1VQMV

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqmV00
3CCJV 3CCSV 2QEXV 1KQSU 1JJ2U 1KD1W 3G71V 2QA4V 3G6EV 1VQMV 3CCVV 1Q86W 1K73W 1M1KW 3G4SV 3I55V 1VQPV 1VQ4V 1Q7YW 3CCQV 3CCRV 3OW2U 1S72V 2OTLV 3CMEV 1VQ6V 1K8AW 1YIJV 1W2BU 1R73A 4WFBV 1NJIW 3I56V 1YHQV 2OTJV 1N8RW 1QVGU 1Q81W 1QVFU 4WCEV 3CXCU 3CC7V 1VQLV 3CD6V 4WFAV 1Q82W 3CC4V 3CPWU 3CCUV 3CCMV 1YJWV 1M90W 1VQ8V 1VQOV 1VQ5V 1YI2V 1VQNV 1YITV 1K9MW 1YJ9V 4WF9V 1VQ9V 5DM6V 1KC8W 3CMAV 3CCLV 3CC2V 3CCEV 1YJNV 2D3OW 1VQKV 1VQ7V
chains in the Genus database with same CATH superfamily
2RCVA 2QKCA 4MTFA 3BEHA 3OT7A 5H2FZ 4B3MB 4DV4B 4JAAA 2Q67A 4X1IB 1HNWO 1VF7A 2O57A 2Y69B 2ZIMA 3ZHQA 3DXRA 3ZMZA 3PN1A 1X4TA 5EK0A 3RWRD 4DR7O 1GTOA 2RMKB 1FXKA 3OTFA 1VARA 3U11A 2GUZA 3HKCA 4DR5O 4IT5A 3THOA 1QU7A 2Y4TA 1PL0A 1PKXA 1F4MA 1SRYA 4U3FH 3D36A 4UCVA 2ZDIC 3A0HZ 2ZXWB 4PA9A 3BPZA 5LMNO 1PNKA 3SPCA 1GM8A 3ABMC 1KP3A 4WBNA 1BQ0A 3N2GA 4NKGB 2CGNA 1AJPA 1Y76A 2AZ0A 4MVUA 1NTKH 1HR0O 1KYOF 2UUBB 2DYRC 1SA0B 1BGYH 4PA7A 2BSKB 2HP8A 2QE7G 4DK0A 1FXHA 5CB4A 3QVNA 3ZN0A 3B09A 4DV6O 4I4TB 4FFBB 4MW3A 4UVBA 4L87A 4B3TO 1CEZA 3K03A 1FXVA 1XL6A 4FFBA 4H0LB 1OJHA 2F93B 1URFA 4FM1A 3WB1A 3OD4A 4DR3O 4RWUA 1M1KW 4CH4A 1RM1C 4X62O 2ZE7A 3ZRWB 4LFCB 1WLEA 3FB8C 3L75H 5B1AB 1AP5A 1B04A 1VQLV 4RAIA 3SYOA 2WLJA 2F66C 3S3XA 1FPOA 5LMNB 3CXHF 2Q7GA 1WP7A 4BW9A 5LXTB 4DV6B 4X1YA 2EILC 1H8EG 4QJFB 1E1RG 1U96A 2A3QA 2XTAA 2QWNB 4JI4O 1S76D 3IFXA 1WB8A 1XHZA 2WA4A 3JAKB 3L70H 1SQGA 3D3IA 2Q7HA 3ETQA 2EBOA 5L3FA 4X9QA 4L8JA 4X1IA 3JAKA 3CHXA 2YEVA 4FPPA 3K9SA 2WLHA 1IBKO 5GW7A 3FD9A 2ADPA 4R7CA 2WSSG 1S5HC 1L1FA 1NH2D 1PV0A 3I5DA 3SR2C 1O9HA 1PM9A 4ASUG 3VQXA 5KX5A 5GONB 4TWKA 5LHIA 4JZ2A 2A0LA 5ITZA 2Y69C 1NJIW 3AG1C 1K34A 3CC7V 1N32O 5JVDB 3E22B 3TXQA 2LFRA 4DR1O 5CBFA 2E75B 5JJEB 2GHYA 3CS5A 5EYPB 1V9PA 4UCSA 2Y0IA 4HYOA 1Y4MA 3RW0A 3STZC 1P7BA 1QNMA 1RPOA 4GKKB 3CXCU 4F6RB 4H33A 2Q0OC 5B5EZ 1XREA 5JH7B 4XDJA 5LHGA 1IVSA 1VQ7V 5EC2C 5JH7A 1V55B 3CRRA 2DYSC 1KKCA 4WFEA 4EKWA 3K5LA 1US6A 1S72V 2UXDB 2FTKA 2NN4A 1JFFA 2W6JG 3L72H 4BR6A 3ABKB 1QR9A 5JJNB 4LF4B 1R3LC 3SJAC 2N04A 3CD6V 3ZJZA 4FIPC 3JAMN 4CS2A 1OCCC 1VQ9V 5JCOA 1AILA 2BCCH 3T1YO 3CCEV 3GWOA 4KFMA 1ZSPA 4CC5A 1YCIA 1P4RA 5KHHA 1AJQA 1K92A 3UO2A 5CB4B 1F7YA 4I50B 3E22A 3DGEA 2LJ2A 4LF8B 3CCQV 1W0JG 3HPLC 1NVPB 4UB8Z 3I56V 1FKAO 3UT5A 3K0GA 1SETA 3SJBC 1SQQH 3UO3A 3N2GB 3UCSC 1MMMA 1MZFA 3A0RA 4E4EA 3JCZA 1MA1A 5A2QN 1SQFA 4F6EA 1LUWA 4C7UA 3CRAA 4LF9O 2B1GA 2QGNA 3ZIAG 3OUSA 3OMAB 2QM8A 1SESA 3Q4HA 2BTQA 5B1BC 2C2AA 1HP8A 3JCUZ 3R66A 2KB1A 5L3GA 3K79A 5B1AC 1K3EA 1FS0G 3QNEA 2V1DA 4TQDA 2UXXA 3OW2U 4KXRA 1XBLA 3HKEA 1R6TA 3ETGA 2AHZA 4QE7A 4X66B 1MSWD 2DOSA 4JAUA 4EB6B 3CPWU 2KQXA 5EZYB 5CBHA 3AG3C 4OPHA 4BIOA 2QJ1A 3BVOA 5EIBD 1KQSU 5B1BB 4ZIBA 1H38A 1EBOA 3BFRA 1TVKB 4PA6A 4AI8A 4OXSA 4MS2A 3AEIA 1M56C 3FB7C 2VQFO 1VIBA 3JATB 2BOCC 5LOVA 3CRQA 1IXBA 2ZXWC 3H01A 4JI5B 1B06A 4GUNA 4BIZA 5L3DA 1NU1H 2DWDC 2GTSA 1RM1B 3U0ZA 2EJRA 3B8NA 3RFRA 1XL4A 1R6KA 2PYJA 3IC7A 4YJ2A 1M4UA 4NYKA 4DV5O 2YIBA 4AILC 3AK3A 5CBGA 3ABLC 1D2DA 4NXNO 4DV1O 3E2EA 3OTOO 1QCEA 4GCZA 3KCYA 4WBNB 5K1XA 1B3QA 4IIJB 1J95A 5BY1A 1Q6IA 4LF7B 5IE9A 5HFMA 2AW9A 4JV5B 2P22C 2EIMB 1VQNV 3F7VC 2DW4A 2GUZB 4LF4O 4JI4B 1FXKB 1XNRO 1M57C 1AR1B 4LNUA 4IHJA 1AP6A 3OFNG 1DLBA 3JARA 2A79B 4ZOLB 3R65A 4W4LA 1N0JA 1M9NA 5IJ0B 1K4DC 2WLLB 5L3EA 1IBMO 1GN4A 1IXMA 1ORQC 2CAZC 1XMOO 3KZIZ 2CDYA 4QPJA 5LBQA 3K9AA 4KUMA 3FAVA 2IBZH 1GRJA 4DV3O 3LUTB 3MD0A 4O2AA 4LFBO 3OE7G 5IDJA 4DR2B 4XDKA 4JI8O 3E8FA 3K5NA 5L3BA 4RUEA 1QLEB 4O4IA 4N23A 1N36B 2ILMA 4UFZA 4I7ZB 2ADQB 4DV7O 5J2TB 4LFCO 3APOA 4LWSA 4RQFA 3ETDA 3C90A 1K8AW 2AGAA 3HKDA 5FLXN 3JSLA 2QWRB 1NBMG 2ZKOA 1J5EO 1VP7A 2WAMA 1YVWA 2LP7A 2P06A 1COWG 3OR7C 2UUAB 1CP9A 3CYOA 2W0FC 3ASOC 2DQ3A 3SPGA 3HB3B 1GH6A 3HKEB 4J7KA 2ZE8A 2IJIA 1BMFG 3AK1A 3QO8A 3O9OA 3ZS8C 4GX0A 1N8RW 3DC6A 3JYCA 1VF6A 1ZX3A 2HHHO 2EINC 4UCUA 2JGDB 5EBLC 1TAEA 1NQTA 3BA9A 2KSDA 3JD1A 3AG2B 3W7TA 3Q4HB 2F95B 3OEEG 3SYQA 4RO2A 1A32A 3H1JH 4OX9B 2VQFB 3TXSA 4FLUA 5J2UA 3ASNB 1Q5OA 1I5XA 3WG7B 3KCXA 1JOYA 2HJDA 1R6NA 4O2AB 1DK1A 4X1KB 2JVDA 2DE0X 2F4VB 1H2NA 1RP3B 3F5WC 1BCCH 2AHYA 2JRIA 4YIPA 4CBCA 3CMAV 3HKBB 5D5QA 4JTDB 5IJ0A 3KKYA 2JJ2G 3B77A 3T1HO 3E35A 2Q68A 1YF2A 2IH3C 5H9CA 2ARHA 2IU3A 5BMVA 4UVAA 3ZRVA 1YSCA 3VQVA 3LNNA 1Z2GA 2YS8A 4FLZA 3L9DA 3FKSG 2EINB 4J42A 1GM7A 1QQCA 1ZWIC 3BAAA 3N27A 4MVOA 1DF4A 2WLKA 5KAFZ 3CJHA 4PHZA 4XDLA 2D2CB 3CCSV 1R3IC 3ZHSA 5TISZ 4DR1B 2ZNIA 4NTWA 2A7WA 1K4CC 2GTAA 1WPBA 1FFXA 2OT5A 3OR6C 4DV0O 2FMLA 4YJ3B 4WCEV 2GBOA 5IYCO 4YJ2B 2IJKA 1BHAA 4RQEA 1OHHG 2HG5C 3W7XA 5A9GA 5FPRA 4LFAB 2QDOA 1K73W 5KA6A 1XI1A 2KG7B 5J9PC 3C3TA 4JI3O 5LOVB 1YXBA 3JATA 3TETA 4K8XA 2BOBC 2CGOA 3K59A 1N36O 4TUYA 1AROP 2MK3A 3E8BA 5LMUB 1BE3H 3FX7A 4E2LA 2ZD9A 3F5TA 5HFLA 5GONA 1RSOA 1R73A 4W4KA 1Y66A 1FJGO 2RJZA 3RYHA 4MVMA 2YICA 2OIEA 3CCMV 3RYFA 4YHHB 4ICGA 1S5JA 2R72A 1J5EB 1LNQA 3E8GA 2R9RB 4Q6GA 2Q0AA 4ZHQB 4DUYB 2P7TC 4K0KO 1TUEB 4B08A 4F4LA 1GKFA 2GDSA 3FB5C 4OPAA 1L8DA 5JWPA 4UCRA 2Q5ZA 1V55C 5LL6Y 2VWKA 2P4VA 3LSSA 5GTHZ 1Q6HA 1NTZH 4I0XA 4X1YB 2V7QG 2E76B 1PP9H 5FNVA 4MVSA 2YXYA 1XMQO 4O4HA 3L71H 2ZIOA 4JI0B 5L3CA 4LF6B 3UT5B 1DGSA 1YZBA 1HNZO 5BXZA 3L74H 1Y67A 5BZBA 1BSMA 2UU9O 1Q43A 1UPGA 2OCCC 3RVYA 2X0LA 5K1PA 1H2GA 4K35A 1AI4A 1GO3F 1QR8A 3SYPA 3EXAA 3RYCA 4DR5B 3RN4A 4TUYB 4K0KB 4I4TA 1G8MA 3CSXA 4WFFA 4EFEA 1L0LH 1JQ0A 3G67A 1S5LZ 1KD1W 2ZE6A 1JFFB 4DR7B 2L35A 1IBLB 2CTRA 3ZCCA 1VQ6V 2ITDC 4D6TH 4FLXA 1GN3A 3FFQA 3E89A 2KG7A 4GKJO 4LF6O 2YUAA 4FJCC 5LHHA 1OV9A 2EULA 4TT3G 1WA8B 4JYAB 4NR1A 4O4JB 4D7SA 4F6RA 2QEXV 4LF7O 2HVJC 3BRCA 1OZ0A 1WA8A 1Q6UA 1VQPV 2JIZG 3H1HH 1YIJV 3X2QB 4WFHA 1R3KC 3HKCB 4AQYB 1M57B 1XNRB 4JPRA 1BT8A 4MTXA 5KA5A 4DR3B 1VQ5V 1PPJH 1N4CA 5IWAB 5JVDA 1BS3A 2ZR3A 2HR3A 4JI3B 2F43G 5ITZB 2QA4V 1IX9A 2P6JA 3BABA 3CB2A 3H9VA 3E8HA 2EZOA 3WFVA 3B40A 4FVMA 2Y4UA 4GLXA 4R6ZA 2UXCB 2Q4PA 1SQXH 3CX5F 2NNUA 3W7SA 1XHXA 3SPJA 4B3SO 4MVQA 4ZI7B 3OUFA 2WLIB 5KMGA 4UV9A 4FZ1A 3QF7A 2EIKC 1Q8IA 1NS1A 1KKDA 3CE2A 2X6CA 3NR7A 5EC1C 1OCRB 4DV4O 3JALB 2FYUH 3RGBA 2LGQA 1XILA 2BE3A 2DN9A 5LA6A 3CCVV 4HNAA 4J7ZA 3CMEV 1RFYA 2OWOA 4J9YB 3VQYA 1P7GA 5LP6C 3H1LH 4ZHQA 1YHQV 3K5MA 2Y48A 2X6AA 2P90A 3SJQC 2DYRB 3OTOB 2N05A 2UUBO 2QWOB 4PDLA 1SKVA 3JSNA 5EBMC 1JX9A 5C93A 4DR4O 2XAQA 3CC2V 2ZE5A 2PTMA 5D5PA 4O2BA 1AVMA 3LNMB 3RYFB 3P3PA 3VQWA 4FM2A 4JI0O 4RUFA 1EFRG 2OTJV 4GX1A 1RSOB 4NVPA 1QVGU 4GT1A 1U97A 1N33B 1NR1A 5CN0A 1IBLO 2IJHA 3OGCC 2HHHB 3JAWB 4JV5O 5IYZB 4OGQB 1ZTEA 4UVCA 3IAYA 1HNXO 2EILB 3KG2A 2CK3G 2YC0A 4O4IB 4CH3A 1M93A 1SA0A 2QKAA 2PI5A 2LW1A 1HDJA 1N34O 4LH7A 4XBFA 1Y76B 2HVKC 4X62B 1OCOC 3H1KH 2XAGA 3P30A 1WN7A 1R3JC 3BHPA 5KHIA 1GMGA 3FAVB 1NI8A 3D36C 1QHTA 1VQMV 2OTLV 1MABG 4MTGA 3EVKA 4JI6O 2YXLA 1SZXA 1KB9F 1XEQA 1ZLZA 2DWEC 1Y74B 3IJ4A 4B3MO 5LGUA 2JGUA 3TJTA 4PA4A 1AI7A 2XUMA 3ZHTA 1KU9A 2F1MA 1SC5B 1NT2B 2E5LB 3RT3C 4J10A 2ZNJA 4DV7B 4NXMO 3CP1A 4FFKA 4IIJA 2RDCA 1HWYA 1QLNA 4IYIA 3ETEA 4P2ZA 3DC5A 4G27B 4HZ3A 3CCLV 1VQKV 4DO2A 1OCZB 3OGIB 3LDEA 2XNDG 3K58A 1MOFA 2XASA 4X1KA 2OIGA 2A9HA 4DR6O 3ZX6A 3D8CA 5IYZA 4PV1B 3A8TA 5DN6G 1YJWV 3ASNC 1M90W 2A06H 3HR0A 3LSUA 2N74A 1EN5A 4KL1A 4MSWC 4I55A 5CMUA 3CCJV 1WAZA 4LC1A 4LF5B 4P9PA 5CA0A 4Z1VA 2PGGA 1BZKA 4NB5A 3E83A 1OCCB 4Z1MG 1THZA 2E5LO 4U7NA 2PY5A 3K08A 2HLDG 1K9MW 1R1BA 1ROPA 4N21A 4LP8A 1ENVA 3P3NA 1I5YA 5IJ9A 5DEDA 4BIUA 2QTSA 4X65O 4FLVA 3AG7A 4HNAB 1JPXA 3J80N 1F23A 4K8ZA 3T1CA 3ABUA 3BA8A 4ABMA 4FLTA 3JASB 1XUQA 1Q3EA 2R70A 3ABTA 2HJFC 4GYCB 4G28B 4UV8A 4B3RO 3DTUB 4DUZB 1I0HA 5IT9N 1Y74A 2G38A 1TUBB 4JI5O 5GTIZ 3ABKC 2WLIA 4ZI7A 1QVFU 3T4DA 4DV1B 1ZL8B 1H2LA 5B1OA 1PD3A 4KHPO 2P4KA 3G80A 4FM0A 4O4LA 4I9WA 1P84F 1YJNV 3ZMSA 2ZCEA 2H3OA 4FK5C 1XMQB 1ZL8A 1VQ4V 2UUAO 4NXNB 3O65A 2W0XA 4J80A 4X20B 4BW5A 2FL4A 4HBNA 1GM9A 5IYBO 3JARB 1F4NA 2EIKB 3DSQA 5B3SB 2EIJC 4CS3A 4QE9A 1Q90D 5IY5C 2P67A 4B3TB 1K33A 3G6EV 1KP2A 4GKJB 1AB3A 2F4VO 4TV8B 1MSDA 1X59A 4CC6A 3K57A 3IC9A 2QM4A 1K5QA 4O4JA 1I94B 4YIOA 1VQ8V 5EBWC 3WB2A 2L6LA 5H6QA 4IYHA 1G6UA 5H5NA 2QWQB 2D3OW 5IYDO 3N2KB 5H6RA 5LYJA 2CUGA 2B9ZA 2X7RB 4BAYA 3QG5A 2QR4A 4JF3A 4X88A 5AG2A 4YY3O 1TGOA 1OCZC 2ZDIA 4BWAA 2R9AA 2XAJA 1JA8A 2B1IA 5LA6B 4WF9V 5DM6V 4FMTA 1KC8W 4LBEC 1NVPD 5CA1A 4JGSA 2WA3A 2PI4A 4G2KA 3JALA 1WNSA 3IGAC 4H37A 2CTQA 3JD2A 4DRXB 4LR3A 1EZVH 3SJCC 1YEWA 3ML0A 4B3SB 4FLYA 1TVKA 1HR0B 1W0KG 3ZMVA 4EEQA 5FNVB 4MVZA 3ABLB 2RQ6A 2QKSA 2UU9B 1T5EA 1N34B 1JMKC 3ASOB 4YY3B 2UUCB 1WP8A 1SQBH 3K3WA 2X6BA 1KECA 4EB6A 4JI2O 4UCOA 4UUJC 3G6BA 2ITCC 5LGTA 3F7YC 2Z5UA 3ZHUA 4MW8A 2YEVB 2UXBO 1XNQO 2CE4A 1VF5B 3APQA 1VMGA 3SDLA 1N32B 3J7AU 5JJJB 4X8AA 3VOUA 4U7OA 4H13B 2BTQB 3SYAA 1L0NH 3UM7A 2CTWA 4TOIA 3OMIB 5KMGB 4U3JA 1WPXA 2B5UA 5F2VO 5LP6B 4DV3B 4P30A 2NLJC 2QWPB 2UXNA 4FLWA 3AG3B 1D5AA 3K04A 3RYHB 4TV9B 1XOUA 1QLEC 5LGNA 4YHHO 1TA8A 4FZ0A 2EIJB 2ZM6B 3ZRWA 4A5UB 2Z0AA 4DK1A 4JTCB 4JI8B 4I50A 2VQEO 1DF5A 3CRMA 1YITV 4PI0A 4B7KA 4JI7B 3JAWA 3B8MA 3LDDA 2IH1C 1I7FA 3JD4A 1XNQB 5JQGA 3G4SV 3T1YB 3A2FA 1B6QA 5E79Z 1UFIA 2E74B 4Z2WA 4MTOA 3BY6A 2IU0A 2QM7A 1SS3A 4ZKIA 2QTOA 2XOKG 3ZMUA 2XHBA 2VWJA 3SGIA 1BQZA 2UXCO 2H8PC 3CWBH 2ZQMA 4U3JB 4O4HB 1NR7A 3S3WA 2HEPA 3B4SA 2GSMB 1Q7YW 2GV9A 2YSUB 1AJNA 4MVRA 2LFSA 2YIBD 4IL6Z 2Q73A 5B66Z 3WU2Z 4PI2A 4X64O 1IDSA 2ZM6O 1VQOV 3ZHRA 4JI6B 3QO7A 3RYCB 4HAMA 4PDRA 3E86A 4IGGA 1CXZB 1FD9A 4DW0A 3GB7C 4JI7O 1IBMB 1G1XB 1XMOB 3FYIB 1S3JA 1ZAUA 3QTCA 4B3RB 5KHJA 3SPIA 3J81N 1S0VA 1FYJA 2WLNA 1NZ6A 1VEWA 2DQ0A 2PZSA 3K0DA 4DR2O 5KX5B 1MNGA 4QGPA 2UXDO 4GKKO 1PNMA 4DR6B 4AQYO 3LSQA 1E1QG 3U10A 5B3SC 1IURA 4DRXA 1N0NA 2JDIG 4DYLA 5IWAO 5CA1B 3T1HB 4CH6A 1SERA 4EFBA 1W59A 3W7UA 1YJ9V 5KHKA 1NTMH 1CPYA 3RBZA 2ETNA 2WPDG 1IBKB 2JS5A 5EIBC 2HFEC 2R9IA 1AI6A 2YI9A 2YXHA 1K5SA 3TK1A 3CEIA 4JASA 2YDEA 2EX3A 4CH5A 1XQ8A 5BR8O 3N2KA 1AR5A 2IW5A 3CC4V 2AXTZ 2YIDA 3B2EE 4P9OA 5LXTA 1G4YB 3QO5A 4DW1A 3HKDB 5KUKA 4TV8A 4NTXA 1EN6A 1WB7A 3T4ZA 5JQGB 4YJ3A 1Z5VA 2JJ1G 1Y6XA 5E1AC 5B1NA 1Q82W 1O9GA 4OX9O 1PNLA 5CA3A 3T2MA 3M99B 1E79G 4X20A 2CH7A 1YTFB 1V54B 1KUQA 2VQEB 1UJWB 3OM3B 4NTYA 2RNBA 1RPRA 2H94A 2LO1A 2WLMA 3I55V 2IJJA 1SQVH 3UQ8A 1I08A 1H8HG 2YIAA 4TV9A 4CZZA 5LMUO 2JS3A 1JVMA 4JI1O 2BSKA 2DYSB 3EHBB 4NXMB 3TGUH 2DJVA 4R8CA 2K9PA 5LP6A 3A0BZ 1FFXB 1KBHA 1TUBA 3ZMTA 4DR4B 3ABMB 3UKMA 2ZT9B 3RYIA 1GN6A 1W2BU 4PJ0Z 3WB0A 4LNUB 2OYQA 4DV2O 3K06A 4I0XB 1H2MA 2LW7A 3CJHB 4DXWA 2V4DA 1YI2V 4LF5O 4GX2A 2Q8VA 2EJ7A 1AI5A 3OAAG 1SF9A 3CRCA 2UXBB 2DMXA 1P49A 5BMVB 4JYCA 3DXRB 1I94O 3AG1B 4KP4A 4LH6A 1S77D 2ODMA 1EZJA 2BTOA 4TSFG 1K97A 3W7WA 2VRZA 4JYYA 3OMNB 3MHHC 3K5OA 1QBZA 1F51A 3MHSC 3SYCA 2OCHA 1SQPH 5J2UB 4B7EA 5IY5B 1HNZB 3STLC 3L73H 4I55B 5FL7G 1JR9A 2JEUA 2PUSA 2LGWA 3MDSA 4LWSB 5KHGA 2JGDA 1LR1A 3C3SA 3M8AA 2FB5A 3AG4B 5KUMA 3TCUA 1PL4A 2W6IG 1H2KA 2VS0A 2WWWA 2P5OA 5LYJB 4MT8A 4GX5A 2Q69A 4PELA 2IM9A 4UXNA 2NR5A 2JEXA 4JTAB 1ZUQA 2MW2B 4X66O 4YXWG 3AG2C 4D7TA 3M7MX 4J7JA 3EFFK 1M5IA 4DUYO 4KHPB 4PA3A 3X2QC 2M6YA 1K7DA 4WFBV 3D3QA 2Q9LA 2XT9A 3ZRSA 5C8YA 4WFAV 4ZOLA 4JI2B 4IHJB 1SZTA 1V54C 3P32A 1JCHA 4X64B 2ZR2A 4J41A 1BL8A 3AG4C 4WFGA 4K3AA 4J9ZB 5KLVH 3RVZA 4CS4A 3GVMA 4QIWF 3GWKC 3RYIB 5DECA 4O4LB 4LF8O 1OCOB 1LUVA 3PJSK 4X65B 3CCUV 3ZBHA 4Q20A 2ATKC 4LF9B 1XDCA 2PYLA 4LCUC 3JD0A 1M56B 3HKBA 2WLLA 5JCOC 1H2SB 4DV5B 4ZBMA 1OCRC 1KMIZ 4QPKA 1FAFA 4R50A 4LFAO 4AHCA 2YI8A 3ZRXA 1MZEA 1GAXA 3FB6C 3VBBA 3ICXA 2CTPA 2AZ2A 1BHBA 2KKWA 3JASA 2OCCB 4PDVA 2CH7B 4DV2B 1JJOA 5BR8B 1FJGB 1EN4A 4JZGA 3ZN1A 2F23A 2XAHA 5C8YB 3CCRV 4X89A 3WG7C 4QNHB 4JYAO 4O2BB 4DUZO 2XAFA 1VF6C 1Q81W 5IJ9B 2K1EA 3H1IH 4H44B 2PF4E 3LDCA 2EIMC 3G71V 4TQFA 3ZEDA 2EZPA 1IZ3A 5KAIZ 1DTOA 5CA0B 3ZHVA 2FKXA 4PDMA 2UUCO 4LFBB 3OEHG 1YTFD 1GK9A 2QSAA 5EYPA 1GN2A 3AK2A 1YDXA 3FYEB 3SPHA 1NKDA 1D5NA 5J2TA 1HNXB 1HNWB 2HKOA 1EM1A 1Z5WA 4DV0B 3NXSA 1JJ2U 1N33O 1MG1A 3MAQA 1Q86W 1AR4A 1NH2B 2Q6AA 4UCTA 2M7WA 2Y0PA 4JYBA 4I9QA 1HW7A 4I5SA 4PD4F 1FXKC 5FPOA 2RN9A 4GZRB 4JAVA 3JD3A 2Z3YA 2ZINA 5EZYA 2Q7EA 4J11A 4UB6Z 2E3CA 1WJZA 1FFTB 4JI1B 2JK5C 3BCCH 2LQTA
chains in the Genus database with same CATH topology
2ZQMA 3LNMB 1NR7A 3OE7G 5IDJA 2GSMB 4XDKA 1Q7YW 3E8FA 2YSUB 4MTFA 3BEHA 1AJNA 4RUFA 1EFRG 2Q67A 4GX1A 2OTJV 4MVRA 2Y69B 5L3BA 4RUEA 2LFSA 1QVGU 1QLEB 4GT1A 4N23A 3ZMZA 5EK0A 1VQOV 1NR1A 3QO7A 1GTOA 5CN0A 4HAMA 2IJHA 3E86A 3OGCC 4PDRA 1FXKA 4UVCA 3GB7C 4RQFA 2EILB 3KG2A 3ETDA 1PL0A 1PKXA 2CK3G 1F4MA 1SRYA 3D36A 1K8AW 3FYIB 1S3JA 2ZDIC 2PI5A 1NBMG 2ZXWB 4PA9A 1PNKA 3SPCA 1GM8A 3SPIA 4XBFA 1S0VA 2HVKC 1KP3A 3ABMC 2WAMA 2WLNA 2LP7A 2DQ0A 1OCOC 3K0DA 1AJPA 2XAGA 1COWG 3P30A 1R3JC 3OR7C 4MVUA 1CP9A 1GMGA 3CYOA 2W0FC 3ASOC 1PNMA 2DQ3A 2DYRC 3SPGA 4PA7A 3HB3B 3LSQA 1VQMV 1E1QG 1BMFG 2IJIA 5B3SC 2QE7G 2OTLV 1MABG 3QO8A 1FXHA 2JDIG 4MTGA 3ZN0A 4GX0A 1N8RW 3JYCA 2EINC 4MW3A 4UVBA 2DWEC 1SERA 4L87A 1CEZA 5EBLC 3W7UA 1NQTA 3K03A 5LGUA 1YJ9V 1CPYA 3RBZA 1FXVA 1XL6A 4PA4A 3JD1A 3AG2B 2WPDG 1AI7A 3W7TA 3OEEG 3SYQA 4RO2A 2HFEC 2R9IA 1AI6A 1M1KW 3ASNB 1K5SA 3TK1A 1RM1C 1I5XA 4JASA 3WG7B 1JOYA 3ZRWB 3CP1A 1WLEA 1R6NA 3FB8C 5B1AB 1VQLV 2IW5A 3CC4V 1HWYA 1QLNA 3ETEA 4P2ZA 4P9OA 3F5WC 2AHYA 4G27B 4RAIA 3SYOA 4CBCA 2WLJA 4HZ3A 3CMAV 3CCLV 1G4YB 3QO5A 1VQKV 4DO2A 1OCZB 3LDEA 4JTDB 2XNDG 1MOFA 2JJ2G 3B77A 5KUKA 3E35A 2Q68A 2XASA 2EILC 1H8EG 2IH3C 5H9CA 1E1RG 4QJFB 3T4ZA 2IU3A 2A9HA 2JJ1G 4UVAA 3ZRVA 1YSCA 5E1AC 1S76D 3IFXA 5B1NA 1Q82W 5DN6G 3FKSG 2EINB 1YJWV 1GM7A 3ASNC 1M90W 1PNLA 1ZWIC 5CA3A 4MVOA 1DF4A 2WLKA 3D3IA 3T2MA 3M99B 1E79G 2EBOA 4MSWC 5L3FA 4XDLA 5CMUA 1YTFB 1V54B 3CCJV 1R3IC 3CCSV 1UJWB 3OM3B 4LC1A 2YEVA 1RPRA 4FPPA 2H94A 4P9PA 2WLMA 3I55V 2IJJA 2WLHA 1K4CC 3E83A 5GW7A 1OCCB 2OT5A 1H8HG 3OR6C 4R7CA 4Z1MG 4CZZA 1THZA 2WSSG 1JVMA 4WCEV 4U7NA 1S5HC 1L1FA 5IYCO 1NH2D 2DYSB 3EHBB 3K08A 2HLDG 1K9MW 2IJKA 1ROPA 4N21A 4ASUG 4RQEA 1BHAA 4LP8A 1ENVA 1OHHG 2HG5C 4R8CA 1I5YA 3W7XA 4BIUA 4TWKA 1K73W 3ZMTA 5KA6A 5LHIA 1JPXA 3ABMB 3UKMA 1F23A 2A0LA 1W2BU 2Y69C 1NJIW 3AG1C 3T1CA 5J9PC 3ABUA 1K34A 3CC7V 3K06A 4DXWA 2LFRA 3TETA 1YI2V 4GX2A 5CBFA 2BOBC 2GHYA 3ABTA 2HJFC 1AI5A 3OAAG 4G28B 4UV8A 3DTUB 1AROP 2MK3A 3E8BA 4E2LA 2ZD9A 4HYOA 4JYCA 5HFLA 1Y4MA 1R73A 1Y66A 3RW0A 3ABKC 3AG1B 2WLIA 4KP4A 3STZC 1P7BA 1RPOA 4MVMA 1QVFU 3T4DA 3CXCU 1S77D 1EZJA 5B1OA 3CCMV 1PD3A 4H33A 4TSFG 1K97A 4XDJA 5LHGA 4I9WA 3W7WA 3OMNB 3MHHC 1YJNV 1VQ7V 3ZMSA 5EC2C 1QBZA 1LNQA 1V55B 3E8GA 4FK5C 1F51A 3MHSC 2DYSC 2R9RB 3SYCA 4WFEA 4EKWA 1VQ4V 1S72V 5IY5B 2FTKA 2W6JG 3ABKB 1QR9A 3STLC 1R3LC 2P7TC 4BW5A 3CD6V 3ZJZA 5FL7G 1GM9A 4FIPC 5IYBO 1F4NA 2EIKB 2JEUA 1TUEB 5B3SB 4F4LA 1OCCC 1GKFA 2EIJC 1VQ9V 4QE9A 3CCEV 3FB5C 5IY5C 3GWOA 4KFMA 3AG4B 5KUMA 2P67A 1P4RA 1K33A 3TCUA 1AJQA 1V55C 1K92A 2W6IG 3G6EV 1KP2A 3DGEA 3LSSA 2WWWA 3CCQV 1W0JG 2V7QG 3HPLC 1NVPB 4MT8A 3I56V 4GX5A 2Q69A 3K0GA 1SETA 4PELA 1K5QA 4UXNA 2JEXA 4JTAB 1VQ8V 4MVSA 5EBWC 3A0RA 5H6QA 3JCZA 4YXWG 3AG2C 5L3CA 2D3OW 5IYDO 3EFFK 5H6RA 2B1GA 2X7RB 4PA3A 4BAYA 5BZBA 4JF3A 4X88A 3X2QC 3ZIAG 2OCCC 3RVYA 3OUSA 3OMAB 2QM8A 1K7DA 2X0LA 4WFBV 1SESA 1H2GA 1OCZC 1AI4A 2ZDIA 1GO3F 1QR8A 5B1BC 3ZRSA 2C2AA 4WFAV 3SYPA 2XAJA 2B1IA 4WF9V 1SZTA 4FMTA 5DM6V 4LBEC 1V54C 2KB1A 5L3GA 1KC8W 3K79A 3P32A 5B1AC 1NVPD 1G8MA 1JCHA 1K3EA 1FS0G 3QNEA 2V1DA 4JGSA 4WFFA 2ZR2A 4G2KA 2PI4A 1JQ0A 1BL8A 3AG4C 1KD1W 3IGAC 2UXXA 4H37A 4J9ZB 4WFGA 3JD2A 3ZCCA 3OW2U 1VQ6V 3RVZA 2ITDC 3ML0A 3ETGA 4QIWF 3E89A 2AHZA 4QE7A 1MSWD 4FJCC 1W0KG 1OCOB 4JAUA 5LHHA 3PJSK 4TT3G 3ZMVA 3CPWU 3CCUV 4Q20A 2ATKC 4MVZA 3ABLB 4LCUC 2QKSA 3JD0A 5CBHA 3AG3C 3ASOB 1M56B 2QEXV 2WLLA 1KQSU 2HVJC 5B1BB 1H38A 1EBOA 1OZ0A 3K3WA 2X6BA 1KECA 4ZBMA 1OCRC 4QPKA 1VQPV 2JIZG 1YIJV 4PA6A 3X2QB 4UUJC 4WFHA 1R3KC 4OXSA 4R50A 4MS2A 1M57B 3AEIA 1M56C 2ITCC 5LGTA 3F7YC 3ZRXA 2Z5UA 3FB6C 4JPRA 3VBBA 4MW8A 4MTXA 2YEVB 3FB7C 5KA5A 1BHBA 1VQ5V 2OCCB 4PDVA 2BOCC 2ZR3A 2HR3A 2ZXWC 3H01A 2F43G 4BIZA 5L3DA 2QA4V 4X8AA 2P6JA 3ZN1A 3VOUA 2XAHA 4U7OA 2DWDC 3CCRV 3E8HA 2EZOA 4X89A 3WG7C 3SYAA 4QNHB 3UM7A 3WFVA 1RM1B 4R6ZA 3OMIB 2EJRA 2XAFA 1WPXA 2B5UA 1Q81W 2K1EA 4P30A 3B8NA 1XL4A 1R6KA 2NLJC 3IC7A 2UXNA 3AG3B 2NNUA 3LDCA 3W7SA 3SPJA 5CBGA 3ABLC 4MVQA 3K04A 3E2EA 3OUFA 2WLIB 1QCEA 4GCZA 4UV9A 1QLEC 5LGNA 2EIMC 3G71V 2EIKC 2EZPA 1DTOA 1KKDA 2EIJB 1J95A 4PDMA 3ZRWA 2X6CA 3OEHG 5HFMA 1YTFD 1GK9A 4JTCB 5EC1C 3FYEB 1OCRB 1DF5A 2EIMB 3SPHA 1VQNV 3F7VC 1NKDA 1YITV 2DW4A 2HKOA 1FXKB 3B8MA 3LDDA 1M57C 1AR1B 2IH1C 3JD4A 3NXSA 1JJ2U 1MG1A 3OFNG 1DLBA 1Q86W 3CCVV 1NH2B 2A79B 3G4SV 2Q6AA 3CMEV 1B6QA 3R65A 2M7WA 4J9YB 4JYBA 1M9NA 1YHQV 4I5SA 2Y48A 2X6AA 1K4DC 2WLLB 2P90A 5L3EA 4MTOA 1FXKC 3SJQC 2DYRB 3JD3A 4JAVA 1IXMA 2Z3YA 1ORQC 3BY6A 2IU0A 4QPJA 4PDLA 5EBMC 5LBQA 2QM7A 1JX9A 4ZKIA 3K9AA 5C93A 2QTOA 2XOKG 4KUMA 3ZMUA 2XAQA 3CC2V 3LUTB 1FFTB 2H8PC 3MD0A 2JK5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ V;  3CCS V;  2QEX V;  1KQS U;  1JJ2 U;  1KD1 W;  3G71 V;  2QA4 V;  3G6E V;  1VQM V;  3CCV V;  1Q86 W;  1K73 W;  1M1K W;  3G4S V;  3I55 V;  1VQP V;  1VQ4 V;  1Q7Y W;  3CCQ V;  3CCR V;  3OW2 U;  1S72 V;  2OTL V;  3CME V;  1VQ6 V;  1K8A W;  1YIJ V;  1W2B U;  1R73 A;  4WFB V;  1NJI W;  3I56 V;  1YHQ V;  2OTJ V;  1N8R W;  1QVG U;  1Q81 W;  1QVF U;  4WCE V;  3CXC U;  3CC7 V;  1VQL V;  3CD6 V;  4WFA V;  1Q82 W;  3CC4 V;  3CPW U;  3CCU V;  3CCM V;  1YJW V;  1M90 W;  1VQ8 V;  1VQO V;  1VQ5 V;  1YI2 V;  1VQN V;  1YIT V;  1K9M W;  1YJ9 V;  4WF9 V;  1VQ9 V;  5DM6 V;  1KC8 W;  3CMA V;  3CCL V;  3CC2 V;  3CCE V;  1YJN V;  2D3O W;  1VQK V;  1VQ7 V; 
#chains in the Genus database with same CATH topology
 2RCV A;  2QKC A;  4MTF A;  3BEH A;  3OT7 A;  5H2F Z;  4B3M B;  4DV4 B;  4JAA A;  2Q67 A;  4X1I B;  1HNW O;  1VF7 A;  2O57 A;  2Y69 B;  2ZIM A;  3ZHQ A;  3DXR A;  3ZMZ A;  3PN1 A;  1X4T A;  5EK0 A;  3RWR D;  4DR7 O;  1GTO A;  2RMK B;  1FXK A;  3OTF A;  1VAR A;  3U11 A;  2GUZ A;  3HKC A;  4DR5 O;  4IT5 A;  3THO A;  1QU7 A;  2Y4T A;  1PL0 A;  1PKX A;  1F4M A;  1SRY A;  4U3F H;  3D36 A;  4UCV A;  2ZDI C;  3A0H Z;  2ZXW B;  4PA9 A;  3BPZ A;  5LMN O;  1PNK A;  3SPC A;  1GM8 A;  3ABM C;  1KP3 A;  4WBN A;  1BQ0 A;  3N2G A;  4NKG B;  2CGN A;  1AJP A;  1Y76 A;  2AZ0 A;  4MVU A;  1NTK H;  1HR0 O;  1KYO F;  2UUB B;  2DYR C;  1SA0 B;  1BGY H;  4PA7 A;  2BSK B;  2HP8 A;  2QE7 G;  4DK0 A;  1FXH A;  5CB4 A;  3QVN A;  3ZN0 A;  3B09 A;  4DV6 O;  4I4T B;  4FFB B;  4MW3 A;  4UVB A;  4L87 A;  4B3T O;  1CEZ A;  3K03 A;  1FXV A;  1XL6 A;  4FFB A;  4H0L B;  1OJH A;  2F93 B;  1URF A;  4FM1 A;  3WB1 A;  3OD4 A;  4DR3 O;  4RWU A;  1M1K W;  4CH4 A;  1RM1 C;  4X62 O;  2ZE7 A;  3ZRW B;  4LFC B;  1WLE A;  3FB8 C;  3L75 H;  5B1A B;  1AP5 A;  1B04 A;  1VQL V;  4RAI A;  3SYO A;  2WLJ A;  2F66 C;  3S3X A;  1FPO A;  5LMN B;  3CXH F;  2Q7G A;  1WP7 A;  4BW9 A;  5LXT B;  4DV6 B;  4X1Y A;  2EIL C;  1H8E G;  4QJF B;  1E1R G;  1U96 A;  2A3Q A;  2XTA A;  2QWN B;  4JI4 O;  1S76 D;  3IFX A;  1WB8 A;  1XHZ A;  2WA4 A;  3JAK B;  3L70 H;  1SQG A;  3D3I A;  2Q7H A;  3ETQ A;  2EBO A;  5L3F A;  4X9Q A;  4L8J A;  4X1I A;  3JAK A;  3CHX A;  2YEV A;  4FPP A;  3K9S A;  2WLH A;  1IBK O;  5GW7 A;  3FD9 A;  2ADP A;  4R7C A;  2WSS G;  1S5H C;  1L1F A;  1NH2 D;  1PV0 A;  3I5D A;  3SR2 C;  1O9H A;  1PM9 A;  4ASU G;  3VQX A;  5KX5 A;  5GON B;  4TWK A;  5LHI A;  4JZ2 A;  2A0L A;  5ITZ A;  2Y69 C;  1NJI W;  3AG1 C;  1K34 A;  3CC7 V;  1N32 O;  5JVD B;  3E22 B;  3TXQ A;  2LFR A;  4DR1 O;  5CBF A;  2E75 B;  5JJE B;  2GHY A;  3CS5 A;  5EYP B;  1V9P A;  4UCS A;  2Y0I A;  4HYO A;  1Y4M A;  3RW0 A;  3STZ C;  1P7B A;  1QNM A;  1RPO A;  4GKK B;  3CXC U;  4F6R B;  4H33 A;  2Q0O C;  5B5E Z;  1XRE A;  5JH7 B;  4XDJ A;  5LHG A;  1IVS A;  1VQ7 V;  5EC2 C;  5JH7 A;  1V55 B;  3CRR A;  2DYS C;  1KKC A;  4WFE A;  4EKW A;  3K5L A;  1US6 A;  1S72 V;  2UXD B;  2FTK A;  2NN4 A;  1JFF A;  2W6J G;  3L72 H;  4BR6 A;  3ABK B;  1QR9 A;  5JJN B;  4LF4 B;  1R3L C;  3SJA C;  2N04 A;  3CD6 V;  3ZJZ A;  4FIP C;  3JAM N;  4CS2 A;  1OCC C;  1VQ9 V;  5JCO A;  1AIL A;  2BCC H;  3T1Y O;  3CCE V;  3GWO A;  4KFM A;  1ZSP A;  4CC5 A;  1YCI A;  1P4R A;  5KHH A;  1AJQ A;  1K92 A;  3UO2 A;  5CB4 B;  1F7Y A;  4I50 B;  3E22 A;  3DGE A;  2LJ2 A;  4LF8 B;  3CCQ V;  1W0J G;  3HPL C;  1NVP B;  4UB8 Z;  3I56 V;  1FKA O;  3UT5 A;  3K0G A;  1SET A;  3SJB C;  1SQQ H;  3UO3 A;  3N2G B;  3UCS C;  1MMM A;  1MZF A;  3A0R A;  4E4E A;  3JCZ A;  1MA1 A;  5A2Q N;  1SQF A;  4F6E A;  1LUW A;  4C7U A;  3CRA A;  4LF9 O;  2B1G A;  2QGN A;  3ZIA G;  3OUS A;  3OMA B;  2QM8 A;  1SES A;  3Q4H A;  2BTQ A;  5B1B C;  2C2A A;  1HP8 A;  3JCU Z;  3R66 A;  2KB1 A;  5L3G A;  3K79 A;  5B1A C;  1K3E A;  1FS0 G;  3QNE A;  2V1D A;  4TQD A;  2UXX A;  3OW2 U;  4KXR A;  1XBL A;  3HKE A;  1R6T A;  3ETG A;  2AHZ A;  4QE7 A;  4X66 B;  1MSW D;  2DOS A;  4JAU A;  4EB6 B;  3CPW U;  2KQX A;  5EZY B;  5CBH A;  3AG3 C;  4OPH A;  4BIO A;  2QJ1 A;  3BVO A;  5EIB D;  1KQS U;  5B1B B;  4ZIB A;  1H38 A;  1EBO A;  3BFR A;  1TVK B;  4PA6 A;  4AI8 A;  4OXS A;  4MS2 A;  3AEI A;  1M56 C;  3FB7 C;  2VQF O;  1VIB A;  3JAT B;  2BOC C;  5LOV A;  3CRQ A;  1IXB A;  2ZXW C;  3H01 A;  4JI5 B;  1B06 A;  4GUN A;  4BIZ A;  5L3D A;  1NU1 H;  2DWD C;  2GTS A;  1RM1 B;  3U0Z A;  2EJR A;  3B8N A;  3RFR A;  1XL4 A;  1R6K A;  2PYJ A;  3IC7 A;  4YJ2 A;  1M4U A;  4NYK A;  4DV5 O;  2YIB A;  4AIL C;  3AK3 A;  5CBG A;  3ABL C;  1D2D A;  4NXN O;  4DV1 O;  3E2E A;  3OTO O;  1QCE A;  4GCZ A;  3KCY A;  4WBN B;  5K1X A;  1B3Q A;  4IIJ B;  1J95 A;  5BY1 A;  1Q6I A;  4LF7 B;  5IE9 A;  5HFM A;  2AW9 A;  4JV5 B;  2P22 C;  2EIM B;  1VQN V;  3F7V C;  2DW4 A;  2GUZ B;  4LF4 O;  4JI4 B;  1FXK B;  1XNR O;  1M57 C;  1AR1 B;  4LNU A;  4IHJ A;  1AP6 A;  3OFN G;  1DLB A;  3JAR A;  2A79 B;  4ZOL B;  3R65 A;  4W4L A;  1N0J A;  1M9N A;  5IJ0 B;  1K4D C;  2WLL B;  5L3E A;  1IBM O;  1GN4 A;  1IXM A;  1ORQ C;  2CAZ C;  1XMO O;  3KZI Z;  2CDY A;  4QPJ A;  5LBQ A;  3K9A A;  4KUM A;  3FAV A;  2IBZ H;  1GRJ A;  4DV3 O;  3LUT B;  3MD0 A;  4O2A A;  4LFB O;  3OE7 G;  5IDJ A;  4DR2 B;  4XDK A;  4JI8 O;  3E8F A;  3K5N A;  5L3B A;  4RUE A;  1QLE B;  4O4I A;  4N23 A;  1N36 B;  2ILM A;  4UFZ A;  4I7Z B;  2ADQ B;  4DV7 O;  5J2T B;  4LFC O;  3APO A;  4LWS A;  4RQF A;  3ETD A;  3C90 A;  1K8A W;  2AGA A;  3HKD A;  5FLX N;  3JSL A;  2QWR B;  1NBM G;  2ZKO A;  1J5E O;  1VP7 A;  2WAM A;  1YVW A;  2LP7 A;  2P06 A;  1COW G;  3OR7 C;  2UUA B;  1CP9 A;  3CYO A;  2W0F C;  3ASO C;  2DQ3 A;  3SPG A;  3HB3 B;  1GH6 A;  3HKE B;  4J7K A;  2ZE8 A;  2IJI A;  1BMF G;  3AK1 A;  3QO8 A;  3O9O A;  3ZS8 C;  4GX0 A;  1N8R W;  3DC6 A;  3JYC A;  1VF6 A;  1ZX3 A;  2HHH O;  2EIN C;  4UCU A;  2JGD B;  5EBL C;  1TAE A;  1NQT A;  3BA9 A;  2KSD A;  3JD1 A;  3AG2 B;  3W7T A;  3Q4H B;  2F95 B;  3OEE G;  3SYQ A;  4RO2 A;  1A32 A;  3H1J H;  4OX9 B;  2VQF B;  3TXS A;  4FLU A;  5J2U A;  3ASN B;  1Q5O A;  1I5X A;  3WG7 B;  3KCX A;  1JOY A;  2HJD A;  1R6N A;  4O2A B;  1DK1 A;  4X1K B;  2JVD A;  2DE0 X;  2F4V B;  1H2N A;  1RP3 B;  3F5W C;  1BCC H;  2AHY A;  2JRI A;  4YIP A;  4CBC A;  3CMA V;  3HKB B;  5D5Q A;  4JTD B;  5IJ0 A;  3KKY A;  2JJ2 G;  3B77 A;  3T1H O;  3E35 A;  2Q68 A;  1YF2 A;  2IH3 C;  5H9C A;  2ARH A;  2IU3 A;  5BMV A;  4UVA A;  3ZRV A;  1YSC A;  3VQV A;  3LNN A;  1Z2G A;  2YS8 A;  4FLZ A;  3L9D A;  3FKS G;  2EIN B;  4J42 A;  1GM7 A;  1QQC A;  1ZWI C;  3BAA A;  3N27 A;  4MVO A;  1DF4 A;  2WLK A;  5KAF Z;  3CJH A;  4PHZ A;  4XDL A;  2D2C B;  3CCS V;  1R3I C;  3ZHS A;  5TIS Z;  4DR1 B;  2ZNI A;  4NTW A;  2A7W A;  1K4C C;  2GTA A;  1WPB A;  1FFX A;  2OT5 A;  3OR6 C;  4DV0 O;  2FML A;  4YJ3 B;  4WCE V;  2GBO A;  5IYC O;  4YJ2 B;  2IJK A;  1BHA A;  4RQE A;  1OHH G;  2HG5 C;  3W7X A;  5A9G A;  5FPR A;  4LFA B;  2QDO A;  1K73 W;  5KA6 A;  1XI1 A;  2KG7 B;  5J9P C;  3C3T A;  4JI3 O;  5LOV B;  1YXB A;  3JAT A;  3TET A;  4K8X A;  2BOB C;  2CGO A;  3K59 A;  1N36 O;  4TUY A;  1ARO P;  2MK3 A;  3E8B A;  5LMU B;  1BE3 H;  3FX7 A;  4E2L A;  2ZD9 A;  3F5T A;  5HFL A;  5GON A;  1RSO A;  1R73 A;  4W4K A;  1Y66 A;  1FJG O;  2RJZ A;  3RYH A;  4MVM A;  2YIC A;  2OIE A;  3CCM V;  3RYF A;  4YHH B;  4ICG A;  1S5J A;  2R72 A;  1J5E B;  1LNQ A;  3E8G A;  2R9R B;  4Q6G A;  2Q0A A;  4ZHQ B;  4DUY B;  2P7T C;  4K0K O;  1TUE B;  4B08 A;  4F4L A;  1GKF A;  2GDS A;  3FB5 C;  4OPA A;  1L8D A;  5JWP A;  4UCR A;  2Q5Z A;  1V55 C;  5LL6 Y;  2VWK A;  2P4V A;  3LSS A;  5GTH Z;  1Q6H A;  1NTZ H;  4I0X A;  4X1Y B;  2V7Q G;  2E76 B;  1PP9 H;  5FNV A;  4MVS A;  2YXY A;  1XMQ O;  4O4H A;  3L71 H;  2ZIO A;  4JI0 B;  5L3C A;  4LF6 B;  3UT5 B;  1DGS A;  1YZB A;  1HNZ O;  5BXZ A;  3L74 H;  1Y67 A;  5BZB A;  1BSM A;  2UU9 O;  1Q43 A;  1UPG A;  2OCC C;  3RVY A;  2X0L A;  5K1P A;  1H2G A;  4K35 A;  1AI4 A;  1GO3 F;  1QR8 A;  3SYP A;  3EXA A;  3RYC A;  4DR5 B;  3RN4 A;  4TUY B;  4K0K B;  4I4T A;  1G8M A;  3CSX A;  4WFF A;  4EFE A;  1L0L H;  1JQ0 A;  3G67 A;  1S5L Z;  1KD1 W;  2ZE6 A;  1JFF B;  4DR7 B;  2L35 A;  1IBL B;  2CTR A;  3ZCC A;  1VQ6 V;  2ITD C;  4D6T H;  4FLX A;  1GN3 A;  3FFQ A;  3E89 A;  2KG7 A;  4GKJ O;  4LF6 O;  2YUA A;  4FJC C;  5LHH A;  1OV9 A;  2EUL A;  4TT3 G;  1WA8 B;  4JYA B;  4NR1 A;  4O4J B;  4D7S A;  4F6R A;  2QEX V;  4LF7 O;  2HVJ C;  3BRC A;  1OZ0 A;  1WA8 A;  1Q6U A;  1VQP V;  2JIZ G;  3H1H H;  1YIJ V;  3X2Q B;  4WFH A;  1R3K C;  3HKC B;  4AQY B;  1M57 B;  1XNR B;  4JPR A;  1BT8 A;  4MTX A;  5KA5 A;  4DR3 B;  1VQ5 V;  1PPJ H;  1N4C A;  5IWA B;  5JVD A;  1BS3 A;  2ZR3 A;  2HR3 A;  4JI3 B;  2F43 G;  5ITZ B;  2QA4 V;  1IX9 A;  2P6J A;  3BAB A;  3CB2 A;  3H9V A;  3E8H A;  2EZO A;  3WFV A;  3B40 A;  4FVM A;  2Y4U A;  4GLX A;  4R6Z A;  2UXC B;  2Q4P A;  1SQX H;  3CX5 F;  2NNU A;  3W7S A;  1XHX A;  3SPJ A;  4B3S O;  4MVQ A;  4ZI7 B;  3OUF A;  2WLI B;  5KMG A;  4UV9 A;  4FZ1 A;  3QF7 A;  2EIK C;  1Q8I A;  1NS1 A;  1KKD A;  3CE2 A;  2X6C A;  3NR7 A;  5EC1 C;  1OCR B;  4DV4 O;  3JAL B;  2FYU H;  3RGB A;  2LGQ A;  1XIL A;  2BE3 A;  2DN9 A;  5LA6 A;  3CCV V;  4HNA A;  4J7Z A;  3CME V;  1RFY A;  2OWO A;  4J9Y B;  3VQY A;  1P7G A;  5LP6 C;  3H1L H;  4ZHQ A;  1YHQ V;  3K5M A;  2Y48 A;  2X6A A;  2P90 A;  3SJQ C;  2DYR B;  3OTO B;  2N05 A;  2UUB O;  2QWO B;  4PDL A;  1SKV A;  3JSN A;  5EBM C;  1JX9 A;  5C93 A;  4DR4 O;  2XAQ A;  3CC2 V;  2ZE5 A;  2PTM A;  5D5P A;  4O2B A;  1AVM A;  3LNM B;  3RYF B;  3P3P A;  3VQW A;  4FM2 A;  4JI0 O;  4RUF A;  1EFR G;  2OTJ V;  4GX1 A;  1RSO B;  4NVP A;  1QVG U;  4GT1 A;  1U97 A;  1N33 B;  1NR1 A;  5CN0 A;  1IBL O;  2IJH A;  3OGC C;  2HHH B;  3JAW B;  4JV5 O;  5IYZ B;  4OGQ B;  1ZTE A;  4UVC A;  3IAY A;  1HNX O;  2EIL B;  3KG2 A;  2CK3 G;  2YC0 A;  4O4I B;  4CH3 A;  1M93 A;  1SA0 A;  2QKA A;  2PI5 A;  2LW1 A;  1HDJ A;  1N34 O;  4LH7 A;  4XBF A;  1Y76 B;  2HVK C;  4X62 B;  1OCO C;  3H1K H;  2XAG A;  3P30 A;  1WN7 A;  1R3J C;  3BHP A;  5KHI A;  1GMG A;  3FAV B;  1NI8 A;  3D36 C;  1QHT A;  1VQM V;  2OTL V;  1MAB G;  4MTG A;  3EVK A;  4JI6 O;  2YXL A;  1SZX A;  1KB9 F;  1XEQ A;  1ZLZ A;  2DWE C;  1Y74 B;  3IJ4 A;  4B3M O;  5LGU A;  2JGU A;  3TJT A;  4PA4 A;  1AI7 A;  2XUM A;  3ZHT A;  1KU9 A;  2F1M A;  1SC5 B;  1NT2 B;  2E5L B;  3RT3 C;  4J10 A;  2ZNJ A;  4DV7 B;  4NXM O;  3CP1 A;  4FFK A;  4IIJ A;  2RDC A;  1HWY A;  1QLN A;  4IYI A;  3ETE A;  4P2Z A;  3DC5 A;  4G27 B;  4HZ3 A;  3CCL V;  1VQK V;  4DO2 A;  1OCZ B;  3OGI B;  3LDE A;  2XND G;  3K58 A;  1MOF A;  2XAS A;  4X1K A;  2OIG A;  2A9H A;  4DR6 O;  3ZX6 A;  3D8C A;  5IYZ A;  4PV1 B;  3A8T A;  5DN6 G;  1YJW V;  3ASN C;  1M90 W;  2A06 H;  3HR0 A;  3LSU A;  2N74 A;  1EN5 A;  4KL1 A;  4MSW C;  4I55 A;  5CMU A;  3CCJ V;  1WAZ A;  4LC1 A;  4LF5 B;  4P9P A;  5CA0 A;  4Z1V A;  2PGG A;  1BZK A;  4NB5 A;  3E83 A;  1OCC B;  4Z1M G;  1THZ A;  2E5L O;  4U7N A;  2PY5 A;  3K08 A;  2HLD G;  1K9M W;  1R1B A;  1ROP A;  4N21 A;  4LP8 A;  1ENV A;  3P3N A;  1I5Y A;  5IJ9 A;  5DED A;  4BIU A;  2QTS A;  4X65 O;  4FLV A;  3AG7 A;  4HNA B;  1JPX A;  3J80 N;  1F23 A;  4K8Z A;  3T1C A;  3ABU A;  3BA8 A;  4ABM A;  4FLT A;  3JAS B;  1XUQ A;  1Q3E A;  2R70 A;  3ABT A;  2HJF C;  4GYC B;  4G28 B;  4UV8 A;  4B3R O;  3DTU B;  4DUZ B;  1I0H A;  5IT9 N;  1Y74 A;  2G38 A;  1TUB B;  4JI5 O;  5GTI Z;  3ABK C;  2WLI A;  4ZI7 A;  1QVF U;  3T4D A;  4DV1 B;  1ZL8 B;  1H2L A;  5B1O A;  1PD3 A;  4KHP O;  2P4K A;  3G80 A;  4FM0 A;  4O4L A;  4I9W A;  1P84 F;  1YJN V;  3ZMS A;  2ZCE A;  2H3O A;  4FK5 C;  1XMQ B;  1ZL8 A;  1VQ4 V;  2UUA O;  4NXN B;  3O65 A;  2W0X A;  4J80 A;  4X20 B;  4BW5 A;  2FL4 A;  4HBN A;  1GM9 A;  5IYB O;  3JAR B;  1F4N A;  2EIK B;  3DSQ A;  5B3S B;  2EIJ C;  4CS3 A;  4QE9 A;  1Q90 D;  5IY5 C;  2P67 A;  4B3T B;  1K33 A;  3G6E V;  1KP2 A;  4GKJ B;  1AB3 A;  2F4V O;  4TV8 B;  1MSD A;  1X59 A;  4CC6 A;  3K57 A;  3IC9 A;  2QM4 A;  1K5Q A;  4O4J A;  1I94 B;  4YIO A;  1VQ8 V;  5EBW C;  3WB2 A;  2L6L A;  5H6Q A;  4IYH A;  1G6U A;  5H5N A;  2QWQ B;  2D3O W;  5IYD O;  3N2K B;  5H6R A;  5LYJ A;  2CUG A;  2B9Z A;  2X7R B;  4BAY A;  3QG5 A;  2QR4 A;  4JF3 A;  4X88 A;  5AG2 A;  4YY3 O;  1TGO A;  1OCZ C;  2ZDI A;  4BWA A;  2R9A A;  2XAJ A;  1JA8 A;  2B1I A;  5LA6 B;  4WF9 V;  5DM6 V;  4FMT A;  1KC8 W;  4LBE C;  1NVP D;  5CA1 A;  4JGS A;  2WA3 A;  2PI4 A;  4G2K A;  3JAL A;  1WNS A;  3IGA C;  4H37 A;  2CTQ A;  3JD2 A;  4DRX B;  4LR3 A;  1EZV H;  3SJC C;  1YEW A;  3ML0 A;  4B3S B;  4FLY A;  1TVK A;  1HR0 B;  1W0K G;  3ZMV A;  4EEQ A;  5FNV B;  4MVZ A;  3ABL B;  2RQ6 A;  2QKS A;  2UU9 B;  1T5E A;  1N34 B;  1JMK C;  3ASO B;  4YY3 B;  2UUC B;  1WP8 A;  1SQB H;  3K3W A;  2X6B A;  1KEC A;  4EB6 A;  4JI2 O;  4UCO A;  4UUJ C;  3G6B A;  2ITC C;  5LGT A;  3F7Y C;  2Z5U A;  3ZHU A;  4MW8 A;  2YEV B;  2UXB O;  1XNQ O;  2CE4 A;  1VF5 B;  3APQ A;  1VMG A;  3SDL A;  1N32 B;  3J7A U;  5JJJ B;  4X8A A;  3VOU A;  4U7O A;  4H13 B;  2BTQ B;  3SYA A;  1L0N H;  3UM7 A;  2CTW A;  4TOI A;  3OMI B;  5KMG B;  4U3J A;  1WPX A;  2B5U A;  5F2V O;  5LP6 B;  4DV3 B;  4P30 A;  2NLJ C;  2QWP B;  2UXN A;  4FLW A;  3AG3 B;  1D5A A;  3K04 A;  3RYH B;  4TV9 B;  1XOU A;  1QLE C;  5LGN A;  4YHH O;  1TA8 A;  4FZ0 A;  2EIJ B;  2ZM6 B;  3ZRW A;  4A5U B;  2Z0A A;  4DK1 A;  4JTC B;  4JI8 B;  4I50 A;  2VQE O;  1DF5 A;  3CRM A;  1YIT V;  4PI0 A;  4B7K A;  4JI7 B;  3JAW A;  3B8M A;  3LDD A;  2IH1 C;  1I7F A;  3JD4 A;  1XNQ B;  5JQG A;  3G4S V;  3T1Y B;  3A2F A;  1B6Q A;  5E79 Z;  1UFI A;  2E74 B;  4Z2W A;  4MTO A;  3BY6 A;  2IU0 A;  2QM7 A;  1SS3 A;  4ZKI A;  2QTO A;  2XOK G;  3ZMU A;  2XHB A;  2VWJ A;  3SGI A;  1BQZ A;  2UXC O;  2H8P C;  3CWB H;  2ZQM A;  4U3J B;  4O4H B;  1NR7 A;  3S3W A;  2HEP A;  3B4S A;  2GSM B;  1Q7Y W;  2GV9 A;  2YSU B;  1AJN A;  4MVR A;  2LFS A;  2YIB D;  4IL6 Z;  2Q73 A;  5B66 Z;  3WU2 Z;  4PI2 A;  4X64 O;  1IDS A;  2ZM6 O;  1VQO V;  3ZHR A;  4JI6 B;  3QO7 A;  3RYC B;  4HAM A;  4PDR A;  3E86 A;  4IGG A;  1CXZ B;  1FD9 A;  4DW0 A;  3GB7 C;  4JI7 O;  1IBM B;  1G1X B;  1XMO B;  3FYI B;  1S3J A;  1ZAU A;  3QTC A;  4B3R B;  5KHJ A;  3SPI A;  3J81 N;  1S0V A;  1FYJ A;  2WLN A;  1NZ6 A;  1VEW A;  2DQ0 A;  2PZS A;  3K0D A;  4DR2 O;  5KX5 B;  1MNG A;  4QGP A;  2UXD O;  4GKK O;  1PNM A;  4DR6 B;  4AQY O;  3LSQ A;  1E1Q G;  3U10 A;  5B3S C;  1IUR A;  4DRX A;  1N0N A;  2JDI G;  4DYL A;  5IWA O;  5CA1 B;  3T1H B;  4CH6 A;  1SER A;  4EFB A;  1W59 A;  3W7U A;  1YJ9 V;  5KHK A;  1NTM H;  1CPY A;  3RBZ A;  2ETN A;  2WPD G;  1IBK B;  2JS5 A;  5EIB C;  2HFE C;  2R9I A;  1AI6 A;  2YI9 A;  2YXH A;  1K5S A;  3TK1 A;  3CEI A;  4JAS A;  2YDE A;  2EX3 A;  4CH5 A;  1XQ8 A;  5BR8 O;  3N2K A;  1AR5 A;  2IW5 A;  3CC4 V;  2AXT Z;  2YID A;  3B2E E;  4P9O A;  5LXT A;  1G4Y B;  3QO5 A;  4DW1 A;  3HKD B;  5KUK A;  4TV8 A;  4NTX A;  1EN6 A;  1WB7 A;  3T4Z A;  5JQG B;  4YJ3 A;  1Z5V A;  2JJ1 G;  1Y6X A;  5E1A C;  5B1N A;  1Q82 W;  1O9G A;  4OX9 O;  1PNL A;  5CA3 A;  3T2M A;  3M99 B;  1E79 G;  4X20 A;  2CH7 A;  1YTF B;  1V54 B;  1KUQ A;  2VQE B;  1UJW B;  3OM3 B;  4NTY A;  2RNB A;  1RPR A;  2H94 A;  2LO1 A;  2WLM A;  3I55 V;  2IJJ A;  1SQV H;  3UQ8 A;  1I08 A;  1H8H G;  2YIA A;  4TV9 A;  4CZZ A;  5LMU O;  2JS3 A;  1JVM A;  4JI1 O;  2BSK A;  2DYS B;  3EHB B;  4NXM B;  3TGU H;  2DJV A;  4R8C A;  2K9P A;  5LP6 A;  3A0B Z;  1FFX B;  1KBH A;  1TUB A;  3ZMT A;  4DR4 B;  3ABM B;  3UKM A;  2ZT9 B;  3RYI A;  1GN6 A;  1W2B U;  4PJ0 Z;  3WB0 A;  4LNU B;  2OYQ A;  4DV2 O;  3K06 A;  4I0X B;  1H2M A;  2LW7 A;  3CJH B;  4DXW A;  2V4D A;  1YI2 V;  4LF5 O;  4GX2 A;  2Q8V A;  2EJ7 A;  1AI5 A;  3OAA G;  1SF9 A;  3CRC A;  2UXB B;  2DMX A;  1P49 A;  5BMV B;  4JYC A;  3DXR B;  1I94 O;  3AG1 B;  4KP4 A;  4LH6 A;  1S77 D;  2ODM A;  1EZJ A;  2BTO A;  4TSF G;  1K97 A;  3W7W A;  2VRZ A;  4JYY A;  3OMN B;  3MHH C;  3K5O A;  1QBZ A;  1F51 A;  3MHS C;  3SYC A;  2OCH A;  1SQP H;  5J2U B;  4B7E A;  5IY5 B;  1HNZ B;  3STL C;  3L73 H;  4I55 B;  5FL7 G;  1JR9 A;  2JEU A;  2PUS A;  2LGW A;  3MDS A;  4LWS B;  5KHG A;  2JGD A;  1LR1 A;  3C3S A;  3M8A A;  2FB5 A;  3AG4 B;  5KUM A;  3TCU A;  1PL4 A;  2W6I G;  1H2K A;  2VS0 A;  2WWW A;  2P5O A;  5LYJ B;  4MT8 A;  4GX5 A;  2Q69 A;  4PEL A;  2IM9 A;  4UXN A;  2NR5 A;  2JEX A;  4JTA B;  1ZUQ A;  2MW2 B;  4X66 O;  4YXW G;  3AG2 C;  4D7T A;  3M7M X;  4J7J A;  3EFF K;  1M5I A;  4DUY O;  4KHP B;  4PA3 A;  3X2Q C;  2M6Y A;  1K7D A;  4WFB V;  3D3Q A;  2Q9L A;  2XT9 A;  3ZRS A;  5C8Y A;  4WFA V;  4ZOL A;  4JI2 B;  4IHJ B;  1SZT A;  1V54 C;  3P32 A;  1JCH A;  4X64 B;  2ZR2 A;  4J41 A;  1BL8 A;  3AG4 C;  4WFG A;  4K3A A;  4J9Z B;  5KLV H;  3RVZ A;  4CS4 A;  3GVM A;  4QIW F;  3GWK C;  3RYI B;  5DEC A;  4O4L B;  4LF8 O;  1OCO B;  1LUV A;  3PJS K;  4X65 B;  3CCU V;  3ZBH A;  4Q20 A;  2ATK C;  4LF9 B;  1XDC A;  2PYL A;  4LCU C;  3JD0 A;  1M56 B;  3HKB A;  2WLL A;  5JCO C;  1H2S B;  4DV5 B;  4ZBM A;  1OCR C;  1KMI Z;  4QPK A;  1FAF A;  4R50 A;  4LFA O;  4AHC A;  2YI8 A;  3ZRX A;  1MZE A;  1GAX A;  3FB6 C;  3VBB A;  3ICX A;  2CTP A;  2AZ2 A;  1BHB A;  2KKW A;  3JAS A;  2OCC B;  4PDV A;  2CH7 B;  4DV2 B;  1JJO A;  5BR8 B;  1FJG B;  1EN4 A;  4JZG A;  3ZN1 A;  2F23 A;  2XAH A;  5C8Y B;  3CCR V;  4X89 A;  3WG7 C;  4QNH B;  4JYA O;  4O2B B;  4DUZ O;  2XAF A;  1VF6 C;  1Q81 W;  5IJ9 B;  2K1E A;  3H1I H;  4H44 B;  2PF4 E;  3LDC A;  2EIM C;  3G71 V;  4TQF A;  3ZED A;  2EZP A;  1IZ3 A;  5KAI Z;  1DTO A;  5CA0 B;  3ZHV A;  2FKX A;  4PDM A;  2UUC O;  4LFB B;  3OEH G;  1YTF D;  1GK9 A;  2QSA A;  5EYP A;  1GN2 A;  3AK2 A;  1YDX A;  3FYE B;  3SPH A;  1NKD A;  1D5N A;  5J2T A;  1HNX B;  1HNW B;  2HKO A;  1EM1 A;  1Z5W A;  4DV0 B;  3NXS A;  1JJ2 U;  1N33 O;  1MG1 A;  3MAQ A;  1Q86 W;  1AR4 A;  1NH2 B;  2Q6A A;  4UCT A;  2M7W A;  2Y0P A;  4JYB A;  4I9Q A;  1HW7 A;  4I5S A;  4PD4 F;  1FXK C;  5FPO A;  2RN9 A;  4GZR B;  4JAV A;  3JD3 A;  2Z3Y A;  2ZIN A;  5EZY A;  2Q7E A;  4J11 A;  4UB6 Z;  2E3C A;  1WJZ A;  1FFT B;  4JI1 B;  2JK5 C;  3BCC H;  2LQT A; 
#chains in the Genus database with same CATH homology
 2ZQM A;  3LNM B;  1NR7 A;  3OE7 G;  5IDJ A;  2GSM B;  4XDK A;  1Q7Y W;  3E8F A;  2YSU B;  4MTF A;  3BEH A;  1AJN A;  4RUF A;  1EFR G;  2Q67 A;  4GX1 A;  2OTJ V;  4MVR A;  2Y69 B;  5L3B A;  4RUE A;  2LFS A;  1QVG U;  1QLE B;  4GT1 A;  4N23 A;  3ZMZ A;  5EK0 A;  1VQO V;  1NR1 A;  3QO7 A;  1GTO A;  5CN0 A;  4HAM A;  2IJH A;  3E86 A;  3OGC C;  4PDR A;  1FXK A;  4UVC A;  3GB7 C;  4RQF A;  2EIL B;  3KG2 A;  3ETD A;  1PL0 A;  1PKX A;  2CK3 G;  1F4M A;  1SRY A;  3D36 A;  1K8A W;  3FYI B;  1S3J A;  2ZDI C;  2PI5 A;  1NBM G;  2ZXW B;  4PA9 A;  1PNK A;  3SPC A;  1GM8 A;  3SPI A;  4XBF A;  1S0V A;  2HVK C;  1KP3 A;  3ABM C;  2WAM A;  2WLN A;  2LP7 A;  2DQ0 A;  1OCO C;  3K0D A;  1AJP A;  2XAG A;  1COW G;  3P30 A;  1R3J C;  3OR7 C;  4MVU A;  1CP9 A;  1GMG A;  3CYO A;  2W0F C;  3ASO C;  1PNM A;  2DQ3 A;  2DYR C;  3SPG A;  4PA7 A;  3HB3 B;  3LSQ A;  1VQM V;  1E1Q G;  1BMF G;  2IJI A;  5B3S C;  2QE7 G;  2OTL V;  1MAB G;  3QO8 A;  1FXH A;  2JDI G;  4MTG A;  3ZN0 A;  4GX0 A;  1N8R W;  3JYC A;  2EIN C;  4MW3 A;  4UVB A;  2DWE C;  1SER A;  4L87 A;  1CEZ A;  5EBL C;  3W7U A;  1NQT A;  3K03 A;  5LGU A;  1YJ9 V;  1CPY A;  3RBZ A;  1FXV A;  1XL6 A;  4PA4 A;  3JD1 A;  3AG2 B;  2WPD G;  1AI7 A;  3W7T A;  3OEE G;  3SYQ A;  4RO2 A;  2HFE C;  2R9I A;  1AI6 A;  1M1K W;  3ASN B;  1K5S A;  3TK1 A;  1RM1 C;  1I5X A;  4JAS A;  3WG7 B;  1JOY A;  3ZRW B;  3CP1 A;  1WLE A;  1R6N A;  3FB8 C;  5B1A B;  1VQL V;  2IW5 A;  3CC4 V;  1HWY A;  1QLN A;  3ETE A;  4P2Z A;  4P9O A;  3F5W C;  2AHY A;  4G27 B;  4RAI A;  3SYO A;  4CBC A;  2WLJ A;  4HZ3 A;  3CMA V;  3CCL V;  1G4Y B;  3QO5 A;  1VQK V;  4DO2 A;  1OCZ B;  3LDE A;  4JTD B;  2XND G;  1MOF A;  2JJ2 G;  3B77 A;  5KUK A;  3E35 A;  2Q68 A;  2XAS A;  2EIL C;  1H8E G;  2IH3 C;  5H9C A;  1E1R G;  4QJF B;  3T4Z A;  2IU3 A;  2A9H A;  2JJ1 G;  4UVA A;  3ZRV A;  1YSC A;  5E1A C;  1S76 D;  3IFX A;  5B1N A;  1Q82 W;  5DN6 G;  3FKS G;  2EIN B;  1YJW V;  1GM7 A;  3ASN C;  1M90 W;  1PNL A;  1ZWI C;  5CA3 A;  4MVO A;  1DF4 A;  2WLK A;  3D3I A;  3T2M A;  3M99 B;  1E79 G;  2EBO A;  4MSW C;  5L3F A;  4XDL A;  5CMU A;  1YTF B;  1V54 B;  3CCJ V;  1R3I C;  3CCS V;  1UJW B;  3OM3 B;  4LC1 A;  2YEV A;  1RPR A;  4FPP A;  2H94 A;  4P9P A;  2WLM A;  3I55 V;  2IJJ A;  2WLH A;  1K4C C;  3E83 A;  5GW7 A;  1OCC B;  2OT5 A;  1H8H G;  3OR6 C;  4R7C A;  4Z1M G;  4CZZ A;  1THZ A;  2WSS G;  1JVM A;  4WCE V;  4U7N A;  1S5H C;  1L1F A;  5IYC O;  1NH2 D;  2DYS B;  3EHB B;  3K08 A;  2HLD G;  1K9M W;  2IJK A;  1ROP A;  4N21 A;  4ASU G;  4RQE A;  1BHA A;  4LP8 A;  1ENV A;  1OHH G;  2HG5 C;  4R8C A;  1I5Y A;  3W7X A;  4BIU A;  4TWK A;  1K73 W;  3ZMT A;  5KA6 A;  5LHI A;  1JPX A;  3ABM B;  3UKM A;  1F23 A;  2A0L A;  1W2B U;  2Y69 C;  1NJI W;  3AG1 C;  3T1C A;  5J9P C;  3ABU A;  1K34 A;  3CC7 V;  3K06 A;  4DXW A;  2LFR A;  3TET A;  1YI2 V;  4GX2 A;  5CBF A;  2BOB C;  2GHY A;  3ABT A;  2HJF C;  1AI5 A;  3OAA G;  4G28 B;  4UV8 A;  3DTU B;  1ARO P;  2MK3 A;  3E8B A;  4E2L A;  2ZD9 A;  4HYO A;  4JYC A;  5HFL A;  1Y4M A;  1R73 A;  1Y66 A;  3RW0 A;  3ABK C;  3AG1 B;  2WLI A;  4KP4 A;  3STZ C;  1P7B A;  1RPO A;  4MVM A;  1QVF U;  3T4D A;  3CXC U;  1S77 D;  1EZJ A;  5B1O A;  3CCM V;  1PD3 A;  4H33 A;  4TSF G;  1K97 A;  4XDJ A;  5LHG A;  4I9W A;  3W7W A;  3OMN B;  3MHH C;  1YJN V;  1VQ7 V;  3ZMS A;  5EC2 C;  1QBZ A;  1LNQ A;  1V55 B;  3E8G A;  4FK5 C;  1F51 A;  3MHS C;  2DYS C;  2R9R B;  3SYC A;  4WFE A;  4EKW A;  1VQ4 V;  1S72 V;  5IY5 B;  2FTK A;  2W6J G;  3ABK B;  1QR9 A;  3STL C;  1R3L C;  2P7T C;  4BW5 A;  3CD6 V;  3ZJZ A;  5FL7 G;  1GM9 A;  4FIP C;  5IYB O;  1F4N A;  2EIK B;  2JEU A;  1TUE B;  5B3S B;  4F4L A;  1OCC C;  1GKF A;  2EIJ C;  1VQ9 V;  4QE9 A;  3CCE V;  3FB5 C;  5IY5 C;  3GWO A;  4KFM A;  3AG4 B;  5KUM A;  2P67 A;  1P4R A;  1K33 A;  3TCU A;  1AJQ A;  1V55 C;  1K92 A;  2W6I G;  3G6E V;  1KP2 A;  3DGE A;  3LSS A;  2WWW A;  3CCQ V;  1W0J G;  2V7Q G;  3HPL C;  1NVP B;  4MT8 A;  3I56 V;  4GX5 A;  2Q69 A;  3K0G A;  1SET A;  4PEL A;  1K5Q A;  4UXN A;  2JEX A;  4JTA B;  1VQ8 V;  4MVS A;  5EBW C;  3A0R A;  5H6Q A;  3JCZ A;  4YXW G;  3AG2 C;  5L3C A;  2D3O W;  5IYD O;  3EFF K;  5H6R A;  2B1G A;  2X7R B;  4PA3 A;  4BAY A;  5BZB A;  4JF3 A;  4X88 A;  3X2Q C;  3ZIA G;  2OCC C;  3RVY A;  3OUS A;  3OMA B;  2QM8 A;  1K7D A;  2X0L A;  4WFB V;  1SES A;  1H2G A;  1OCZ C;  1AI4 A;  2ZDI A;  1GO3 F;  1QR8 A;  5B1B C;  3ZRS A;  2C2A A;  4WFA V;  3SYP A;  2XAJ A;  2B1I A;  4WF9 V;  1SZT A;  4FMT A;  5DM6 V;  4LBE C;  1V54 C;  2KB1 A;  5L3G A;  1KC8 W;  3K79 A;  3P32 A;  5B1A C;  1NVP D;  1G8M A;  1JCH A;  1K3E A;  1FS0 G;  3QNE A;  2V1D A;  4JGS A;  4WFF A;  2ZR2 A;  4G2K A;  2PI4 A;  1JQ0 A;  1BL8 A;  3AG4 C;  1KD1 W;  3IGA C;  2UXX A;  4H37 A;  4J9Z B;  4WFG A;  3JD2 A;  3ZCC A;  3OW2 U;  1VQ6 V;  3RVZ A;  2ITD C;  3ML0 A;  3ETG A;  4QIW F;  3E89 A;  2AHZ A;  4QE7 A;  1MSW D;  4FJC C;  1W0K G;  1OCO B;  4JAU A;  5LHH A;  3PJS K;  4TT3 G;  3ZMV A;  3CPW U;  3CCU V;  4Q20 A;  2ATK C;  4MVZ A;  3ABL B;  4LCU C;  2QKS A;  3JD0 A;  5CBH A;  3AG3 C;  3ASO B;  1M56 B;  2QEX V;  2WLL A;  1KQS U;  2HVJ C;  5B1B B;  1H38 A;  1EBO A;  1OZ0 A;  3K3W A;  2X6B A;  1KEC A;  4ZBM A;  1OCR C;  4QPK A;  1VQP V;  2JIZ G;  1YIJ V;  4PA6 A;  3X2Q B;  4UUJ C;  4WFH A;  1R3K C;  4OXS A;  4R50 A;  4MS2 A;  1M57 B;  3AEI A;  1M56 C;  2ITC C;  5LGT A;  3F7Y C;  3ZRX A;  2Z5U A;  3FB6 C;  4JPR A;  3VBB A;  4MW8 A;  4MTX A;  2YEV B;  3FB7 C;  5KA5 A;  1BHB A;  1VQ5 V;  2OCC B;  4PDV A;  2BOC C;  2ZR3 A;  2HR3 A;  2ZXW C;  3H01 A;  2F43 G;  4BIZ A;  5L3D A;  2QA4 V;  4X8A A;  2P6J A;  3ZN1 A;  3VOU A;  2XAH A;  4U7O A;  2DWD C;  3CCR V;  3E8H A;  2EZO A;  4X89 A;  3WG7 C;  3SYA A;  4QNH B;  3UM7 A;  3WFV A;  1RM1 B;  4R6Z A;  3OMI B;  2EJR A;  2XAF A;  1WPX A;  2B5U A;  1Q81 W;  2K1E A;  4P30 A;  3B8N A;  1XL4 A;  1R6K A;  2NLJ C;  3IC7 A;  2UXN A;  3AG3 B;  2NNU A;  3LDC A;  3W7S A;  3SPJ A;  5CBG A;  3ABL C;  4MVQ A;  3K04 A;  3E2E A;  3OUF A;  2WLI B;  1QCE A;  4GCZ A;  4UV9 A;  1QLE C;  5LGN A;  2EIM C;  3G71 V;  2EIK C;  2EZP A;  1DTO A;  1KKD A;  2EIJ B;  1J95 A;  4PDM A;  3ZRW A;  2X6C A;  3OEH G;  5HFM A;  1YTF D;  1GK9 A;  4JTC B;  5EC1 C;  3FYE B;  1OCR B;  1DF5 A;  2EIM B;  3SPH A;  1VQN V;  3F7V C;  1NKD A;  1YIT V;  2DW4 A;  2HKO A;  1FXK B;  3B8M A;  3LDD A;  1M57 C;  1AR1 B;  2IH1 C;  3JD4 A;  3NXS A;  1JJ2 U;  1MG1 A;  3OFN G;  1DLB A;  1Q86 W;  3CCV V;  1NH2 B;  2A79 B;  3G4S V;  2Q6A A;  3CME V;  1B6Q A;  3R65 A;  2M7W A;  4J9Y B;  4JYB A;  1M9N A;  1YHQ V;  4I5S A;  2Y48 A;  2X6A A;  1K4D C;  2WLL B;  2P90 A;  5L3E A;  4MTO A;  1FXK C;  3SJQ C;  2DYR B;  3JD3 A;  4JAV A;  1IXM A;  2Z3Y A;  1ORQ C;  3BY6 A;  2IU0 A;  4QPJ A;  4PDL A;  5EBM C;  5LBQ A;  2QM7 A;  1JX9 A;  4ZKI A;  3K9A A;  5C93 A;  2QTO A;  2XOK G;  4KUM A;  3ZMU A;  2XAQ A;  3CC2 V;  3LUT B;  1FFT B;  2H8P C;  3MD0 A;  2JK5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...