S17 J;  4I98 B;  1J75 A;  1ETX A;  3UNG C;  1J9I A;  1PDN C;  2BW3 A;  3TGN A;  2MLG A;  4ETS A;  5FKM A;  2WAE A;  2HI3 A;  2PLY A;  2CYY A;  2YSR A;  4HF1 A;  3BTJ A;  4RB1 A;  4WCG A;  4EVI A;  4IEJ A;  2V26 A;  3A1Y A;  2K9N A;  4R1H A;  1RET A;  2M1B A;  4ENK A;  3RZO J;  4P96 A;  5HDG A;  4D7M A;  4R79 A;  5J6X A;  1ZR2 A;  1KU3 A;  1PP7 U;  2NRA C;  3HPG A;  4B44 A;  1MD0 A;  1EH8 A;  3ZN1 A;  4NB5 A;  2RRE A;  4ZZD A;  3GLL A;  1Z3Y A;  3HC7 A;  3PNY A;  4ZDO A;  5DS9 A;  3H5N A;  4E7H A;  3PJR A;  1T98 A;  4XL9 A;  1HF0 A;  2IGN A;  4F93 B;  2LH9 A;  5EDN A;  5ICE A;  1FTT A;  2HR3 A;  1MBE A;  3BG3 A;  1ETW A;  1Y0U A;  2E1M B;  3AG1 H;  4ZTJ A;  4II3 A;  2Z2S B;  2KFD A;  1XG1 A;  2H8W A;  2M8G X;  2HQA A;  4D1Q A;  1VQP I;  4FE4 A;  3CC4 I;  1W5S A;  2JVG A;  1P4W A;  5FKN A;  4ZYE A;  3SZP A;  2L5Q A;  4B09 A;  2HVQ A;  3BT9 A;  3SFI A;  2CFO A;  1Z67 A;  4AC0 A;  1HC8 A;  4E6K G;  1NH3 A;  1STZ A;  4S05 A;  3IP4 B;  2ICW G;  1W7P A;  4BNC A;  1YX3 A;  3V7R A;  2VI6 A;  3K70 C;  2L9S A;  2OCC H;  4UUT A;  1U5T A;  1AU7 A;  1J0R A;  4CH7 A;  3WTW C;  2DA1 A;  3DXJ F;  2CH0 A;  2B7E A;  3FKI J;  5K7F A;  2DTR A;  2QUF A;  2XGE A;  3G1M A;  2YX7 A;  2ZNZ A;  4L5I A;  2PG4 A;  4A69 C;  5E20 A;  1MGT A;  2EZI A;  3ZQC A;  2CUF A;  1ZG1 A;  5K5Q A;  9ANT A;  1IXC A;  3GFM A;  5LFA A;  1R4M B;  5J1Y A;  1XC5 A;  1HSJ A;  2F5C A;  2MSY A;  3F8N A;  1Z77 A;  2OTL I;  4IHW A;  2ZBK A;  2CUJ A;  1UJ8 A;  2P0W A;  3PUB A;  4V2F A;  1VFC A;  3I5U A;  1LFB A;  3OR1 C;  3FX3 A;  5K5O A;  1JE8 A;  1W1W E;  1B8I A;  2ESH A;  3KZZ A;  3FWE A;  2BY2 A;  2Z33 A;  5H20 A;  2QF7 A;  3RKX A;  4PK4 A;  1E17 A;  2DXI A;  1KU7 A;  3LSH A;  1D0Z A;  5HDK A;  3D5S C;  2IAI A;  3QP6 A;  1BIA A;  2JVH A;  3LMM A;  2O7O A;  1YG2 A;  2LMD A;  3TKY A;  2R5Y B;  1U0J A;  1SVL A;  1X3Z B;  5LLQ A;  2L9R A;  4E7K A;  4XN0 A;  3CES A;  1B4A A;  4Y4R A;  1T0F A;  2EZK A;  4ZYD A;  2DJN A;  1Y8R B;  4E7Z A;  2NVX J;  1U2W A;  2H6B A;  3HOU J;  4BBS J;  4NC7 A;  5J1U A;  1MIJ A;  2X1C A;  4PJL A;  1J09 A;  3ZMZ A;  3DU5 A;  2NOG A;  1ACI A;  1UST A;  2L4M A;  2OV7 A;  2PMU A;  3RPQ A;  2VBZ A;  2HZT A;  5M5W J;  1BBY A;  2NS8 A;  3BZC A;  3IV5 A;  1P7J A;  4C2U A;  1BI2 A;  2R7Q A;  3K1P A;  4CDG A;  4A12 A;  3JRH A;  5F0H A;  2VJ4 A;  1TP4 A;  3VPR A;  3JAM K;  1QRY A;  4QPO A;  4IHS A;  4AM3 A;  2KRF A;  3MAJ A;  2PMH A;  1X2M A;  3O8G A;  4BE0 A;  1TWC J;  1VQM I;  4X0G A;  2ISY A;  4G9Y A;  3UR3 C;  2A61 A;  3B6A A;  2CUZ A;  2EJR A;  4EJV A;  3BR2 A;  1YS7 A;  1N25 A;  5K7H A;  5JLW A;  1K78 B;  2VJI A;  5CVJ A;  1JGS A;  3BDD A;  1R4N B;  4L9N A;  1DP7 P;  2Z99 A;  4PZJ A;  4BXU A;  3H0D A;  3DF8 A;  1I3Q J;  1IN6 A;  4IL6 C;  1ZRF A;  3JR9 A;  2OC6 A;  1F5T A;  1MW7 A;  2NNN A;  1Q1H A;  2E7W A;  3BP8 A;  3PIP F;  2QGU A;  1KON A;  1RPW A;  3NEU A;  2UV1 A;  2WWY A;  2L3D A;  1K7A A;  2W82 A;  2O6G E;  1QPM A;  3OYD A;  1BJZ A;  2VE9 A;  1FBU A;  2A5Y B;  3HPH A;  4XOT A;  4B3X A;  4ZYA A;  1MBG A;  3V4G A;  1UMQ A;  3VB2 A;  2FF4 A;  4AVP A;  2NS7 A;  3S2H J;  3EUA A;  3T0Y A;  2B0L A;  4WK8 F;  2VC1 A;  3LA7 A;  3QWL A;  4IZZ A;  2K9S A;  2NVT J;  2X51 A;  1Z6T A;  4KN7 X;  1NHA A;  3WTS C;  1WJC A;  2LKX A;  2JK3 A;  2NVQ J;  1ON2 A;  4A3E J;  2DOE A;  4RAF A;  4Z2Y A;  1G3T A;  3WTV C;  1SAX A;  1JHF A;  2XKP A;  1LEA A;  1U9N A;  1XN7 A;  2CU7 A;  5GAD J;  3OYH A;  1JKR C;  2HKO A;  1ZRC A;  3F21 A;  1D1C A;  1RZ4 A;  3RJP A;  3HM5 A;  1A5J A;  2IGK A;  3CZ6 A;  3IH3 A;  2PBI A;  5JFR A;  3IAS 2;  5F27 A;  3ROU A;  2I10 A;  4W97 A;  1Z3X A;  3WGH A;  3LSI A;  3LFU A;  2LC2 A;  2X1D A;  4NBQ A;  1E2X A;  2EFO A;  2F48 A;  1R36 A;  5J8F A;  4ASN A;  1YYV A;  3D1N I;  2L7Z A;  2NYX A;  2VL8 A;  3M8E A;  1H9T A;  3LST A;  2L0K A;  2E2J J;  3NAU A;  3D0S A;  3G6E I;  3V8J A;  3GWZ A;  3RYP A;  1D0X A;  2PFB A;  4IHV A;  1Z7L A;  2JPB A;  2DMN A;  1HDP A;  3FM3 A;  1Y0N A;  1ODD A;  3DEE A;  3CJQ B;  1HLV A;  4HPQ A;  2CQN A;  5KK1 A;  1MBK A;  3E6B A;  1S3J A;  1LQ1 A;  3S15 J;  2QSF X;  5DDG A;  1I6H J;  1ZN2 A;  4XOR A;  2JRM A;  2Z9O A;  2EV5 A;  2JUG A;  4BQA A;  2VC0 A;  4YIR X;  2PI0 A;  2BEO A;  2H27 A;  3M3Y J;  1FOW A;  2A69 F;  2OZ6 A;  4KFC A;  2FRH A;  2YX4 A;  2IS6 A;  3K0L A;  1B72 B;  2ZCW A;  3ABL H;  2ZC2 A;  2OQR A;  3GZN B;  2A05 A;  2GA2 A;  3KET A;  3G1O A;  4MEY F;  4HA8 A;  3KEO A;  3BC8 A;  1LDK B;  2CQ7 A;  2O8X A;  3F8B A;  2R7V A;  1UHS A;  3HOZ J;  2VT2 A;  3F9K A;  3L2W A;  2V1N A;  3HTU A;  1F1Z A;  1R5G A;  1W36 C;  3D5R C;  2XAU A;  1Y1V J;  2K9M A;  1BI3 A;  4XLE A;  2WTE A;  2O9L A;  1TT0 A;  1IXR C;  5KCM A;  1YJN I;  1NG6 A;  1NK2 P;  2X4H A;  2RGV A;  3KFW X;  3WU2 C;  1D5V A;  2E71 A;  3I3L A;  4OMZ A;  1GV2 A;  4CUG A;  2YR2 A;  2G7H A;  3HGG A;  5DCM A;  3VFZ A;  1GDT A;  2BY3 A;  2DW4 A;  2O03 A;  3U2R A;  2BGC A;  3FZV A;  3LQQ A;  3CUQ C;  3TDU C;  1XDU A;  3W2W A;  1PP8 F;  2QBY A;  2ZJR F;  3QOP A;  5GAH J;  4HNU A;  2V9P A;  3H3Z A;  1SD7 A;  5IYC J;  2DA5 A;  1I50 J;  3CP2 A;  4M3D A;  4WX9 A;  5CVI A;  3CQZ J;  3QRF F;  5DM6 F;  3JRF A;  2IT0 A;  1SMY F;  3KZI C;  2MW8 A;  3HHG A;  4YIF A;  3CUQ B;  3DCF A;  3H36 A;  3H9Q A;  2Y2Z A;  5IOZ A;  2LD5 A;  4P1W A;  4MQ9 F;  4BH9 A;  2KZG A;  2DO7 A;  3FIS A;  5KAI C;  1T95 A;  3MQ0 A;  1CGP A;  1HOM A;  4A3I J;  2O3F A;  1ETO A;  2BXZ A;  5EG0 A;  2R7Z J;  2FU4 A;  3OYC A;  1SVO A;  2W48 A;  2XC7 A;  3OYB A;  2EQR A;  4JP0 A;  2QEX I;  4ZTF A;  5FKK A;  3VYR B;  1YE9 A;  2P5V A;  3EET A;  3H35 A;  3M8F A;  1FEX A;  3PIO F;  1LB2 A;  5JI6 A;  3BPX A;  2VQL A;  1MJA A;  2G0E A;  3C7J A;  3TQN A;  4B43 A;  2VKV A;  3DTI A;  4AIH A;  4FCY A;  2MH2 A;  3DBH B;  5HOO A;  3QOD A;  5DCM B;  5HS8 A;  1MMD A;  4FX0 A;  3JCU C;  2C6Y A;  1PYV A;  1Z7U A;  3J7A Y;  3J7Z I;  1R9T J;  2QBY B;  2VKH A;  1G8X A;  1XGO A;  1Y39 A;  4GO1 A;  4DYC A;  1P7I A;  1Y6I A;  3B73 A;  1YRN B;  2IW5 A;  3TO9 A;  4IRI A;  2ME6 A;  4GFB A;  1R6R A;  2R7T A;  3HHH A;  4OIN F;  1G3S A;  1VQO I;  3VEP A;  1SEU A;  3CDH A;  5FKL A;  3CCL I;  2VQG A;  4PUS A;  1DPU A;  3V7C A;  2WV1 A;  5EG0 B;  5A2Q K;  4G12 A;  1R5H A;  2L7M P;  1S8N A;  3PNT A;  2JZY A;  2DOA A;  2BHZ A;  2Z16 A;  3CP8 A;  4ZZL A;  1W7P D;  3ABK H;  3ZQG A;  3HTS B;  2WB1 A;  2LKP A;  2ME0 A;  3E1S A;  4BHP A;  2HYG D;  1OR7 A;  3M9A A;  4RGU A;  4OU0 A;  3ZPL A;  4OIP F;  2F5D A;  1NTC A;  2V1D A;  2Q1Z B;  2UUZ A;  2AQE A;  2GLO A;  2CS3 A;  2K4J A;  4BJ6 C;  3X2Q H;  1B59 A;  2KIQ A;  5E3M A;  3F3X A;  2HDD A;  1E0E A;  3L2Q A;  3I58 A;  1HXD A;  5JLX A;  3O8H A;  3G71 I;  1WZ2 A;  2VOP A;  3IRR A;  1R5I D;  2IXS A;  3H5R A;  3U21 A;  2EFP A;  5HOD A;  3OYI A;  3R6S A;  4HDU A;  2JSP A;  4KDP A;  3ABU A;  3CDI A;  4MFD A;  3VSK A;  5E8G A;  4A0Z A;  2TDX A;  3PQK A;  5KVR A;  2O8K A;  1RKT A;  1FNN A;  1XGM A;  1IRZ A;  5FKO A;  3FMQ A;  3P7N A;  1FIP A;  4WXC A;  4QLC U;  2AS5 F;  1DU0 A;  3FM5 A;  2ECB A;  4LD5 A;  4XSZ F;  3FXK A;  3RSN A;  4NC6 A;  3BZ6 A;  4YG2 F;  1HW2 A;  1V4R A;  1FWZ A;  1MBH A;  2DT6 A;  2IP2 A;  2WC2 A;  4CZC A;  2DK5 A;  1A6I A;  3VSL A;  1BL0 A;  2W00 A;  4Y17 A;  3ASO H;  4XOP A;  2HPI A;  2DOF A;  4BKX A;  2BOL A;  3AG4 H;  2R7F A; 
#chains in the Genus database with same CATH homology
 3PIO F;  1VQ5 I;  1ACI A;  1VQ6 I;  3CMA I;  2NXN B;  4IO9 F;  3I55 I;  5DM7 F;  4UY8 I;  1VQN I;  3G6E I;  3J7Z I;  1YHQ I;  2JQ7 A;  1VQM I;  1YJ9 I;  2H8W A;  3J7Y J;  1VQ9 I;  1Y39 A;  1VQP I;  3CC4 I;  3CME I;  2E36 A;  2OTJ I;  3I56 I;  2E34 A;  3CCR I;  1VQ4 I;  1VQO I;  1FOW A;  1HC8 A;  3CCL I;  3CJT B;  3CD6 I;  3CCJ I;  2K3F A;  1VQL I;  3CCS I;  3PIP F;  4IOC F;  3CF5 F;  5GAE J;  3CC7 I;  1YJN I;  2FOW A;  3CCE I;  1MMS A;  3DLL F;  2ZJP F;  2ZJQ F;  3G71 I;  2OTL I;  1FOY A;  1QA6 A;  1YIJ I;  1VQK I;  5JVG F;  3CCV I;  2ZJR F;  2QA4 I;  5GAH J;  4IOA F;  1VQ8 I;  4V19 K;  3CCU I;  3CCM I;  1YIT I;  5DM6 F;  5GAD J;  3CC2 I;  3G4S I;  1YJW I;  1S72 I;  1FOX A;  5GAG J;  2QEX I;  1YI2 I;  2E35 A;  1VQ7 I;  3CCQ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...