1VQMV

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqmV00
3CCRV 1Q81W 4WF9V 3CPWU 3CCSV 1M1KW 2OTJV 1VQ7V 1VQOV 1Q7YW 1YIJV 3CCJV 3CCVV 4WFBV 1VQKV 1VQ4V 1VQMV 1VQ8V 3CC4V 1R73A 3CXCU 3CCQV 1S72V 3I55V 1KD1W 1VQ6V 1VQLV 2QEXV 2OTLV 3CCEV 1N8RW 4WFAV 2QA4V 3CCUV 1YJNV 1K73W 3CCMV 1K8AW 1M90W 2D3OW 1QVFU 1YITV 3G71V 3G6EV 1NJIW 1JJ2U 3G4SV 3CCLV 1K9MW 5DM6V 3I56V 1VQ9V 3CD6V 1YHQV 4WCEV 1Q82W 1VQNV 1VQPV 3CMAV 3CC7V 3CC2V 1W2BU 1YJ9V 1KC8W 3OW2U 3CMEV 1YJWV 1KQSU 1YI2V 1VQ5V 1Q86W 1QVGU
chains in the Genus database with same CATH superfamily
1LNQA 2R70A 1I94O 1RM1C 1TAEA 2ZNIA 2HFEC 2ZDIA 3OT7A 4X1YB 4QIWF 4PA3A 2UUAO 4GT1A 5KUMA 4DR4O 4GKJB 5LA6B 2ODMA 3JAWB 1GM8A 4DR3O 1F4MA 5E79Z 5DM6V 2Z3YA 1R6NA 4WCEV 2W0XA 2LW1A 1AI7A 4X1KB 4DV7B 2DYRB 5CA1A 4WBNB 1BQZA 3HKBA 4OPHA 1Q81W 4ZKIA 2XHBA 5IYDO 4G28B 2JS3A 2Q0AA 3SR2C 4Z2WA 3ABLB 3ABMC 2HG5C 1EZVH 2OIGA 2QKCA 4PDMA 3BEHA 3I56V 1SQVH 4EB6B 4KP4A 1Q90D 1H8EG 3CJHA 4GUNA 3RYCB 1OCRC 4DV2B 3B8MA 2OTJV 4TV8A 4TQFA 1WJZA 2Q0OC 3CEIA 3OFNG 4O4HB 3X2QC 2EIMC 1QLEC 2IH1C 1QU7A 3QO8A 3ZHSA 2C2AA 4DR2B 5EBMC 3GVMA 3OW2U 1ROPA 2CAZC 1HDJA 2ZIOA 3DC5A 4OXSA 2F43G 1BMFG 3UO3A 4FFKA 4JGSA 4JI0O 5H6QA 4Z1VA 3J80N 2L6LA 2MW2B 1GKFA 4LNUB 3B4SA 4FVMA 2FL4A 2F1MA 3STZC 1AJQA 4GKKO 2F66C 1QHTA 2JJ2G 4CS2A 2F93B 2ZE6A 2V7QG 3JARA 4X8AA 5L3FA 2P67A 2WLMA 2UXDO 3OR6C 4CH3A 3EFFK 1WPBA 3NXSA 2CK3G 4JYAO 1N0JA 3B77A 3RYHA 3ASOB 2GTSA 1Y74A 4JV5O 5IJ0A 1NTMH 3RBZA 4RUEA 4UV9A 2IH3C 2MK3A 2WLHA 3TXQA 5L3GA 5IJ9A 4B3RB 4JI3B 4TV9A 2EX3A 4I0XA 4H44B 1KKDA 2RN9A 4DUZB 2AW9A 2H3OA 4MTFA 4JAAA 4GX0A 3K59A 1DF5A 2GDSA 1AP6A 2AXTZ 4UB6Z 4DW1A 3N2GA 4J42A 3O9OA 1US6A 2OCCC 5FPRA 1FAFA 4LF5O 1QR8A 2WWWA 1SC5B 1AI6A 1WB7A 2DQ0A 3E35A 2YS8A 3G71V 4J9ZB 4DO2A 3A0RA 2UXBB 2PY5A 1MSWD 4YXWG 2QKSA 2VS0A 2LJ2A 4CC5A 2GV9A 4BIOA 3G6BA 3CCJV 2UXCB 4MVMA 1COWG 1JX9A 4Z1MG 3FKSG 3S3XA 3T2MA 1SS3A 1N34B 5CBHA 3P3NA 3ZN0A 2HHHB 3K5MA 2ZR3A 2Z0AA 4XDJA 4PDLA 2PYLA 1RPRA 2XAGA 2IM9A 4D6TH 2KB1A 3EXAA 4JF3A 4U3JA 1KP2A 2P7TC 4TOIA 2QWOB 5J2UA 1YCIA 4GX5A 4I55B 3T1CA 1OCCB 5L3CA 4J7KA 1P7BA 5LMNO 2WLIB 1NU1H 1Y6XA 3JD3A 4LF9B 4H0LB 1Q6IA 5ITZB 2E5LO 1I7FA 2KQXA 2LO1A 4YHHO 3FYEB 4K8XA 3MDSA 2DOSA 3K58A 3IFXA 2Y69C 3BRCA 3CC4V 1VMGA 1NTZH 3WG7C 2LFRA 1K8AW 1WA8A 4X64B 5L3BA 3IAYA 1J5EB 4RAIA 2YSUB 4QJFB 3AK1A 4YY3B 3N2KB 1HNXO 1IXMA 1I5XA 2YICA 1EN4A 4FLUA 3APOA 2EIKC 2AZ0A 2QGNA 4DV0O 2AGAA 5J9PC 2PZSA 5B1OA 2WLKA 3IGAC 5IDJA 5EYPB 4CC6A 2EULA 2UXXA 4MTOA 2F4VO 3K3WA 2KG7B 3E22B 1XUQA 2UUCO 2YDEA 5K1XA 3ZRVA 1KECA 4JI1B 2DWEC 2QM8A 2ITCC 3RW0A 1AILA 2P06A 2A06H 4LF6B 1R3KC 3ZMTA 3H1KH 2GBOA 3FB5C 3CRAA 3SPHA 2Q4PA 4JI4O 1IBKO 1VQPV 4J41A 4AILC 1JQ0A 4PELA 4LWSB 2JEUA 5BY1A 3RFRA 2H8PC 3CX5F 3D3QA 2KSDA 4DV3B 1CEZA 2AHZA 4J80A 4FFBA 2ZCEA 4DV4O 1ENVA 2DQ3A 3CMAV 2IJJA 1IURA 5JQGA 5JVDB 4UCVA 1OCOC 1K3EA 2YEVB 1JJOA 1D5AA 3TCUA 3CCSV 3T4DA 3E8HA 1JFFA 4ZIBA 5LP6A 1YF2A 4IT5A 5LP6C 3ZN1A 3WB0A 4LF8B 1L0LH 4IIJB 4B3SB 4PDVA 4LF7B 3VQXA 2YIBA 1OJHA 4DV6O 1QBZA 4GLXA 5LYJA 4X88A 4AQYO 2H94A 5KMGA 1YIJV 4FLTA 3P30A 2DW4A 1JA8A 1OCZC 3FAVA 5LXTB 1AP5A 1G8MA 4WFFA 2A9HA 2IJIA 3JASA 5IE9A 4NXNB 4F6EA 4AI8A 1F23A 2N05A 2E75B 4LP8A 1FPOA 4UCRA 3CMEV 3CYOA 2QWRB 3KG2A 1BT8A 4AHCA 1NR7A 3CCRV 5KHGA 3WB1A 3C90A 2GUZA 2LQTA 3W7WA 4DV1B 1ZX3A 4X62O 3ETEA 5DEDA 3M99B 1V54C 2IBZH 1XNQB 3SYCA 4YJ3A 3M8AA 5LHHA 3JD2A 4JI6B 5KX5B 2XASA 3JD4A 1YTFB 1IZ3A 3LUTB 1XMOO 1FJGO 3L74H 4IL6Z 1ORQC 4F6RB 2IW5A 5IYBO 5LHGA 4HNAB 3RYFA 5KHHA 4W4LA 1H2GA 3CCEV 1BHBA 1FYJA 4PA7A 2Q69A 4DV5O 1H2NA 4NTWA 5TISZ 4XBFA 1PL0A 3W7XA 3ETDA 3DTUB 3A2FA 2JGDA 5CBGA 1K4DC 1BL8A 4EFEA 2RDCA 4IHJA 2PYJA 1VQ7V 4DR5O 3WU2Z 3OUSA 2EIJC 4FLZA 2JDIG 3QTCA 2EJ7A 2ZM6B 2XNDG 4WFGA 1TVKA 1YHQV 2JK5C 3RWRD 5EZYA 1VQNV 4EKWA 2VQEO 3UQ8A 5EC2C 2JJ1G 1TUEB 3CCVV 4JTDB 4FMTA 2VRZA 1ZWIC 3CJHB 3JCUZ 2P90A 3O65A 3OGIB 1M56C 2JEXA 4ASUG 3K9SA 2Y4UA 3OTOB 4TV8B 4B3TO 4LFAO 4NXMB 1YVWA 2LW7A 5GONA 2YIBD 2ZD9A 4CH5A 3M7MX 5BR8B 2UU9B 4YIOA 3UT5A 1XMQB 1S72V 1P4RA 1T5EA 2Q6AA 2EILC 1PM9A 2JGUA 1B3QA 4K35A 5E1AC 4B3MO 1OV9A 2WLLA 1SESA 4TWKA 2O57A 3K08A 1BE3H 3NR7A 4TUYA 1K92A 1IBLB 3E2EA 3JALA 4EFBA 4X9QA 4F4LA 3ZRWA 4WFAV 4GKJO 1KBHA 1Y67A 2WSSG 4H37A 3AG7A 3SYQA 3JARB 4DK0A 3JSLA 1XREA 3B2EE 4DV7O 3CRQA 2W0FC 4KHPB 2M7WA 3SJBC 2JIZG 4PV1B 3UKMA 2YXYA 4UCSA 1DGSA 3RYHB 2F23A 3BABA 1Y74B 4L87A 1HNWB 2WLNA 2Q5ZA 4LR3A 1FXKA 3L70H 2PF4E 3Q4HA 1FXKC 5H2FZ 1J95A 3K04A 3ZX6A 4RQFA 1M57C 5DECA 3K5OA 4JASA 1E79G 1XNRO 4I50A 4WFHA 4JI8O 5IJ9B 2M6YA 3AG4C 3LDDA 1U96A 5DN6G 1WAZA 1EFRG 3LSQA 4K3AA 3H9VA 4TV9B 4I0XB 2XUMA 3T4ZA 2ZE7A 2XAQA 4ZHQA 2CTQA 4NR1A 1SETA 3N2GB 1JJ2U 5LL6Y 3THOA 2ZR2A 4TQDA 3CP1A 1OZ0A 3OE7G 1FS0G 4LF4B 1AR5A 1PNMA 2CGNA 4R7CA 3JYCA 3CS5A 1V9PA 3SJQC 1Q3EA 3OM3B 4PI2A 3CCMV 1VEWA 3UM7A 2VQFB 1XL4A 3G4SV 2R9AA 1BGYH 3JAKA 3JCZA 4I7ZB 3CRMA 1K5SA 3MD0A 4UCTA 1W59A 2HJFC 2P4VA 4LH6A 4QPKA 4O4IA 4K8ZA 4ZOLA 3AG2B 1MABG 3CSXA 1VQLV 4J7ZA 2ZQMA 4FLXA 4UCUA 2P5OA 3G80A 3TXSA 5J2UB 2ZKOA 4X89A 4ZI7A 2QTSA 4FK5C 3SYAA 1M4UA 1V55C 5LOVB 4PI0A 2XTAA 2B1GA 3T1YB 2NR5A 3T1HB 5K1PA 1D2DA 4B3RO 2HR3A 3W7SA 1GAXA 2Q7GA 1YTFD 2R9IA 3ZJZA 4DUZO 1NKDA 1FKAO 1KB9F 3L73H 3ZHRA 1KQSU 3CXHF 1WA8B 5JCOA 2A3QA 3QF7A 5JCOC 1QCEA 2R9RB 3F5TA 4DW0A 1Q7YW 4UVCA 1VQ8V 3AG3C 3AK2A 4JZ2A 1IBMB 1TUBA 1K73W 1SA0B 1U97A 3R66A 3F7VC 2IJKA 2PI5A 3EVKA 2UXBO 1AI5A 3MHSC 3ZBHA 4ICGA 2EJRA 4X1YA 2ITDC 1NI8A 2CH7B 5LA6A 3JAWA 3OMNB 3K06A 4P9PA 3ABKB 2UXCO 1MOFA 2CGOA 4FZ0A 3ZMUA 3BVOA 3OEEG 4X1KA 2K1EA 4NVPA 1N34O 4WBNA 2DYRC 2WPDG 2HHHO 4JYAB 3BCCH 4UV8A 3SJAC 3CC2V 1Q8IA 5CA0A 1YSCA 1ZLZA 1P84F 3ZEDA 3ABLC 1DTOA 2BE3A 4EB6A 1SQFA 3RYCA 4A5UB 5HFMA 4Q6GA 4LF9O 1G1XB 1H8HG 3LNNA 1N32B 3HKCB 1Z5WA 1K97A 3DXRA 4FFBB 2UUBB 4WF9V 3RGBA 4YJ2A 1Z2GA 1IVSA 1RSOB 3B40A 1VQ4V 3J81N 2Q8VA 4KUMA 5LMUO 4O2AB 1YEWA 4X64O 3ASNB 5EBWC 1M5IA 1S0VA 4RUFA 5B3SB 2CTRA 1J5EO 3QO7A 4PA4A 1HR0B 1JFFB 4I9WA 4LNUA 5EK0A 5B66Z 1JR9A 2ZXWB 2X0LA 4GCZA 5LBQA 3CE2A 4DR1B 3W7TA 3K57A 2EZOA 1FD9A 2WAMA 1S5HC 1PD3A 1JPXA 5LYJB 1AR1B 5HFLA 5KHJA 1S5JA 2F95B 3FAVB 1WPXA 2QTOA 1YJWV 1K5QA 3E89A 3JASB 4DXWA 3LSSA 1N4CA 4JI1O 5H6RA 5LGTA 4ABMA 4LF6O 3H1HH 2P4KA 1ZTEA 2RCVA 3ASOC 4N23A 5J2TB 1DK1A 1NQTA 1RP3B 1I0HA 2GUZB 4IYIA 3ZMVA 1K9MW 1H2MA 2DN9A 1IXBA 4X1IA 3CC7V 1IDSA 3FB7C 1GTOA 2Q7HA 2BSKA 2BOCC 2XT9A 1BQ0A 1QVGU 4YJ3B 3D8CA 3FFQA 2XAHA 4FM1A 1VQKV 4DV3O 4DRXA 3I55V 5FLXN 2NLJC 2DYSB 4CBCA 1P49A 5L3EA 3A8TA 4MT8A 5IWAB 5JH7B 3ZCCA 1H2SB 4U3FH 4K0KB 3PN1A 4I9QA 4FJCC 5GW7A 4BW9A 3CPWU 3R65A 3DGEA 5D5PA 3SPJA 4PHZA 5IYCO 3LDEA 1AB3A 5CBFA 2QR4A 4LF8O 2E74B 4IHJB 4B3SO 4LF7O 1K33A 4ZBMA 1W2BU 1TVKB 1VQOV 1NR1A 4I4TB 4JPRA 3CCQV 4UXNA 2N04A 2CTPA 4NXNO 4BR6A 5IT9N 1IBKB 4OX9B 5IY5C 3OUFA 4DR7B 2BTQB 1SQQH 4DR6B 2P22C 2HP8A 1F51A 1MSDA 1SF9A 5A2QN 4JI7O 4LFCO 1MG1A 1NH2D 1F4NA 3ZIAG 5FNVA 1OCCC 4B7KA 3TK1A 5GONB 1I08A 4MVQA 5EIBC 1XNQO 1BCCH 5KLVH 4HAMA 2V4DA 1GH6A 1VQ9V 2E3CA 3UT5B 3PJSK 4JI6O 1KC8W 1DLBA 2EINB 1N0NA 2WLLB 1CP9A 3LDCA 4PA6A 2Y0PA 3AG1C 5IYZA 4O4LA 5B1AB 4QPJA 3APQA 3FX7A 2ZT9B 2OTLV 3D36A 3N2KA 2YC0A 1SERA 2QWQB 3D36C 2LGWA 2FTKA 3SPIA 4X65B 5CA3A 4JZGA 5LGNA 3U0ZA 3ZRWB 3K5LA 3ZRSA 1G6UA 4E2LA 4O4JA 1IX9A 3OEHG 4PD4F 3LNMB 1N33O 4MTGA 3RYIA 1R3IC 3UO2A 3FYIB 3HPLC 2ATKC 1H2KA 1ZL8A 4MS2A 4MVSA 1EN5A 4U7OA 1SRYA 2KG7A 3E22A 2ZM6O 2YI9A 1RM1B 1NTKH 1VF6C 3OAAG 3IJ4A 4MVRA 4CS4A 5EC1C 4UVBA 2AHYA 2FYUH 1Q43A 3Q4HB 3AK3A 3VBBA 5B1BC 4I50B 3AG4B 1E1QG 1XQ8A 4JI2B 1H2LA 1R73A 1VARA 1QNMA 1VF5B 5CA1B 5CN0A 3HKBB 3OTOO 4IGGA 4NXMO 2IJHA 2P6JA 4BW5A 3A0HZ 3VOUA 1PPJH 3ABMB 4LC1A 1I5YA 1EM1A 4ZHQB 4GX2A 4D7TA 3JSNA 5C93A 2ARHA 2UU9O 1M9NA 2YI8A 4NYKA 3ETGA 1XMQO 5CMUA 1Q6UA 5JVDA 2QEXV 1OCRB 5F2VO 1LUVA 3BPZA 2YEVA 1FFXA 4D7SA 2VWJA 2PI4A 3VQWA 1TGOA 1SZXA 4P30A 4WFEA 4I5SA 3QG5A 2YXLA 1L0NH 3X2QB 2EIMB 1QLEB 5JWPA 1NS1A 1KKCA 1TA8A 2QDOA 4IIJA 1IBLO 2LFSA 1VQMV 1R3JC 1KD1W 2QKAA 3FB8C 3ABTA 2QA4V 2YUAA 4O4IB 4ZOLB 4HYOA 2IU3A 1GN2A 1Q6HA 4RWUA 1GN4A 2ZNJA 4KHPO 4JAVA 2X6BA 1DF4A 3DSQA 2Q73A 1R6KA 1HNWO 2ETNA 1SQGA 4X20A 1R3LC 3OR7C 4DUYB 1YJNV 3VQVA 5C8YA 2CDYA 5L3DA 4H13B 3JAMN 2LP7A 4JI5B 3TETA 4BWAA 5GTHZ 1W0KG 3K03A 1UJWB 2HKOA 1AR4A 1K7DA 1G4YB 5IJ0B 5KX5A 5H5NA 1KMIZ 1N36B 4C7UA 4TT3G 1NJIW 5CB4A 1GO3F 3AG3B 3ZMSA 3J7AU 4R50A 4GZRB 4F6RA 5LGUA 2JRIA 4O2BA 4HNAA 4DV2O 1X4TA 4X66B 2RNBA 1WB8A 1S76D 3KKYA 3ZHQA 2ZDIC 1EN6A 4LFBB 1B06A 1PL4A 1VF7A 4B7EA 2VQFO 1RFYA 1GM9A 2OCCB 3HKDA 1PP9H 4DR2O 3OGCC 1HNZB 2YIAA 3E8BA 3VQYA 1O9GA 4NB5A 3CHXA 2VWKA 1WP8A 1I94B 1KP3A 5CA0B 3OD4A 4H33A 3E8FA 2UUAB 3BHPA 1NBMG 2PTMA 4KL1A 4DR4B 5AG2A 2ZIMA 3HKEA 4DR3B 3F7YC 4YIPA 1XNRB 2X6AA 3H1LH 4JI8B 1YJ9V 3K79A 4BIUA 3F5WC 4J7JA 2A7WA 1Q86W 3OTFA 4G2KA 3DC6A 3T1YO 4DYLA 1SKVA 2LGQA 3T1HO 3DXRB 4G27B 2Q67A 4YJ2B 2XAFA 3JATA 4U3JB 1RPOA 2Y4TA 1JCHA 2D2CB 1MNGA 1VIBA 3TJTA 1ZSPA 2BTOA 1BSMA 1GN3A 4WFBV 2WA4A 3AEIA 5BZBA 3CXCU 1IBMO 3MAQA 1K34A 1NH2B 4JI3O 4B08A 3P32A 2Y69B 5FL7G 3TGUH 3S3WA 2B5UA 1UFIA 4CS3A 3SPGA 3WG7B 1R1BA 1K4CC 1D5NA 2ZINA 5FPOA 3FB6C 1GRJA 1MZFA 4DK1A 3ICXA 2HVKC 1NT2B 4R8CA 4JI0B 3P3PA 1M93A 1KUQA 3SJCC 2EIKB 1M90W 3CCUV 3UCSC 1Y76A 4JAUA 5BMVA 1AROP 3SPCA 2GHYA 2QM4A 3ZMZA 4GKKB 4PJ0Z 1NZ6A 3CWBH 3KZIZ 2PUSA 5KAFZ 4X1IB 1LR1A 3ZHTA 2BSKB 1Q5OA 2ILMA 2UXDB 2EZPA 3KCYA 3G67A 1WLEA 3BY6A 2QSAA 2X6CA 4DRXB 1N32O 2GTAA 4PDRA 2OCHA 2UUBO 4JV5B 4MW8A 5JJJB 2QM7A 3E83A 5KUKA 3OMIB 1XOUA 4IYHA 1W0JG 1YXBA 1NVPB 3CD6V 2QJ1A 1HR0O 1L1FA 3N27A 4MVUA 4UUJC 2ZE8A 4QE7A 1R6TA 2GSMB 4O4HA 4DR1O 3BFRA 2JVDA 1OCOB 3SYPA 3RVYA 5JQGB 4JYCA 2W6IG 5B1NA 3K5NA 2Y48A 3GB7C 1AI4A 4LF5B 3C3TA 3D3IA 2HLDG 2WA3A 1PNLA 1ZAUA 2V1DA 3AG2C 4YY3O 2N74A 5LP6B 1WP7A 1XBLA 4LBEC 2Q9LA 2RMKB 1Z5VA 1O9HA 3CRRA 5IY5B 3IC7A 2E76B 4FIPC 1XI1A 1N8RW 2XAJA 5FNVB 1PKXA 5LOVA 5KMGB 1AVMA 3L72H 1OCZB 2NNUA 1GMGA 1S5LZ 3U10A 3B09A 3RVZA 3JD0A 2AZ2A 1FXVA 4L8JA 4Q20A 2RQ6A 1F7YA 4MVZA 5LMUB 3STLC 3AG1B 5IWAO 5IYZB 4O4LB 1AJNA 5LMNB 4K0KO 1V54B 1JOYA 4FLVA 2CE4A 4MTXA 2E5LB 1SA0A 3A0BZ 5LHIA 2QWNB 4YHHB 2FKXA 1KYOF 2ADQB 1A32A 4O4JB 1SQBH 2EBOA 4RQEA 3GWKC 3RYIB 4GX1A 2D3OW 1YITV 1QR9A 2CH7A 3G6EV 2PGGA 1FFTB 1Y66A 1ZL8B 2HVJC 3QNEA 4FLWA 3ABKC 4MSWC 5KA6A 3RYFB 2ADPA 1XHXA 1HNXB 4TSFG 5KAIZ 3BA8A 1SQPH 4OGQB 2BOBC 4DV0B 3HR0A 2JGDB 4UFZA 5B1BB 4J9YB 1BHAA 3WFVA 3E86A 3GWOA 2EIJB 4OX9O 2Q68A 2YXHA 4DR7O 3ABUA 1XHZA 4DR6O 2F4VB 1X59A 5GTIZ 4NKGB 1XILA 5BXZA 1PV0A 2JS5A 1GK9A 2UUCB 4FM0A 5B5EZ 5EZYB 1GN6A 2QWPB 1WN7A 4CZZA 3HKCA 4NTYA 5JJEB 4BIZA 3ETQA 3EHBB 1URFA 3OMAB 1LUWA 1RSOA 1CPYA 4JI4B 4P9OA 1FFXB 1M56B 4O2AA 5H9CA 4I55A 3HB3B 1ZUQA 3ASNC 5B3SC 4DV1O 2DJVA 1H38A 4FM2A 2WLIA 4PA9A 2CTWA 2Q7EA 2BCCH 3SYOA 5ITZA 4X65O 2X7RB 2ZXWC 2RJZA 4DV4B 2EILB 2OT5A 1MA1A 2CUGA 2WLJA 2Y0IA 1QQCA 1YI2V 1HW7A 1L8DA 1CXZB 4FPPA 4BAYA 4NTXA 4KFMA 4QNHB 4J10A 2G38A 4TUYB 3K9AA 2OIEA 4J11A 4X20B 4CH6A 2K9PA 3JALB 2ZE5A 1QLNA 1KU9A 1VQ5V 4XDLA 2OWOA 2KKWA 5J2TA 4JI7B 5C8YB 5EBLC 4LFCB 4DV6B 5EYPA 4AQYB 3BA9A 3SGIA 5A9GA 4JI2O 3ZHVA 2IU0A 4LH7A 1VP7A 1AJPA 1VF6A 1EBOA 4E4EA 4EEQA 2QE7G 3QVNA 2DE0X 1OHHG 3CRCA 3WB2A 1FXKB 3FD9A 4QE9A 1M57B 3E8GA 5CB4B 3L75H 5KHIA 3IC9A 2DYSC 3C3SA 3QO5A 1B6QA 5JH7A 3BAAA 4U7NA 4O2BB 1NVPD 4X62B 5JJNB 4GYCB 1E1RG 5KA5A 4UVAA 5D5QA 4LWSA 1JMKC 2HJDA 1Y4MA 1GM7A 1S3JA 4P2ZA 2UXNA 4MVOA 4UCOA 2HEPA 4W4KA 1N33B 3HKDB 2L35A 5BR8O 1XMOB 3ZS8C 1FJGB 4FLYA 1FXHA 3I5DA 2Z5UA 4LCUC 4JYBA 1S77D 1BZKA 1SZTA 4DV5B 2YIDA 1XL6A 1THZA 2A0LA 4I4TA 1HWYA 3JD1A 2W6JG 3K0DA 1EZJA 2B1IA 2B9ZA 3HKEB 1M1KW 1YZBA 4FZ1A 4DR5B 3JAKB 5EIBD 2DWDC 4DUYO 3W7UA 1MZEA 2BTQA 3SDLA 4HBNA 4CH4A 2FB5A 4JI5O 4XDKA 2R72A 1PNKA 2VQEB 1JVMA 1XDCA 3U11A 3JATB 4OPAA 4R6ZA 5LXTA 2XOKG 4N21A 4ZI7B 4RO2A 1N36O 4KXRA 5KHKA 1V55B 2EINC 1QVFU 4MW3A 3B8NA 3CCLV 3L9DA 1Q82W 4B3TB 4LFAB 5B1AC 1SQXH 1BS3A 4X66O 4UB8Z 3CB2A 2OYQA 4JYYA 1MMMA 2DMXA 3H1IH 3LSUA 3K0GA 2NN4A 4LFBO 1UPGA 1VQ6V 3RN4A 3H01A 3ML0A 3RT3C 3H1JH 4JTAB 4JTCB 1HP8A 1HNZO 1XEQA 3L71H 3MHHC 3ZRXA 4QGPA 4B3MB 4HZ3A 1WNSA 2A79B 2FMLA 3ZHUA 1YDXA 4LF4O 1P7GA 1TUBB 1Y76B 3KCXA 5BMVB 1B04A
chains in the Genus database with same CATH topology
3LUTB 1LNQA 1RM1C 2HFEC 1ORQC 2IW5A 2XAHA 1VQKV 2ZDIA 5IYBO 5LHGA 3I55V 1H2GA 4QIWF 4PA3A 3CCEV 1BHBA 2NLJC 2EZPA 4GT1A 5KUMA 2DYSB 4CBCA 4PA7A 1GM8A 5L3EA 2Q69A 1F4MA 4XBFA 5DM6V 4MT8A 2Z3YA 1R6NA 1PL0A 1WLEA 3BY6A 3ZCCA 4WCEV 2X6CA 3W7XA 1AI7A 3ETDA 3DTUB 5CBGA 1K4DC 4PDRA 1BL8A 2DYRB 4FJCC 5GW7A 4MW8A 1Q81W 3CPWU 3R65A 3DGEA 4ZKIA 1VQ7V 3SPJA 3OUSA 2EIJC 5IYDO 2QM7A 3E83A 4G28B 5IYCO 5KUKA 3LDEA 3OMIB 3ABLB 3ABMC 2HG5C 5CBFA 2JDIG 1W0JG 4PDMA 3BEHA 2XNDG 3I56V 1NVPB 3CD6V 4WFGA 1YHQV 2JK5C 1K33A 4ZBMA 1L1FA 4EKWA 1VQNV 4MVUA 1W2BU 4UUJC 4KP4A 4QE7A 1H8EG 2GSMB 1OCRC 3B8MA 5EC2C 2JJ1G 2OTJV 1VQOV 1TUEB 3CCVV 1NR1A 1OCOB 4JTDB 3SYPA 3RVYA 4JYCA 2W6IG 4FMTA 4JPRA 5B1NA 1ZWIC 3CCQV 3OFNG 2Y48A 3GB7C 4UXNA 1AI4A 3X2QC 2EIMC 1QLEC 2IH1C 3D3IA 2HLDG 2P90A 1M56C 2JEXA 3QO8A 4ASUG 1PNLA 2C2AA 3AG2C 2V1DA 5EBMC 2ZD9A 3OUFA 5IY5C 3OW2U 1ROPA 4LBEC 1F51A 4OXSA 1MG1A 2F43G 1NH2D 1BMFG 1F4NA 4JGSA 3ZIAG 1OCCC 5H6QA 5IY5B 3TK1A 3IC7A 4FIPC 1GKFA 4MVQA 1S72V 1P4RA 2Q6AA 2EILC 1N8RW 2XAJA 4HAMA 1PKXA 5E1AC 1VQ9V 3STZC 2WLLA 1SESA 1AJQA 1OCZB 3PJSK 2NNUA 1GMGA 1KC8W 4TWKA 1DLBA 2EINB 3RVZA 2JJ2G 3JD0A 3K08A 1FXVA 2V7QG 1CP9A 2WLLB 4Q20A 3LDCA 1K92A 4PA6A 3AG1C 5B1AB 4QPJA 4X8AA 3E2EA 5L3FA 2P67A 2WLMA 3OR6C 2OTLV 4MVZA 4F4LA 3D36A 3EFFK 3ZRWA 4WFAV 3STLC 1SERA 3AG1B 2WSSG 3NXSA 4H37A 2FTKA 3SYQA 3SPIA 2CK3G 5CA3A 5LGNA 1AJNA 3B77A 3ASOB 1V54B 3ZRWB 1JOYA 2W0FC 3ZRSA 4E2LA 3OEHG 4MTXA 2M7WA 4RUEA 3LNMB 4UV9A 2JIZG 2IH3C 4MTGA 3RBZA 3UKMA 1R3IC 2MK3A 5LHIA 3FYIB 2WLHA 3HPLC 2ATKC 4L87A 2WLNA 4MS2A 4MVSA 5L3GA 1FXKA 4U7OA 1SRYA 2EBOA 1FXKC 4RQEA 1J95A 3K04A 4RQFA 1M57C 4GX1A 1RM1B 2D3OW 1YITV 1QR9A 3G6EV 3OAAG 1FFTB 1Y66A 4MVRA 4JASA 1E79G 1KKDA 2HVJC 3QNEA 4WFHA 3ABKC 4MSWC 5EC1C 4UVBA 2AHYA 3AG4C 5KA6A 4MTFA 3LDDA 4GX0A 5DN6G 1EFRG 1DF5A 3LSQA 3VBBA 3T4ZA 4TSFG 5B1BC 3AG4B 1E1QG 2XAQA 2OCCC 2BOBC 1R73A 5B1BB 4J9YB 1BHAA 1QR8A 2WWWA 3WFVA 1AI6A 5CN0A 2DQ0A 3E35A 3E86A 1SETA 3GWOA 3G71V 1JJ2U 4J9ZB 2EIJB 2IJHA 2P6JA 3A0RA 4DO2A 2ZR2A 4BW5A 3CP1A 2Q68A 1MSWD 3VOUA 1OZ0A 3ABUA 4YXWG 2QKSA 3ABMB 3OE7G 4LC1A 1I5YA 1FS0G 4GX2A 1PNMA 5C93A 1GK9A 1M9NA 4R7CA 3JYCA 3ETGA 3CCJV 5CMUA 4MVMA 1COWG 1JX9A 4CZZA 3SJQC 2QEXV 1OCRB 2YEVA 3OM3B 4BIZA 4Z1MG 3FKSG 3CCMV 2PI4A 3T2MA 3UM7A 1XL4A 5CBHA 3ZN0A 3G4SV 3EHBB 4P30A 3OMAB 2ZR3A 4WFEA 4I5SA 1CPYA 3JCZA 4XDJA 4P9OA 1K5SA 2EIMB 3MD0A 1QLEB 4PDLA 3X2QB 1RPRA 2XAGA 2HJFC 1M56B 5H9CA 2KB1A 4JF3A 4QPKA 3HB3B 3ASNC 1KP2A 2P7TC 3AG2B 1MABG 5B3SC 1H38A 2LFSA 1VQMV 2WLIA 1R3JC 4PA9A 1KD1W 1VQLV 3SYOA 3FB8C 2ZQMA 3ABTA 2QA4V 4GX5A 3T1CA 1OCCB 2X7RB 4HYOA 2IU3A 2ZXWC 5L3CA 1P7BA 2WLIB 4X89A 2EILB 2OT5A 3JD3A 2WLJA 4JAVA 2X6BA 1YI2V 1DF4A 4FK5C 3SYAA 4FPPA 4BAYA 3FYEB 1V55C 1R6KA 3IFXA 2Y69C 2B1GA 1R3LC 3CC4V 4KFMA 3OR7C 4QNHB 3WG7C 2LFRA 1YJNV 2HR3A 3W7SA 1K8AW 5L3BA 1YTFD 2R9IA 3ZJZA 3K9AA 1NKDA 4RAIA 5L3DA 1QLNA 2YSUB 4QJFB 2LP7A 3TETA 1KQSU 1IXMA 1I5XA 1VQ5V 4XDLA 1W0KG 5EBLC 2EIKC 3K03A 1UJWB 1QCEA 2R9RB 1Q7YW 2HKOA 4UVCA 1K7DA 2IU0A 1VQ8V 3AG3C 5J9PC 1G4YB 5B1OA 1K73W 2WLKA 1AJPA 3IGAC 5IDJA 1EBOA 4TT3G 1NJIW 2QE7G 3F7VC 2UXXA 2IJKA 2PI5A 3AG3B 1GO3F 3ZMSA 1OHHG 1AI5A 4R50A 3MHSC 4MTOA 5LGUA 2EJRA 1FXKB 4QE9A 2ITDC 3K3WA 1M57B 3E8GA 3ZRVA 3OMNB 4P9PA 3K06A 3ABKB 1KECA 2DYSC 2DWEC 2QM8A 3QO5A 1B6QA 1MOFA 1S76D 2ITCC 3ZMUA 3OEEG 4U7NA 2ZDIC 3RW0A 1NVPD 2K1EA 1R3KC 3ZMTA 2DYRC 3FB5C 1E1RG 5KA5A 1GM9A 2OCCB 4UVAA 3SPHA 2WPDG 3OGCC 4UV8A 1Y4MA 1VQPV 1GM7A 1S3JA 4P2ZA 3CC2V 3E8BA 2UXNA 4MVOA 1YSCA 1JQ0A 3ABLC 4PELA 1DTOA 2JEUA 2H8PC 1FXHA 2Z5UA 1KP3A 4LCUC 4H33A 1CEZA 3E8FA 4JYBA 2AHZA 1NBMG 1S77D 1SZTA 5HFMA 3F7YC 1ENVA 2X6AA 2DQ3A 3CMAV 1XL6A 2IJJA 1H8HG 1THZA 1YJ9V 3K79A 2A0LA 4BIUA 3F5WC 1HWYA 1OCOC 1K3EA 2YEVB 1K97A 3JD1A 1Q86W 2W6JG 3K0DA 3TCUA 1EZJA 2B1IA 4G2KA 4WF9V 3CCSV 1M1KW 3T4DA 1VQ4V 2DWDC 3E8HA 4KUMA 3W7UA 4G27B 2Q67A 3ZN1A 3ASNB 5EBWC 2XAFA 1S0VA 4RUFA 5B3SB 1RPOA 3QO7A 4PDVA 4PA4A 4I9WA 4XDKA 1JCHA 5EK0A 1PNKA 1JVMA 1QBZA 2ZXWB 2X0LA 4R6ZA 4X88A 4GCZA 5LBQA 2H94A 3W7TA 1YIJV 2XOKG 4WFBV 3P30A 2DW4A 2EZOA 4N21A 5BZBA 3AEIA 1OCZC 3CXCU 2WAMA 4RO2A 1G8MA 4WFFA 1K34A 1S5HC 1PD3A 1JPXA 1AR1B 1V55B 2A9HA 2IJIA 1NH2B 2EINC 1QVFU 4MW3A 5HFLA 3B8NA 3P32A 2Y69B 5FL7G 3CCLV 2B5UA 1F23A 1Q82W 3SPGA 1WPXA 4LP8A 3WG7B 1K4CC 5B1AC 2QTOA 3CMEV 1YJWV 1K5QA 3FB6C 3CYOA 3E89A 3KG2A 4DXWA 3LSSA 1NR7A 3CCRV 5H6RA 5LGTA 2HVKC 4R8CA 3W7WA 3K0GA 3ETEA 1VQ6V 3ASOC 3H01A 3M99B 2EIKB 3ML0A 1V54C 4N23A 1M90W 3CCUV 1NQTA 4JAUA 3SYCA 4JTAB 4JTCB 3ZMVA 1K9MW 1AROP 3MHHC 3SPCA 3ZRXA 2GHYA 4HZ3A 2A79B 5LHHA 3CC7V 3FB7C 3ZMZA 1GTOA 3JD2A 2BOCC 2XASA 3JD4A 1YTFB 1QVGU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR V;  1Q81 W;  4WF9 V;  3CPW U;  3CCS V;  1M1K W;  2OTJ V;  1VQ7 V;  1VQO V;  1Q7Y W;  1YIJ V;  3CCJ V;  3CCV V;  4WFB V;  1VQK V;  1VQ4 V;  1VQM V;  1VQ8 V;  3CC4 V;  1R73 A;  3CXC U;  3CCQ V;  1S72 V;  3I55 V;  1KD1 W;  1VQ6 V;  1VQL V;  2QEX V;  2OTL V;  3CCE V;  1N8R W;  4WFA V;  2QA4 V;  3CCU V;  1YJN V;  1K73 W;  3CCM V;  1K8A W;  1M90 W;  2D3O W;  1QVF U;  1YIT V;  3G71 V;  3G6E V;  1NJI W;  1JJ2 U;  3G4S V;  3CCL V;  1K9M W;  5DM6 V;  3I56 V;  1VQ9 V;  3CD6 V;  1YHQ V;  4WCE V;  1Q82 W;  1VQN V;  1VQP V;  3CMA V;  3CC7 V;  3CC2 V;  1W2B U;  1YJ9 V;  1KC8 W;  3OW2 U;  3CME V;  1YJW V;  1KQS U;  1YI2 V;  1VQ5 V;  1Q86 W;  1QVG U; 
#chains in the Genus database with same CATH topology
 1LNQ A;  2R70 A;  1I94 O;  1RM1 C;  1TAE A;  2ZNI A;  2HFE C;  2ZDI A;  3OT7 A;  4X1Y B;  4QIW F;  4PA3 A;  2UUA O;  4GT1 A;  5KUM A;  4DR4 O;  4GKJ B;  5LA6 B;  2ODM A;  3JAW B;  1GM8 A;  4DR3 O;  1F4M A;  5E79 Z;  5DM6 V;  2Z3Y A;  1R6N A;  4WCE V;  2W0X A;  2LW1 A;  1AI7 A;  4X1K B;  4DV7 B;  2DYR B;  5CA1 A;  4WBN B;  1BQZ A;  3HKB A;  4OPH A;  1Q81 W;  4ZKI A;  2XHB A;  5IYD O;  4G28 B;  2JS3 A;  2Q0A A;  3SR2 C;  4Z2W A;  3ABL B;  3ABM C;  2HG5 C;  1EZV H;  2OIG A;  2QKC A;  4PDM A;  3BEH A;  3I56 V;  1SQV H;  4EB6 B;  4KP4 A;  1Q90 D;  1H8E G;  3CJH A;  4GUN A;  3RYC B;  1OCR C;  4DV2 B;  3B8M A;  2OTJ V;  4TV8 A;  4TQF A;  1WJZ A;  2Q0O C;  3CEI A;  3OFN G;  4O4H B;  3X2Q C;  2EIM C;  1QLE C;  2IH1 C;  1QU7 A;  3QO8 A;  3ZHS A;  2C2A A;  4DR2 B;  5EBM C;  3GVM A;  3OW2 U;  1ROP A;  2CAZ C;  1HDJ A;  2ZIO A;  3DC5 A;  4OXS A;  2F43 G;  1BMF G;  3UO3 A;  4FFK A;  4JGS A;  4JI0 O;  5H6Q A;  4Z1V A;  3J80 N;  2L6L A;  2MW2 B;  1GKF A;  4LNU B;  3B4S A;  4FVM A;  2FL4 A;  2F1M A;  3STZ C;  1AJQ A;  4GKK O;  2F66 C;  1QHT A;  2JJ2 G;  4CS2 A;  2F93 B;  2ZE6 A;  2V7Q G;  3JAR A;  4X8A A;  5L3F A;  2P67 A;  2WLM A;  2UXD O;  3OR6 C;  4CH3 A;  3EFF K;  1WPB A;  3NXS A;  2CK3 G;  4JYA O;  1N0J A;  3B77 A;  3RYH A;  3ASO B;  2GTS A;  1Y74 A;  4JV5 O;  5IJ0 A;  1NTM H;  3RBZ A;  4RUE A;  4UV9 A;  2IH3 C;  2MK3 A;  2WLH A;  3TXQ A;  5L3G A;  5IJ9 A;  4B3R B;  4JI3 B;  4TV9 A;  2EX3 A;  4I0X A;  4H44 B;  1KKD A;  2RN9 A;  4DUZ B;  2AW9 A;  2H3O A;  4MTF A;  4JAA A;  4GX0 A;  3K59 A;  1DF5 A;  2GDS A;  1AP6 A;  2AXT Z;  4UB6 Z;  4DW1 A;  3N2G A;  4J42 A;  3O9O A;  1US6 A;  2OCC C;  5FPR A;  1FAF A;  4LF5 O;  1QR8 A;  2WWW A;  1SC5 B;  1AI6 A;  1WB7 A;  2DQ0 A;  3E35 A;  2YS8 A;  3G71 V;  4J9Z B;  4DO2 A;  3A0R A;  2UXB B;  2PY5 A;  1MSW D;  4YXW G;  2QKS A;  2VS0 A;  2LJ2 A;  4CC5 A;  2GV9 A;  4BIO A;  3G6B A;  3CCJ V;  2UXC B;  4MVM A;  1COW G;  1JX9 A;  4Z1M G;  3FKS G;  3S3X A;  3T2M A;  1SS3 A;  1N34 B;  5CBH A;  3P3N A;  3ZN0 A;  2HHH B;  3K5M A;  2ZR3 A;  2Z0A A;  4XDJ A;  4PDL A;  2PYL A;  1RPR A;  2XAG A;  2IM9 A;  4D6T H;  2KB1 A;  3EXA A;  4JF3 A;  4U3J A;  1KP2 A;  2P7T C;  4TOI A;  2QWO B;  5J2U A;  1YCI A;  4GX5 A;  4I55 B;  3T1C A;  1OCC B;  5L3C A;  4J7K A;  1P7B A;  5LMN O;  2WLI B;  1NU1 H;  1Y6X A;  3JD3 A;  4LF9 B;  4H0L B;  1Q6I A;  5ITZ B;  2E5L O;  1I7F A;  2KQX A;  2LO1 A;  4YHH O;  3FYE B;  4K8X A;  3MDS A;  2DOS A;  3K58 A;  3IFX A;  2Y69 C;  3BRC A;  3CC4 V;  1VMG A;  1NTZ H;  3WG7 C;  2LFR A;  1K8A W;  1WA8 A;  4X64 B;  5L3B A;  3IAY A;  1J5E B;  4RAI A;  2YSU B;  4QJF B;  3AK1 A;  4YY3 B;  3N2K B;  1HNX O;  1IXM A;  1I5X A;  2YIC A;  1EN4 A;  4FLU A;  3APO A;  2EIK C;  2AZ0 A;  2QGN A;  4DV0 O;  2AGA A;  5J9P C;  2PZS A;  5B1O A;  2WLK A;  3IGA C;  5IDJ A;  5EYP B;  4CC6 A;  2EUL A;  2UXX A;  4MTO A;  2F4V O;  3K3W A;  2KG7 B;  3E22 B;  1XUQ A;  2UUC O;  2YDE A;  5K1X A;  3ZRV A;  1KEC A;  4JI1 B;  2DWE C;  2QM8 A;  2ITC C;  3RW0 A;  1AIL A;  2P06 A;  2A06 H;  4LF6 B;  1R3K C;  3ZMT A;  3H1K H;  2GBO A;  3FB5 C;  3CRA A;  3SPH A;  2Q4P A;  4JI4 O;  1IBK O;  1VQP V;  4J41 A;  4AIL C;  1JQ0 A;  4PEL A;  4LWS B;  2JEU A;  5BY1 A;  3RFR A;  2H8P C;  3CX5 F;  3D3Q A;  2KSD A;  4DV3 B;  1CEZ A;  2AHZ A;  4J80 A;  4FFB A;  2ZCE A;  4DV4 O;  1ENV A;  2DQ3 A;  3CMA V;  2IJJ A;  1IUR A;  5JQG A;  5JVD B;  4UCV A;  1OCO C;  1K3E A;  2YEV B;  1JJO A;  1D5A A;  3TCU A;  3CCS V;  3T4D A;  3E8H A;  1JFF A;  4ZIB A;  5LP6 A;  1YF2 A;  4IT5 A;  5LP6 C;  3ZN1 A;  3WB0 A;  4LF8 B;  1L0L H;  4IIJ B;  4B3S B;  4PDV A;  4LF7 B;  3VQX A;  2YIB A;  1OJH A;  4DV6 O;  1QBZ A;  4GLX A;  5LYJ A;  4X88 A;  4AQY O;  2H94 A;  5KMG A;  1YIJ V;  4FLT A;  3P30 A;  2DW4 A;  1JA8 A;  1OCZ C;  3FAV A;  5LXT B;  1AP5 A;  1G8M A;  4WFF A;  2A9H A;  2IJI A;  3JAS A;  5IE9 A;  4NXN B;  4F6E A;  4AI8 A;  1F23 A;  2N05 A;  2E75 B;  4LP8 A;  1FPO A;  4UCR A;  3CME V;  3CYO A;  2QWR B;  3KG2 A;  1BT8 A;  4AHC A;  1NR7 A;  3CCR V;  5KHG A;  3WB1 A;  3C90 A;  2GUZ A;  2LQT A;  3W7W A;  4DV1 B;  1ZX3 A;  4X62 O;  3ETE A;  5DED A;  3M99 B;  1V54 C;  2IBZ H;  1XNQ B;  3SYC A;  4YJ3 A;  3M8A A;  5LHH A;  3JD2 A;  4JI6 B;  5KX5 B;  2XAS A;  3JD4 A;  1YTF B;  1IZ3 A;  3LUT B;  1XMO O;  1FJG O;  3L74 H;  4IL6 Z;  1ORQ C;  4F6R B;  2IW5 A;  5IYB O;  5LHG A;  4HNA B;  3RYF A;  5KHH A;  4W4L A;  1H2G A;  3CCE V;  1BHB A;  1FYJ A;  4PA7 A;  2Q69 A;  4DV5 O;  1H2N A;  4NTW A;  5TIS Z;  4XBF A;  1PL0 A;  3W7X A;  3ETD A;  3DTU B;  3A2F A;  2JGD A;  5CBG A;  1K4D C;  1BL8 A;  4EFE A;  2RDC A;  4IHJ A;  2PYJ A;  1VQ7 V;  4DR5 O;  3WU2 Z;  3OUS A;  2EIJ C;  4FLZ A;  2JDI G;  3QTC A;  2EJ7 A;  2ZM6 B;  2XND G;  4WFG A;  1TVK A;  1YHQ V;  2JK5 C;  3RWR D;  5EZY A;  1VQN V;  4EKW A;  2VQE O;  3UQ8 A;  5EC2 C;  2JJ1 G;  1TUE B;  3CCV V;  4JTD B;  4FMT A;  2VRZ A;  1ZWI C;  3CJH B;  3JCU Z;  2P90 A;  3O65 A;  3OGI B;  1M56 C;  2JEX A;  4ASU G;  3K9S A;  2Y4U A;  3OTO B;  4TV8 B;  4B3T O;  4LFA O;  4NXM B;  1YVW A;  2LW7 A;  5GON A;  2YIB D;  2ZD9 A;  4CH5 A;  3M7M X;  5BR8 B;  2UU9 B;  4YIO A;  3UT5 A;  1XMQ B;  1S72 V;  1P4R A;  1T5E A;  2Q6A A;  2EIL C;  1PM9 A;  2JGU A;  1B3Q A;  4K35 A;  5E1A C;  4B3M O;  1OV9 A;  2WLL A;  1SES A;  4TWK A;  2O57 A;  3K08 A;  1BE3 H;  3NR7 A;  4TUY A;  1K92 A;  1IBL B;  3E2E A;  3JAL A;  4EFB A;  4X9Q A;  4F4L A;  3ZRW A;  4WFA V;  4GKJ O;  1KBH A;  1Y67 A;  2WSS G;  4H37 A;  3AG7 A;  3SYQ A;  3JAR B;  4DK0 A;  3JSL A;  1XRE A;  3B2E E;  4DV7 O;  3CRQ A;  2W0F C;  4KHP B;  2M7W A;  3SJB C;  2JIZ G;  4PV1 B;  3UKM A;  2YXY A;  4UCS A;  1DGS A;  3RYH B;  2F23 A;  3BAB A;  1Y74 B;  4L87 A;  1HNW B;  2WLN A;  2Q5Z A;  4LR3 A;  1FXK A;  3L70 H;  2PF4 E;  3Q4H A;  1FXK C;  5H2F Z;  1J95 A;  3K04 A;  3ZX6 A;  4RQF A;  1M57 C;  5DEC A;  3K5O A;  4JAS A;  1E79 G;  1XNR O;  4I50 A;  4WFH A;  4JI8 O;  5IJ9 B;  2M6Y A;  3AG4 C;  3LDD A;  1U96 A;  5DN6 G;  1WAZ A;  1EFR G;  3LSQ A;  4K3A A;  3H9V A;  4TV9 B;  4I0X B;  2XUM A;  3T4Z A;  2ZE7 A;  2XAQ A;  4ZHQ A;  2CTQ A;  4NR1 A;  1SET A;  3N2G B;  1JJ2 U;  5LL6 Y;  3THO A;  2ZR2 A;  4TQD A;  3CP1 A;  1OZ0 A;  3OE7 G;  1FS0 G;  4LF4 B;  1AR5 A;  1PNM A;  2CGN A;  4R7C A;  3JYC A;  3CS5 A;  1V9P A;  3SJQ C;  1Q3E A;  3OM3 B;  4PI2 A;  3CCM V;  1VEW A;  3UM7 A;  2VQF B;  1XL4 A;  3G4S V;  2R9A A;  1BGY H;  3JAK A;  3JCZ A;  4I7Z B;  3CRM A;  1K5S A;  3MD0 A;  4UCT A;  1W59 A;  2HJF C;  2P4V A;  4LH6 A;  4QPK A;  4O4I A;  4K8Z A;  4ZOL A;  3AG2 B;  1MAB G;  3CSX A;  1VQL V;  4J7Z A;  2ZQM A;  4FLX A;  4UCU A;  2P5O A;  3G80 A;  3TXS A;  5J2U B;  2ZKO A;  4X89 A;  4ZI7 A;  2QTS A;  4FK5 C;  3SYA A;  1M4U A;  1V55 C;  5LOV B;  4PI0 A;  2XTA A;  2B1G A;  3T1Y B;  2NR5 A;  3T1H B;  5K1P A;  1D2D A;  4B3R O;  2HR3 A;  3W7S A;  1GAX A;  2Q7G A;  1YTF D;  2R9I A;  3ZJZ A;  4DUZ O;  1NKD A;  1FKA O;  1KB9 F;  3L73 H;  3ZHR A;  1KQS U;  3CXH F;  1WA8 B;  5JCO A;  2A3Q A;  3QF7 A;  5JCO C;  1QCE A;  2R9R B;  3F5T A;  4DW0 A;  1Q7Y W;  4UVC A;  1VQ8 V;  3AG3 C;  3AK2 A;  4JZ2 A;  1IBM B;  1TUB A;  1K73 W;  1SA0 B;  1U97 A;  3R66 A;  3F7V C;  2IJK A;  2PI5 A;  3EVK A;  2UXB O;  1AI5 A;  3MHS C;  3ZBH A;  4ICG A;  2EJR A;  4X1Y A;  2ITD C;  1NI8 A;  2CH7 B;  5LA6 A;  3JAW A;  3OMN B;  3K06 A;  4P9P A;  3ABK B;  2UXC O;  1MOF A;  2CGO A;  4FZ0 A;  3ZMU A;  3BVO A;  3OEE G;  4X1K A;  2K1E A;  4NVP A;  1N34 O;  4WBN A;  2DYR C;  2WPD G;  2HHH O;  4JYA B;  3BCC H;  4UV8 A;  3SJA C;  3CC2 V;  1Q8I A;  5CA0 A;  1YSC A;  1ZLZ A;  1P84 F;  3ZED A;  3ABL C;  1DTO A;  2BE3 A;  4EB6 A;  1SQF A;  3RYC A;  4A5U B;  5HFM A;  4Q6G A;  4LF9 O;  1G1X B;  1H8H G;  3LNN A;  1N32 B;  3HKC B;  1Z5W A;  1K97 A;  3DXR A;  4FFB B;  2UUB B;  4WF9 V;  3RGB A;  4YJ2 A;  1Z2G A;  1IVS A;  1RSO B;  3B40 A;  1VQ4 V;  3J81 N;  2Q8V A;  4KUM A;  5LMU O;  4O2A B;  1YEW A;  4X64 O;  3ASN B;  5EBW C;  1M5I A;  1S0V A;  4RUF A;  5B3S B;  2CTR A;  1J5E O;  3QO7 A;  4PA4 A;  1HR0 B;  1JFF B;  4I9W A;  4LNU A;  5EK0 A;  5B66 Z;  1JR9 A;  2ZXW B;  2X0L A;  4GCZ A;  5LBQ A;  3CE2 A;  4DR1 B;  3W7T A;  3K57 A;  2EZO A;  1FD9 A;  2WAM A;  1S5H C;  1PD3 A;  1JPX A;  5LYJ B;  1AR1 B;  5HFL A;  5KHJ A;  1S5J A;  2F95 B;  3FAV B;  1WPX A;  2QTO A;  1YJW V;  1K5Q A;  3E89 A;  3JAS B;  4DXW A;  3LSS A;  1N4C A;  4JI1 O;  5H6R A;  5LGT A;  4ABM A;  4LF6 O;  3H1H H;  2P4K A;  1ZTE A;  2RCV A;  3ASO C;  4N23 A;  5J2T B;  1DK1 A;  1NQT A;  1RP3 B;  1I0H A;  2GUZ B;  4IYI A;  3ZMV A;  1K9M W;  1H2M A;  2DN9 A;  1IXB A;  4X1I A;  3CC7 V;  1IDS A;  3FB7 C;  1GTO A;  2Q7H A;  2BSK A;  2BOC C;  2XT9 A;  1BQ0 A;  1QVG U;  4YJ3 B;  3D8C A;  3FFQ A;  2XAH A;  4FM1 A;  1VQK V;  4DV3 O;  4DRX A;  3I55 V;  5FLX N;  2NLJ C;  2DYS B;  4CBC A;  1P49 A;  5L3E A;  3A8T A;  4MT8 A;  5IWA B;  5JH7 B;  3ZCC A;  1H2S B;  4U3F H;  4K0K B;  3PN1 A;  4I9Q A;  4FJC C;  5GW7 A;  4BW9 A;  3CPW U;  3R65 A;  3DGE A;  5D5P A;  3SPJ A;  4PHZ A;  5IYC O;  3LDE A;  1AB3 A;  5CBF A;  2QR4 A;  4LF8 O;  2E74 B;  4IHJ B;  4B3S O;  4LF7 O;  1K33 A;  4ZBM A;  1W2B U;  1TVK B;  1VQO V;  1NR1 A;  4I4T B;  4JPR A;  3CCQ V;  4UXN A;  2N04 A;  2CTP A;  4NXN O;  4BR6 A;  5IT9 N;  1IBK B;  4OX9 B;  5IY5 C;  3OUF A;  4DR7 B;  2BTQ B;  1SQQ H;  4DR6 B;  2P22 C;  2HP8 A;  1F51 A;  1MSD A;  1SF9 A;  5A2Q N;  4JI7 O;  4LFC O;  1MG1 A;  1NH2 D;  1F4N A;  3ZIA G;  5FNV A;  1OCC C;  4B7K A;  3TK1 A;  5GON B;  1I08 A;  4MVQ A;  5EIB C;  1XNQ O;  1BCC H;  5KLV H;  4HAM A;  2V4D A;  1GH6 A;  1VQ9 V;  2E3C A;  3UT5 B;  3PJS K;  4JI6 O;  1KC8 W;  1DLB A;  2EIN B;  1N0N A;  2WLL B;  1CP9 A;  3LDC A;  4PA6 A;  2Y0P A;  3AG1 C;  5IYZ A;  4O4L A;  5B1A B;  4QPJ A;  3APQ A;  3FX7 A;  2ZT9 B;  2OTL V;  3D36 A;  3N2K A;  2YC0 A;  1SER A;  2QWQ B;  3D36 C;  2LGW A;  2FTK A;  3SPI A;  4X65 B;  5CA3 A;  4JZG A;  5LGN A;  3U0Z A;  3ZRW B;  3K5L A;  3ZRS A;  1G6U A;  4E2L A;  4O4J A;  1IX9 A;  3OEH G;  4PD4 F;  3LNM B;  1N33 O;  4MTG A;  3RYI A;  1R3I C;  3UO2 A;  3FYI B;  3HPL C;  2ATK C;  1H2K A;  1ZL8 A;  4MS2 A;  4MVS A;  1EN5 A;  4U7O A;  1SRY A;  2KG7 A;  3E22 A;  2ZM6 O;  2YI9 A;  1RM1 B;  1NTK H;  1VF6 C;  3OAA G;  3IJ4 A;  4MVR A;  4CS4 A;  5EC1 C;  4UVB A;  2AHY A;  2FYU H;  1Q43 A;  3Q4H B;  3AK3 A;  3VBB A;  5B1B C;  4I50 B;  3AG4 B;  1E1Q G;  1XQ8 A;  4JI2 B;  1H2L A;  1R73 A;  1VAR A;  1QNM A;  1VF5 B;  5CA1 B;  5CN0 A;  3HKB B;  3OTO O;  4IGG A;  4NXM O;  2IJH A;  2P6J A;  4BW5 A;  3A0H Z;  3VOU A;  1PPJ H;  3ABM B;  4LC1 A;  1I5Y A;  1EM1 A;  4ZHQ B;  4GX2 A;  4D7T A;  3JSN A;  5C93 A;  2ARH A;  2UU9 O;  1M9N A;  2YI8 A;  4NYK A;  3ETG A;  1XMQ O;  5CMU A;  1Q6U A;  5JVD A;  2QEX V;  1OCR B;  5F2V O;  1LUV A;  3BPZ A;  2YEV A;  1FFX A;  4D7S A;  2VWJ A;  2PI4 A;  3VQW A;  1TGO A;  1SZX A;  4P30 A;  4WFE A;  4I5S A;  3QG5 A;  2YXL A;  1L0N H;  3X2Q B;  2EIM B;  1QLE B;  5JWP A;  1NS1 A;  1KKC A;  1TA8 A;  2QDO A;  4IIJ A;  1IBL O;  2LFS A;  1VQM V;  1R3J C;  1KD1 W;  2QKA A;  3FB8 C;  3ABT A;  2QA4 V;  2YUA A;  4O4I B;  4ZOL B;  4HYO A;  2IU3 A;  1GN2 A;  1Q6H A;  4RWU A;  1GN4 A;  2ZNJ A;  4KHP O;  4JAV A;  2X6B A;  1DF4 A;  3DSQ A;  2Q73 A;  1R6K A;  1HNW O;  2ETN A;  1SQG A;  4X20 A;  1R3L C;  3OR7 C;  4DUY B;  1YJN V;  3VQV A;  5C8Y A;  2CDY A;  5L3D A;  4H13 B;  3JAM N;  2LP7 A;  4JI5 B;  3TET A;  4BWA A;  5GTH Z;  1W0K G;  3K03 A;  1UJW B;  2HKO A;  1AR4 A;  1K7D A;  1G4Y B;  5IJ0 B;  5KX5 A;  5H5N A;  1KMI Z;  1N36 B;  4C7U A;  4TT3 G;  1NJI W;  5CB4 A;  1GO3 F;  3AG3 B;  3ZMS A;  3J7A U;  4R50 A;  4GZR B;  4F6R A;  5LGU A;  2JRI A;  4O2B A;  4HNA A;  4DV2 O;  1X4T A;  4X66 B;  2RNB A;  1WB8 A;  1S76 D;  3KKY A;  3ZHQ A;  2ZDI C;  1EN6 A;  4LFB B;  1B06 A;  1PL4 A;  1VF7 A;  4B7E A;  2VQF O;  1RFY A;  1GM9 A;  2OCC B;  3HKD A;  1PP9 H;  4DR2 O;  3OGC C;  1HNZ B;  2YIA A;  3E8B A;  3VQY A;  1O9G A;  4NB5 A;  3CHX A;  2VWK A;  1WP8 A;  1I94 B;  1KP3 A;  5CA0 B;  3OD4 A;  4H33 A;  3E8F A;  2UUA B;  3BHP A;  1NBM G;  2PTM A;  4KL1 A;  4DR4 B;  5AG2 A;  2ZIM A;  3HKE A;  4DR3 B;  3F7Y C;  4YIP A;  1XNR B;  2X6A A;  3H1L H;  4JI8 B;  1YJ9 V;  3K79 A;  4BIU A;  3F5W C;  4J7J A;  2A7W A;  1Q86 W;  3OTF A;  4G2K A;  3DC6 A;  3T1Y O;  4DYL A;  1SKV A;  2LGQ A;  3T1H O;  3DXR B;  4G27 B;  2Q67 A;  4YJ2 B;  2XAF A;  3JAT A;  4U3J B;  1RPO A;  2Y4T A;  1JCH A;  2D2C B;  1MNG A;  1VIB A;  3TJT A;  1ZSP A;  2BTO A;  1BSM A;  1GN3 A;  4WFB V;  2WA4 A;  3AEI A;  5BZB A;  3CXC U;  1IBM O;  3MAQ A;  1K34 A;  1NH2 B;  4JI3 O;  4B08 A;  3P32 A;  2Y69 B;  5FL7 G;  3TGU H;  3S3W A;  2B5U A;  1UFI A;  4CS3 A;  3SPG A;  3WG7 B;  1R1B A;  1K4C C;  1D5N A;  2ZIN A;  5FPO A;  3FB6 C;  1GRJ A;  1MZF A;  4DK1 A;  3ICX A;  2HVK C;  1NT2 B;  4R8C A;  4JI0 B;  3P3P A;  1M93 A;  1KUQ A;  3SJC C;  2EIK B;  1M90 W;  3CCU V;  3UCS C;  1Y76 A;  4JAU A;  5BMV A;  1ARO P;  3SPC A;  2GHY A;  2QM4 A;  3ZMZ A;  4GKK B;  4PJ0 Z;  1NZ6 A;  3CWB H;  3KZI Z;  2PUS A;  5KAF Z;  4X1I B;  1LR1 A;  3ZHT A;  2BSK B;  1Q5O A;  2ILM A;  2UXD B;  2EZP A;  3KCY A;  3G67 A;  1WLE A;  3BY6 A;  2QSA A;  2X6C A;  4DRX B;  1N32 O;  2GTA A;  4PDR A;  2OCH A;  2UUB O;  4JV5 B;  4MW8 A;  5JJJ B;  2QM7 A;  3E83 A;  5KUK A;  3OMI B;  1XOU A;  4IYH A;  1W0J G;  1YXB A;  1NVP B;  3CD6 V;  2QJ1 A;  1HR0 O;  1L1F A;  3N27 A;  4MVU A;  4UUJ C;  2ZE8 A;  4QE7 A;  1R6T A;  2GSM B;  4O4H A;  4DR1 O;  3BFR A;  2JVD A;  1OCO B;  3SYP A;  3RVY A;  5JQG B;  4JYC A;  2W6I G;  5B1N A;  3K5N A;  2Y48 A;  3GB7 C;  1AI4 A;  4LF5 B;  3C3T A;  3D3I A;  2HLD G;  2WA3 A;  1PNL A;  1ZAU A;  2V1D A;  3AG2 C;  4YY3 O;  2N74 A;  5LP6 B;  1WP7 A;  1XBL A;  4LBE C;  2Q9L A;  2RMK B;  1Z5V A;  1O9H A;  3CRR A;  5IY5 B;  3IC7 A;  2E76 B;  4FIP C;  1XI1 A;  1N8R W;  2XAJ A;  5FNV B;  1PKX A;  5LOV A;  5KMG B;  1AVM A;  3L72 H;  1OCZ B;  2NNU A;  1GMG A;  1S5L Z;  3U10 A;  3B09 A;  3RVZ A;  3JD0 A;  2AZ2 A;  1FXV A;  4L8J A;  4Q20 A;  2RQ6 A;  1F7Y A;  4MVZ A;  5LMU B;  3STL C;  3AG1 B;  5IWA O;  5IYZ B;  4O4L B;  1AJN A;  5LMN B;  4K0K O;  1V54 B;  1JOY A;  4FLV A;  2CE4 A;  4MTX A;  2E5L B;  1SA0 A;  3A0B Z;  5LHI A;  2QWN B;  4YHH B;  2FKX A;  1KYO F;  2ADQ B;  1A32 A;  4O4J B;  1SQB H;  2EBO A;  4RQE A;  3GWK C;  3RYI B;  4GX1 A;  2D3O W;  1YIT V;  1QR9 A;  2CH7 A;  3G6E V;  2PGG A;  1FFT B;  1Y66 A;  1ZL8 B;  2HVJ C;  3QNE A;  4FLW A;  3ABK C;  4MSW C;  5KA6 A;  3RYF B;  2ADP A;  1XHX A;  1HNX B;  4TSF G;  5KAI Z;  3BA8 A;  1SQP H;  4OGQ B;  2BOB C;  4DV0 B;  3HR0 A;  2JGD B;  4UFZ A;  5B1B B;  4J9Y B;  1BHA A;  3WFV A;  3E86 A;  3GWO A;  2EIJ B;  4OX9 O;  2Q68 A;  2YXH A;  4DR7 O;  3ABU A;  1XHZ A;  4DR6 O;  2F4V B;  1X59 A;  5GTI Z;  4NKG B;  1XIL A;  5BXZ A;  1PV0 A;  2JS5 A;  1GK9 A;  2UUC B;  4FM0 A;  5B5E Z;  5EZY B;  1GN6 A;  2QWP B;  1WN7 A;  4CZZ A;  3HKC A;  4NTY A;  5JJE B;  4BIZ A;  3ETQ A;  3EHB B;  1URF A;  3OMA B;  1LUW A;  1RSO A;  1CPY A;  4JI4 B;  4P9O A;  1FFX B;  1M56 B;  4O2A A;  5H9C A;  4I55 A;  3HB3 B;  1ZUQ A;  3ASN C;  5B3S C;  4DV1 O;  2DJV A;  1H38 A;  4FM2 A;  2WLI A;  4PA9 A;  2CTW A;  2Q7E A;  2BCC H;  3SYO A;  5ITZ A;  4X65 O;  2X7R B;  2ZXW C;  2RJZ A;  4DV4 B;  2EIL B;  2OT5 A;  1MA1 A;  2CUG A;  2WLJ A;  2Y0I A;  1QQC A;  1YI2 V;  1HW7 A;  1L8D A;  1CXZ B;  4FPP A;  4BAY A;  4NTX A;  4KFM A;  4QNH B;  4J10 A;  2G38 A;  4TUY B;  3K9A A;  2OIE A;  4J11 A;  4X20 B;  4CH6 A;  2K9P A;  3JAL B;  2ZE5 A;  1QLN A;  1KU9 A;  1VQ5 V;  4XDL A;  2OWO A;  2KKW A;  5J2T A;  4JI7 B;  5C8Y B;  5EBL C;  4LFC B;  4DV6 B;  5EYP A;  4AQY B;  3BA9 A;  3SGI A;  5A9G A;  4JI2 O;  3ZHV A;  2IU0 A;  4LH7 A;  1VP7 A;  1AJP A;  1VF6 A;  1EBO A;  4E4E A;  4EEQ A;  2QE7 G;  3QVN A;  2DE0 X;  1OHH G;  3CRC A;  3WB2 A;  1FXK B;  3FD9 A;  4QE9 A;  1M57 B;  3E8G A;  5CB4 B;  3L75 H;  5KHI A;  3IC9 A;  2DYS C;  3C3S A;  3QO5 A;  1B6Q A;  5JH7 A;  3BAA A;  4U7N A;  4O2B B;  1NVP D;  4X62 B;  5JJN B;  4GYC B;  1E1R G;  5KA5 A;  4UVA A;  5D5Q A;  4LWS A;  1JMK C;  2HJD A;  1Y4M A;  1GM7 A;  1S3J A;  4P2Z A;  2UXN A;  4MVO A;  4UCO A;  2HEP A;  4W4K A;  1N33 B;  3HKD B;  2L35 A;  5BR8 O;  1XMO B;  3ZS8 C;  1FJG B;  4FLY A;  1FXH A;  3I5D A;  2Z5U A;  4LCU C;  4JYB A;  1S77 D;  1BZK A;  1SZT A;  4DV5 B;  2YID A;  1XL6 A;  1THZ A;  2A0L A;  4I4T A;  1HWY A;  3JD1 A;  2W6J G;  3K0D A;  1EZJ A;  2B1I A;  2B9Z A;  3HKE B;  1M1K W;  1YZB A;  4FZ1 A;  4DR5 B;  3JAK B;  5EIB D;  2DWD C;  4DUY O;  3W7U A;  1MZE A;  2BTQ A;  3SDL A;  4HBN A;  4CH4 A;  2FB5 A;  4JI5 O;  4XDK A;  2R72 A;  1PNK A;  2VQE B;  1JVM A;  1XDC A;  3U11 A;  3JAT B;  4OPA A;  4R6Z A;  5LXT A;  2XOK G;  4N21 A;  4ZI7 B;  4RO2 A;  1N36 O;  4KXR A;  5KHK A;  1V55 B;  2EIN C;  1QVF U;  4MW3 A;  3B8N A;  3CCL V;  3L9D A;  1Q82 W;  4B3T B;  4LFA B;  5B1A C;  1SQX H;  1BS3 A;  4X66 O;  4UB8 Z;  3CB2 A;  2OYQ A;  4JYY A;  1MMM A;  2DMX A;  3H1I H;  3LSU A;  3K0G A;  2NN4 A;  4LFB O;  1UPG A;  1VQ6 V;  3RN4 A;  3H01 A;  3ML0 A;  3RT3 C;  3H1J H;  4JTA B;  4JTC B;  1HP8 A;  1HNZ O;  1XEQ A;  3L71 H;  3MHH C;  3ZRX A;  4QGP A;  4B3M B;  4HZ3 A;  1WNS A;  2A79 B;  2FML A;  3ZHU A;  1YDX A;  4LF4 O;  1P7G A;  1TUB B;  1Y76 B;  3KCX A;  5BMV B;  1B04 A; 
#chains in the Genus database with same CATH homology
 3LUT B;  1LNQ A;  1RM1 C;  2HFE C;  1ORQ C;  2IW5 A;  2XAH A;  1VQK V;  2ZDI A;  5IYB O;  5LHG A;  3I55 V;  1H2G A;  4QIW F;  4PA3 A;  3CCE V;  1BHB A;  2NLJ C;  2EZP A;  4GT1 A;  5KUM A;  2DYS B;  4CBC A;  4PA7 A;  1GM8 A;  5L3E A;  2Q69 A;  1F4M A;  4XBF A;  5DM6 V;  4MT8 A;  2Z3Y A;  1R6N A;  1PL0 A;  1WLE A;  3BY6 A;  3ZCC A;  4WCE V;  2X6C A;  3W7X A;  1AI7 A;  3ETD A;  3DTU B;  5CBG A;  1K4D C;  4PDR A;  1BL8 A;  2DYR B;  4FJC C;  5GW7 A;  4MW8 A;  1Q81 W;  3CPW U;  3R65 A;  3DGE A;  4ZKI A;  1VQ7 V;  3SPJ A;  3OUS A;  2EIJ C;  5IYD O;  2QM7 A;  3E83 A;  4G28 B;  5IYC O;  5KUK A;  3LDE A;  3OMI B;  3ABL B;  3ABM C;  2HG5 C;  5CBF A;  2JDI G;  1W0J G;  4PDM A;  3BEH A;  2XND G;  3I56 V;  1NVP B;  3CD6 V;  4WFG A;  1YHQ V;  2JK5 C;  1K33 A;  4ZBM A;  1L1F A;  4EKW A;  1VQN V;  4MVU A;  1W2B U;  4UUJ C;  4KP4 A;  4QE7 A;  1H8E G;  2GSM B;  1OCR C;  3B8M A;  5EC2 C;  2JJ1 G;  2OTJ V;  1VQO V;  1TUE B;  3CCV V;  1NR1 A;  1OCO B;  4JTD B;  3SYP A;  3RVY A;  4JYC A;  2W6I G;  4FMT A;  4JPR A;  5B1N A;  1ZWI C;  3CCQ V;  3OFN G;  2Y48 A;  3GB7 C;  4UXN A;  1AI4 A;  3X2Q C;  2EIM C;  1QLE C;  2IH1 C;  3D3I A;  2HLD G;  2P90 A;  1M56 C;  2JEX A;  3QO8 A;  4ASU G;  1PNL A;  2C2A A;  3AG2 C;  2V1D A;  5EBM C;  2ZD9 A;  3OUF A;  5IY5 C;  3OW2 U;  1ROP A;  4LBE C;  1F51 A;  4OXS A;  1MG1 A;  2F43 G;  1NH2 D;  1BMF G;  1F4N A;  4JGS A;  3ZIA G;  1OCC C;  5H6Q A;  5IY5 B;  3TK1 A;  3IC7 A;  4FIP C;  1GKF A;  4MVQ A;  1S72 V;  1P4R A;  2Q6A A;  2EIL C;  1N8R W;  2XAJ A;  4HAM A;  1PKX A;  5E1A C;  1VQ9 V;  3STZ C;  2WLL A;  1SES A;  1AJQ A;  1OCZ B;  3PJS K;  2NNU A;  1GMG A;  1KC8 W;  4TWK A;  1DLB A;  2EIN B;  3RVZ A;  2JJ2 G;  3JD0 A;  3K08 A;  1FXV A;  2V7Q G;  1CP9 A;  2WLL B;  4Q20 A;  3LDC A;  1K92 A;  4PA6 A;  3AG1 C;  5B1A B;  4QPJ A;  4X8A A;  3E2E A;  5L3F A;  2P67 A;  2WLM A;  3OR6 C;  2OTL V;  4MVZ A;  4F4L A;  3D36 A;  3EFF K;  3ZRW A;  4WFA V;  3STL C;  1SER A;  3AG1 B;  2WSS G;  3NXS A;  4H37 A;  2FTK A;  3SYQ A;  3SPI A;  2CK3 G;  5CA3 A;  5LGN A;  1AJN A;  3B77 A;  3ASO B;  1V54 B;  3ZRW B;  1JOY A;  2W0F C;  3ZRS A;  4E2L A;  3OEH G;  4MTX A;  2M7W A;  4RUE A;  3LNM B;  4UV9 A;  2JIZ G;  2IH3 C;  4MTG A;  3RBZ A;  3UKM A;  1R3I C;  2MK3 A;  5LHI A;  3FYI B;  2WLH A;  3HPL C;  2ATK C;  4L87 A;  2WLN A;  4MS2 A;  4MVS A;  5L3G A;  1FXK A;  4U7O A;  1SRY A;  2EBO A;  1FXK C;  4RQE A;  1J95 A;  3K04 A;  4RQF A;  1M57 C;  4GX1 A;  1RM1 B;  2D3O W;  1YIT V;  1QR9 A;  3G6E V;  3OAA G;  1FFT B;  1Y66 A;  4MVR A;  4JAS A;  1E79 G;  1KKD A;  2HVJ C;  3QNE A;  4WFH A;  3ABK C;  4MSW C;  5EC1 C;  4UVB A;  2AHY A;  3AG4 C;  5KA6 A;  4MTF A;  3LDD A;  4GX0 A;  5DN6 G;  1EFR G;  1DF5 A;  3LSQ A;  3VBB A;  3T4Z A;  4TSF G;  5B1B C;  3AG4 B;  1E1Q G;  2XAQ A;  2OCC C;  2BOB C;  1R73 A;  5B1B B;  4J9Y B;  1BHA A;  1QR8 A;  2WWW A;  3WFV A;  1AI6 A;  5CN0 A;  2DQ0 A;  3E35 A;  3E86 A;  1SET A;  3GWO A;  3G71 V;  1JJ2 U;  4J9Z B;  2EIJ B;  2IJH A;  2P6J A;  3A0R A;  4DO2 A;  2ZR2 A;  4BW5 A;  3CP1 A;  2Q68 A;  1MSW D;  3VOU A;  1OZ0 A;  3ABU A;  4YXW G;  2QKS A;  3ABM B;  3OE7 G;  4LC1 A;  1I5Y A;  1FS0 G;  4GX2 A;  1PNM A;  5C93 A;  1GK9 A;  1M9N A;  4R7C A;  3JYC A;  3ETG A;  3CCJ V;  5CMU A;  4MVM A;  1COW G;  1JX9 A;  4CZZ A;  3SJQ C;  2QEX V;  1OCR B;  2YEV A;  3OM3 B;  4BIZ A;  4Z1M G;  3FKS G;  3CCM V;  2PI4 A;  3T2M A;  3UM7 A;  1XL4 A;  5CBH A;  3ZN0 A;  3G4S V;  3EHB B;  4P30 A;  3OMA B;  2ZR3 A;  4WFE A;  4I5S A;  1CPY A;  3JCZ A;  4XDJ A;  4P9O A;  1K5S A;  2EIM B;  3MD0 A;  1QLE B;  4PDL A;  3X2Q B;  1RPR A;  2XAG A;  2HJF C;  1M56 B;  5H9C A;  2KB1 A;  4JF3 A;  4QPK A;  3HB3 B;  3ASN C;  1KP2 A;  2P7T C;  3AG2 B;  1MAB G;  5B3S C;  1H38 A;  2LFS A;  1VQM V;  2WLI A;  1R3J C;  4PA9 A;  1KD1 W;  1VQL V;  3SYO A;  3FB8 C;  2ZQM A;  3ABT A;  2QA4 V;  4GX5 A;  3T1C A;  1OCC B;  2X7R B;  4HYO A;  2IU3 A;  2ZXW C;  5L3C A;  1P7B A;  2WLI B;  4X89 A;  2EIL B;  2OT5 A;  3JD3 A;  2WLJ A;  4JAV A;  2X6B A;  1YI2 V;  1DF4 A;  4FK5 C;  3SYA A;  4FPP A;  4BAY A;  3FYE B;  1V55 C;  1R6K A;  3IFX A;  2Y69 C;  2B1G A;  1R3L C;  3CC4 V;  4KFM A;  3OR7 C;  4QNH B;  3WG7 C;  2LFR A;  1YJN V;  2HR3 A;  3W7S A;  1K8A W;  5L3B A;  1YTF D;  2R9I A;  3ZJZ A;  3K9A A;  1NKD A;  4RAI A;  5L3D A;  1QLN A;  2YSU B;  4QJF B;  2LP7 A;  3TET A;  1KQS U;  1IXM A;  1I5X A;  1VQ5 V;  4XDL A;  1W0K G;  5EBL C;  2EIK C;  3K03 A;  1UJW B;  1QCE A;  2R9R B;  1Q7Y W;  2HKO A;  4UVC A;  1K7D A;  2IU0 A;  1VQ8 V;  3AG3 C;  5J9P C;  1G4Y B;  5B1O A;  1K73 W;  2WLK A;  1AJP A;  3IGA C;  5IDJ A;  1EBO A;  4TT3 G;  1NJI W;  2QE7 G;  3F7V C;  2UXX A;  2IJK A;  2PI5 A;  3AG3 B;  1GO3 F;  3ZMS A;  1OHH G;  1AI5 A;  4R50 A;  3MHS C;  4MTO A;  5LGU A;  2EJR A;  1FXK B;  4QE9 A;  2ITD C;  3K3W A;  1M57 B;  3E8G A;  3ZRV A;  3OMN B;  4P9P A;  3K06 A;  3ABK B;  1KEC A;  2DYS C;  2DWE C;  2QM8 A;  3QO5 A;  1B6Q A;  1MOF A;  1S76 D;  2ITC C;  3ZMU A;  3OEE G;  4U7N A;  2ZDI C;  3RW0 A;  1NVP D;  2K1E A;  1R3K C;  3ZMT A;  2DYR C;  3FB5 C;  1E1R G;  5KA5 A;  1GM9 A;  2OCC B;  4UVA A;  3SPH A;  2WPD G;  3OGC C;  4UV8 A;  1Y4M A;  1VQP V;  1GM7 A;  1S3J A;  4P2Z A;  3CC2 V;  3E8B A;  2UXN A;  4MVO A;  1YSC A;  1JQ0 A;  3ABL C;  4PEL A;  1DTO A;  2JEU A;  2H8P C;  1FXH A;  2Z5U A;  1KP3 A;  4LCU C;  4H33 A;  1CEZ A;  3E8F A;  4JYB A;  2AHZ A;  1NBM G;  1S77 D;  1SZT A;  5HFM A;  3F7Y C;  1ENV A;  2X6A A;  2DQ3 A;  3CMA V;  1XL6 A;  2IJJ A;  1H8H G;  1THZ A;  1YJ9 V;  3K79 A;  2A0L A;  4BIU A;  3F5W C;  1HWY A;  1OCO C;  1K3E A;  2YEV B;  1K97 A;  3JD1 A;  1Q86 W;  2W6J G;  3K0D A;  3TCU A;  1EZJ A;  2B1I A;  4G2K A;  4WF9 V;  3CCS V;  1M1K W;  3T4D A;  1VQ4 V;  2DWD C;  3E8H A;  4KUM A;  3W7U A;  4G27 B;  2Q67 A;  3ZN1 A;  3ASN B;  5EBW C;  2XAF A;  1S0V A;  4RUF A;  5B3S B;  1RPO A;  3QO7 A;  4PDV A;  4PA4 A;  4I9W A;  4XDK A;  1JCH A;  5EK0 A;  1PNK A;  1JVM A;  1QBZ A;  2ZXW B;  2X0L A;  4R6Z A;  4X88 A;  4GCZ A;  5LBQ A;  2H94 A;  3W7T A;  1YIJ V;  2XOK G;  4WFB V;  3P30 A;  2DW4 A;  2EZO A;  4N21 A;  5BZB A;  3AEI A;  1OCZ C;  3CXC U;  2WAM A;  4RO2 A;  1G8M A;  4WFF A;  1K34 A;  1S5H C;  1PD3 A;  1JPX A;  1AR1 B;  1V55 B;  2A9H A;  2IJI A;  1NH2 B;  2EIN C;  1QVF U;  4MW3 A;  5HFL A;  3B8N A;  3P32 A;  2Y69 B;  5FL7 G;  3CCL V;  2B5U A;  1F23 A;  1Q82 W;  3SPG A;  1WPX A;  4LP8 A;  3WG7 B;  1K4C C;  5B1A C;  2QTO A;  3CME V;  1YJW V;  1K5Q A;  3FB6 C;  3CYO A;  3E89 A;  3KG2 A;  4DXW A;  3LSS A;  1NR7 A;  3CCR V;  5H6R A;  5LGT A;  2HVK C;  4R8C A;  3W7W A;  3K0G A;  3ETE A;  1VQ6 V;  3ASO C;  3H01 A;  3M99 B;  2EIK B;  3ML0 A;  1V54 C;  4N23 A;  1M90 W;  3CCU V;  1NQT A;  4JAU A;  3SYC A;  4JTA B;  4JTC B;  3ZMV A;  1K9M W;  1ARO P;  3MHH C;  3SPC A;  3ZRX A;  2GHY A;  4HZ3 A;  2A79 B;  5LHH A;  3CC7 V;  3FB7 C;  3ZMZ A;  1GTO A;  3JD2 A;  2BOC C;  2XAS A;  3JD4 A;  1YTF B;  1QVG U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...