1VQMV

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqmV00
1VQMV 1VQNV 2QEXV 1M90W 1KD1W 1VQ4V 3CMEV 1R73A 1YI2V 3CMAV 4WFAV 3CPWU 3CCUV 1K73W 1VQ9V 1VQPV 1YJNV 1Q7YW 2D3OW 1VQ7V 2OTJV 3CCQV 3I55V 1VQLV 2OTLV 3CD6V 3I56V 3OW2U 1W2BU 3CCJV 3CCRV 3G4SV 1VQKV 3CC7V 1YJ9V 1M1KW 1YITV 1VQ8V 1VQ6V 1YJWV 1KC8W 1VQ5V 3CCSV 1KQSU 3G6EV 1Q82W 4WFBV 5DM6V 1JJ2U 1QVFU 3CCLV 3G71V 1YHQV 1QVGU 2QA4V 3CCMV 1N8RW 4WF9V 1VQOV 1Q81W 1K8AW 1K9MW 1S72V 3CC2V 3CC4V 3CCVV 4WCEV 1YIJV 3CCEV 1Q86W 3CXCU 1NJIW
chains in the Genus database with same CATH superfamily
2ZQMA 3P3PA 1WB8A 4K0KB 1IBLO 1XILA 1B06A 3W7UA 4DV7B 2QKCA 1YJ9V 2P06A 3K5OA 4LNUB 5CBFA 2P67A 3DTUB 3K57A 5BZBA 4DR7B 5LGTA 4X65B 3JCZA 1YEWA 3NXSA 1YVWA 3ZX6A 4AI8A 5IWAB 3OGIB 4X66B 4JI8B 1M1KW 5IJ9A 4X1KA 4BIZA 3JARA 3R65A 4ZBMA 1FPOA 2EILC 4QIWF 2L6LA 3CJHA 4DYLA 1MZFA 4EB6A 3N2KB 3RGBA 4LFBB 4WCEV 4LR3A 2WAMA 3TJTA 3FB7C 1TUEB 3RN4A 2ZNJA 2PGGA 1XL4A 5HFLA 5DN6G 1O9GA 3BRCA 3JAMN 3ABLB 5L3DA 2R9AA 3SDLA 2KSDA 4WFFA 1MG1A 4PELA 4JI3B 2GBOA 1BL8A 1COWG 4TV8A 1AI6A 2HEPA 5FL7G 4BWAA 3OTOB 1VF5B 1F7YA 5BR8O 3A0BZ 4JAVA 4EFBA 4GX2A 2PZSA 2EINC 2W0XA 3JATA 4QE9A 1B04A 4YJ2A 3K3WA 4PDRA 1U96A 3RFRA 2YUAA 1N36B 2P90A 1WP7A 1N8RW 2CTWA 3OR6C 3RYHB 2YXLA 3FB8C 1SQPH 1Y74B 1JCHA 1VQ7V 2E74B 2RJZA 3EFFK 1KU9A 3HKEB 2HHHB 3ASOB 1PL0A 4EEQA 2VQFB 4LWSB 2AHYA 5CB4A 3L75H 1H2NA 4X64O 4GT1A 1J5EB 1WA8A 4JI2O 2VWJA 4Z1MG 2IJHA 3PN1A 1JPXA 4PI0A 4JI7B 2CH7A 3DC5A 1HNWB 3JASB 1GM9A 2WLIA 4DV4O 3G80A 1ZSPA 2R9IA 3ABUA 3JCUZ 2CTPA 3ZHSA 1SZTA 5IY5B 3SGIA 1QU7A 2EJ7A 2IW5A 1BE3H 3HKDB 1F51A 3SPGA 1H8HG 1SETA 1XNQO 4BAYA 1R6KA 4WFHA 5JCOC 2UUAB 1M56B 1ZWIC 4PA3A 2X0LA 3B8MA 4TSFG 1PV0A 2HVJC 1JVMA 4GX5A 1N34O 2YEVA 1IBKO 3MDSA 2H8PC 3AG7A 5LXTB 1QVFU 2JVDA 4X1KB 3JARB 1G6UA 2IU0A 4WBNB 1NVPB 3BFRA 4KUMA 4DR5B 1W0JG 4J41A 4FM0A 4PDLA 2Y0IA 2QSAA 2WLKA 4DV3B 4J11A 3T1CA 1Z5WA 4YIOA 4X1YA 2M6YA 3UO2A 4ZHQA 1SQBH 2F66C 1WJZA 4TV8B 2HJDA 2OCCB 2Y69C 2IJKA 1MABG 3W7XA 3FB5C 3GWKC 4FLVA 1QLNA 1V55B 2PI5A 1ZUQA 3SPIA 4X62O 4DR4B 4DR6O 2UU9O 5FLXN 1A32A 1X4TA 2ZM6O 1GO3F 3IJ4A 5J2TA 1NTZH 3WFVA 3DGEA 2GTSA 3JD0A 1HP8A 1I0HA 1ZX3A 4OXSA 1I08A 3RYCB 3CP1A 1VQNV 1P49A 1ENVA 1M4UA 2HG5C 1QLEC 4GKJO 2XUMA 3CEIA 1IBMO 4ZI7B 1L8DA 1GH6A 1Q82W 1RFYA 4GKKB 1HNZB 3WG7C 3CCVV 3QVNA 3UT5A 4K35A 4AILC 4JI6B 3VOUA 3SPJA 3IC7A 4JYYA 3BABA 5CA1B 2CH7B 4JPRA 3F5TA 2JEXA 2UUBB 5B1BB 1Y4MA 1YJWV 4GCZA 1MOFA 4DXWA 4R6ZA 3EXAA 1M57B 1PD3A 2YIDA 1JFFA 4TWKA 5A2QN 1KD1W 4LFCO 3CX5F 3QO5A 3T1YO 5EC1C 4UVAA 2RMKB 3ZMTA 3C3SA 1VEWA 2WLNA 2AGAA 2JJ1G 1B3QA 3K0GA 5LMNB 4QPJA 1NU1H 3JAWB 3SPHA 3K06A 1HNXO 3UM7A 4XDJA 2OIGA 5JVDB 1K5SA 2IH1C 3S3WA 5KHKA 4NTXA 3IAYA 1AB3A 3DXRB 4X1YB 3FAVA 2ZT9B 2Q73A 4ZHQB 5KUKA 3H1LH 3L72H 2F95B 3CXCU 3OUFA 2QM4A 5EIBD 5J9PC 2WA4A 4MVQA 5K1XA 4RO2A 1VF6C 4FLTA 1VF6A 4PI2A 3OW2U 4F6RB 5CA3A 3CCJV 1EN4A 3T2MA 2FTKA 2X6BA 2YI8A 3RYFB 3K58A 5LP6B 1Q81W 1GRJA 4IIJA 2ZNIA 3ETEA 4X9QA 3VQVA 3BA8A 1IDSA 2NN4A 1EN5A 4ZKIA 1VQPV 1S3JA 5EZYB 3L74H 1KYOF 1NVPD 1Q8IA 4UXNA 3K04A 3O65A 4QE7A 4MW3A 4LF4O 3ASNB 4GYCB 2E3CA 3G71V 1RP3B 4D6TH 4NYKA 2RQ6A 5L3BA 3ZS8C 1I7FA 4MSWC 2A79B 4PA6A 3THOA 4UUJC 1PNMA 1Q7YW 4BIOA 1FXKB 2CTRA 1DF5A 1Y76B 3AK1A 4FJCC 3HKBB 5B1AB 5H2FZ 4HZ3A 4DR3B 1BHAA 4NKGB 1OCRB 3MHHC 2NR5A 1NI8A 3DC6A 4IT5A 2R70A 4PV1B 3AK3A 4MT8A 5JJEB 1SQFA 4X20B 2AHZA 3SPCA 4FLYA 4IYIA 4UCVA 4Z2WA 1FFXA 2UXBB 3E86A 4JI1O 3AG3C 2BTQB 3QNEA 4GUNA 2WLHA 3AG1B 2LGWA 3UO3A 2QWNB 4YY3O 1G8MA 3JALB 3SYQA 3IC9A 2HFEC 5J2UB 3F7YC 1VQMV 2ZCEA 5BR8B 4DV2B 1I94O 3ICXA 5IT9N 2D3OW 2XNDG 2ZE6A 3D36C 4BW5A 3KZIZ 1N32B 3RVYA 1NR7A 3UCSC 1VF7A 2ADPA 1SZXA 1YF2A 5IE9A 1KMIZ 4R8CA 4GX0A 4O4HB 2QKAA 1GM8A 4JI5B 3L70H 2FYUH 4CS4A 2ZDIA 1AI5A 1LUVA 4NTWA 2OIEA 1QVGU 2CTQA 4HBNA 1E1RG 1LR1A 3ABKB 2LW1A 5B3SC 5H6QA 4RWUA 3APQA 3JYCA 4QGPA 1R73A 3ABLC 2YXHA 4ZOLA 1OCCB 3GB7C 4FLWA 4NVPA 4G27B 5LHIA 4UVCA 2AXTZ 3BCCH 2QJ1A 3ZEDA 1QCEA 4GLXA 2QWOB 4F6EA 1K92A 4CH4A 3M99B 1DF4A 1GN6A 2Q5ZA 1Y6XA 1XOUA 1K97A 3CSXA 4CH5A 3AEIA 4LF6B 3T4ZA 1MSDA 2AZ0A 4O4IA 3TGUH 4UCSA 3UQ8A 2YI9A 1SA0A 1AILA 1N34B 1SQQH 4O2BB 5KX5A 1HW7A 2CGNA 4LH6A 5IYBO 3X2QB 2F4VB 2QDOA 3N2GB 4DR2O 2BCCH 5JQGA 3P3NA 4CS3A 1FAFA 2GV9A 5KA6A 2QM8A 1ZTEA 4HNAB 4LF8B 3P32A 1W0KG 1AROP 3OFNG 2ODMA 3ASOC 5JH7A 3QG5A 3A0HZ 4H13B 4B7KA 2E75B 1KKDA 1XNRB 4K8XA 1PL4A 5H5NA 4DV6B 4UCOA 3RWRD 4I7ZB 3FYEB 2WLJA 3JD2A 2EIMB 3S3XA 5LGNA 4OX9O 1K4DC 5IY5C 2DQ0A 5EIBC 4PJ0Z 1S5JA 1CPYA 2ZM6B 1BGYH 4KXRA 1N33O 3EVKA 2Q67A 4B3RB 4I50B 4NXMO 5HFMA 3CRAA 4LF7O 3QTCA 1AR5A 1JOYA 3H01A 3G6BA 1AP5A 5IYZB 1EN6A 4A5UB 3CRQA 3HPLC 4RUFA 3SYCA 1Y67A 5L3FA 3E8GA 5LA6B 1AI7A 2JGUA 2PYJA 1H2KA 2KKWA 1FD9A 4L8JA 5GONA 1V54B 4IHJB 4JYBA 5ITZB 4TUYB 5KAIZ 3ML0A 2VQEB 2JK5C 1XMOB 1OHHG 3SJAC 3H1IH 3SR2C 1SERA 1WLEA 1GN2A 4ZOLB 2PYLA 1I5XA 2W6IG 2Z0AA 1NR1A 3SJCC 4DO2A 5H6RA 2HLDG 4JYAO 2V1DA 4JAUA 5LOVA 2OCCC 1FJGO 2EZOA 2WLLA 2HP8A 4JI0B 2ZE5A 1ZLZA 4C7UA 4JGSA 1Q90D 2DJVA 3RYIB 1AVMA 1V55C 3D3QA 4DV5O 1BS3A 4UVBA 4J9YB 2CE4A 5F2VO 4LFCB 5KMGA 1SA0B 5KX5B 2DYSB 2XTAA 2MW2B 4DK1A 5LL6Y 5FPOA 2ZR2A 1EM1A 2B1GA 2OYQA 1HR0O 4I4TA 3GWOA 1RM1B 4H44B 5CA0A 5AG2A 5JH7B 2ZKOA 2IM9A 2UXDO 2LO1A 4O4JA 5DECA 5E1AC 4WF9V 3ABMB 1QR9A 4FK5C 5C8YA 2KG7A 2CAZC 2P4KA 4MTXA 3Q4HA 2QEXV 4MVMA 1R3KC 5B1BC 2JS3A 3ZRWA 5JCOA 4MVSA 3ZJZA 1M57C 1S5LZ 2BSKA 5IJ9B 4I0XA 4MTFA 3B2EE 4FZ1A 1XL6A 5GW7A 1QQCA 1Y66A 2X6CA 1OJHA 3CJHB 4EB6B 1CEZA 4L87A 1JA8A 3CPWU 3AG2B 2DYRC 3P30A 2ZE7A 2QWQB 1S0VA 4J7ZA 3W7TA 5JJNB 2A0LA 2YDEA 5LYJA 4JV5O 4YXWG 4UFZA 4B3SB 5BMVA 3B4SA 4DK0A 3H1JH 1W59A 5LHGA 1H2SB 4PA9A 3U11A 1OCZC 3OMNB 1XDCA 3LDDA 3IGAC 3OUSA 3JATB 3ZHVA 2YC0A 2VS0A 1PNLA 1TVKA 2N04A 4PHZA 2P7TC 4YJ2B 3G6EV 4DR7O 2XAQA 1DTOA 3T4DA 4X65O 4B3MB 2X7RB 4P2ZA 1KBHA 1Q3EA 5IWAO 1GKFA 4U3JA 3CMEV 3VQYA 3AG4B 4X66O 4JI8O 4FM1A 3NR7A 5L3GA 3TXSA 2UXCB 1KC8W 5LP6C 4I9WA 2R9RB 1K3EA 4LF5O 5B1NA 3ZIAG 1WPXA 4B3TB 1AR1B 5CB4B 3RT3C 1O9HA 1J95A 1XMQO 1JJOA 3ZHRA 2RNBA 1WA8B 5B1OA 3BVOA 2ARHA 5IYDO 3ASNC 2WLIB 1MZEA 2XT9A 1FKAO 3OTOO 1AI4A 1GN3A 4O2AA 1YHQV 1XUQA 4ABMA 4DW0A 4MVZA 2V4DA 3LDCA 1PPJH 1PP9H 1FXKC 3J7AU 3K79A 2GTAA 3Q4HB 4O4LA 3E22A 1GTOA 2QM7A 2EZPA 3ZRWB 4CC5A 1OCRC 5K1PA 4RQEA 1FFTB 1N36O 2YEVB 2BSKB 4JTAB 2L35A 4KHPB 4JTDB 3HB3B 2UXNA 2IH3C 3DSQA 4QPKA 1JMKC 2DMXA 1TAEA 1KB9F 2UUCB 2JIZG 1T5EA 2YIBD 3RBZA 1PNKA 4I9QA 2VQFO 4AQYB 4QNHB 3OGCC 3FFQA 1J5EO 3OMIB 4W4LA 1OCOB 5CN0A 5BMVB 4JI7O 1HNWO 3ZHUA 3MD0A 2Q0AA 3D3IA 2E5LO 5FNVA 5A9GA 3ETQA 1MMMA 4DUZO 3OEHG 2EX3A 4LFAB 5J2TB 4JTCB 4PD4F 2QA4V 3HR0A 2Y0PA 5LMUO 2BE3A 2FMLA 1YIJV 3OT7A 1FYJA 1TA8A 3BPZA 4DR2B 5CBGA 3F5WC 3K9AA 4LP8A 4TT3G 3WB0A 1F4NA 1IBLB 3CHXA 1GK9A 1URFA 2P6JA 1TUBA 3SJQC 2Q68A 2ATKC 2ZR3A 4KP4A 3ABKC 1DK1A 1BQZA 4UV8A 2WLMA 1EBOA 5KHIA 4QJFB 2BOBC 1K8AW 4LF9O 1OCCC 4MTGA 2LGQA 2PUSA 2HVKC 2JRIA 3UT5B 2CGOA 1SRYA 2B9ZA 4J80A 5B5EZ 1WAZA 3UKMA 2F93B 4OX9B 4PDMA 5C93A 5B66Z 2EIKB 2XOKG 4U7NA 1U97A 3FD9A 1RPRA 1K4CC 4YJ3A 1N33B 1NZ6A 5H9CA 4HYOA 4NXMB 4GZRB 1JFFB 1M90W 4LF7B 4DW1A 4PA4A 3E22B 3CE2A 1WP8A 1XHXA 2K1EA 2ZXWC 4FLXA 4MS2A 1F4MA 3O9OA 4JZGA 4MVOA 1S77D 4X1IA 1KQSU 3JAKA 4JAAA 4D7SA 2UXXA 1WPBA 3B09A 1BQ0A 2EIJB 2JEUA 3CCEV 2P5OA 3IFXA 3I5DA 2QTOA 3LSUA 3LSSA 4RAIA 3K5LA 2E76B 4LNUA 2OT5A 1QNMA 3OAAG 1Q6HA 3D36A 3VBBA 4DR1O 4GKKO 1HNZO 4JYAB 2EIMC 3T1HO 1B6QA 1MA1A 3FAVB 4JI6O 1SS3A 1UJWB 1KKCA 4FZ0A 2R72A 2Q4PA 2UUBO 4DV1O 4JI4O 2YIAA 1ROPA 2A9HA 1Q5OA 2XAGA 2WPDG 2XASA 2DW4A 3N2KA 4FMTA 4KFMA 4JF3A 4OPAA 1S76D 3CD6V 1F23A 1VMGA 2KQXA 5EBWC 4X64B 4IIJB 1D2DA 4JI2B 1OV9A 3J81N 1VQKV 3EHBB 4X88A 2BOCC 1VARA 4DV4B 1HR0B 2LJ2A 1V54C 4FLZA 4DRXA 5KUMA 1CP9A 5EC2C 2BTOA 3RW0A 5LGUA 1GAXA 4ZIBA 1XNQB 3SJBC 1VQ9V 1RSOA 1YJNV 4TQFA 3K9SA 3LNMB 1YITV 4YHHO 3N27A 1P7BA 1ZAUA 2DOSA 1IBKB 1AP6A 3RYHA 4DV0O 1WB7A 1NKDA 3OD4A 4YJ3B 1KP2A 2JGDA 2OCHA 4F4LA 3E8FA 2FL4A 3F7VC 1YXBA 4JASA 3HKEA 3K59A 2K9PA 2YICA 4FFBA 2LFRA 5EK0A 1FFXB 4LWSA 4J42A 2WWWA 4NTYA 3AG3B 1I5YA 4NB5A 2LQTA 2FKXA 1FS0G 1AR4A 1VIBA 3C3TA 1OZ0A 3JD1A 3WB2A 1RM1C 3JASA 1IURA 1R3LC 4H37A 4JYCA 4G28B 3BY6A 2GUZA 5IYCO 1G4YB 4X62B 4DR6B 3ABMC 1QR8A 2UU9B 3HKDA 3QF7A 4BR6A 4XDLA 1JJ2U 1K7DA 3ETDA 1US6A 1DLBA 1V9PA 3E2EA 3JD4A 3MHSC 1M56C 2ZIMA 2V7QG 3PJSK 1IZ3A 4ASUG 3BAAA 4WFAV 3BHPA 3ETGA 4UB6Z 1K34A 1NT2B 2ZE8A 2RDCA 4MVRA 1WNSA 4DR3O 5LXTA 4BW9A 1P84F 4GKJB 2IU3A 4WBNA 1IBMB 1YSCA 1SESA 1S5HC 4LF5B 3AG2C 3ZMUA 1K73W 4P9PA 1EZJA 1UFIA 2UXBO 5B3SB 1XMQB 4PDVA 4EFEA 4EKWA 2Y4TA 1H2GA 3SYAA 3B40A 1VP7A 5D5PA 2DE0X 4DRXB 3K5NA 1S72V 4DV2O 4XDKA 4RQFA 4IL6Z 2DN9A 3QO8A 5EBLC 3CYOA 2ZIOA 2XAHA 1SQXH 3ZMZA 2HKOA 4FPPA 1M5IA 1SQVH 1N32O 3ZCCA 3CCQV 1RSOB 4B08A 2W6JG 1NTMH 3T1YB 4O4IB 2Q8VA 1BT8A 1P4RA 1PKXA 2PTMA 1IX9A 1Q6IA 4JI5O 3RYCA 3AG4C 1ZL8A 1QHTA 1D5AA 2YXYA 3WB1A 5JQGB 1H8EG 2JGDB 4PA7A 1IVSA 4WFEA 4I55A 3M7MX 2Q6AA 1HNXB 1ORQC 4ZI7A 4NXNO 3ZRXA 3CCSV 4FFBB 5KHGA 3W7WA 3OE7G 4N21A 2JJ2G 4CS2A 1QBZA 4U3FH 5CA1A 3LUTB 4OGQB 5E79Z 4YIPA 5FPRA 2E5LB 2Z3YA 3SYOA 2GUZB 2XAFA 4DUZB 2MK3A 4DUYO 1WN7A 5L3CA 1K33A 1RPOA 3CC4V 4UCTA 3AK2A 1Q43A 4LF6O 4X89A 2PY5A 2EILB 5LMUB 1IXBA 4R7CA 2VWKA 1IXMA 1FXHA 1PM9A 4J7KA 1P7GA 3B8NA 4MVUA 3BA9A 1BCCH 1JQ0A 1MSWD 1YDXA 3G4SV 3CXHF 3STLC 2Y48A 1AJQA 2F1MA 2NLJC 1K5QA 2DWDC 1D5NA 5DM6V 2F4VO 3ZRVA 4LF4B 3JAWA 2WSSG 2G38A 3VQWA 1YTFB 2A3QA 5GONB 3K03A 4LF8O 4LF9B 4K0KO 2WA3A 1BHBA 1SKVA 3E89A 4K8ZA 1THZA 3L9DA 5JVDA 3HKCA 4WFGA 4DV7O 2EINB 3CC7V 2Y4UA 5KA5A 3DXRA 3RVZA 3H1KH 1XNRO 3FKSG 2N05A 3FYIB 5KHJA 4DV6O 4B7EA 1OCOC 5BXZA 4WFBV 1E1QG 1TGOA 5LOVB 1R6TA 2WLLB 2GSMB 4NR1A 1JX9A 2F43G 1YZBA 1VQ4V 4J9ZB 1M93A 4F6RA 5EYPA 2OTLV 4FM2A 1R1BA 1FXVA 2N74A 3W7SA 1VQ8V 4FFKA 3U0ZA 3VQXA 3B77A 3OEEG 2JS5A 4JI1B 5CMUA 3RYFA 5LP6A 4B3RO 2QGNA 1XHZA 5KMGB 3K5MA 4LFBO 4K3AA 1CXZB 1ZL8B 4YY3B 1DGSA 5EZYA 3MAQA 3KCXA 1NH2B 4I55B 3M8AA 3OM3B 4BIUA 1I94B 4R50A 4IYHA 1GM7A 4UCRA 4JI3O 1VQ6V 1LUWA 2PF4E 1N0JA 4I4TB 2EULA 2Q69A 5CA0B 4W4KA 2Q0OC 4DR1B 2P22C 1KECA 4E4EA 4O4JB 3T1HB 2VQEO 5IJ0A 1NQTA 1XMOO 4MTOA 5C8YB 2KG7B 2HR3A 1FXKA 1Y76A 5KAFZ 4X8AA 1SQGA 3CRCA 4H33A 5B1AC 2EIKC 3HKBA 3R66A 4DV1B 4JI4B 2FB5A 4JI0O 3D8CA 1XI1A 3K08A 3BEHA 4I0XB 2XHBA 2LFSA 4FLUA 3CC2V 3ZRSA 2F23A 4X20A 4ICGA 1R6NA 2IJJA 1AJPA 2IJIA 4D7TA 1L0LH 4LBEC 2BTQA 2C2AA 2HHHO 1N4CA 3AG1C 1X59A 2DYRB 3FX7A 3CRRA 3ZMSA 1H2LA 3CS5A 1Z2GA 2EIJC 5LYJB 3LDEA 3JALA 3CCMV 5J2UA 3A8TA 1R3IC 3H9VA 4JZ2A 3CCUV 2Y69B 3ZN1A 5D5QA 1XBLA 3HKCB 3TCUA 3CCRV 2ZD9A 1OCZB 5IDJA 2O57A 2ETNA 4YHHB 1TVKB 3G67A 4O4HA 5TISZ 4CC6A 2EBOA 3ZBHA 2GHYA 3ZMVA 4DV0B 1G1XB 2UUAO 4AHCA 2A06H 1HWYA 5EBMC 3FB6C 4U3JB 4Z1VA 3TXQA 3TETA 5EYPB 2B5UA 2Q7HA 3APOA 2RN9A 1QLEB 2X6AA 3ZHQA 3CCLV 4GX1A 4I5SA 5LHHA 3H1HH 4Q20A 4CBCA 1EFRG 2D2CB 4TV9A 4DR5O 3OTFA 3C90A 2DQ3A 2KB1A 5GTIZ 2VRZA 3WG7B 4DV3O 3KCYA 3I55V 1VQLV 4TQDA 2PI4A 1YTFD 1GMGA 2GDSA 1H2MA 1Q6UA 2AZ2A 3TK1A 4TOIA 4U7OA 1E79G 3E83A 4B3SO 1N0NA 1HDJA 1KUQA 5BY1A 1AJNA 4O2AB 2QTSA 1NJIW 5IJ0B 4P30A 2ITDC 3CMAV 2H94A 4DR4O 4O4LB 5JWPA 3GVMA 1BSMA 2ADQB 2RCVA 3ABTA 4O2BA 3LNNA 3ZN0A 2QE7G 2Q7GA 3E8BA 3X2QC 3N2GA 1JR9A 1XREA 4B3MO 4IGGA 2LP7A 3CB2A 1M9NA 4HNAA 2LW7A 5LBQA 2QWPB 5KLVH 2EJRA 3L73H 4LCUC 2UXCO 2Z5UA 1EZVH 4UV9A 3ZHTA 1R3JC 4CH3A 1NH2D 4RUEA 4B3TO 4CZZA 2HJFC 1YCIA 2QKSA 1FJGB 4UCUA 3E35A 1NBMG 4MW8A 2AW9A 1BMFG 2Q7EA 3L71H 1NS1A 1SC5B 4DV5B 4J7JA 4LC1A 1L1FA 4P9OA 5FNVB 1SF9A 4I50A 4Q6GA 3JSLA 4H0LB 1H38A 1GN4A 4J10A 5IYZA 2YSUB 2XAJA 1BZKA 3CWBH 2ZDIC 3OR7C 1KP3A 3OMAB 5LA6A 3A0RA 5CBHA 3I56V 4OPHA 2DWEC 3U10A 3CRMA 5GTHZ 4NXNB 3KG2A 4KHPO 5LMNO 4IHJA 2OWOA 1TUBB 5ITZA 2UXDB 4CH6A 4TUYA 2A7WA 1K9MW 4UB8Z 3STZC 2UUCO 4TV9B 4KL1A 3JD3A 4N23A 1Z5VA 1LNQA 3LSQA 2OTJV 2CUGA 2H3OA 3J80N 4AQYO 2Q9LA 1MNGA 1VQ5V 5L3EA 2P4VA 3RYIA 4G2KA 3WU2Z 2JDIG 1VQOV 4XBFA 3QO7A 1XQ8A 4FVMA 1UPGA 4DUYB 5DEDA 4E2LA 1Q86W 1Y74A 3E8HA 2W0FC 1NTKH 2ILMA 2ITCC 2ZINA 1YI2V 1XEQA 4FIPC 4HAMA 5KHHA 2QWRB 1W2BU 3KKYA 4LH7A 3SYPA 4LFAO 2QR4A 2CDYA 2ZXWB 3JSNA 2DYSC 3K0DA 2B1IA 2IBZH 3A2FA 2NNUA 2YIBA 4X1IB 2YS8A 3JAKB 4JV5B 2CK3G 1L0NH 2M7WA 5JJJB
chains in the Genus database with same CATH topology
1FXKC 1QBZA 2ZQMA 3K79A 3LUTB 4MT8A 2AHZA 3SPCA 1GTOA 2QM7A 2EZPA 3ZRWB 3W7UA 1YJ9V 3E86A 2Z3YA 3AG3C 1OCRC 3QNEA 3SYOA 4RQEA 1FFTB 5CBFA 2WLHA 3AG1B 2P67A 2XAFA 2YEVB 2MK3A 3DTUB 4JTAB 5L3CA 1K33A 1RPOA 5BZBA 4JTDB 3CC4V 1G8MA 3SYQA 5LGTA 2HFEC 4X89A 3F7YC 3HB3B 3JCZA 2EILB 1VQMV 2UXNA 4R7CA 3NXSA 2IH3C 1IXMA 4QPKA 1FXHA 3B8NA 2D3OW 2XNDG 4MVUA 2JIZG 1JQ0A 1MSWD 3RBZA 3G4SV 1M1KW 4BW5A 1PNKA 3STLC 2Y48A 3RVYA 1AJQA 1NR7A 4QNHB 2NLJC 1K5QA 4BIZA 3R65A 2DWDC 5DM6V 4ZBMA 3OGCC 2EILC 4QIWF 3ZRVA 4R8CA 4GX0A 2WSSG 3OMIB 1OCOB 5CN0A 1YTFB 4WCEV 1GM8A 3K03A 2WAMA 3FB7C 1BHBA 1TUEB 3MD0A 3D3IA 3E89A 1THZA 4WFGA 1XL4A 5HFLA 2ZDIA 5DN6G 1AI5A 2EINB 3ABLB 3CC7V 5KA5A 3RVZA 5L3DA 3FKSG 3FYIB 4WFFA 1MG1A 4PELA 3OEHG 1BL8A 1OCOC 1COWG 4WFBV 1AI6A 1E1QG 4JTCB 5FL7G 1QVGU 2QA4V 2WLLB 1E1RG 2GSMB 3ABKB 5B3SC 1YIJV 4JAVA 1JX9A 2F43G 4GX2A 5H6QA 3JYCA 1VQ4V 5CBGA 1R73A 2EINC 3ABLC 4J9ZB 3F5WC 3K9AA 1OCCB 3GB7C 4QE9A 4G27B 2OTLV 1FXVA 4LP8A 4TT3G 5LHIA 3W7SA 1F4NA 1VQ8V 4UVCA 1GK9A 3B77A 3OEEG 3K3WA 2P6JA 3SJQC 2Q68A 2ATKC 1QCEA 4PDRA 5CMUA 2ZR3A 4KP4A 3ABKC 1K92A 3M99B 1DF4A 4UV8A 2P90A 2WLMA 1N8RW 1EBOA 4QJFB 2BOBC 1K8AW 3OR6C 1OCCC 4MTGA 1K97A 3FB8C 2HVKC 3AEIA 3T4ZA 1NH2B 1JCHA 1SRYA 1VQ7V 4BIUA 3OM3B 3UKMA 4R50A 1GM7A 3EFFK 4PDMA 5C93A 1VQ6V 2EIKB 2Q69A 3ASOB 2XOKG 1PL0A 4U7NA 2AHYA 1KECA 5IYBO 1RPRA 1K4CC 3X2QB 1NQTA 5H9CA 4MTOA 4HYOA 4GT1A 4Z1MG 1M90W 2IJHA 5KA6A 2HR3A 2QM8A 1FXKA 1JPXA 4X8AA 4PA4A 3P32A 1W0KG 1AROP 4H33A 5B1AC 3OFNG 1GM9A 2EIKC 2WLIA 2R9IA 3ASOC 2K1EA 2ZXWC 3ABUA 4MS2A 1F4MA 4MVOA 1SZTA 5IY5B 1S77D 1KQSU 1KKDA 2IW5A 3K08A 3BEHA 2UXXA 2LFSA 1F51A 3SPGA 3FYEB 3CC2V 1H8HG 1SETA 3ZRSA 4BAYA 2WLJA 2EIJB 2JEUA 2EIMB 3JD2A 1R6KA 3CCEV 5LGNA 3IFXA 4WFHA 1R6NA 2IJJA 1M56B 1AJPA 2IJIA 2QTOA 3LSSA 4RAIA 1K4DC 1ZWIC 2X0LA 3B8MA 4LBEC 4PA3A 5IY5C 4TSFG 2C2AA 2DQ0A 3AG1C 2HVJC 2OT5A 2DYRB 3OAAG 1JVMA 3D36A 4GX5A 3VBBA 2YEVA 3ZMSA 2H8PC 1CPYA 2EIJC 2EIMC 3LDEA 1QVFU 3CCMV 2IU0A 1B6QA 2Q67A 1NVPB 5HFMA 1R3IC 1UJWB 1JOYA 4KUMA 3H01A 1W0JG 3CCUV 4PDLA 3HPLC 2Y69B 4RUFA 3ZN1A 3SYCA 2WLKA 5L3FA 1ROPA 3E8GA 2A9HA 2ZD9A 3TCUA 3CCRV 3T1CA 1AI7A 1OCZB 5IDJA 2XAGA 2WPDG 2XASA 2DW4A 4FMTA 2EBOA 4KFMA 1V54B 2GHYA 4JF3A 2OCCB 4JYBA 3ZMVA 1S76D 3CD6V 2Y69C 1F23A 2IJKA 3ML0A 5EBWC 1MABG 2JK5C 1HWYA 5EBMC 3W7XA 3FB5C 1OHHG 1QLNA 1SERA 1V55B 2PI5A 1WLEA 3FB6C 3SPIA 1I5XA 2W6IG 3TETA 1VQKV 3EHBB 2B5UA 1NR1A 2BOCC 4X88A 4DO2A 5H6RA 2HLDG 1GO3F 1V54C 2V1DA 4JAUA 1QLEB 2OCCC 2X6AA 3WFVA 2EZOA 2WLLA 3DGEA 3JD0A 3CCLV 4GX1A 4I5SA 5KUMA 1CP9A 5LHHA 3E2EA 4Q20A 4JGSA 4OXSA 5EC2C 1EFRG 4CBCA 1V55C 3CP1A 3RW0A 5LGUA 4UVBA 1VQNV 2DQ3A 2KB1A 1VQ9V 3WG7B 1YJNV 4J9YB 1ENVA 3I55V 2HG5C 1VQLV 2PI4A 1QLEC 1YTFD 3LNMB 1GMGA 1YITV 3TK1A 4U7OA 1E79G 3E83A 1P7BA 1Q82W 2DYSB 1NKDA 3WG7C 1AJNA 3CCVV 1KP2A 1NJIW 4P30A 2ITDC 4F4LA 3E8FA 3VOUA 3CMAV 2ZR2A 2B1GA 3SPJA 3F7VC 3IC7A 2H94A 4JASA 3GWOA 4JPRA 1RM1B 2JEXA 5B1BB 1Y4MA 2LFRA 3ABTA 5EK0A 1YJWV 4GCZA 3ZN0A 1MOFA 2QE7G 3E8BA 4DXWA 4R6ZA 2WWWA 3X2QC 3AG3B 1I5YA 1M57B 1PD3A 5E1AC 4WF9V 1FS0G 3ABMB 1QR9A 4FK5C 2LP7A 1M9NA 4TWKA 4MTXA 1OZ0A 3JD1A 2QEXV 5LBQA 1KD1W 4MVMA 1RM1C 1R3KC 5B1BC 3ZRWA 1R3LC 2EJRA 4H37A 4JYCA 4LCUC 3QO5A 2Z5UA 4G28B 4MVSA 4UVAA 5EC1C 3ZMTA 3BY6A 4UV9A 3ZJZA 1M57C 5IYCO 1G4YB 1R3JC 2WLNA 3ABMC 1QR8A 1NH2D 4MTFA 4RUEA 4CZZA 4XDLA 2HJFC 2JJ1G 1JJ2U 1XL6A 5GW7A 1K7DA 3ETDA 1DLBA 2QKSA 3K0GA 1Y66A 3E35A 1NBMG 2X6CA 3JD4A 4MW8A 3MHSC 1M56C 4QPJA 1BMFG 2V7QG 1CEZA 4L87A 3PJSK 4ASUG 4WFAV 3CPWU 3AG2B 3SPHA 3K06A 3ETGA 4LC1A 2DYRC 3P30A 1K34A 1L1FA 3UM7A 4XDJA 1S0VA 4P9OA 1K5SA 2IH1C 4MVRA 3W7TA 2A0LA 2IU3A 4YXWG 1YSCA 5KUKA 1H38A 1SESA 1S5HC 3AG2C 3ZMUA 1K73W 4P9PA 1EZJA 3CXCU 3OUFA 2YSUB 2XAJA 5LHGA 2ZDIC 5B3SB 5J9PC 4MVQA 3OR7C 4PA9A 1KP3A 4RO2A 4PDVA 1OCZC 3OMAB 3A0RA 3OMNB 3LDDA 3IGAC 5CBHA 3OUSA 3I56V 3OW2U 5CA3A 3CCJV 4EKWA 3T2MA 2FTKA 1PNLA 2DWEC 2X6BA 1H2GA 3SYAA 3KG2A 2P7TC 3G6EV 2XAQA 1DTOA 3T4DA 1K9MW 1Q81W 1S72V 2X7RB 4XDKA 4P2ZA 3STZC 4RQFA 3ETEA 1GKFA 3CYOA 3JD3A 3QO8A 2XAHA 4N23A 5EBLC 3ZMZA 3CMEV 3AG4B 2HKOA 4FPPA 4ZKIA 1VQPV 1LNQA 1S3JA 3LSQA 3ZCCA 5L3GA 3CCQV 2OTJV 1NVPD 2W6JG 4UXNA 1KC8W 1VQ5V 3K04A 5L3EA 4QE7A 4MW3A 1P4RA 2R9RB 4I9WA 3ASNB 4G2KA 1K3EA 1PKXA 3G71V 2JDIG 5B1NA 1WPXA 3ZIAG 1VQOV 4XBFA 3QO7A 1AR1B 3AG4C 4E2LA 5L3BA 1Q86W 3E8HA 4MSWC 2W0FC 2A79B 1J95A 4PA6A 2ITCC 1YI2V 1H8EG 4FIPC 4PA7A 1PNMA 4HAMA 4UUJC 4WFEA 1Q7YW 5B1OA 1FXKB 1DF5A 2Q6AA 5IYDO 1W2BU 3ASNC 1ORQC 4FJCC 3SYPA 2WLIB 5B1AB 3ZRXA 3CCSV 2ZXWB 4HZ3A 3W7WA 2DYSC 1AI4A 2B1IA 3K0DA 3OE7G 1BHAA 2NNUA 1OCRB 1YHQV 3MHHC 4N21A 4MVZA 2CK3G 2JJ2G 3LDCA 2M7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM V;  1VQN V;  2QEX V;  1M90 W;  1KD1 W;  1VQ4 V;  3CME V;  1R73 A;  1YI2 V;  3CMA V;  4WFA V;  3CPW U;  3CCU V;  1K73 W;  1VQ9 V;  1VQP V;  1YJN V;  1Q7Y W;  2D3O W;  1VQ7 V;  2OTJ V;  3CCQ V;  3I55 V;  1VQL V;  2OTL V;  3CD6 V;  3I56 V;  3OW2 U;  1W2B U;  3CCJ V;  3CCR V;  3G4S V;  1VQK V;  3CC7 V;  1YJ9 V;  1M1K W;  1YIT V;  1VQ8 V;  1VQ6 V;  1YJW V;  1KC8 W;  1VQ5 V;  3CCS V;  1KQS U;  3G6E V;  1Q82 W;  4WFB V;  5DM6 V;  1JJ2 U;  1QVF U;  3CCL V;  3G71 V;  1YHQ V;  1QVG U;  2QA4 V;  3CCM V;  1N8R W;  4WF9 V;  1VQO V;  1Q81 W;  1K8A W;  1K9M W;  1S72 V;  3CC2 V;  3CC4 V;  3CCV V;  4WCE V;  1YIJ V;  3CCE V;  1Q86 W;  3CXC U;  1NJI W; 
#chains in the Genus database with same CATH topology
 2ZQM A;  3P3P A;  1WB8 A;  4K0K B;  1IBL O;  1XIL A;  1B06 A;  3W7U A;  4DV7 B;  2QKC A;  1YJ9 V;  2P06 A;  3K5O A;  4LNU B;  5CBF A;  2P67 A;  3DTU B;  3K57 A;  5BZB A;  4DR7 B;  5LGT A;  4X65 B;  3JCZ A;  1YEW A;  3NXS A;  1YVW A;  3ZX6 A;  4AI8 A;  5IWA B;  3OGI B;  4X66 B;  4JI8 B;  1M1K W;  5IJ9 A;  4X1K A;  4BIZ A;  3JAR A;  3R65 A;  4ZBM A;  1FPO A;  2EIL C;  4QIW F;  2L6L A;  3CJH A;  4DYL A;  1MZF A;  4EB6 A;  3N2K B;  3RGB A;  4LFB B;  4WCE V;  4LR3 A;  2WAM A;  3TJT A;  3FB7 C;  1TUE B;  3RN4 A;  2ZNJ A;  2PGG A;  1XL4 A;  5HFL A;  5DN6 G;  1O9G A;  3BRC A;  3JAM N;  3ABL B;  5L3D A;  2R9A A;  3SDL A;  2KSD A;  4WFF A;  1MG1 A;  4PEL A;  4JI3 B;  2GBO A;  1BL8 A;  1COW G;  4TV8 A;  1AI6 A;  2HEP A;  5FL7 G;  4BWA A;  3OTO B;  1VF5 B;  1F7Y A;  5BR8 O;  3A0B Z;  4JAV A;  4EFB A;  4GX2 A;  2PZS A;  2EIN C;  2W0X A;  3JAT A;  4QE9 A;  1B04 A;  4YJ2 A;  3K3W A;  4PDR A;  1U96 A;  3RFR A;  2YUA A;  1N36 B;  2P90 A;  1WP7 A;  1N8R W;  2CTW A;  3OR6 C;  3RYH B;  2YXL A;  3FB8 C;  1SQP H;  1Y74 B;  1JCH A;  1VQ7 V;  2E74 B;  2RJZ A;  3EFF K;  1KU9 A;  3HKE B;  2HHH B;  3ASO B;  1PL0 A;  4EEQ A;  2VQF B;  4LWS B;  2AHY A;  5CB4 A;  3L75 H;  1H2N A;  4X64 O;  4GT1 A;  1J5E B;  1WA8 A;  4JI2 O;  2VWJ A;  4Z1M G;  2IJH A;  3PN1 A;  1JPX A;  4PI0 A;  4JI7 B;  2CH7 A;  3DC5 A;  1HNW B;  3JAS B;  1GM9 A;  2WLI A;  4DV4 O;  3G80 A;  1ZSP A;  2R9I A;  3ABU A;  3JCU Z;  2CTP A;  3ZHS A;  1SZT A;  5IY5 B;  3SGI A;  1QU7 A;  2EJ7 A;  2IW5 A;  1BE3 H;  3HKD B;  1F51 A;  3SPG A;  1H8H G;  1SET A;  1XNQ O;  4BAY A;  1R6K A;  4WFH A;  5JCO C;  2UUA B;  1M56 B;  1ZWI C;  4PA3 A;  2X0L A;  3B8M A;  4TSF G;  1PV0 A;  2HVJ C;  1JVM A;  4GX5 A;  1N34 O;  2YEV A;  1IBK O;  3MDS A;  2H8P C;  3AG7 A;  5LXT B;  1QVF U;  2JVD A;  4X1K B;  3JAR B;  1G6U A;  2IU0 A;  4WBN B;  1NVP B;  3BFR A;  4KUM A;  4DR5 B;  1W0J G;  4J41 A;  4FM0 A;  4PDL A;  2Y0I A;  2QSA A;  2WLK A;  4DV3 B;  4J11 A;  3T1C A;  1Z5W A;  4YIO A;  4X1Y A;  2M6Y A;  3UO2 A;  4ZHQ A;  1SQB H;  2F66 C;  1WJZ A;  4TV8 B;  2HJD A;  2OCC B;  2Y69 C;  2IJK A;  1MAB G;  3W7X A;  3FB5 C;  3GWK C;  4FLV A;  1QLN A;  1V55 B;  2PI5 A;  1ZUQ A;  3SPI A;  4X62 O;  4DR4 B;  4DR6 O;  2UU9 O;  5FLX N;  1A32 A;  1X4T A;  2ZM6 O;  1GO3 F;  3IJ4 A;  5J2T A;  1NTZ H;  3WFV A;  3DGE A;  2GTS A;  3JD0 A;  1HP8 A;  1I0H A;  1ZX3 A;  4OXS A;  1I08 A;  3RYC B;  3CP1 A;  1VQN V;  1P49 A;  1ENV A;  1M4U A;  2HG5 C;  1QLE C;  4GKJ O;  2XUM A;  3CEI A;  1IBM O;  4ZI7 B;  1L8D A;  1GH6 A;  1Q82 W;  1RFY A;  4GKK B;  1HNZ B;  3WG7 C;  3CCV V;  3QVN A;  3UT5 A;  4K35 A;  4AIL C;  4JI6 B;  3VOU A;  3SPJ A;  3IC7 A;  4JYY A;  3BAB A;  5CA1 B;  2CH7 B;  4JPR A;  3F5T A;  2JEX A;  2UUB B;  5B1B B;  1Y4M A;  1YJW V;  4GCZ A;  1MOF A;  4DXW A;  4R6Z A;  3EXA A;  1M57 B;  1PD3 A;  2YID A;  1JFF A;  4TWK A;  5A2Q N;  1KD1 W;  4LFC O;  3CX5 F;  3QO5 A;  3T1Y O;  5EC1 C;  4UVA A;  2RMK B;  3ZMT A;  3C3S A;  1VEW A;  2WLN A;  2AGA A;  2JJ1 G;  1B3Q A;  3K0G A;  5LMN B;  4QPJ A;  1NU1 H;  3JAW B;  3SPH A;  3K06 A;  1HNX O;  3UM7 A;  4XDJ A;  2OIG A;  5JVD B;  1K5S A;  2IH1 C;  3S3W A;  5KHK A;  4NTX A;  3IAY A;  1AB3 A;  3DXR B;  4X1Y B;  3FAV A;  2ZT9 B;  2Q73 A;  4ZHQ B;  5KUK A;  3H1L H;  3L72 H;  2F95 B;  3CXC U;  3OUF A;  2QM4 A;  5EIB D;  5J9P C;  2WA4 A;  4MVQ A;  5K1X A;  4RO2 A;  1VF6 C;  4FLT A;  1VF6 A;  4PI2 A;  3OW2 U;  4F6R B;  5CA3 A;  3CCJ V;  1EN4 A;  3T2M A;  2FTK A;  2X6B A;  2YI8 A;  3RYF B;  3K58 A;  5LP6 B;  1Q81 W;  1GRJ A;  4IIJ A;  2ZNI A;  3ETE A;  4X9Q A;  3VQV A;  3BA8 A;  1IDS A;  2NN4 A;  1EN5 A;  4ZKI A;  1VQP V;  1S3J A;  5EZY B;  3L74 H;  1KYO F;  1NVP D;  1Q8I A;  4UXN A;  3K04 A;  3O65 A;  4QE7 A;  4MW3 A;  4LF4 O;  3ASN B;  4GYC B;  2E3C A;  3G71 V;  1RP3 B;  4D6T H;  4NYK A;  2RQ6 A;  5L3B A;  3ZS8 C;  1I7F A;  4MSW C;  2A79 B;  4PA6 A;  3THO A;  4UUJ C;  1PNM A;  1Q7Y W;  4BIO A;  1FXK B;  2CTR A;  1DF5 A;  1Y76 B;  3AK1 A;  4FJC C;  3HKB B;  5B1A B;  5H2F Z;  4HZ3 A;  4DR3 B;  1BHA A;  4NKG B;  1OCR B;  3MHH C;  2NR5 A;  1NI8 A;  3DC6 A;  4IT5 A;  2R70 A;  4PV1 B;  3AK3 A;  4MT8 A;  5JJE B;  1SQF A;  4X20 B;  2AHZ A;  3SPC A;  4FLY A;  4IYI A;  4UCV A;  4Z2W A;  1FFX A;  2UXB B;  3E86 A;  4JI1 O;  3AG3 C;  2BTQ B;  3QNE A;  4GUN A;  2WLH A;  3AG1 B;  2LGW A;  3UO3 A;  2QWN B;  4YY3 O;  1G8M A;  3JAL B;  3SYQ A;  3IC9 A;  2HFE C;  5J2U B;  3F7Y C;  1VQM V;  2ZCE A;  5BR8 B;  4DV2 B;  1I94 O;  3ICX A;  5IT9 N;  2D3O W;  2XND G;  2ZE6 A;  3D36 C;  4BW5 A;  3KZI Z;  1N32 B;  3RVY A;  1NR7 A;  3UCS C;  1VF7 A;  2ADP A;  1SZX A;  1YF2 A;  5IE9 A;  1KMI Z;  4R8C A;  4GX0 A;  4O4H B;  2QKA A;  1GM8 A;  4JI5 B;  3L70 H;  2FYU H;  4CS4 A;  2ZDI A;  1AI5 A;  1LUV A;  4NTW A;  2OIE A;  1QVG U;  2CTQ A;  4HBN A;  1E1R G;  1LR1 A;  3ABK B;  2LW1 A;  5B3S C;  5H6Q A;  4RWU A;  3APQ A;  3JYC A;  4QGP A;  1R73 A;  3ABL C;  2YXH A;  4ZOL A;  1OCC B;  3GB7 C;  4FLW A;  4NVP A;  4G27 B;  5LHI A;  4UVC A;  2AXT Z;  3BCC H;  2QJ1 A;  3ZED A;  1QCE A;  4GLX A;  2QWO B;  4F6E A;  1K92 A;  4CH4 A;  3M99 B;  1DF4 A;  1GN6 A;  2Q5Z A;  1Y6X A;  1XOU A;  1K97 A;  3CSX A;  4CH5 A;  3AEI A;  4LF6 B;  3T4Z A;  1MSD A;  2AZ0 A;  4O4I A;  3TGU H;  4UCS A;  3UQ8 A;  2YI9 A;  1SA0 A;  1AIL A;  1N34 B;  1SQQ H;  4O2B B;  5KX5 A;  1HW7 A;  2CGN A;  4LH6 A;  5IYB O;  3X2Q B;  2F4V B;  2QDO A;  3N2G B;  4DR2 O;  2BCC H;  5JQG A;  3P3N A;  4CS3 A;  1FAF A;  2GV9 A;  5KA6 A;  2QM8 A;  1ZTE A;  4HNA B;  4LF8 B;  3P32 A;  1W0K G;  1ARO P;  3OFN G;  2ODM A;  3ASO C;  5JH7 A;  3QG5 A;  3A0H Z;  4H13 B;  4B7K A;  2E75 B;  1KKD A;  1XNR B;  4K8X A;  1PL4 A;  5H5N A;  4DV6 B;  4UCO A;  3RWR D;  4I7Z B;  3FYE B;  2WLJ A;  3JD2 A;  2EIM B;  3S3X A;  5LGN A;  4OX9 O;  1K4D C;  5IY5 C;  2DQ0 A;  5EIB C;  4PJ0 Z;  1S5J A;  1CPY A;  2ZM6 B;  1BGY H;  4KXR A;  1N33 O;  3EVK A;  2Q67 A;  4B3R B;  4I50 B;  4NXM O;  5HFM A;  3CRA A;  4LF7 O;  3QTC A;  1AR5 A;  1JOY A;  3H01 A;  3G6B A;  1AP5 A;  5IYZ B;  1EN6 A;  4A5U B;  3CRQ A;  3HPL C;  4RUF A;  3SYC A;  1Y67 A;  5L3F A;  3E8G A;  5LA6 B;  1AI7 A;  2JGU A;  2PYJ A;  1H2K A;  2KKW A;  1FD9 A;  4L8J A;  5GON A;  1V54 B;  4IHJ B;  4JYB A;  5ITZ B;  4TUY B;  5KAI Z;  3ML0 A;  2VQE B;  2JK5 C;  1XMO B;  1OHH G;  3SJA C;  3H1I H;  3SR2 C;  1SER A;  1WLE A;  1GN2 A;  4ZOL B;  2PYL A;  1I5X A;  2W6I G;  2Z0A A;  1NR1 A;  3SJC C;  4DO2 A;  5H6R A;  2HLD G;  4JYA O;  2V1D A;  4JAU A;  5LOV A;  2OCC C;  1FJG O;  2EZO A;  2WLL A;  2HP8 A;  4JI0 B;  2ZE5 A;  1ZLZ A;  4C7U A;  4JGS A;  1Q90 D;  2DJV A;  3RYI B;  1AVM A;  1V55 C;  3D3Q A;  4DV5 O;  1BS3 A;  4UVB A;  4J9Y B;  2CE4 A;  5F2V O;  4LFC B;  5KMG A;  1SA0 B;  5KX5 B;  2DYS B;  2XTA A;  2MW2 B;  4DK1 A;  5LL6 Y;  5FPO A;  2ZR2 A;  1EM1 A;  2B1G A;  2OYQ A;  1HR0 O;  4I4T A;  3GWO A;  1RM1 B;  4H44 B;  5CA0 A;  5AG2 A;  5JH7 B;  2ZKO A;  2IM9 A;  2UXD O;  2LO1 A;  4O4J A;  5DEC A;  5E1A C;  4WF9 V;  3ABM B;  1QR9 A;  4FK5 C;  5C8Y A;  2KG7 A;  2CAZ C;  2P4K A;  4MTX A;  3Q4H A;  2QEX V;  4MVM A;  1R3K C;  5B1B C;  2JS3 A;  3ZRW A;  5JCO A;  4MVS A;  3ZJZ A;  1M57 C;  1S5L Z;  2BSK A;  5IJ9 B;  4I0X A;  4MTF A;  3B2E E;  4FZ1 A;  1XL6 A;  5GW7 A;  1QQC A;  1Y66 A;  2X6C A;  1OJH A;  3CJH B;  4EB6 B;  1CEZ A;  4L87 A;  1JA8 A;  3CPW U;  3AG2 B;  2DYR C;  3P30 A;  2ZE7 A;  2QWQ B;  1S0V A;  4J7Z A;  3W7T A;  5JJN B;  2A0L A;  2YDE A;  5LYJ A;  4JV5 O;  4YXW G;  4UFZ A;  4B3S B;  5BMV A;  3B4S A;  4DK0 A;  3H1J H;  1W59 A;  5LHG A;  1H2S B;  4PA9 A;  3U11 A;  1OCZ C;  3OMN B;  1XDC A;  3LDD A;  3IGA C;  3OUS A;  3JAT B;  3ZHV A;  2YC0 A;  2VS0 A;  1PNL A;  1TVK A;  2N04 A;  4PHZ A;  2P7T C;  4YJ2 B;  3G6E V;  4DR7 O;  2XAQ A;  1DTO A;  3T4D A;  4X65 O;  4B3M B;  2X7R B;  4P2Z A;  1KBH A;  1Q3E A;  5IWA O;  1GKF A;  4U3J A;  3CME V;  3VQY A;  3AG4 B;  4X66 O;  4JI8 O;  4FM1 A;  3NR7 A;  5L3G A;  3TXS A;  2UXC B;  1KC8 W;  5LP6 C;  4I9W A;  2R9R B;  1K3E A;  4LF5 O;  5B1N A;  3ZIA G;  1WPX A;  4B3T B;  1AR1 B;  5CB4 B;  3RT3 C;  1O9H A;  1J95 A;  1XMQ O;  1JJO A;  3ZHR A;  2RNB A;  1WA8 B;  5B1O A;  3BVO A;  2ARH A;  5IYD O;  3ASN C;  2WLI B;  1MZE A;  2XT9 A;  1FKA O;  3OTO O;  1AI4 A;  1GN3 A;  4O2A A;  1YHQ V;  1XUQ A;  4ABM A;  4DW0 A;  4MVZ A;  2V4D A;  3LDC A;  1PPJ H;  1PP9 H;  1FXK C;  3J7A U;  3K79 A;  2GTA A;  3Q4H B;  4O4L A;  3E22 A;  1GTO A;  2QM7 A;  2EZP A;  3ZRW B;  4CC5 A;  1OCR C;  5K1P A;  4RQE A;  1FFT B;  1N36 O;  2YEV B;  2BSK B;  4JTA B;  2L35 A;  4KHP B;  4JTD B;  3HB3 B;  2UXN A;  2IH3 C;  3DSQ A;  4QPK A;  1JMK C;  2DMX A;  1TAE A;  1KB9 F;  2UUC B;  2JIZ G;  1T5E A;  2YIB D;  3RBZ A;  1PNK A;  4I9Q A;  2VQF O;  4AQY B;  4QNH B;  3OGC C;  3FFQ A;  1J5E O;  3OMI B;  4W4L A;  1OCO B;  5CN0 A;  5BMV B;  4JI7 O;  1HNW O;  3ZHU A;  3MD0 A;  2Q0A A;  3D3I A;  2E5L O;  5FNV A;  5A9G A;  3ETQ A;  1MMM A;  4DUZ O;  3OEH G;  2EX3 A;  4LFA B;  5J2T B;  4JTC B;  4PD4 F;  2QA4 V;  3HR0 A;  2Y0P A;  5LMU O;  2BE3 A;  2FML A;  1YIJ V;  3OT7 A;  1FYJ A;  1TA8 A;  3BPZ A;  4DR2 B;  5CBG A;  3F5W C;  3K9A A;  4LP8 A;  4TT3 G;  3WB0 A;  1F4N A;  1IBL B;  3CHX A;  1GK9 A;  1URF A;  2P6J A;  1TUB A;  3SJQ C;  2Q68 A;  2ATK C;  2ZR3 A;  4KP4 A;  3ABK C;  1DK1 A;  1BQZ A;  4UV8 A;  2WLM A;  1EBO A;  5KHI A;  4QJF B;  2BOB C;  1K8A W;  4LF9 O;  1OCC C;  4MTG A;  2LGQ A;  2PUS A;  2HVK C;  2JRI A;  3UT5 B;  2CGO A;  1SRY A;  2B9Z A;  4J80 A;  5B5E Z;  1WAZ A;  3UKM A;  2F93 B;  4OX9 B;  4PDM A;  5C93 A;  5B66 Z;  2EIK B;  2XOK G;  4U7N A;  1U97 A;  3FD9 A;  1RPR A;  1K4C C;  4YJ3 A;  1N33 B;  1NZ6 A;  5H9C A;  4HYO A;  4NXM B;  4GZR B;  1JFF B;  1M90 W;  4LF7 B;  4DW1 A;  4PA4 A;  3E22 B;  3CE2 A;  1WP8 A;  1XHX A;  2K1E A;  2ZXW C;  4FLX A;  4MS2 A;  1F4M A;  3O9O A;  4JZG A;  4MVO A;  1S77 D;  4X1I A;  1KQS U;  3JAK A;  4JAA A;  4D7S A;  2UXX A;  1WPB A;  3B09 A;  1BQ0 A;  2EIJ B;  2JEU A;  3CCE V;  2P5O A;  3IFX A;  3I5D A;  2QTO A;  3LSU A;  3LSS A;  4RAI A;  3K5L A;  2E76 B;  4LNU A;  2OT5 A;  1QNM A;  3OAA G;  1Q6H A;  3D36 A;  3VBB A;  4DR1 O;  4GKK O;  1HNZ O;  4JYA B;  2EIM C;  3T1H O;  1B6Q A;  1MA1 A;  3FAV B;  4JI6 O;  1SS3 A;  1UJW B;  1KKC A;  4FZ0 A;  2R72 A;  2Q4P A;  2UUB O;  4DV1 O;  4JI4 O;  2YIA A;  1ROP A;  2A9H A;  1Q5O A;  2XAG A;  2WPD G;  2XAS A;  2DW4 A;  3N2K A;  4FMT A;  4KFM A;  4JF3 A;  4OPA A;  1S76 D;  3CD6 V;  1F23 A;  1VMG A;  2KQX A;  5EBW C;  4X64 B;  4IIJ B;  1D2D A;  4JI2 B;  1OV9 A;  3J81 N;  1VQK V;  3EHB B;  4X88 A;  2BOC C;  1VAR A;  4DV4 B;  1HR0 B;  2LJ2 A;  1V54 C;  4FLZ A;  4DRX A;  5KUM A;  1CP9 A;  5EC2 C;  2BTO A;  3RW0 A;  5LGU A;  1GAX A;  4ZIB A;  1XNQ B;  3SJB C;  1VQ9 V;  1RSO A;  1YJN V;  4TQF A;  3K9S A;  3LNM B;  1YIT V;  4YHH O;  3N27 A;  1P7B A;  1ZAU A;  2DOS A;  1IBK B;  1AP6 A;  3RYH A;  4DV0 O;  1WB7 A;  1NKD A;  3OD4 A;  4YJ3 B;  1KP2 A;  2JGD A;  2OCH A;  4F4L A;  3E8F A;  2FL4 A;  3F7V C;  1YXB A;  4JAS A;  3HKE A;  3K59 A;  2K9P A;  2YIC A;  4FFB A;  2LFR A;  5EK0 A;  1FFX B;  4LWS A;  4J42 A;  2WWW A;  4NTY A;  3AG3 B;  1I5Y A;  4NB5 A;  2LQT A;  2FKX A;  1FS0 G;  1AR4 A;  1VIB A;  3C3T A;  1OZ0 A;  3JD1 A;  3WB2 A;  1RM1 C;  3JAS A;  1IUR A;  1R3L C;  4H37 A;  4JYC A;  4G28 B;  3BY6 A;  2GUZ A;  5IYC O;  1G4Y B;  4X62 B;  4DR6 B;  3ABM C;  1QR8 A;  2UU9 B;  3HKD A;  3QF7 A;  4BR6 A;  4XDL A;  1JJ2 U;  1K7D A;  3ETD A;  1US6 A;  1DLB A;  1V9P A;  3E2E A;  3JD4 A;  3MHS C;  1M56 C;  2ZIM A;  2V7Q G;  3PJS K;  1IZ3 A;  4ASU G;  3BAA A;  4WFA V;  3BHP A;  3ETG A;  4UB6 Z;  1K34 A;  1NT2 B;  2ZE8 A;  2RDC A;  4MVR A;  1WNS A;  4DR3 O;  5LXT A;  4BW9 A;  1P84 F;  4GKJ B;  2IU3 A;  4WBN A;  1IBM B;  1YSC A;  1SES A;  1S5H C;  4LF5 B;  3AG2 C;  3ZMU A;  1K73 W;  4P9P A;  1EZJ A;  1UFI A;  2UXB O;  5B3S B;  1XMQ B;  4PDV A;  4EFE A;  4EKW A;  2Y4T A;  1H2G A;  3SYA A;  3B40 A;  1VP7 A;  5D5P A;  2DE0 X;  4DRX B;  3K5N A;  1S72 V;  4DV2 O;  4XDK A;  4RQF A;  4IL6 Z;  2DN9 A;  3QO8 A;  5EBL C;  3CYO A;  2ZIO A;  2XAH A;  1SQX H;  3ZMZ A;  2HKO A;  4FPP A;  1M5I A;  1SQV H;  1N32 O;  3ZCC A;  3CCQ V;  1RSO B;  4B08 A;  2W6J G;  1NTM H;  3T1Y B;  4O4I B;  2Q8V A;  1BT8 A;  1P4R A;  1PKX A;  2PTM A;  1IX9 A;  1Q6I A;  4JI5 O;  3RYC A;  3AG4 C;  1ZL8 A;  1QHT A;  1D5A A;  2YXY A;  3WB1 A;  5JQG B;  1H8E G;  2JGD B;  4PA7 A;  1IVS A;  4WFE A;  4I55 A;  3M7M X;  2Q6A A;  1HNX B;  1ORQ C;  4ZI7 A;  4NXN O;  3ZRX A;  3CCS V;  4FFB B;  5KHG A;  3W7W A;  3OE7 G;  4N21 A;  2JJ2 G;  4CS2 A;  1QBZ A;  4U3F H;  5CA1 A;  3LUT B;  4OGQ B;  5E79 Z;  4YIP A;  5FPR A;  2E5L B;  2Z3Y A;  3SYO A;  2GUZ B;  2XAF A;  4DUZ B;  2MK3 A;  4DUY O;  1WN7 A;  5L3C A;  1K33 A;  1RPO A;  3CC4 V;  4UCT A;  3AK2 A;  1Q43 A;  4LF6 O;  4X89 A;  2PY5 A;  2EIL B;  5LMU B;  1IXB A;  4R7C A;  2VWK A;  1IXM A;  1FXH A;  1PM9 A;  4J7K A;  1P7G A;  3B8N A;  4MVU A;  3BA9 A;  1BCC H;  1JQ0 A;  1MSW D;  1YDX A;  3G4S V;  3CXH F;  3STL C;  2Y48 A;  1AJQ A;  2F1M A;  2NLJ C;  1K5Q A;  2DWD C;  1D5N A;  5DM6 V;  2F4V O;  3ZRV A;  4LF4 B;  3JAW A;  2WSS G;  2G38 A;  3VQW A;  1YTF B;  2A3Q A;  5GON B;  3K03 A;  4LF8 O;  4LF9 B;  4K0K O;  2WA3 A;  1BHB A;  1SKV A;  3E89 A;  4K8Z A;  1THZ A;  3L9D A;  5JVD A;  3HKC A;  4WFG A;  4DV7 O;  2EIN B;  3CC7 V;  2Y4U A;  5KA5 A;  3DXR A;  3RVZ A;  3H1K H;  1XNR O;  3FKS G;  2N05 A;  3FYI B;  5KHJ A;  4DV6 O;  4B7E A;  1OCO C;  5BXZ A;  4WFB V;  1E1Q G;  1TGO A;  5LOV B;  1R6T A;  2WLL B;  2GSM B;  4NR1 A;  1JX9 A;  2F43 G;  1YZB A;  1VQ4 V;  4J9Z B;  1M93 A;  4F6R A;  5EYP A;  2OTL V;  4FM2 A;  1R1B A;  1FXV A;  2N74 A;  3W7S A;  1VQ8 V;  4FFK A;  3U0Z A;  3VQX A;  3B77 A;  3OEE G;  2JS5 A;  4JI1 B;  5CMU A;  3RYF A;  5LP6 A;  4B3R O;  2QGN A;  1XHZ A;  5KMG B;  3K5M A;  4LFB O;  4K3A A;  1CXZ B;  1ZL8 B;  4YY3 B;  1DGS A;  5EZY A;  3MAQ A;  3KCX A;  1NH2 B;  4I55 B;  3M8A A;  3OM3 B;  4BIU A;  1I94 B;  4R50 A;  4IYH A;  1GM7 A;  4UCR A;  4JI3 O;  1VQ6 V;  1LUW A;  2PF4 E;  1N0J A;  4I4T B;  2EUL A;  2Q69 A;  5CA0 B;  4W4K A;  2Q0O C;  4DR1 B;  2P22 C;  1KEC A;  4E4E A;  4O4J B;  3T1H B;  2VQE O;  5IJ0 A;  1NQT A;  1XMO O;  4MTO A;  5C8Y B;  2KG7 B;  2HR3 A;  1FXK A;  1Y76 A;  5KAF Z;  4X8A A;  1SQG A;  3CRC A;  4H33 A;  5B1A C;  2EIK C;  3HKB A;  3R66 A;  4DV1 B;  4JI4 B;  2FB5 A;  4JI0 O;  3D8C A;  1XI1 A;  3K08 A;  3BEH A;  4I0X B;  2XHB A;  2LFS A;  4FLU A;  3CC2 V;  3ZRS A;  2F23 A;  4X20 A;  4ICG A;  1R6N A;  2IJJ A;  1AJP A;  2IJI A;  4D7T A;  1L0L H;  4LBE C;  2BTQ A;  2C2A A;  2HHH O;  1N4C A;  3AG1 C;  1X59 A;  2DYR B;  3FX7 A;  3CRR A;  3ZMS A;  1H2L A;  3CS5 A;  1Z2G A;  2EIJ C;  5LYJ B;  3LDE A;  3JAL A;  3CCM V;  5J2U A;  3A8T A;  1R3I C;  3H9V A;  4JZ2 A;  3CCU V;  2Y69 B;  3ZN1 A;  5D5Q A;  1XBL A;  3HKC B;  3TCU A;  3CCR V;  2ZD9 A;  1OCZ B;  5IDJ A;  2O57 A;  2ETN A;  4YHH B;  1TVK B;  3G67 A;  4O4H A;  5TIS Z;  4CC6 A;  2EBO A;  3ZBH A;  2GHY A;  3ZMV A;  4DV0 B;  1G1X B;  2UUA O;  4AHC A;  2A06 H;  1HWY A;  5EBM C;  3FB6 C;  4U3J B;  4Z1V A;  3TXQ A;  3TET A;  5EYP B;  2B5U A;  2Q7H A;  3APO A;  2RN9 A;  1QLE B;  2X6A A;  3ZHQ A;  3CCL V;  4GX1 A;  4I5S A;  5LHH A;  3H1H H;  4Q20 A;  4CBC A;  1EFR G;  2D2C B;  4TV9 A;  4DR5 O;  3OTF A;  3C90 A;  2DQ3 A;  2KB1 A;  5GTI Z;  2VRZ A;  3WG7 B;  4DV3 O;  3KCY A;  3I55 V;  1VQL V;  4TQD A;  2PI4 A;  1YTF D;  1GMG A;  2GDS A;  1H2M A;  1Q6U A;  2AZ2 A;  3TK1 A;  4TOI A;  4U7O A;  1E79 G;  3E83 A;  4B3S O;  1N0N A;  1HDJ A;  1KUQ A;  5BY1 A;  1AJN A;  4O2A B;  2QTS A;  1NJI W;  5IJ0 B;  4P30 A;  2ITD C;  3CMA V;  2H94 A;  4DR4 O;  4O4L B;  5JWP A;  3GVM A;  1BSM A;  2ADQ B;  2RCV A;  3ABT A;  4O2B A;  3LNN A;  3ZN0 A;  2QE7 G;  2Q7G A;  3E8B A;  3X2Q C;  3N2G A;  1JR9 A;  1XRE A;  4B3M O;  4IGG A;  2LP7 A;  3CB2 A;  1M9N A;  4HNA A;  2LW7 A;  5LBQ A;  2QWP B;  5KLV H;  2EJR A;  3L73 H;  4LCU C;  2UXC O;  2Z5U A;  1EZV H;  4UV9 A;  3ZHT A;  1R3J C;  4CH3 A;  1NH2 D;  4RUE A;  4B3T O;  4CZZ A;  2HJF C;  1YCI A;  2QKS A;  1FJG B;  4UCU A;  3E35 A;  1NBM G;  4MW8 A;  2AW9 A;  1BMF G;  2Q7E A;  3L71 H;  1NS1 A;  1SC5 B;  4DV5 B;  4J7J A;  4LC1 A;  1L1F A;  4P9O A;  5FNV B;  1SF9 A;  4I50 A;  4Q6G A;  3JSL A;  4H0L B;  1H38 A;  1GN4 A;  4J10 A;  5IYZ A;  2YSU B;  2XAJ A;  1BZK A;  3CWB H;  2ZDI C;  3OR7 C;  1KP3 A;  3OMA B;  5LA6 A;  3A0R A;  5CBH A;  3I56 V;  4OPH A;  2DWE C;  3U10 A;  3CRM A;  5GTH Z;  4NXN B;  3KG2 A;  4KHP O;  5LMN O;  4IHJ A;  2OWO A;  1TUB B;  5ITZ A;  2UXD B;  4CH6 A;  4TUY A;  2A7W A;  1K9M W;  4UB8 Z;  3STZ C;  2UUC O;  4TV9 B;  4KL1 A;  3JD3 A;  4N23 A;  1Z5V A;  1LNQ A;  3LSQ A;  2OTJ V;  2CUG A;  2H3O A;  3J80 N;  4AQY O;  2Q9L A;  1MNG A;  1VQ5 V;  5L3E A;  2P4V A;  3RYI A;  4G2K A;  3WU2 Z;  2JDI G;  1VQO V;  4XBF A;  3QO7 A;  1XQ8 A;  4FVM A;  1UPG A;  4DUY B;  5DED A;  4E2L A;  1Q86 W;  1Y74 A;  3E8H A;  2W0F C;  1NTK H;  2ILM A;  2ITC C;  2ZIN A;  1YI2 V;  1XEQ A;  4FIP C;  4HAM A;  5KHH A;  2QWR B;  1W2B U;  3KKY A;  4LH7 A;  3SYP A;  4LFA O;  2QR4 A;  2CDY A;  2ZXW B;  3JSN A;  2DYS C;  3K0D A;  2B1I A;  2IBZ H;  3A2F A;  2NNU A;  2YIB A;  4X1I B;  2YS8 A;  3JAK B;  4JV5 B;  2CK3 G;  1L0N H;  2M7W A;  5JJJ B; 
#chains in the Genus database with same CATH homology
 1FXK C;  1QBZ A;  2ZQM A;  3K79 A;  3LUT B;  4MT8 A;  2AHZ A;  3SPC A;  1GTO A;  2QM7 A;  2EZP A;  3ZRW B;  3W7U A;  1YJ9 V;  3E86 A;  2Z3Y A;  3AG3 C;  1OCR C;  3QNE A;  3SYO A;  4RQE A;  1FFT B;  5CBF A;  2WLH A;  3AG1 B;  2P67 A;  2XAF A;  2YEV B;  2MK3 A;  3DTU B;  4JTA B;  5L3C A;  1K33 A;  1RPO A;  5BZB A;  4JTD B;  3CC4 V;  1G8M A;  3SYQ A;  5LGT A;  2HFE C;  4X89 A;  3F7Y C;  3HB3 B;  3JCZ A;  2EIL B;  1VQM V;  2UXN A;  4R7C A;  3NXS A;  2IH3 C;  1IXM A;  4QPK A;  1FXH A;  3B8N A;  2D3O W;  2XND G;  4MVU A;  2JIZ G;  1JQ0 A;  1MSW D;  3RBZ A;  3G4S V;  1M1K W;  4BW5 A;  1PNK A;  3STL C;  2Y48 A;  3RVY A;  1AJQ A;  1NR7 A;  4QNH B;  2NLJ C;  1K5Q A;  4BIZ A;  3R65 A;  2DWD C;  5DM6 V;  4ZBM A;  3OGC C;  2EIL C;  4QIW F;  3ZRV A;  4R8C A;  4GX0 A;  2WSS G;  3OMI B;  1OCO B;  5CN0 A;  1YTF B;  4WCE V;  1GM8 A;  3K03 A;  2WAM A;  3FB7 C;  1BHB A;  1TUE B;  3MD0 A;  3D3I A;  3E89 A;  1THZ A;  4WFG A;  1XL4 A;  5HFL A;  2ZDI A;  5DN6 G;  1AI5 A;  2EIN B;  3ABL B;  3CC7 V;  5KA5 A;  3RVZ A;  5L3D A;  3FKS G;  3FYI B;  4WFF A;  1MG1 A;  4PEL A;  3OEH G;  1BL8 A;  1OCO C;  1COW G;  4WFB V;  1AI6 A;  1E1Q G;  4JTC B;  5FL7 G;  1QVG U;  2QA4 V;  2WLL B;  1E1R G;  2GSM B;  3ABK B;  5B3S C;  1YIJ V;  4JAV A;  1JX9 A;  2F43 G;  4GX2 A;  5H6Q A;  3JYC A;  1VQ4 V;  5CBG A;  1R73 A;  2EIN C;  3ABL C;  4J9Z B;  3F5W C;  3K9A A;  1OCC B;  3GB7 C;  4QE9 A;  4G27 B;  2OTL V;  1FXV A;  4LP8 A;  4TT3 G;  5LHI A;  3W7S A;  1F4N A;  1VQ8 V;  4UVC A;  1GK9 A;  3B77 A;  3OEE G;  3K3W A;  2P6J A;  3SJQ C;  2Q68 A;  2ATK C;  1QCE A;  4PDR A;  5CMU A;  2ZR3 A;  4KP4 A;  3ABK C;  1K92 A;  3M99 B;  1DF4 A;  4UV8 A;  2P90 A;  2WLM A;  1N8R W;  1EBO A;  4QJF B;  2BOB C;  1K8A W;  3OR6 C;  1OCC C;  4MTG A;  1K97 A;  3FB8 C;  2HVK C;  3AEI A;  3T4Z A;  1NH2 B;  1JCH A;  1SRY A;  1VQ7 V;  4BIU A;  3OM3 B;  3UKM A;  4R50 A;  1GM7 A;  3EFF K;  4PDM A;  5C93 A;  1VQ6 V;  2EIK B;  2Q69 A;  3ASO B;  2XOK G;  1PL0 A;  4U7N A;  2AHY A;  1KEC A;  5IYB O;  1RPR A;  1K4C C;  3X2Q B;  1NQT A;  5H9C A;  4MTO A;  4HYO A;  4GT1 A;  4Z1M G;  1M90 W;  2IJH A;  5KA6 A;  2HR3 A;  2QM8 A;  1FXK A;  1JPX A;  4X8A A;  4PA4 A;  3P32 A;  1W0K G;  1ARO P;  4H33 A;  5B1A C;  3OFN G;  1GM9 A;  2EIK C;  2WLI A;  2R9I A;  3ASO C;  2K1E A;  2ZXW C;  3ABU A;  4MS2 A;  1F4M A;  4MVO A;  1SZT A;  5IY5 B;  1S77 D;  1KQS U;  1KKD A;  2IW5 A;  3K08 A;  3BEH A;  2UXX A;  2LFS A;  1F51 A;  3SPG A;  3FYE B;  3CC2 V;  1H8H G;  1SET A;  3ZRS A;  4BAY A;  2WLJ A;  2EIJ B;  2JEU A;  2EIM B;  3JD2 A;  1R6K A;  3CCE V;  5LGN A;  3IFX A;  4WFH A;  1R6N A;  2IJJ A;  1M56 B;  1AJP A;  2IJI A;  2QTO A;  3LSS A;  4RAI A;  1K4D C;  1ZWI C;  2X0L A;  3B8M A;  4LBE C;  4PA3 A;  5IY5 C;  4TSF G;  2C2A A;  2DQ0 A;  3AG1 C;  2HVJ C;  2OT5 A;  2DYR B;  3OAA G;  1JVM A;  3D36 A;  4GX5 A;  3VBB A;  2YEV A;  3ZMS A;  2H8P C;  1CPY A;  2EIJ C;  2EIM C;  3LDE A;  1QVF U;  3CCM V;  2IU0 A;  1B6Q A;  2Q67 A;  1NVP B;  5HFM A;  1R3I C;  1UJW B;  1JOY A;  4KUM A;  3H01 A;  1W0J G;  3CCU V;  4PDL A;  3HPL C;  2Y69 B;  4RUF A;  3ZN1 A;  3SYC A;  2WLK A;  5L3F A;  1ROP A;  3E8G A;  2A9H A;  2ZD9 A;  3TCU A;  3CCR V;  3T1C A;  1AI7 A;  1OCZ B;  5IDJ A;  2XAG A;  2WPD G;  2XAS A;  2DW4 A;  4FMT A;  2EBO A;  4KFM A;  1V54 B;  2GHY A;  4JF3 A;  2OCC B;  4JYB A;  3ZMV A;  1S76 D;  3CD6 V;  2Y69 C;  1F23 A;  2IJK A;  3ML0 A;  5EBW C;  1MAB G;  2JK5 C;  1HWY A;  5EBM C;  3W7X A;  3FB5 C;  1OHH G;  1QLN A;  1SER A;  1V55 B;  2PI5 A;  1WLE A;  3FB6 C;  3SPI A;  1I5X A;  2W6I G;  3TET A;  1VQK V;  3EHB B;  2B5U A;  1NR1 A;  2BOC C;  4X88 A;  4DO2 A;  5H6R A;  2HLD G;  1GO3 F;  1V54 C;  2V1D A;  4JAU A;  1QLE B;  2OCC C;  2X6A A;  3WFV A;  2EZO A;  2WLL A;  3DGE A;  3JD0 A;  3CCL V;  4GX1 A;  4I5S A;  5KUM A;  1CP9 A;  5LHH A;  3E2E A;  4Q20 A;  4JGS A;  4OXS A;  5EC2 C;  1EFR G;  4CBC A;  1V55 C;  3CP1 A;  3RW0 A;  5LGU A;  4UVB A;  1VQN V;  2DQ3 A;  2KB1 A;  1VQ9 V;  3WG7 B;  1YJN V;  4J9Y B;  1ENV A;  3I55 V;  2HG5 C;  1VQL V;  2PI4 A;  1QLE C;  1YTF D;  3LNM B;  1GMG A;  1YIT V;  3TK1 A;  4U7O A;  1E79 G;  3E83 A;  1P7B A;  1Q82 W;  2DYS B;  1NKD A;  3WG7 C;  1AJN A;  3CCV V;  1KP2 A;  1NJI W;  4P30 A;  2ITD C;  4F4L A;  3E8F A;  3VOU A;  3CMA V;  2ZR2 A;  2B1G A;  3SPJ A;  3F7V C;  3IC7 A;  2H94 A;  4JAS A;  3GWO A;  4JPR A;  1RM1 B;  2JEX A;  5B1B B;  1Y4M A;  2LFR A;  3ABT A;  5EK0 A;  1YJW V;  4GCZ A;  3ZN0 A;  1MOF A;  2QE7 G;  3E8B A;  4DXW A;  4R6Z A;  2WWW A;  3X2Q C;  3AG3 B;  1I5Y A;  1M57 B;  1PD3 A;  5E1A C;  4WF9 V;  1FS0 G;  3ABM B;  1QR9 A;  4FK5 C;  2LP7 A;  1M9N A;  4TWK A;  4MTX A;  1OZ0 A;  3JD1 A;  2QEX V;  5LBQ A;  1KD1 W;  4MVM A;  1RM1 C;  1R3K C;  5B1B C;  3ZRW A;  1R3L C;  2EJR A;  4H37 A;  4JYC A;  4LCU C;  3QO5 A;  2Z5U A;  4G28 B;  4MVS A;  4UVA A;  5EC1 C;  3ZMT A;  3BY6 A;  4UV9 A;  3ZJZ A;  1M57 C;  5IYC O;  1G4Y B;  1R3J C;  2WLN A;  3ABM C;  1QR8 A;  1NH2 D;  4MTF A;  4RUE A;  4CZZ A;  4XDL A;  2HJF C;  2JJ1 G;  1JJ2 U;  1XL6 A;  5GW7 A;  1K7D A;  3ETD A;  1DLB A;  2QKS A;  3K0G A;  1Y66 A;  3E35 A;  1NBM G;  2X6C A;  3JD4 A;  4MW8 A;  3MHS C;  1M56 C;  4QPJ A;  1BMF G;  2V7Q G;  1CEZ A;  4L87 A;  3PJS K;  4ASU G;  4WFA V;  3CPW U;  3AG2 B;  3SPH A;  3K06 A;  3ETG A;  4LC1 A;  2DYR C;  3P30 A;  1K34 A;  1L1F A;  3UM7 A;  4XDJ A;  1S0V A;  4P9O A;  1K5S A;  2IH1 C;  4MVR A;  3W7T A;  2A0L A;  2IU3 A;  4YXW G;  1YSC A;  5KUK A;  1H38 A;  1SES A;  1S5H C;  3AG2 C;  3ZMU A;  1K73 W;  4P9P A;  1EZJ A;  3CXC U;  3OUF A;  2YSU B;  2XAJ A;  5LHG A;  2ZDI C;  5B3S B;  5J9P C;  4MVQ A;  3OR7 C;  4PA9 A;  1KP3 A;  4RO2 A;  4PDV A;  1OCZ C;  3OMA B;  3A0R A;  3OMN B;  3LDD A;  3IGA C;  5CBH A;  3OUS A;  3I56 V;  3OW2 U;  5CA3 A;  3CCJ V;  4EKW A;  3T2M A;  2FTK A;  1PNL A;  2DWE C;  2X6B A;  1H2G A;  3SYA A;  3KG2 A;  2P7T C;  3G6E V;  2XAQ A;  1DTO A;  3T4D A;  1K9M W;  1Q81 W;  1S72 V;  2X7R B;  4XDK A;  4P2Z A;  3STZ C;  4RQF A;  3ETE A;  1GKF A;  3CYO A;  3JD3 A;  3QO8 A;  2XAH A;  4N23 A;  5EBL C;  3ZMZ A;  3CME V;  3AG4 B;  2HKO A;  4FPP A;  4ZKI A;  1VQP V;  1LNQ A;  1S3J A;  3LSQ A;  3ZCC A;  5L3G A;  3CCQ V;  2OTJ V;  1NVP D;  2W6J G;  4UXN A;  1KC8 W;  1VQ5 V;  3K04 A;  5L3E A;  4QE7 A;  4MW3 A;  1P4R A;  2R9R B;  4I9W A;  3ASN B;  4G2K A;  1K3E A;  1PKX A;  3G71 V;  2JDI G;  5B1N A;  1WPX A;  3ZIA G;  1VQO V;  4XBF A;  3QO7 A;  1AR1 B;  3AG4 C;  4E2L A;  5L3B A;  1Q86 W;  3E8H A;  4MSW C;  2W0F C;  2A79 B;  1J95 A;  4PA6 A;  2ITC C;  1YI2 V;  1H8E G;  4FIP C;  4PA7 A;  1PNM A;  4HAM A;  4UUJ C;  4WFE A;  1Q7Y W;  5B1O A;  1FXK B;  1DF5 A;  2Q6A A;  5IYD O;  1W2B U;  3ASN C;  1ORQ C;  4FJC C;  3SYP A;  2WLI B;  5B1A B;  3ZRX A;  3CCS V;  2ZXW B;  4HZ3 A;  3W7W A;  2DYS C;  1AI4 A;  2B1I A;  3K0D A;  3OE7 G;  1BHA A;  2NNU A;  1OCR B;  1YHQ V;  3MHH C;  4N21 A;  4MVZ A;  2CK3 G;  2JJ2 G;  3LDC A;  2M7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...