1VQMV

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqmV00
1M90W 1K9MW 1VQNV 1Q86W 1QVGU 3CCEV 5DM6V 3CCQV 1QVFU 2OTLV 3OW2U 1YIJV 3I56V 1JJ2U 1VQLV 1VQOV 1VQ8V 1Q7YW 1YI2V 1M1KW 2OTJV 3CPWU 1K8AW 3G4SV 3CCLV 1N8RW 1KC8W 1Q81W 3CD6V 2QA4V 3CXCU 3CMEV 3CCUV 1YJNV 4WFAV 1Q82W 3CC4V 1KD1W 1VQ4V 1VQ6V 3G6EV 3CMAV 1VQPV 1K73W 1R73A 3G71V 1YJ9V 3CC7V 1VQKV 1KQSU 3CC2V 1VQ7V 3CCSV 1VQ9V 3CCVV 2QEXV 3I55V 1YHQV 3CCRV 4WCEV 3CCMV 1YITV 4WF9V 4WFBV 1S72V 1VQMV 3CCJV 2D3OW 1YJWV 1VQ5V 1W2BU 1NJIW
chains in the Genus database with same CATH superfamily
3AK3A 3K79A 2XNDG 2W6JG 3IGAC 5K1XA 3UQ8A 2QWPB 1L0LH 4LF4B 1N36O 1HNZB 2ARHA 5B1AB 3J7AU 2HR3A 3CMAV 3JAKB 4DUZO 4JV5B 4OPAA 4DK0A 4NXNB 1H2SB 2JEUA 1DK1A 5L3EA 3CCJV 3HKDA 1N34O 4HZ3A 1QCEA 4DR7B 1EZVH 1K97A 5IT9N 3WG7B 1SZTA 1J95A 1R73A 3GB7C 1M5IA 5KHHA 1AR4A 4FFBB 1H2MA 1I5YA 3JD0A 3QO8A 4XDKA 1KQSU 1H2LA 2CTQA 2H8PC 4RWUA 5FLXN 1NH2D 5IYZB 3OW2U 2R70A 4OGQB 2EBOA 5CB4B 3CD6V 2XAFA 1Y74B 3OEHG 5GTHZ 2QDOA 1TUBB 1ZLZA 4FPPA 4P9OA 1OCRC 5A2QN 2EX3A 1K3EA 1OCCB 3EFFK 3OM3B 1OCCC 4X88A 3CB2A 3RYIB 1XQ8A 3JAKA 4DUYB 1XMOB 4UCVA 3ZEDA 1R3JC 3CXHF 4I0XA 1Q7YW 2Q9LA 4LF7O 3BFRA 4FLWA 4TV9A 1SF9A 5H6QA 1CXZB 1RPRA 1WPXA 2F23A 3F5TA 4X1IA 1G6UA 1K4DC 2EZPA 1TAEA 1MMMA 5KMGB 5JWPA 4PV1B 1B3QA 1M93A 4JI4B 1YF2A 2JJ1G 3SJCC 2UXCO 1FXVA 2LP7A 2X7RB 1IBMB 2RCVA 1I94O 4J80A 5LHGA 4I7ZB 3OEEG 2YXYA 4NXMO 1Q6IA 1TUBA 4WFHA 2UUBO 1S77D 5EIBC 1VQOV 1JCHA 3LNNA 5GONA 3I5DA 2BE3A 1QU7A 1WPBA 3ZRWA 4X1YA 1HP8A 3AG7A 4G28B 1VEWA 1CP9A 2ZCEA 2FMLA 2PGGA 1O9GA 3B09A 3JAWB 2X6AA 1OCZB 3FYIB 2WLJA 1RSOA 2AW9A 4JI7O 2EULA 2LGQA 5B1OA 1SERA 3J81N 5KX5A 1L1FA 2YEVB 2JS3A 3N2KA 3CJHB 1FXKB 1VMGA 3OAAG 4TQFA 3ZMVA 4FLYA 5C8YA 1WN7A 3UM7A 4K8ZA 1TGOA 1W0JG 1XEQA 5LOVB 2NLJC 4GKJB 1BGYH 3ZHTA 4DV5B 1PL0A 5IJ9B 3JSNA 1FD9A 4UFZA 4ASUG 1GN3A 2K1EA 4TV8A 5LHHA 2ZE7A 1GRJA 1FXHA 2A0LA 5JQGA 4JTAB 4CS3A 3OUFA 2OIEA 4XBFA 3HKDB 5B3SC 1G4YB 3G4SV 3K59A 1I5XA 1AR1B 4F4LA 1HWYA 3BPZA 3VBBA 4O4JA 2JGDB 2JVDA 1H8HG 3BA9A 1S0VA 1MNGA 1FXKA 2N04A 1XREA 1BSMA 4KP4A 4UXNA 5IWAO 2KSDA 4X62B 2ZIMA 3ASOC 1Z5VA 2IU3A 3CC4V 3ZN1A 4B3RO 1VQ6V 3QF7A 3T1HB 4JI3B 1XNQO 5IJ9A 4UCRA 3CCMV 2IU0A 3X2QC 3CWBH 4OX9O 4NTXA 1Y74A 4O2BA 5IY5C 1LNQA 1YCIA 2M7WA 1BMFG 2EINC 2YIBA 4CH4A 2A06H 3ETDA 5JQGB 4PD4F 3ZRVA 5IE9A 3RWRD 4PJ0Z 2EIKB 5KHGA 3VQYA 2IM9A 2BSKA 2YXHA 3ZHRA 4LWSB 1QQCA 4UVCA 2JGDA 3CX5F 2HFEC 1PNMA 5FPRA 5CA1B 4FK5C 2DOSA 1IX9A 1SKVA 3ZHQA 2DE0X 3PN1A 2CGOA 2ZR2A 3SYPA 3RFRA 4JTDB 2PI5A 2GTSA 2ZM6B 3T4DA 4R8CA 4OPHA 2Y4UA 3RVYA 2XAJA 3ABKB 2RJZA 4E2LA 4FM0A 2RNBA 3JASA 5LL6Y 3L72H 3S3WA 4DUZB 4ZKIA 1TA8A 4PDVA 2IJKA 1ZUQA 1XUQA 2XT9A 2UXBB 2Z5UA 4X1YB 3K5OA 1Q86W 2PZSA 3JD3A 4I9WA 3SPHA 2Y69C 1U97A 1H2NA 1Z5WA 4P9PA 4YY3O 2V1DA 1WB8A 4ZHQA 5KAIZ 3HKEA 3D36C 4QGPA 3E8FA 4BW9A 5LMUB 4B3RB 1KD1W 3BVOA 3JCZA 1M57C 1VQ9V 4GX1A 1ZX3A 2V4DA 2CDYA 2BTQB 3SYQA 4PA3A 3G6BA 1J5EB 5JJNB 2PUSA 3JSLA 4NTWA 1Q8IA 1JFFA 5FL7G 3FB7C 3K04A 3OE7G 4GLXA 4J7ZA 4RQEA 3E22A 1ZWIC 1NU1H 2CTRA 3OFNG 1VF6C 3AG3B 1OJHA 5EBWC 4F6EA 2W0XA 1G8MA 2CE4A 4BWAA 1YHQV 3SYOA 1P84F 1ZL8B 4PA4A 1K5QA 1YSCA 1W59A 4FZ1A 3OTOB 4QE7A 5CBGA 2R9IA 2PY5A 5J9PC 1VQLV 1KU9A 1NKDA 4TUYA 4YHHO 4LF7B 2KG7A 1FPOA 2VWKA 3E86A 2DYSB 1XI1A 3DXRA 3JAMN 4DR4O 1N33B 3CCRV 1KMIZ 1N32O 4LFCO 2D3OW 2E5LB 3MAQA 1S3JA 3L71H 1QVGU 2Y48A 1FJGB 3ZJZA 1NZ6A 2HVJC 4JI6O 5J2TA 1VQ4V 4PDLA 1GN6A 4X64O 1BCCH 1K33A 2ZDIA 2WLLB 2CUGA 1NTZH 3OGIB 2EILC 5EZYA 4IYIA 3FB8C 4JF3A 4NXMB 1SA0B 4CBCA 5DM6V 4IIJA 1NR1A 4TQDA 3SDLA 3ZMTA 1ZL8A 1K34A 2B5UA 2KB1A 1XILA 4GX0A 2B1GA 5LMUO 3E8GA 5KLVH 3TXQA 4TUYB 1SZXA 4JZ2A 1EM1A 3I55V 2ODMA 4WCEV 2ZNJA 3IAYA 2F95B 1YJWV 3DXRB 1W2BU 3ZMUA 1EFRG 3OMAB 5BZBA 3B8MA 2Q5ZA 1OZ0A 3CS5A 1Q82W 5L3DA 4FFKA 4MVMA 4AQYO 3KZIZ 4DR6O 1R6TA 3P3PA 4MT8A 3RYHB 5EYPA 3K9AA 2AHYA 3ABLC 2UU9O 2UUAB 2LJ2A 3K58A 1BS3A 4B08A 2NN4A 1A32A 2JS5A 4GCZA 2UXDB 3CCLV 4U3JA 4ZI7B 2YI8A 2QWRB 4EFEA 1M56C 4LC1A 4MVSA 3JASB 3K3WA 1URFA 2VQFO 3KCXA 3MDSA 3UO2A 4DR1B 4LFCB 2FB5A 4LFBO 2EJ7A 2B1IA 4I50A 1BHAA 5TISZ 5CBFA 3CCEV 4AI8A 5E79Z 1Y66A 1PM9A 3LDDA 4R50A 3TETA 4WBNB 3CXCU 3K03A 3SPIA 4UV9A 4X20A 2P67A 1M57B 1PNLA 1F4NA 3RYCB 1SQXH 5BR8B 4GYCB 1AR5A 2CH7A 4LFAB 1F4MA 4JI5B 4JGSA 2O57A 1WAZA 3CCQV 1AROP 3EHBB 1N0NA 3SGIA 1SQBH 3HKBB 5JH7A 2Z0AA 5ITZA 1PNKA 3ZIAG 4WFAV 2HVKC 3K5NA 1RPOA 3K0GA 4J10A 4JYBA 2QJ1A 3M8AA 1H38A 4R6ZA 1B04A 1FFXA 1XNRO 2EIMC 2ZXWC 4CH3A 1OCOC 2ZINA 1AJNA 3RVZA 3JD2A 4BAYA 4UVAA 1Y67A 4P2ZA 3W7WA 2HJFC 1D5NA 4CZZA 1X59A 4L87A 2HHHO 1UFIA 3AEIA 4EKWA 5DECA 3VQWA 4RUEA 2EIMB 4TOIA 3BCCH 4JTCB 3OMIB 1QBZA 5LA6B 1YZBA 3FX7A 3STZC 4DR2O 3T2MA 3SR2C 4I55B 4EFBA 5J2UB 2CH7B 4FFBA 2UXDO 1M9NA 2XAGA 3RBZA 3TXSA 4LF8B 3P3NA 4DV1O 3THOA 2UUCB 3CC2V 1KP2A 1Y4MA 3STLC 2XAHA 5IYZA 2HLDG 2GDSA 4H44B 2QKAA 2DYRC 4LFBB 2GSMB 3VOUA 1FKAO 1HW7A 3DC6A 2WLLA 4MTXA 1W0KG 4YIPA 1AJPA 5CBHA 3L73H 4NR1A 1KB9F 1M4UA 4B3MO 1SA0A 2F4VO 3RYIA 3L9DA 2DWDC 2ZE8A 1GM8A 4KXRA 3E2EA 1NTKH 1V54C 2ATKC 4X9QA 2YUAA 2WLHA 2Q0OC 3TK1A 2ADQB 2E74B 5K1PA 4HBNA 1IDSA 4TV9B 2LW7A 1BHBA 4KL1A 2Q7GA 1YEWA 4LH7A 1D5AA 3HB3B 4RO2A 3JALB 4J9ZB 2P22C 1ROPA 5EC1C 4H33A 1AP6A 4DYLA 1N4CA 3FD9A 2Q67A 1R6NA 5LYJA 5CN0A 4PI0A 5KUKA 2EJRA 3QVNA 1IURA 4ICGA 4U3FH 4Z1VA 1IBKO 5JCOA 1Y6XA 2ZQMA 1WA8B 1IBLB 5EC2C 4CH6A 5EK0A 1YJ9V 3CCSV 4ZIBA 1IVSA 4DV4B 3HKCB 4GKKO 2P5OA 1GAXA 4AHCA 1ENVA 5GONB 1ZTEA 5KHKA 3JYCA 4GKJO 5JVDB 2GBOA 4JI1B 1MZEA 2BCCH 1MA1A 3OGCC 4YHHB 4I9QA 4BW5A 3LNMB 1KYOF 1VF5B 5L3CA 3CMEV 1HNXO 4J11A 1Q6UA 5CA0A 2Y0PA 1N33O 4TSFG 1OCRB 4NTYA 2PF4E 4WBNA 1VQMV 5LGUA 2YEVA 2Q4PA 2ITCC 2OIGA 5L3BA 2HG5C 1EBOA 2ZT9B 1MSDA 3APQA 4Q6GA 3RYCA 1FFTB 1AJQA 1SC5B 3C90A 1Q81W 4JI6B 1OCOB 4MTGA 3G80A 5LYJB 3G6EV 1EN4A 3IC7A 2LO1A 5JJJB 3ZHUA 1V54B 1FS0G 2OYQA 1LUVA 3AG2B 2ZR3A 1VQNV 3OR6C 4I4TB 3QO5A 4W4LA 2OTLV 3WB2A 1SQVH 5IJ0A 4X62O 3ZHSA 4X66B 2JIZG 2QKCA 4TV8B 1KP3A 5H5NA 1V55C 4FVMA 4LF9O 4PA6A 1Q5OA 3M7MX 1VF6A 3KKYA 3BABA 3P32A 4A5UB 4MSWC 3OUSA 3SJAC 4AILC 1S72V 2Z3YA 3JD1A 1AP5A 1JVMA 2BTOA 3W7XA 3UO3A 3E8BA 3D36A 4NYKA 5HFMA 2X0LA 3N2GA 3B2EE 4YXWG 1UPGA 2M6YA 3WFVA 4N21A 2E76B 3CC7V 1VQKV 2Y69B 5J2UA 3W7UA 2Q7HA 1YDXA 4LF5O 3GWOA 3FFQA 5CA3A 4LNUB 4CH5A 4JI1O 2Q68A 2CK3G 3F7VC 1QLNA 3CRMA 4NB5A 4H13B 4O4HA 2AGAA 2H3OA 2VS0A 3U11A 5KHIA 4NVPA 4QPJA 4JI0O 3UT5A 5IJ0B 2MK3A 2P06A 4Z2WA 2VQFB 3NXSA 2QM4A 2ZM6O 3CSXA 4KFMA 4MTOA 4X8AA 2HJDA 3O9OA 5A9GA 5E1AC 4FM2A 3CHXA 4X1KB 2JEXA 1N8RW 1R3LC 5KA5A 3RYFA 3K9SA 1BL8A 5LBQA 1IXMA 1IBMO 1PKXA 1R3KC 1G1XB 5CA1A 3T1CA 2DYSC 1BQZA 4RAIA 4JAVA 3UCSC 4X66O 1BZKA 1K8AW 1Q43A 2QWQB 4LP8A 2B9ZA 5LMNB 1P7BA 1QR8A 3FKSG 4ZBMA 1S76D 1XL6A 3RGBA 3H1HH 5CB4A 1WA8A 2PI4A 3D8CA 4DV0O 3QNEA 4JPRA 4OXSA 5KA6A 1XOUA 2QM8A 5D5PA 2UXNA 1ZAUA 1SQPH 3U0ZA 5KUMA 1M1KW 3SJBC 3CRRA 2YIBD 3H1JH 3E35A 2YICA 4GX5A 1GM7A 4K3AA 1TVKB 4X1KA 4DV3B 3ZX6A 2QEXV 3X2QB 3OTFA 4JYCA 2YIAA 3FB5C 1WNSA 2P90A 3RW0A 2W0FC 2F1MA 2AXTZ 1K7DA 3ZBHA 1NI8A 4N23A 1KC8W 4DV2B 4B3SB 1SETA 4JI0B 4YJ3B 4X65O 3ZRXA 4I0XB 2PYLA 3HR0A 3Q4HB 2FL4A 4MW3A 1FJGO 2DJVA 3I56V 4CC6A 1K4CC 2F93B 1EN6A 1N36B 4I4TA 1Q6HA 3ZMZA 2WA4A 2OCHA 2Q73A 4YJ2B 3P30A 4HNAB 5JCOC 2HP8A 2Y0IA 2YI9A 5KMGA 1V9PA 2N74A 2CAZC 2RQ6A 4FLUA 3C3SA 3AG2C 2KG7B 1AILA 4MVRA 1TVKA 4KUMA 3JAWA 4MVOA 3F7YC 2OTJV 4CS4A 2ETNA 3CRQA 1VIBA 3T1HO 3SPJA 3FAVB 4JI3O 4UVBA 5KX5B 1NBMG 1T5EA 3N2GB 1YITV 3JATB 1DGSA 4DV0B 3A0RA 1ORQC 5C8YB 2BOBC 2JK5C 4GUNA 3RN4A 4DR5B 5J2TB 1EZJA 4DR3B 1IBKB 4F6RA 2A7WA 3B77A 1FAFA 4RQFA 2ZKOA 3LSSA 3O65A 5EBLC 3DTUB 4QNHB 2VRZA 2BOCC 3ABKC 2LFRA 4IIJB 4O4HB 3ZCCA 4EB6B 1OCZC 3W7SA 1SQGA 2Y4TA 3WG7C 3W7TA 1YTFB 3CJHA 4R7CA 4W4KA 4IT5A 3R66A 1SRYA 4YJ2A 2N05A 4I5SA 1MG1A 3TGUH 1BQ0A 1IXBA 3AG4C 2Q69A 4QE9A 2P4VA 3T1YO 4JAUA 4JYYA 4B3SO 1LUWA 1HNXB 4MS2A 1IZ3A 3M99B 1VARA 1HR0B 1GH6A 2JDIG 5B1BC 5B1BB 3LDEA 3E89A 4UV8A 4D7SA 2KQXA 3ZRSA 1QLEC 1R3IC 4O4JB 1K9MW 3FB6C 2PTMA 3AG4B 1JJ2U 3B4SA 3QG5A 2F43G 2P7TC 2ZE5A 3LSUA 1NVPB 5IYCO 3KG2A 4F6RB 1I94B 3L74H 2JRIA 3OT7A 5BR8O 4LBEC 4L8JA 1U96A 3H1KH 3APOA 1ZSPA 2Q8VA 2ZDIC 1NR7A 4TT3G 3ABUA 2YXLA 3H01A 4O2BB 1US6A 2P4KA 1B06A 4LF9B 2VQEO 2ILMA 4KHPO 1SQQH 5B1NA 3CCVV 1MABG 5FNVA 1XNRB 2QM7A 3AK1A 1QNMA 1HNWO 1GK9A 2XOKG 4DR5O 1JR9A 4YIOA 1JA8A 1AI7A 1N0JA 1JQ0A 1OHHG 4DR3O 3WB1A 2OWOA 3B8NA 1GM9A 1D2DA 3CCUV 4QJFB 2HHHB 2WLMA 2XHBA 5L3GA 4J9YB 3CRCA 1SS3A 2KKWA 4LF5B 3RT3C 2AZ0A 3LUTB 4YJ3A 3ZN0A 1WP8A 4DV5O 2EILB 4UCTA 1FXKC 2BSKB 4LF8O 4MTFA 4DV1B 1VQPV 4BIUA 2UUCO 2X6BA 1AI5A 4DR4B 1XMQB 4LR3A 1JX9A 4UB8Z 3CE2A 4PHZA 1V55B 1DF5A 5BMVB 2E5LO 4IL6Z 2R9RB 2R9AA 2NR5A 1Z2GA 2ZXWB 4LF4O 1H2GA 1HNZO 3WU2Z 4B3MB 2CTPA 2F4VB 5B5EZ 4LF6O 3CEIA 2ZNIA 1S5JA 4B3TB 3HKEB 3K06A 4NXNO 2GV9A 3IC9A 3L70H 1DF4A 2WLNA 1VQ5V 2UXXA 3BRCA 3FAVA 5AG2A 4PDRA 1Q3EA 2AHZA 2BTQA 1X4TA 5B3SB 4G2KA 4U7OA 3G71V 2DWEC 4J7KA 1VQ7V 3AG3C 5FPOA 2QTSA 1EN5A 2Q0AA 3A0BZ 2QSAA 1FYJA 3OMNB 1BE3H 4OX9B 2ITDC 4JI8B 1HNWB 2IH1C 4UCOA 2QE7G 2H94A 2JGUA 2G38A 1BT8A 2FKXA 1JMKC 3A2FA 4FZ0A 1JOYA 4EB6A 1NVPD 3G67A 3K57A 5BMVA 3CP1A 2R72A 4GZRB 4O4IA 1H8EG 4JAAA 4MVZA 4O4LA 4QIWF 4AQYB 1VF7A 1JFFB 3MHSC 4GKKB 4D6TH 1XMOO 3E22B 5LP6C 3SYCA 3JALA 4WFFA 1I08A 3BY6A 1RM1B 1RM1C 1S5HC 1R6KA 1YTFD 4FLZA 1PV0A 1XMQO 4C7UA 4WFEA 2WAMA 1P4RA 3ZRWB 3LDCA 4FJCC 3FYEB 2IBZH 3BEHA 3DGEA 3WB0A 3J80N 5DN6G 4PA9A 2ADPA 1P49A 3GWKC 1SQFA 3QO7A 5LP6B 4K35A 1CPYA 1XDCA 3A0HZ 4O4LB 4WF9V 2UXBO 3DC5A 1UJWB 4JI5O 1JPXA 2E75B 4J7JA 3H1LH 1I7FA 1WJZA 1YXBA 2UUBB 4O2AA 2OT5A 5FNVB 1K5SA 2YIDA 1WLEA 4DV7B 2DYRB 2OCCC 3ABMC 5IYBO 1COWG 5LGNA 4E4EA 1WP7A 3BA8A 3K5MA 4X89A 3R65A 1RP3B 1J5EO 5L3FA 4JI7B 4JYAO 5IY5B 1GO3F 2HEPA 4DW1A 3ETEA 3ASNC 2QA4V 2XUMA 1Y76B 4DRXB 4MVUA 5KAFZ 3ABTA 3AG1B 3ZHVA 3ETGA 1NS1A 3BAAA 3ASOB 3ABLB 4FMTA 5IYDO 2LFSA 1E1RG 5DEDA 1H2KA 2ZD9A 4FLVA 4IGGA 5EYPB 1DTOA 3SPCA 1KBHA 4GX2A 2EZOA 3E8HA 1AI4A 3PJSK 3UKMA 1JJOA 4K8XA 2YSUB 2LQTA 5LHIA 1WB7A 4IHJA 3QTCA 3IJ4A 2QKSA 1GMGA 4HYOA 4P30A 4ZI7A 1XBLA 2XASA 4LCUC 3MHHC 1KUQA 4UCUA 3IFXA 4UCSA 4B7KA 4B7EA 4K0KB 3U10A 1K73W 4I50B 5ITZB 2NNUA 1AB3A 1F23A 4WFBV 4DRXA 1N34B 3GVMA 4Q20A 1L8DA 4G27B 4DR7O 4CC5A 5IWAB 1FFXB 4LWSA 2IJJA 5LMNO 2VQEB 3L75H 1GKFA 5GTIZ 2IW5A 1YVWA 1XNQB 4O4IB 3HKBA 5JH7B 2VWJA 3ETQA 1R1BA 5B1AC 3CYOA 4JYAB 4D7TA 1XHXA 4GT1A 4BIOA 4IHJB 1P7GA 1VQ8V 3OD4A 2GTAA 4BR6A 2GHYA 3E83A 5LA6A 4DK1A 1THZA 4DR6B 4NKGB 2XAQA 4JASA 2DN9A 4DV3O 3H9VA 5KHJA 2WLKA 1PD3A 1B6QA 1L0NH 2V7QG 3K5LA 1XL4A 3TCUA 2LW1A 4JZGA 1RFYA 2EIJC 4BIZA 4DV6B 2ZIOA 4DV2O 3JARB 4MVQA 2EIKC 2C2AA 4UB6Z 4ZHQB 3VQXA 4FM1A 4U7NA 4I55A 2IH3C 1NQTA 2E3CA 4DR1O 1MOFA 1LR1A 2W6IG 1KKDA 5LP6A 2FTKA 2GUZB 2A3QA 3ML0A 1YIJV 2CTWA 4JI4O 1OV9A 4EEQA 5EIBD 4K0KO 2WSSG 1F7YA 5LGTA 2UXCB 4O2AB 4LF6B 1SESA 4B3TO 2WA3A 2QGNA 3JD4A 4LFAO 2PYJA 2WWWA 3TJTA 4JI2O 3JCUZ 5H2FZ 1PPJH 2DQ3A 3D3QA 5GW7A 5B66Z 5LXTB 4YY3B 2K9PA 4J41A 4IYHA 3ASNB 1MZFA 4DO2A 3Q4HA 1NH2B 1Q90D 3B40A 3KCYA 1Y76A 3VQVA 3EVKA 4Z1MG 4JI8O 4FIPC 3SYAA 2JJ2G 3HKCA 2F66C 4PI2A 4HNAA 3ZS8C 5C93A 1VP7A 3EXAA 2DMXA 4DXWA 2GUZA 1S5LZ 4PELA 2QR4A 4XDJA 2P6JA 2MW2B 3A8TA 2AZ2A 2CGNA 1QLEB 1NTMH 4RUFA 2WPDG 2XTAA 1O9HA 3OTOO 4DR2B 4FLTA 3ABMB 4UUJC 4DW0A 2EIJB 5EZYB 2X6CA 4DV6O 1PL4A 1YI2V 4H37A 2YDEA 3AK2A 3T1YB 3C3TA 3T4ZA 3ICXA 3JATA 3OR7C 4XDLA 1HR0O 5JVDA 1M56B 2RN9A 5CMUA 5JJEB 5LXTA 5H9CA 5H6RA 2EINB 1GN2A 1GTOA 1N32B 1KKCA 2HKOA 4ZOLA 1QR9A 3MD0A 4TWKA 5EBMC 2A79B 4QPKA 1QVFU 5CA0B 4PDMA 1AVMA 5BY1A 3H1IH 4X1IB 4CS2A 2WLIB 4X64B 4MW8A 1TUEB 4JV5O 3CRAA 2QTOA 2FYUH 5D5QA 2YS8A 5HFLA 2Q7EA 2D2CB 4JI2B 2L35A 3SPGA 3K08A 3RYHA 3ZMSA 2QWNB 3CPWU 1E1QG 4DV7O 2L6LA 1YJNV 1XHZA 1QHTA 3SJQC 4KHPB 1E79G 4ABMA 4U3JB 3F5WC 3S3XA 2RMKB 1DLBA 3DSQA 1NJIW 1M90W 1CEZA 2ZE6A 4LH6A 2Q6AA 1KECA 1AI6A 3BHPA 5BXZA 2DW4A 4ZOLB 4LNUA 1IBLO 1NT2B 4WFGA 2IJIA 1RSOB 4HAMA 1HDJA 1MSWD 2QWOB 1F51A 4DV4O 5F2VO 3JARA 2WLIA 3NR7A 1GN4A 1K92A 2A9HA 4DUYO 3N2KB 4X20B 2UUAO 2OCCB 2UU9B 3UT5B 3LSQA 3K0DA 3HPLC 3D3IA 4PA7A 2LGWA 5IDJA 5LOVA 4H0LB 3AG1C 4X65B 2DQ0A 3N27A 2IJHA 3RYFB 2YC0A 2RDCA 4FLXA 4J42A 1PP9H 1I0HA
chains in the Genus database with same CATH topology
1S3JA 4KFMA 1QVGU 2Y48A 4FJCC 4MTOA 4X8AA 3K79A 3ZJZA 2XNDG 2W6JG 3FYEB 3IGAC 5E1AC 3BEHA 3DGEA 5DN6G 2JEXA 4PA9A 1N8RW 2HVJC 1R3LC 5KA5A 5B1AB 1BL8A 1VQ4V 2HR3A 4PDLA 3CMAV 5LBQA 3QO7A 1K33A 1IXMA 2ZDIA 2WLLB 1PKXA 2EILC 4WF9V 1CPYA 1R3KC 2JEUA 5L3EA 3CCJV 3FB8C 1UJWB 4JF3A 4HZ3A 3T1CA 1QCEA 2DYSC 1JPXA 4RAIA 4JAVA 4CBCA 5DM6V 1NR1A 3ZMTA 2OT5A 1K5SA 1WLEA 1K34A 1K8AW 1K97A 2B5UA 2KB1A 4GX0A 2DYRB 4LP8A 3WG7B 1SZTA 2B1GA 2OCCC 3E8GA 1P7BA 1QR8A 3ABMC 5IYBO 1J95A 1R73A 3GB7C 1COWG 5LGNA 3FKSG 4ZBMA 1S76D 1XL6A 1I5YA 3I55V 4WCEV 3JD0A 3QO8A 4X89A 2PI4A 3R65A 4XDKA 1YJWV 1W2BU 1KQSU 3QNEA 2H8PC 3ZMUA 1EFRG 4JPRA 4OXSA 5KA6A 5L3FA 2QM8A 2UXNA 1NH2D 5IY5B 3OMAB 3OW2U 1GO3F 5BZBA 5KUMA 3B8MA 1OZ0A 1M1KW 3ETEA 3ASNC 2EBOA 3CD6V 2QA4V 1Q82W 5L3DA 2XAFA 3E35A 4MVMA 4GX5A 1GM7A 4MVUA 3ABTA 3OEHG 3AG1B 2QEXV 3ETGA 4MT8A 3X2QB 4FPPA 4P9OA 1OCRC 3K9AA 4JYCA 2AHYA 1K3EA 3FB5C 3EFFK 3ASOB 1OCCB 1OCCC 3OM3B 4X88A 2P90A 3E2EA 3RW0A 2W0FC 3ABLC 3ABLB 1R3JC 1K7DA 4FMTA 5IYDO 2LFSA 1E1RG 4N23A 1Q7YW 4GCZA 3CCLV 2ZD9A 1KC8W 1DTOA 3SPCA 4GX2A 2EZOA 3E8HA 1SETA 1AI4A 3PJSK 3UKMA 1M56C 4LC1A 4MVSA 3ZRXA 2YSUB 3K3WA 5LHIA 5H6QA 1RPRA 1WPXA 2QKSA 1GMGA 4HYOA 4P30A 2B1IA 1BHAA 1K4DC 2EZPA 4MW3A 5CBFA 3CCEV 2XASA 4LCUC 3MHHC 3I56V 1K4CC 1Y66A 3IFXA 2JJ1G 3LDDA 4R50A 3TETA 3CXCU 3K03A 3ZMZA 3SPIA 1K73W 4UV9A 1FXVA 2LP7A 2X7RB 3P30A 2P67A 2NNUA 1F23A 1M57B 1PNLA 1F4NA 4WFBV 5LHGA 3AG2C 1F4MA 3OEEG 4JGSA 4Q20A 4MVRA 4WFHA 4G27B 1S77D 3CCQV 1AROP 3EHBB 4KUMA 1VQOV 4MVOA 3F7YC 1JCHA 1PNKA 2OTJV 3ZIAG 2IJJA 3ZRWA 4WFAV 2HVKC 1GKFA 1RPOA 3SPJA 3K0GA 4G28B 1CP9A 2IW5A 4JYBA 4UVBA 1NBMG 1H38A 1YITV 4R6ZA 2EIMC 2ZXWC 2X6AA 1OCZB 1OCOC 1ORQC 3A0RA 3FYIB 2WLJA 1AJNA 2BOBC 2JK5C 5B1AC 3RVZA 3CYOA 3JD2A 4GT1A 4UVAA 4BAYA 5B1OA 1EZJA 4P2ZA 3W7WA 1SERA 1VQ8V 2HJFC 4CZZA 3B77A 2YEVB 1L1FA 4L87A 2GHYA 4RQFA 3E83A 1FXKB 3LSSA 3OAAG 5EBLC 3DTUB 4QNHB 3ZMVA 1THZA 2BOCC 3AEIA 4EKWA 3UM7A 2XAQA 3ABKC 4JASA 2LFRA 4RUEA 1W0JG 2EIMB 1PD3A 2WLKA 3ZCCA 1B6QA 2V7QG 1OCZC 4JTCB 3OMIB 3W7SA 1XL4A 3TCUA 2NLJC 3WG7C 3W7TA 4R7CA 1YTFB 1QBZA 1SRYA 3STZC 3T2MA 4I5SA 1MG1A 2EIJC 3AG4C 2Q69A 4QE9A 4BIZA 1PL0A 1M9NA 2XAGA 4JAUA 3RBZA 4ASUG 4MS2A 4MVQA 3M99B 2K1EA 3CC2V 2EIKC 2C2AA 2JDIG 1KP2A 1Y4MA 3STLC 5B1BC 5B1BB 2XAHA 3LDEA 2HLDG 3E89A 4UV8A 4U7NA 2IH3C 5LHHA 2DYRC 1NQTA 3ZRSA 1QLEC 2GSMB 1MOFA 2W6IG 1FXHA 3VOUA 1R3IC 1KKDA 2A0LA 1K9MW 4JTAB 3OUFA 2FTKA 2WLLA 4MTXA 1W0KG 3FB6C 1AJPA 5CBHA 3ML0A 3AG4B 1YIJV 1JJ2U 4XBFA 5B3SC 3G4SV 1G4YB 2F43G 1I5XA 2P7TC 1AR1B 4F4LA 1NVPB 1HWYA 2WSSG 3VBBA 5LGTA 2DWDC 5IYCO 1GM8A 3KG2A 1SESA 1H8HG 1S0VA 1V54C 1FXKA 2ATKC 4LBEC 3JD4A 2WLHA 3TK1A 4KP4A 2WWWA 4UXNA 2DQ3A 2ZDIC 5GW7A 1NR7A 4TT3G 3ASOC 3ABUA 1BHBA 3H01A 3ASNB 4DO2A 2IU3A 3CC4V 3ZN1A 3HB3B 1VQ6V 4RO2A 1NH2B 4J9ZB 5B1NA 3CCVV 1ROPA 1MABG 5EC1C 3CCMV 4H33A 2IU0A 3X2QC 2QM7A 4Z1MG 2Q67A 1R6NA 1GK9A 2XOKG 4FIPC 3SYAA 2JJ2G 5IY5C 5CN0A 1AI7A 1LNQA 5KUKA 2EJRA 2M7WA 1BMFG 1JQ0A 2EINC 1OHHG 5C93A 3B8NA 3ETDA 1GM9A 2ZQMA 3ZRVA 3CCUV 5EC2C 4DXWA 4QJFB 2WLMA 4PELA 5EK0A 1YJ9V 5L3GA 4J9YB 3CCSV 2EIKB 4XDJA 2P6JA 1ENVA 4UVCA 1QLEB 3JYCA 2HFEC 4RUFA 2WPDG 3LUTB 3ZN0A 3ABMB 1PNMA 4UUJC 2EIJB 2X6CA 2EILB 1YI2V 3OGCC 4H37A 4BW5A 1FXKC 3LNMB 4FK5C 3T4ZA 5L3CA 3CMEV 4MTFA 3OR7C 4XDLA 1VQPV 4BIUA 1M56B 2X6BA 1AI5A 5CMUA 2ZR2A 4TSFG 5H9CA 5H6RA 1JX9A 1OCRB 3SYPA 2EINB 1GTOA 4JTDB 1V55B 1DF5A 1VQMV 5LGUA 2PI5A 3T4DA 2HKOA 4R8CA 2YEVA 1QR9A 3MD0A 4TWKA 5EBMC 2A79B 2R9RB 2ITCC 4QPKA 5L3BA 2HG5C 1QVFU 1EBOA 3RVYA 2XAJA 3ABKB 1FFTB 1AJQA 4E2LA 4PDMA 2ZXWB 1H2GA 1Q81W 1OCOB 4MTGA 2WLIB 3G6EV 3IC7A 4MW8A 1TUEB 4ZKIA 4PDVA 2QTOA 2IJKA 3K06A 1V54B 1FS0G 3AG2B 2ZR3A 5HFLA 1DF4A 2WLNA 1VQ5V 2UXXA 2Z5UA 1VQNV 1Q86W 3JD3A 3OR6C 4I9WA 3SPHA 3QO5A 4PDRA 2Y69C 3K08A 3SPGA 2AHZA 2OTLV 4P9PA 3ZMSA 5B3SB 2JIZG 3CPWU 2V1DA 1E1QG 1KP3A 4G2KA 1V55C 3E8FA 1YJNV 4U7OA 1KD1W 4PA6A 3G71V 2DWEC 3SJQC 1VQ7V 1E79G 3AG3C 3JCZA 1M57C 3P32A 1VQ9V 3OUSA 4GX1A 4MSWC 3F5WC 3SYQA 4PA3A 1S72V 1DLBA 2Z3YA 3JD1A 3OMNB 1NJIW 1M90W 1JVMA 1CEZA 3W7XA 2ITDC 3E8BA 3D36A 2IH1C 2QE7G 2H94A 2Q6AA 1KECA 1AI6A 1JOYA 1NVPD 5HFMA 2DW4A 5FL7G 3FB7C 2X0LA 3CP1A 3K04A 3OE7G 4RQEA 1H8EG 4MVZA 4YXWG 1ZWIC 3OFNG 4QIWF 4WFGA 3WFVA 4N21A 3AG3B 3CC7V 2IJIA 5EBWC 1VQKV 4HAMA 2Y69B 1G8MA 1MSWD 1F51A 1YHQV 3W7UA 3MHSC 3SYOA 3GWOA 4PA4A 2WLIA 1K5QA 1YSCA 1K92A 2A9HA 2OCCB 5CA3A 4QE7A 5CBGA 3SYCA 3LSQA 4WFFA 2R9IA 3K0DA 3HPLC 2Q68A 2CK3G 3BY6A 5J9PC 1NKDA 1VQLV 3D3IA 3F7VC 1QLNA 4PA7A 1RM1B 3E86A 1RM1C 1S5HC 1R6KA 2DYSB 5IDJA 1YTFD 3AG1C 4QPJA 2MK3A 2DQ0A 4WFEA 2WAMA 1P4RA 3CCRV 3NXSA 2IJHA 3ZRWB 2D3OW 3LDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 W;  1K9M W;  1VQN V;  1Q86 W;  1QVG U;  3CCE V;  5DM6 V;  3CCQ V;  1QVF U;  2OTL V;  3OW2 U;  1YIJ V;  3I56 V;  1JJ2 U;  1VQL V;  1VQO V;  1VQ8 V;  1Q7Y W;  1YI2 V;  1M1K W;  2OTJ V;  3CPW U;  1K8A W;  3G4S V;  3CCL V;  1N8R W;  1KC8 W;  1Q81 W;  3CD6 V;  2QA4 V;  3CXC U;  3CME V;  3CCU V;  1YJN V;  4WFA V;  1Q82 W;  3CC4 V;  1KD1 W;  1VQ4 V;  1VQ6 V;  3G6E V;  3CMA V;  1VQP V;  1K73 W;  1R73 A;  3G71 V;  1YJ9 V;  3CC7 V;  1VQK V;  1KQS U;  3CC2 V;  1VQ7 V;  3CCS V;  1VQ9 V;  3CCV V;  2QEX V;  3I55 V;  1YHQ V;  3CCR V;  4WCE V;  3CCM V;  1YIT V;  4WF9 V;  4WFB V;  1S72 V;  1VQM V;  3CCJ V;  2D3O W;  1YJW V;  1VQ5 V;  1W2B U;  1NJI W; 
#chains in the Genus database with same CATH topology
 3AK3 A;  3K79 A;  2XND G;  2W6J G;  3IGA C;  5K1X A;  3UQ8 A;  2QWP B;  1L0L H;  4LF4 B;  1N36 O;  1HNZ B;  2ARH A;  5B1A B;  3J7A U;  2HR3 A;  3CMA V;  3JAK B;  4DUZ O;  4JV5 B;  4OPA A;  4DK0 A;  4NXN B;  1H2S B;  2JEU A;  1DK1 A;  5L3E A;  3CCJ V;  3HKD A;  1N34 O;  4HZ3 A;  1QCE A;  4DR7 B;  1EZV H;  1K97 A;  5IT9 N;  3WG7 B;  1SZT A;  1J95 A;  1R73 A;  3GB7 C;  1M5I A;  5KHH A;  1AR4 A;  4FFB B;  1H2M A;  1I5Y A;  3JD0 A;  3QO8 A;  4XDK A;  1KQS U;  1H2L A;  2CTQ A;  2H8P C;  4RWU A;  5FLX N;  1NH2 D;  5IYZ B;  3OW2 U;  2R70 A;  4OGQ B;  2EBO A;  5CB4 B;  3CD6 V;  2XAF A;  1Y74 B;  3OEH G;  5GTH Z;  2QDO A;  1TUB B;  1ZLZ A;  4FPP A;  4P9O A;  1OCR C;  5A2Q N;  2EX3 A;  1K3E A;  1OCC B;  3EFF K;  3OM3 B;  1OCC C;  4X88 A;  3CB2 A;  3RYI B;  1XQ8 A;  3JAK A;  4DUY B;  1XMO B;  4UCV A;  3ZED A;  1R3J C;  3CXH F;  4I0X A;  1Q7Y W;  2Q9L A;  4LF7 O;  3BFR A;  4FLW A;  4TV9 A;  1SF9 A;  5H6Q A;  1CXZ B;  1RPR A;  1WPX A;  2F23 A;  3F5T A;  4X1I A;  1G6U A;  1K4D C;  2EZP A;  1TAE A;  1MMM A;  5KMG B;  5JWP A;  4PV1 B;  1B3Q A;  1M93 A;  4JI4 B;  1YF2 A;  2JJ1 G;  3SJC C;  2UXC O;  1FXV A;  2LP7 A;  2X7R B;  1IBM B;  2RCV A;  1I94 O;  4J80 A;  5LHG A;  4I7Z B;  3OEE G;  2YXY A;  4NXM O;  1Q6I A;  1TUB A;  4WFH A;  2UUB O;  1S77 D;  5EIB C;  1VQO V;  1JCH A;  3LNN A;  5GON A;  3I5D A;  2BE3 A;  1QU7 A;  1WPB A;  3ZRW A;  4X1Y A;  1HP8 A;  3AG7 A;  4G28 B;  1VEW A;  1CP9 A;  2ZCE A;  2FML A;  2PGG A;  1O9G A;  3B09 A;  3JAW B;  2X6A A;  1OCZ B;  3FYI B;  2WLJ A;  1RSO A;  2AW9 A;  4JI7 O;  2EUL A;  2LGQ A;  5B1O A;  1SER A;  3J81 N;  5KX5 A;  1L1F A;  2YEV B;  2JS3 A;  3N2K A;  3CJH B;  1FXK B;  1VMG A;  3OAA G;  4TQF A;  3ZMV A;  4FLY A;  5C8Y A;  1WN7 A;  3UM7 A;  4K8Z A;  1TGO A;  1W0J G;  1XEQ A;  5LOV B;  2NLJ C;  4GKJ B;  1BGY H;  3ZHT A;  4DV5 B;  1PL0 A;  5IJ9 B;  3JSN A;  1FD9 A;  4UFZ A;  4ASU G;  1GN3 A;  2K1E A;  4TV8 A;  5LHH A;  2ZE7 A;  1GRJ A;  1FXH A;  2A0L A;  5JQG A;  4JTA B;  4CS3 A;  3OUF A;  2OIE A;  4XBF A;  3HKD B;  5B3S C;  1G4Y B;  3G4S V;  3K59 A;  1I5X A;  1AR1 B;  4F4L A;  1HWY A;  3BPZ A;  3VBB A;  4O4J A;  2JGD B;  2JVD A;  1H8H G;  3BA9 A;  1S0V A;  1MNG A;  1FXK A;  2N04 A;  1XRE A;  1BSM A;  4KP4 A;  4UXN A;  5IWA O;  2KSD A;  4X62 B;  2ZIM A;  3ASO C;  1Z5V A;  2IU3 A;  3CC4 V;  3ZN1 A;  4B3R O;  1VQ6 V;  3QF7 A;  3T1H B;  4JI3 B;  1XNQ O;  5IJ9 A;  4UCR A;  3CCM V;  2IU0 A;  3X2Q C;  3CWB H;  4OX9 O;  4NTX A;  1Y74 A;  4O2B A;  5IY5 C;  1LNQ A;  1YCI A;  2M7W A;  1BMF G;  2EIN C;  2YIB A;  4CH4 A;  2A06 H;  3ETD A;  5JQG B;  4PD4 F;  3ZRV A;  5IE9 A;  3RWR D;  4PJ0 Z;  2EIK B;  5KHG A;  3VQY A;  2IM9 A;  2BSK A;  2YXH A;  3ZHR A;  4LWS B;  1QQC A;  4UVC A;  2JGD A;  3CX5 F;  2HFE C;  1PNM A;  5FPR A;  5CA1 B;  4FK5 C;  2DOS A;  1IX9 A;  1SKV A;  3ZHQ A;  2DE0 X;  3PN1 A;  2CGO A;  2ZR2 A;  3SYP A;  3RFR A;  4JTD B;  2PI5 A;  2GTS A;  2ZM6 B;  3T4D A;  4R8C A;  4OPH A;  2Y4U A;  3RVY A;  2XAJ A;  3ABK B;  2RJZ A;  4E2L A;  4FM0 A;  2RNB A;  3JAS A;  5LL6 Y;  3L72 H;  3S3W A;  4DUZ B;  4ZKI A;  1TA8 A;  4PDV A;  2IJK A;  1ZUQ A;  1XUQ A;  2XT9 A;  2UXB B;  2Z5U A;  4X1Y B;  3K5O A;  1Q86 W;  2PZS A;  3JD3 A;  4I9W A;  3SPH A;  2Y69 C;  1U97 A;  1H2N A;  1Z5W A;  4P9P A;  4YY3 O;  2V1D A;  1WB8 A;  4ZHQ A;  5KAI Z;  3HKE A;  3D36 C;  4QGP A;  3E8F A;  4BW9 A;  5LMU B;  4B3R B;  1KD1 W;  3BVO A;  3JCZ A;  1M57 C;  1VQ9 V;  4GX1 A;  1ZX3 A;  2V4D A;  2CDY A;  2BTQ B;  3SYQ A;  4PA3 A;  3G6B A;  1J5E B;  5JJN B;  2PUS A;  3JSL A;  4NTW A;  1Q8I A;  1JFF A;  5FL7 G;  3FB7 C;  3K04 A;  3OE7 G;  4GLX A;  4J7Z A;  4RQE A;  3E22 A;  1ZWI C;  1NU1 H;  2CTR A;  3OFN G;  1VF6 C;  3AG3 B;  1OJH A;  5EBW C;  4F6E A;  2W0X A;  1G8M A;  2CE4 A;  4BWA A;  1YHQ V;  3SYO A;  1P84 F;  1ZL8 B;  4PA4 A;  1K5Q A;  1YSC A;  1W59 A;  4FZ1 A;  3OTO B;  4QE7 A;  5CBG A;  2R9I A;  2PY5 A;  5J9P C;  1VQL V;  1KU9 A;  1NKD A;  4TUY A;  4YHH O;  4LF7 B;  2KG7 A;  1FPO A;  2VWK A;  3E86 A;  2DYS B;  1XI1 A;  3DXR A;  3JAM N;  4DR4 O;  1N33 B;  3CCR V;  1KMI Z;  1N32 O;  4LFC O;  2D3O W;  2E5L B;  3MAQ A;  1S3J A;  3L71 H;  1QVG U;  2Y48 A;  1FJG B;  3ZJZ A;  1NZ6 A;  2HVJ C;  4JI6 O;  5J2T A;  1VQ4 V;  4PDL A;  1GN6 A;  4X64 O;  1BCC H;  1K33 A;  2ZDI A;  2WLL B;  2CUG A;  1NTZ H;  3OGI B;  2EIL C;  5EZY A;  4IYI A;  3FB8 C;  4JF3 A;  4NXM B;  1SA0 B;  4CBC A;  5DM6 V;  4IIJ A;  1NR1 A;  4TQD A;  3SDL A;  3ZMT A;  1ZL8 A;  1K34 A;  2B5U A;  2KB1 A;  1XIL A;  4GX0 A;  2B1G A;  5LMU O;  3E8G A;  5KLV H;  3TXQ A;  4TUY B;  1SZX A;  4JZ2 A;  1EM1 A;  3I55 V;  2ODM A;  4WCE V;  2ZNJ A;  3IAY A;  2F95 B;  1YJW V;  3DXR B;  1W2B U;  3ZMU A;  1EFR G;  3OMA B;  5BZB A;  3B8M A;  2Q5Z A;  1OZ0 A;  3CS5 A;  1Q82 W;  5L3D A;  4FFK A;  4MVM A;  4AQY O;  3KZI Z;  4DR6 O;  1R6T A;  3P3P A;  4MT8 A;  3RYH B;  5EYP A;  3K9A A;  2AHY A;  3ABL C;  2UU9 O;  2UUA B;  2LJ2 A;  3K58 A;  1BS3 A;  4B08 A;  2NN4 A;  1A32 A;  2JS5 A;  4GCZ A;  2UXD B;  3CCL V;  4U3J A;  4ZI7 B;  2YI8 A;  2QWR B;  4EFE A;  1M56 C;  4LC1 A;  4MVS A;  3JAS B;  3K3W A;  1URF A;  2VQF O;  3KCX A;  3MDS A;  3UO2 A;  4DR1 B;  4LFC B;  2FB5 A;  4LFB O;  2EJ7 A;  2B1I A;  4I50 A;  1BHA A;  5TIS Z;  5CBF A;  3CCE V;  4AI8 A;  5E79 Z;  1Y66 A;  1PM9 A;  3LDD A;  4R50 A;  3TET A;  4WBN B;  3CXC U;  3K03 A;  3SPI A;  4UV9 A;  4X20 A;  2P67 A;  1M57 B;  1PNL A;  1F4N A;  3RYC B;  1SQX H;  5BR8 B;  4GYC B;  1AR5 A;  2CH7 A;  4LFA B;  1F4M A;  4JI5 B;  4JGS A;  2O57 A;  1WAZ A;  3CCQ V;  1ARO P;  3EHB B;  1N0N A;  3SGI A;  1SQB H;  3HKB B;  5JH7 A;  2Z0A A;  5ITZ A;  1PNK A;  3ZIA G;  4WFA V;  2HVK C;  3K5N A;  1RPO A;  3K0G A;  4J10 A;  4JYB A;  2QJ1 A;  3M8A A;  1H38 A;  4R6Z A;  1B04 A;  1FFX A;  1XNR O;  2EIM C;  2ZXW C;  4CH3 A;  1OCO C;  2ZIN A;  1AJN A;  3RVZ A;  3JD2 A;  4BAY A;  4UVA A;  1Y67 A;  4P2Z A;  3W7W A;  2HJF C;  1D5N A;  4CZZ A;  1X59 A;  4L87 A;  2HHH O;  1UFI A;  3AEI A;  4EKW A;  5DEC A;  3VQW A;  4RUE A;  2EIM B;  4TOI A;  3BCC H;  4JTC B;  3OMI B;  1QBZ A;  5LA6 B;  1YZB A;  3FX7 A;  3STZ C;  4DR2 O;  3T2M A;  3SR2 C;  4I55 B;  4EFB A;  5J2U B;  2CH7 B;  4FFB A;  2UXD O;  1M9N A;  2XAG A;  3RBZ A;  3TXS A;  4LF8 B;  3P3N A;  4DV1 O;  3THO A;  2UUC B;  3CC2 V;  1KP2 A;  1Y4M A;  3STL C;  2XAH A;  5IYZ A;  2HLD G;  2GDS A;  4H44 B;  2QKA A;  2DYR C;  4LFB B;  2GSM B;  3VOU A;  1FKA O;  1HW7 A;  3DC6 A;  2WLL A;  4MTX A;  1W0K G;  4YIP A;  1AJP A;  5CBH A;  3L73 H;  4NR1 A;  1KB9 F;  1M4U A;  4B3M O;  1SA0 A;  2F4V O;  3RYI A;  3L9D A;  2DWD C;  2ZE8 A;  1GM8 A;  4KXR A;  3E2E A;  1NTK H;  1V54 C;  2ATK C;  4X9Q A;  2YUA A;  2WLH A;  2Q0O C;  3TK1 A;  2ADQ B;  2E74 B;  5K1P A;  4HBN A;  1IDS A;  4TV9 B;  2LW7 A;  1BHB A;  4KL1 A;  2Q7G A;  1YEW A;  4LH7 A;  1D5A A;  3HB3 B;  4RO2 A;  3JAL B;  4J9Z B;  2P22 C;  1ROP A;  5EC1 C;  4H33 A;  1AP6 A;  4DYL A;  1N4C A;  3FD9 A;  2Q67 A;  1R6N A;  5LYJ A;  5CN0 A;  4PI0 A;  5KUK A;  2EJR A;  3QVN A;  1IUR A;  4ICG A;  4U3F H;  4Z1V A;  1IBK O;  5JCO A;  1Y6X A;  2ZQM A;  1WA8 B;  1IBL B;  5EC2 C;  4CH6 A;  5EK0 A;  1YJ9 V;  3CCS V;  4ZIB A;  1IVS A;  4DV4 B;  3HKC B;  4GKK O;  2P5O A;  1GAX A;  4AHC A;  1ENV A;  5GON B;  1ZTE A;  5KHK A;  3JYC A;  4GKJ O;  5JVD B;  2GBO A;  4JI1 B;  1MZE A;  2BCC H;  1MA1 A;  3OGC C;  4YHH B;  4I9Q A;  4BW5 A;  3LNM B;  1KYO F;  1VF5 B;  5L3C A;  3CME V;  1HNX O;  4J11 A;  1Q6U A;  5CA0 A;  2Y0P A;  1N33 O;  4TSF G;  1OCR B;  4NTY A;  2PF4 E;  4WBN A;  1VQM V;  5LGU A;  2YEV A;  2Q4P A;  2ITC C;  2OIG A;  5L3B A;  2HG5 C;  1EBO A;  2ZT9 B;  1MSD A;  3APQ A;  4Q6G A;  3RYC A;  1FFT B;  1AJQ A;  1SC5 B;  3C90 A;  1Q81 W;  4JI6 B;  1OCO B;  4MTG A;  3G80 A;  5LYJ B;  3G6E V;  1EN4 A;  3IC7 A;  2LO1 A;  5JJJ B;  3ZHU A;  1V54 B;  1FS0 G;  2OYQ A;  1LUV A;  3AG2 B;  2ZR3 A;  1VQN V;  3OR6 C;  4I4T B;  3QO5 A;  4W4L A;  2OTL V;  3WB2 A;  1SQV H;  5IJ0 A;  4X62 O;  3ZHS A;  4X66 B;  2JIZ G;  2QKC A;  4TV8 B;  1KP3 A;  5H5N A;  1V55 C;  4FVM A;  4LF9 O;  4PA6 A;  1Q5O A;  3M7M X;  1VF6 A;  3KKY A;  3BAB A;  3P32 A;  4A5U B;  4MSW C;  3OUS A;  3SJA C;  4AIL C;  1S72 V;  2Z3Y A;  3JD1 A;  1AP5 A;  1JVM A;  2BTO A;  3W7X A;  3UO3 A;  3E8B A;  3D36 A;  4NYK A;  5HFM A;  2X0L A;  3N2G A;  3B2E E;  4YXW G;  1UPG A;  2M6Y A;  3WFV A;  4N21 A;  2E76 B;  3CC7 V;  1VQK V;  2Y69 B;  5J2U A;  3W7U A;  2Q7H A;  1YDX A;  4LF5 O;  3GWO A;  3FFQ A;  5CA3 A;  4LNU B;  4CH5 A;  4JI1 O;  2Q68 A;  2CK3 G;  3F7V C;  1QLN A;  3CRM A;  4NB5 A;  4H13 B;  4O4H A;  2AGA A;  2H3O A;  2VS0 A;  3U11 A;  5KHI A;  4NVP A;  4QPJ A;  4JI0 O;  3UT5 A;  5IJ0 B;  2MK3 A;  2P06 A;  4Z2W A;  2VQF B;  3NXS A;  2QM4 A;  2ZM6 O;  3CSX A;  4KFM A;  4MTO A;  4X8A A;  2HJD A;  3O9O A;  5A9G A;  5E1A C;  4FM2 A;  3CHX A;  4X1K B;  2JEX A;  1N8R W;  1R3L C;  5KA5 A;  3RYF A;  3K9S A;  1BL8 A;  5LBQ A;  1IXM A;  1IBM O;  1PKX A;  1R3K C;  1G1X B;  5CA1 A;  3T1C A;  2DYS C;  1BQZ A;  4RAI A;  4JAV A;  3UCS C;  4X66 O;  1BZK A;  1K8A W;  1Q43 A;  2QWQ B;  4LP8 A;  2B9Z A;  5LMN B;  1P7B A;  1QR8 A;  3FKS G;  4ZBM A;  1S76 D;  1XL6 A;  3RGB A;  3H1H H;  5CB4 A;  1WA8 A;  2PI4 A;  3D8C A;  4DV0 O;  3QNE A;  4JPR A;  4OXS A;  5KA6 A;  1XOU A;  2QM8 A;  5D5P A;  2UXN A;  1ZAU A;  1SQP H;  3U0Z A;  5KUM A;  1M1K W;  3SJB C;  3CRR A;  2YIB D;  3H1J H;  3E35 A;  2YIC A;  4GX5 A;  1GM7 A;  4K3A A;  1TVK B;  4X1K A;  4DV3 B;  3ZX6 A;  2QEX V;  3X2Q B;  3OTF A;  4JYC A;  2YIA A;  3FB5 C;  1WNS A;  2P90 A;  3RW0 A;  2W0F C;  2F1M A;  2AXT Z;  1K7D A;  3ZBH A;  1NI8 A;  4N23 A;  1KC8 W;  4DV2 B;  4B3S B;  1SET A;  4JI0 B;  4YJ3 B;  4X65 O;  3ZRX A;  4I0X B;  2PYL A;  3HR0 A;  3Q4H B;  2FL4 A;  4MW3 A;  1FJG O;  2DJV A;  3I56 V;  4CC6 A;  1K4C C;  2F93 B;  1EN6 A;  1N36 B;  4I4T A;  1Q6H A;  3ZMZ A;  2WA4 A;  2OCH A;  2Q73 A;  4YJ2 B;  3P30 A;  4HNA B;  5JCO C;  2HP8 A;  2Y0I A;  2YI9 A;  5KMG A;  1V9P A;  2N74 A;  2CAZ C;  2RQ6 A;  4FLU A;  3C3S A;  3AG2 C;  2KG7 B;  1AIL A;  4MVR A;  1TVK A;  4KUM A;  3JAW A;  4MVO A;  3F7Y C;  2OTJ V;  4CS4 A;  2ETN A;  3CRQ A;  1VIB A;  3T1H O;  3SPJ A;  3FAV B;  4JI3 O;  4UVB A;  5KX5 B;  1NBM G;  1T5E A;  3N2G B;  1YIT V;  3JAT B;  1DGS A;  4DV0 B;  3A0R A;  1ORQ C;  5C8Y B;  2BOB C;  2JK5 C;  4GUN A;  3RN4 A;  4DR5 B;  5J2T B;  1EZJ A;  4DR3 B;  1IBK B;  4F6R A;  2A7W A;  3B77 A;  1FAF A;  4RQF A;  2ZKO A;  3LSS A;  3O65 A;  5EBL C;  3DTU B;  4QNH B;  2VRZ A;  2BOC C;  3ABK C;  2LFR A;  4IIJ B;  4O4H B;  3ZCC A;  4EB6 B;  1OCZ C;  3W7S A;  1SQG A;  2Y4T A;  3WG7 C;  3W7T A;  1YTF B;  3CJH A;  4R7C A;  4W4K A;  4IT5 A;  3R66 A;  1SRY A;  4YJ2 A;  2N05 A;  4I5S A;  1MG1 A;  3TGU H;  1BQ0 A;  1IXB A;  3AG4 C;  2Q69 A;  4QE9 A;  2P4V A;  3T1Y O;  4JAU A;  4JYY A;  4B3S O;  1LUW A;  1HNX B;  4MS2 A;  1IZ3 A;  3M99 B;  1VAR A;  1HR0 B;  1GH6 A;  2JDI G;  5B1B C;  5B1B B;  3LDE A;  3E89 A;  4UV8 A;  4D7S A;  2KQX A;  3ZRS A;  1QLE C;  1R3I C;  4O4J B;  1K9M W;  3FB6 C;  2PTM A;  3AG4 B;  1JJ2 U;  3B4S A;  3QG5 A;  2F43 G;  2P7T C;  2ZE5 A;  3LSU A;  1NVP B;  5IYC O;  3KG2 A;  4F6R B;  1I94 B;  3L74 H;  2JRI A;  3OT7 A;  5BR8 O;  4LBE C;  4L8J A;  1U96 A;  3H1K H;  3APO A;  1ZSP A;  2Q8V A;  2ZDI C;  1NR7 A;  4TT3 G;  3ABU A;  2YXL A;  3H01 A;  4O2B B;  1US6 A;  2P4K A;  1B06 A;  4LF9 B;  2VQE O;  2ILM A;  4KHP O;  1SQQ H;  5B1N A;  3CCV V;  1MAB G;  5FNV A;  1XNR B;  2QM7 A;  3AK1 A;  1QNM A;  1HNW O;  1GK9 A;  2XOK G;  4DR5 O;  1JR9 A;  4YIO A;  1JA8 A;  1AI7 A;  1N0J A;  1JQ0 A;  1OHH G;  4DR3 O;  3WB1 A;  2OWO A;  3B8N A;  1GM9 A;  1D2D A;  3CCU V;  4QJF B;  2HHH B;  2WLM A;  2XHB A;  5L3G A;  4J9Y B;  3CRC A;  1SS3 A;  2KKW A;  4LF5 B;  3RT3 C;  2AZ0 A;  3LUT B;  4YJ3 A;  3ZN0 A;  1WP8 A;  4DV5 O;  2EIL B;  4UCT A;  1FXK C;  2BSK B;  4LF8 O;  4MTF A;  4DV1 B;  1VQP V;  4BIU A;  2UUC O;  2X6B A;  1AI5 A;  4DR4 B;  1XMQ B;  4LR3 A;  1JX9 A;  4UB8 Z;  3CE2 A;  4PHZ A;  1V55 B;  1DF5 A;  5BMV B;  2E5L O;  4IL6 Z;  2R9R B;  2R9A A;  2NR5 A;  1Z2G A;  2ZXW B;  4LF4 O;  1H2G A;  1HNZ O;  3WU2 Z;  4B3M B;  2CTP A;  2F4V B;  5B5E Z;  4LF6 O;  3CEI A;  2ZNI A;  1S5J A;  4B3T B;  3HKE B;  3K06 A;  4NXN O;  2GV9 A;  3IC9 A;  3L70 H;  1DF4 A;  2WLN A;  1VQ5 V;  2UXX A;  3BRC A;  3FAV A;  5AG2 A;  4PDR A;  1Q3E A;  2AHZ A;  2BTQ A;  1X4T A;  5B3S B;  4G2K A;  4U7O A;  3G71 V;  2DWE C;  4J7K A;  1VQ7 V;  3AG3 C;  5FPO A;  2QTS A;  1EN5 A;  2Q0A A;  3A0B Z;  2QSA A;  1FYJ A;  3OMN B;  1BE3 H;  4OX9 B;  2ITD C;  4JI8 B;  1HNW B;  2IH1 C;  4UCO A;  2QE7 G;  2H94 A;  2JGU A;  2G38 A;  1BT8 A;  2FKX A;  1JMK C;  3A2F A;  4FZ0 A;  1JOY A;  4EB6 A;  1NVP D;  3G67 A;  3K57 A;  5BMV A;  3CP1 A;  2R72 A;  4GZR B;  4O4I A;  1H8E G;  4JAA A;  4MVZ A;  4O4L A;  4QIW F;  4AQY B;  1VF7 A;  1JFF B;  3MHS C;  4GKK B;  4D6T H;  1XMO O;  3E22 B;  5LP6 C;  3SYC A;  3JAL A;  4WFF A;  1I08 A;  3BY6 A;  1RM1 B;  1RM1 C;  1S5H C;  1R6K A;  1YTF D;  4FLZ A;  1PV0 A;  1XMQ O;  4C7U A;  4WFE A;  2WAM A;  1P4R A;  3ZRW B;  3LDC A;  4FJC C;  3FYE B;  2IBZ H;  3BEH A;  3DGE A;  3WB0 A;  3J80 N;  5DN6 G;  4PA9 A;  2ADP A;  1P49 A;  3GWK C;  1SQF A;  3QO7 A;  5LP6 B;  4K35 A;  1CPY A;  1XDC A;  3A0H Z;  4O4L B;  4WF9 V;  2UXB O;  3DC5 A;  1UJW B;  4JI5 O;  1JPX A;  2E75 B;  4J7J A;  3H1L H;  1I7F A;  1WJZ A;  1YXB A;  2UUB B;  4O2A A;  2OT5 A;  5FNV B;  1K5S A;  2YID A;  1WLE A;  4DV7 B;  2DYR B;  2OCC C;  3ABM C;  5IYB O;  1COW G;  5LGN A;  4E4E A;  1WP7 A;  3BA8 A;  3K5M A;  4X89 A;  3R65 A;  1RP3 B;  1J5E O;  5L3F A;  4JI7 B;  4JYA O;  5IY5 B;  1GO3 F;  2HEP A;  4DW1 A;  3ETE A;  3ASN C;  2QA4 V;  2XUM A;  1Y76 B;  4DRX B;  4MVU A;  5KAF Z;  3ABT A;  3AG1 B;  3ZHV A;  3ETG A;  1NS1 A;  3BAA A;  3ASO B;  3ABL B;  4FMT A;  5IYD O;  2LFS A;  1E1R G;  5DED A;  1H2K A;  2ZD9 A;  4FLV A;  4IGG A;  5EYP B;  1DTO A;  3SPC A;  1KBH A;  4GX2 A;  2EZO A;  3E8H A;  1AI4 A;  3PJS K;  3UKM A;  1JJO A;  4K8X A;  2YSU B;  2LQT A;  5LHI A;  1WB7 A;  4IHJ A;  3QTC A;  3IJ4 A;  2QKS A;  1GMG A;  4HYO A;  4P30 A;  4ZI7 A;  1XBL A;  2XAS A;  4LCU C;  3MHH C;  1KUQ A;  4UCU A;  3IFX A;  4UCS A;  4B7K A;  4B7E A;  4K0K B;  3U10 A;  1K73 W;  4I50 B;  5ITZ B;  2NNU A;  1AB3 A;  1F23 A;  4WFB V;  4DRX A;  1N34 B;  3GVM A;  4Q20 A;  1L8D A;  4G27 B;  4DR7 O;  4CC5 A;  5IWA B;  1FFX B;  4LWS A;  2IJJ A;  5LMN O;  2VQE B;  3L75 H;  1GKF A;  5GTI Z;  2IW5 A;  1YVW A;  1XNQ B;  4O4I B;  3HKB A;  5JH7 B;  2VWJ A;  3ETQ A;  1R1B A;  5B1A C;  3CYO A;  4JYA B;  4D7T A;  1XHX A;  4GT1 A;  4BIO A;  4IHJ B;  1P7G A;  1VQ8 V;  3OD4 A;  2GTA A;  4BR6 A;  2GHY A;  3E83 A;  5LA6 A;  4DK1 A;  1THZ A;  4DR6 B;  4NKG B;  2XAQ A;  4JAS A;  2DN9 A;  4DV3 O;  3H9V A;  5KHJ A;  2WLK A;  1PD3 A;  1B6Q A;  1L0N H;  2V7Q G;  3K5L A;  1XL4 A;  3TCU A;  2LW1 A;  4JZG A;  1RFY A;  2EIJ C;  4BIZ A;  4DV6 B;  2ZIO A;  4DV2 O;  3JAR B;  4MVQ A;  2EIK C;  2C2A A;  4UB6 Z;  4ZHQ B;  3VQX A;  4FM1 A;  4U7N A;  4I55 A;  2IH3 C;  1NQT A;  2E3C A;  4DR1 O;  1MOF A;  1LR1 A;  2W6I G;  1KKD A;  5LP6 A;  2FTK A;  2GUZ B;  2A3Q A;  3ML0 A;  1YIJ V;  2CTW A;  4JI4 O;  1OV9 A;  4EEQ A;  5EIB D;  4K0K O;  2WSS G;  1F7Y A;  5LGT A;  2UXC B;  4O2A B;  4LF6 B;  1SES A;  4B3T O;  2WA3 A;  2QGN A;  3JD4 A;  4LFA O;  2PYJ A;  2WWW A;  3TJT A;  4JI2 O;  3JCU Z;  5H2F Z;  1PPJ H;  2DQ3 A;  3D3Q A;  5GW7 A;  5B66 Z;  5LXT B;  4YY3 B;  2K9P A;  4J41 A;  4IYH A;  3ASN B;  1MZF A;  4DO2 A;  3Q4H A;  1NH2 B;  1Q90 D;  3B40 A;  3KCY A;  1Y76 A;  3VQV A;  3EVK A;  4Z1M G;  4JI8 O;  4FIP C;  3SYA A;  2JJ2 G;  3HKC A;  2F66 C;  4PI2 A;  4HNA A;  3ZS8 C;  5C93 A;  1VP7 A;  3EXA A;  2DMX A;  4DXW A;  2GUZ A;  1S5L Z;  4PEL A;  2QR4 A;  4XDJ A;  2P6J A;  2MW2 B;  3A8T A;  2AZ2 A;  2CGN A;  1QLE B;  1NTM H;  4RUF A;  2WPD G;  2XTA A;  1O9H A;  3OTO O;  4DR2 B;  4FLT A;  3ABM B;  4UUJ C;  4DW0 A;  2EIJ B;  5EZY B;  2X6C A;  4DV6 O;  1PL4 A;  1YI2 V;  4H37 A;  2YDE A;  3AK2 A;  3T1Y B;  3C3T A;  3T4Z A;  3ICX A;  3JAT A;  3OR7 C;  4XDL A;  1HR0 O;  5JVD A;  1M56 B;  2RN9 A;  5CMU A;  5JJE B;  5LXT A;  5H9C A;  5H6R A;  2EIN B;  1GN2 A;  1GTO A;  1N32 B;  1KKC A;  2HKO A;  4ZOL A;  1QR9 A;  3MD0 A;  4TWK A;  5EBM C;  2A79 B;  4QPK A;  1QVF U;  5CA0 B;  4PDM A;  1AVM A;  5BY1 A;  3H1I H;  4X1I B;  4CS2 A;  2WLI B;  4X64 B;  4MW8 A;  1TUE B;  4JV5 O;  3CRA A;  2QTO A;  2FYU H;  5D5Q A;  2YS8 A;  5HFL A;  2Q7E A;  2D2C B;  4JI2 B;  2L35 A;  3SPG A;  3K08 A;  3RYH A;  3ZMS A;  2QWN B;  3CPW U;  1E1Q G;  4DV7 O;  2L6L A;  1YJN V;  1XHZ A;  1QHT A;  3SJQ C;  4KHP B;  1E79 G;  4ABM A;  4U3J B;  3F5W C;  3S3X A;  2RMK B;  1DLB A;  3DSQ A;  1NJI W;  1M90 W;  1CEZ A;  2ZE6 A;  4LH6 A;  2Q6A A;  1KEC A;  1AI6 A;  3BHP A;  5BXZ A;  2DW4 A;  4ZOL B;  4LNU A;  1IBL O;  1NT2 B;  4WFG A;  2IJI A;  1RSO B;  4HAM A;  1HDJ A;  1MSW D;  2QWO B;  1F51 A;  4DV4 O;  5F2V O;  3JAR A;  2WLI A;  3NR7 A;  1GN4 A;  1K92 A;  2A9H A;  4DUY O;  3N2K B;  4X20 B;  2UUA O;  2OCC B;  2UU9 B;  3UT5 B;  3LSQ A;  3K0D A;  3HPL C;  3D3I A;  4PA7 A;  2LGW A;  5IDJ A;  5LOV A;  4H0L B;  3AG1 C;  4X65 B;  2DQ0 A;  3N27 A;  2IJH A;  3RYF B;  2YC0 A;  2RDC A;  4FLX A;  4J42 A;  1PP9 H;  1I0H A; 
#chains in the Genus database with same CATH homology
 1S3J A;  4KFM A;  1QVG U;  2Y48 A;  4FJC C;  4MTO A;  4X8A A;  3K79 A;  3ZJZ A;  2XND G;  2W6J G;  3FYE B;  3IGA C;  5E1A C;  3BEH A;  3DGE A;  5DN6 G;  2JEX A;  4PA9 A;  1N8R W;  2HVJ C;  1R3L C;  5KA5 A;  5B1A B;  1BL8 A;  1VQ4 V;  2HR3 A;  4PDL A;  3CMA V;  5LBQ A;  3QO7 A;  1K33 A;  1IXM A;  2ZDI A;  2WLL B;  1PKX A;  2EIL C;  4WF9 V;  1CPY A;  1R3K C;  2JEU A;  5L3E A;  3CCJ V;  3FB8 C;  1UJW B;  4JF3 A;  4HZ3 A;  3T1C A;  1QCE A;  2DYS C;  1JPX A;  4RAI A;  4JAV A;  4CBC A;  5DM6 V;  1NR1 A;  3ZMT A;  2OT5 A;  1K5S A;  1WLE A;  1K34 A;  1K8A W;  1K97 A;  2B5U A;  2KB1 A;  4GX0 A;  2DYR B;  4LP8 A;  3WG7 B;  1SZT A;  2B1G A;  2OCC C;  3E8G A;  1P7B A;  1QR8 A;  3ABM C;  5IYB O;  1J95 A;  1R73 A;  3GB7 C;  1COW G;  5LGN A;  3FKS G;  4ZBM A;  1S76 D;  1XL6 A;  1I5Y A;  3I55 V;  4WCE V;  3JD0 A;  3QO8 A;  4X89 A;  2PI4 A;  3R65 A;  4XDK A;  1YJW V;  1W2B U;  1KQS U;  3QNE A;  2H8P C;  3ZMU A;  1EFR G;  4JPR A;  4OXS A;  5KA6 A;  5L3F A;  2QM8 A;  2UXN A;  1NH2 D;  5IY5 B;  3OMA B;  3OW2 U;  1GO3 F;  5BZB A;  5KUM A;  3B8M A;  1OZ0 A;  1M1K W;  3ETE A;  3ASN C;  2EBO A;  3CD6 V;  2QA4 V;  1Q82 W;  5L3D A;  2XAF A;  3E35 A;  4MVM A;  4GX5 A;  1GM7 A;  4MVU A;  3ABT A;  3OEH G;  3AG1 B;  2QEX V;  3ETG A;  4MT8 A;  3X2Q B;  4FPP A;  4P9O A;  1OCR C;  3K9A A;  4JYC A;  2AHY A;  1K3E A;  3FB5 C;  3EFF K;  3ASO B;  1OCC B;  1OCC C;  3OM3 B;  4X88 A;  2P90 A;  3E2E A;  3RW0 A;  2W0F C;  3ABL C;  3ABL B;  1R3J C;  1K7D A;  4FMT A;  5IYD O;  2LFS A;  1E1R G;  4N23 A;  1Q7Y W;  4GCZ A;  3CCL V;  2ZD9 A;  1KC8 W;  1DTO A;  3SPC A;  4GX2 A;  2EZO A;  3E8H A;  1SET A;  1AI4 A;  3PJS K;  3UKM A;  1M56 C;  4LC1 A;  4MVS A;  3ZRX A;  2YSU B;  3K3W A;  5LHI A;  5H6Q A;  1RPR A;  1WPX A;  2QKS A;  1GMG A;  4HYO A;  4P30 A;  2B1I A;  1BHA A;  1K4D C;  2EZP A;  4MW3 A;  5CBF A;  3CCE V;  2XAS A;  4LCU C;  3MHH C;  3I56 V;  1K4C C;  1Y66 A;  3IFX A;  2JJ1 G;  3LDD A;  4R50 A;  3TET A;  3CXC U;  3K03 A;  3ZMZ A;  3SPI A;  1K73 W;  4UV9 A;  1FXV A;  2LP7 A;  2X7R B;  3P30 A;  2P67 A;  2NNU A;  1F23 A;  1M57 B;  1PNL A;  1F4N A;  4WFB V;  5LHG A;  3AG2 C;  1F4M A;  3OEE G;  4JGS A;  4Q20 A;  4MVR A;  4WFH A;  4G27 B;  1S77 D;  3CCQ V;  1ARO P;  3EHB B;  4KUM A;  1VQO V;  4MVO A;  3F7Y C;  1JCH A;  1PNK A;  2OTJ V;  3ZIA G;  2IJJ A;  3ZRW A;  4WFA V;  2HVK C;  1GKF A;  1RPO A;  3SPJ A;  3K0G A;  4G28 B;  1CP9 A;  2IW5 A;  4JYB A;  4UVB A;  1NBM G;  1H38 A;  1YIT V;  4R6Z A;  2EIM C;  2ZXW C;  2X6A A;  1OCZ B;  1OCO C;  1ORQ C;  3A0R A;  3FYI B;  2WLJ A;  1AJN A;  2BOB C;  2JK5 C;  5B1A C;  3RVZ A;  3CYO A;  3JD2 A;  4GT1 A;  4UVA A;  4BAY A;  5B1O A;  1EZJ A;  4P2Z A;  3W7W A;  1SER A;  1VQ8 V;  2HJF C;  4CZZ A;  3B77 A;  2YEV B;  1L1F A;  4L87 A;  2GHY A;  4RQF A;  3E83 A;  1FXK B;  3LSS A;  3OAA G;  5EBL C;  3DTU B;  4QNH B;  3ZMV A;  1THZ A;  2BOC C;  3AEI A;  4EKW A;  3UM7 A;  2XAQ A;  3ABK C;  4JAS A;  2LFR A;  4RUE A;  1W0J G;  2EIM B;  1PD3 A;  2WLK A;  3ZCC A;  1B6Q A;  2V7Q G;  1OCZ C;  4JTC B;  3OMI B;  3W7S A;  1XL4 A;  3TCU A;  2NLJ C;  3WG7 C;  3W7T A;  4R7C A;  1YTF B;  1QBZ A;  1SRY A;  3STZ C;  3T2M A;  4I5S A;  1MG1 A;  2EIJ C;  3AG4 C;  2Q69 A;  4QE9 A;  4BIZ A;  1PL0 A;  1M9N A;  2XAG A;  4JAU A;  3RBZ A;  4ASU G;  4MS2 A;  4MVQ A;  3M99 B;  2K1E A;  3CC2 V;  2EIK C;  2C2A A;  2JDI G;  1KP2 A;  1Y4M A;  3STL C;  5B1B C;  5B1B B;  2XAH A;  3LDE A;  2HLD G;  3E89 A;  4UV8 A;  4U7N A;  2IH3 C;  5LHH A;  2DYR C;  1NQT A;  3ZRS A;  1QLE C;  2GSM B;  1MOF A;  2W6I G;  1FXH A;  3VOU A;  1R3I C;  1KKD A;  2A0L A;  1K9M W;  4JTA B;  3OUF A;  2FTK A;  2WLL A;  4MTX A;  1W0K G;  3FB6 C;  1AJP A;  5CBH A;  3ML0 A;  3AG4 B;  1YIJ V;  1JJ2 U;  4XBF A;  5B3S C;  3G4S V;  1G4Y B;  2F43 G;  1I5X A;  2P7T C;  1AR1 B;  4F4L A;  1NVP B;  1HWY A;  2WSS G;  3VBB A;  5LGT A;  2DWD C;  5IYC O;  1GM8 A;  3KG2 A;  1SES A;  1H8H G;  1S0V A;  1V54 C;  1FXK A;  2ATK C;  4LBE C;  3JD4 A;  2WLH A;  3TK1 A;  4KP4 A;  2WWW A;  4UXN A;  2DQ3 A;  2ZDI C;  5GW7 A;  1NR7 A;  4TT3 G;  3ASO C;  3ABU A;  1BHB A;  3H01 A;  3ASN B;  4DO2 A;  2IU3 A;  3CC4 V;  3ZN1 A;  3HB3 B;  1VQ6 V;  4RO2 A;  1NH2 B;  4J9Z B;  5B1N A;  3CCV V;  1ROP A;  1MAB G;  5EC1 C;  3CCM V;  4H33 A;  2IU0 A;  3X2Q C;  2QM7 A;  4Z1M G;  2Q67 A;  1R6N A;  1GK9 A;  2XOK G;  4FIP C;  3SYA A;  2JJ2 G;  5IY5 C;  5CN0 A;  1AI7 A;  1LNQ A;  5KUK A;  2EJR A;  2M7W A;  1BMF G;  1JQ0 A;  2EIN C;  1OHH G;  5C93 A;  3B8N A;  3ETD A;  1GM9 A;  2ZQM A;  3ZRV A;  3CCU V;  5EC2 C;  4DXW A;  4QJF B;  2WLM A;  4PEL A;  5EK0 A;  1YJ9 V;  5L3G A;  4J9Y B;  3CCS V;  2EIK B;  4XDJ A;  2P6J A;  1ENV A;  4UVC A;  1QLE B;  3JYC A;  2HFE C;  4RUF A;  2WPD G;  3LUT B;  3ZN0 A;  3ABM B;  1PNM A;  4UUJ C;  2EIJ B;  2X6C A;  2EIL B;  1YI2 V;  3OGC C;  4H37 A;  4BW5 A;  1FXK C;  3LNM B;  4FK5 C;  3T4Z A;  5L3C A;  3CME V;  4MTF A;  3OR7 C;  4XDL A;  1VQP V;  4BIU A;  1M56 B;  2X6B A;  1AI5 A;  5CMU A;  2ZR2 A;  4TSF G;  5H9C A;  5H6R A;  1JX9 A;  1OCR B;  3SYP A;  2EIN B;  1GTO A;  4JTD B;  1V55 B;  1DF5 A;  1VQM V;  5LGU A;  2PI5 A;  3T4D A;  2HKO A;  4R8C A;  2YEV A;  1QR9 A;  3MD0 A;  4TWK A;  5EBM C;  2A79 B;  2R9R B;  2ITC C;  4QPK A;  5L3B A;  2HG5 C;  1QVF U;  1EBO A;  3RVY A;  2XAJ A;  3ABK B;  1FFT B;  1AJQ A;  4E2L A;  4PDM A;  2ZXW B;  1H2G A;  1Q81 W;  1OCO B;  4MTG A;  2WLI B;  3G6E V;  3IC7 A;  4MW8 A;  1TUE B;  4ZKI A;  4PDV A;  2QTO A;  2IJK A;  3K06 A;  1V54 B;  1FS0 G;  3AG2 B;  2ZR3 A;  5HFL A;  1DF4 A;  2WLN A;  1VQ5 V;  2UXX A;  2Z5U A;  1VQN V;  1Q86 W;  3JD3 A;  3OR6 C;  4I9W A;  3SPH A;  3QO5 A;  4PDR A;  2Y69 C;  3K08 A;  3SPG A;  2AHZ A;  2OTL V;  4P9P A;  3ZMS A;  5B3S B;  2JIZ G;  3CPW U;  2V1D A;  1E1Q G;  1KP3 A;  4G2K A;  1V55 C;  3E8F A;  1YJN V;  4U7O A;  1KD1 W;  4PA6 A;  3G71 V;  2DWE C;  3SJQ C;  1VQ7 V;  1E79 G;  3AG3 C;  3JCZ A;  1M57 C;  3P32 A;  1VQ9 V;  3OUS A;  4GX1 A;  4MSW C;  3F5W C;  3SYQ A;  4PA3 A;  1S72 V;  1DLB A;  2Z3Y A;  3JD1 A;  3OMN B;  1NJI W;  1M90 W;  1JVM A;  1CEZ A;  3W7X A;  2ITD C;  3E8B A;  3D36 A;  2IH1 C;  2QE7 G;  2H94 A;  2Q6A A;  1KEC A;  1AI6 A;  1JOY A;  1NVP D;  5HFM A;  2DW4 A;  5FL7 G;  3FB7 C;  2X0L A;  3CP1 A;  3K04 A;  3OE7 G;  4RQE A;  1H8E G;  4MVZ A;  4YXW G;  1ZWI C;  3OFN G;  4QIW F;  4WFG A;  3WFV A;  4N21 A;  3AG3 B;  3CC7 V;  2IJI A;  5EBW C;  1VQK V;  4HAM A;  2Y69 B;  1G8M A;  1MSW D;  1F51 A;  1YHQ V;  3W7U A;  3MHS C;  3SYO A;  3GWO A;  4PA4 A;  2WLI A;  1K5Q A;  1YSC A;  1K92 A;  2A9H A;  2OCC B;  5CA3 A;  4QE7 A;  5CBG A;  3SYC A;  3LSQ A;  4WFF A;  2R9I A;  3K0D A;  3HPL C;  2Q68 A;  2CK3 G;  3BY6 A;  5J9P C;  1NKD A;  1VQL V;  3D3I A;  3F7V C;  1QLN A;  4PA7 A;  1RM1 B;  3E86 A;  1RM1 C;  1S5H C;  1R6K A;  2DYS B;  5IDJ A;  1YTF D;  3AG1 C;  4QPJ A;  2MK3 A;  2DQ0 A;  4WFE A;  2WAM A;  1P4R A;  3CCR V;  3NXS A;  2IJH A;  3ZRW B;  2D3O W;  3LDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...