1VQMV

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqmV00
3I56V 1R73A 1K8AW 1JJ2U 1VQ5V 1KD1W 1YHQV 1YIJV 4WF9V 3CC4V 1VQ9V 3CC2V 3CCVV 3OW2U 1VQLV 1VQOV 1M1KW 5DM6V 1KC8W 3CCEV 2OTLV 1K73W 1QVFU 3CCLV 1YJ9V 3CC7V 3CCUV 3CXCU 1Q86W 3CPWU 1Q7YW 3CCMV 3CMAV 4WFAV 1VQ7V 2D3OW 1N8RW 1VQ6V 3CMEV 1W2BU 1VQNV 2OTJV 1VQMV 1Q82W 3CCQV 1Q81W 3CCSV 4WCEV 1YJNV 1VQ4V 1VQ8V 1YITV 3G4SV 3I55V 3CD6V 1M90W 1YI2V 2QA4V 1VQKV 2QEXV 1NJIW 1YJWV 3G6EV 3CCRV 1S72V 3CCJV 1VQPV 4WFBV 1QVGU 3G71V 1KQSU 1K9MW
chains in the Genus database with same CATH superfamily
1GM7A 1AI5A 4DR3O 2IBZH 2RQ6A 4JI3B 4PHZA 2UUAB 4X9QA 2OCHA 4DW0A 2LGWA 2HVKC 1FJGO 2QM4A 1IBMO 5L3BA 4YXWG 4QE9A 2WLNA 2CUGA 4CS2A 1OCZB 2FB5A 2IJJA 1M93A 4I9QA 4JI5B 4G28B 5JJNB 2F23A 1ZLZA 1HNZB 4CC5A 4UCSA 1NS1A 5EIBC 1Q3EA 4DV1B 1YF2A 5IY5C 4DV5B 2RCVA 2RNBA 5GW7A 4LWSB 4QPJA 4J9YB 4DV0O 5JJJB 3H1IH 3L70H 5KUKA 1THZA 5F2VO 1UFIA 2IH1C 2JS5A 1URFA 3OW2U 4JASA 4KXRA 1ZX3A 1D5AA 2ODMA 3K03A 2EX3A 3SDLA 2GTSA 3UQ8A 4J11A 3N2KA 3CYOA 4NXMO 4TT3G 5EC1C 2WLIB 3K5LA 3I56V 2VWJA 5HFLA 2YSUB 3ETGA 4X1KA 4D7TA 4JI5O 3D36C 5IYCO 2VWKA 3ML0A 5B3SB 4JI4O 4JAAA 3B4SA 3FB6C 1OCRC 4P9PA 1G6UA 2YI8A 2XOKG 4HZ3A 2QGNA 1H2GA 4JPRA 3SJAC 1V55C 1JMKC 3OR6C 3VBBA 5IJ0B 2GBOA 2XT9A 1Q6UA 3E86A 4LF8B 2ADPA 3OEHG 4UCVA 3LDDA 4L8JA 4DR3B 4O4IB 3ZHUA 1HW7A 3A0RA 2PI4A 4MW8A 1NTZH 3CCUV 1NBMG 4TV8A 4BW9A 2P6JA 3EVKA 4FLXA 2LGQA 2HEPA 4I5SA 3AG4C 3WU2Z 5KA5A 4AHCA 4TV8B 1AR4A 3OEEG 4JI1B 1AVMA 5AG2A 3N27A 4NB5A 2P90A 4WFFA 2Q9LA 3SJBC 4JI0B 3G6EV 4JGSA 2VQFO 4DV1O 1R73A 1FS0G 4DR5O 1PM9A 5LMUB 2YI9A 1ZTEA 1XILA 4GT1A 2PYLA 4DV7O 3IFXA 4KL1A 2QJ1A 3ETDA 4P30A 2HP8A 1SRYA 1Q5OA 5GTIZ 3MD0A 3CJHA 1GN6A 1VF6C 3T1HB 4JI3O 1FAFA 3CRRA 4RWUA 1YJ9V 2CH7B 1NR1A 3RN4A 4WFAV 2ZE6A 1EBOA 1F4MA 2AGAA 5KHJA 4JYYA 5FNVB 1KP2A 2QSAA 1PKXA 1M9NA 3JD0A 1COWG 4RAIA 1NZ6A 5B66Z 1BHBA 5LMUO 1D5NA 4N21A 2F66C 4JI2O 4JF3A 1P7BA 1SQPH 2R70A 1NR7A 3OMIB 3E83A 3TETA 3CXCU 2W6JG 2XAFA 4QPKA 4LCUC 2JK5C 5B3SC 4BIOA 2HR3A 1Q43A 4J41A 1NH2B 1QLEC 1P7GA 4BIUA 4WBNA 3ABKC 5IJ9B 1SKVA 1Y6XA 1I08A 3RYFA 4MT8A 2EZPA 2Q0AA 2X0LA 2W0FC 4O4HB 4FFKA 3SPGA 5KX5A 4LF6B 1ZAUA 2F4VO 3QF7A 2RMKB 4CH6A 4TWKA 3BPZA 3LSQA 2CTWA 5BZBA 2CTRA 5LYJB 1EN4A 5LMNO 1EN5A 3Q4HA 2WLJA 1HDJA 4LC1A 1XREA 4O4HA 4MVOA 3T1HO 3CCVV 1VF6A 3VQYA 2GV9A 1K73W 3CCLV 2E74B 1SA0A 4DR4B 1K97A 4OPHA 1AILA 1KYOF 1R6NA 4X8AA 4P9OA 5IJ9A 3JATB 3M99B 5FL7G 3SJQC 1K92A 4G27B 1K9MW 4WF9V 4UCUA 4DK0A 1CEZA 1PL4A 2Y4TA 1GK9A 1EN6A 1R1BA 2JGUA 2VQFB 4GX5A 5B5EZ 3WG7C 3AK2A 2BSKA 3OE7G 4YJ3A 4QJFB 5JCOC 3SYPA 3UO2A 5LP6A 3ZHTA 1K34A 1N4CA 3APOA 1PP9H 1OCZC 3J80N 4DV6B 4GLXA 2QE7G 2QEXV 3W7TA 1JFFB 3ZMVA 5LGTA 1WLEA 3RBZA 3N2GA 3M8AA 4K3AA 5IY5B 1EFRG 5BMVB 2MK3A 2JVDA 3CX5F 3ABMC 3X2QC 3SR2C 2JS3A 3IJ4A 3CRCA 4NTWA 1NH2D 2LO1A 5B1BB 1IURA 1XMOB 4DR1B 4QNHB 1JX9A 2Y69B 1KMIZ 3C3TA 3BCCH 4UB8Z 5A2QN 1I5XA 3LNNA 1M57B 2YEVA 2CGOA 4J7KA 3GWKC 5KHKA 1H8EG 1NI8A 4LNUB 3AK1A 2EULA 3SPIA 2HLDG 2CDYA 2RJZA 2UUAO 1XNQB 5IYBO 5L3GA 1HNWB 2EIMB 4IHJA 4B3SO 1K8AW 3D8CA 4MW3A 1YHQV 3CC4V 5KHIA 2FL4A 2XASA 1H2MA 1VQ7V 4OGQB 4X20A 4DR7B 3QTCA 3IGAC 2E3CA 2Z3YA 2GSMB 2ZNIA 3RGBA 2YS8A 2HG5C 3ZMTA 2Q67A 4X62O 3G71V 2DYRB 3AG2C 2Q69A 4ZOLA 1IBKO 1HR0B 5CA1B 2F1MA 3MHHC 1N32O 3BEHA 3S3WA 1NVPD 2WLLB 4NTXA 4Q6GA 5TISZ 4D6TH 4YIPA 4DUZO 1NU1H 4TOIA 4O4JB 5DN6G 1E1QG 1EZVH 4DV5O 3A0HZ 1IDSA 4GKJB 3ASNC 4YHHO 4JI7B 3U10A 1LR1A 1PNMA 3E2EA 1KD1W 2UU9B 3HKBA 3JALA 3F7VC 4MTXA 4CBCA 3AG7A 4MVSA 1Q7YW 3D3IA 1N8RW 3O9OA 3W7SA 3KZIZ 1VQ8V 4BW5A 3K58A 2H94A 1W0JG 3ABUA 1BSMA 2P4KA 1FYJA 2OCCB 1ZL8B 5CB4A 2ZIMA 3LDCA 2ZIOA 3K9AA 3CCSV 4WCEV 3TXQA 2CAZC 1H2NA 4GKKO 2P67A 2HJDA 2IM9A 3STZC 4E4EA 3EHBB 2IU3A 3GB7C 3L74H 4R7CA 2UXNA 4JTCB 4GYCB 2QDOA 3S3XA 2Y69C 5KMGA 1VQ9V 4I4TB 4GX0A 2KSDA 5J2TB 2QKSA 1BE3H 3FB7C 2RN9A 2JEUA 4DR1O 2P4VA 1RM1C 2ZNJA 1FFXA 3E22B 4I4TA 1P84F 3T4ZA 3UT5A 1QLNA 2K1EA 4FM2A 4MTFA 1XI1A 2UXCB 3SPCA 1WP7A 2K9PA 4UVCA 4ZI7B 3CPWU 3D36A 2Q73A 4O2BA 3CHXA 2UXDB 1Y4MA 3OR7C 4J7ZA 4DXWA 1DF5A 3ZHQA 1SZXA 3APQA 4UCOA 3P3PA 1G1XB 2UXBB 4JV5O 1T5EA 4NR1A 3JSNA 2FMLA 4MSWC 4K8XA 4FM0A 3OD4A 1ZUQA 3KG2A 4I0XA 1B6QA 3JD2A 4K35A 4PA7A 1SQVH 4RUFA 1JFFA 3L71H 3CCJV 1TVKB 1WJZA 4Z2WA 1KQSU 4DR4O 1ZWIC 2A79B 4RQEA 4R8CA 4MTOA 3TXSA 2JRIA 1GH6A 1RPRA 3HPLC 4JI6B 1TUBA 1E79G 5LMNB 4LF9B 5BR8B 2EIMC 2ITCC 1FXKB 2UXDO 4YIOA 4JAUA 2EIKB 1WB8A 3ZRSA 1GM9A 1YI2V 4DRXA 1IZ3A 4JI8O 2ARHA 4J10A 3H1KH 4YJ2A 5B1OA 4OX9B 1MABG 5B1AB 3B2EE 3W7XA 1AI4A 4DR2O 4GUNA 1S5HC 2XNDG 4HAMA 2V1DA 5EYPB 4RQFA 2QWPB 4JYCA 5LHGA 4B08A 2F93B 3M7MX 4OXSA 2ADQB 1M90W 1GN2A 1DK1A 4TV9B 3SJCC 2AHZA 2QWOB 1WA8A 2BTQB 3JAWA 2Q4PA 3HKCA 2OWOA 1NTMH 3H9VA 3JARA 1XOUA 4ZHQA 3OGCC 4JI2B 3JD3A 1VP7A 1DLBA 2B1GA 3X2QB 4CC6A 3RYCA 3CMEV 2JJ1G 1NVPB 3EXAA 5B1BC 1YZBA 1DTOA 2L6LA 1FPOA 2WLIA 3RYHB 4EKWA 1ROPA 3VQVA 1O9GA 2ZM6B 4LR3A 4JZ2A 3T1YB 4QGPA 1GKFA 1AP5A 4PI2A 5C8YA 1YITV 2HHHO 1GTOA 2PZSA 1ENVA 4PDLA 4X1YB 5KHGA 2NNUA 1NJIW 1L8DA 3RVZA 4X88A 4B3TB 4JTAB 4FLUA 4W4KA 3N2KB 3TK1A 2BOBC 1S5JA 1JJ2U 4LF4O 4H0LB 2AZ2A 3BA8A 1IXMA 4LF7B 1XNRB 3E8GA 1VARA 4TSFG 4FFBA 2CH7A 5CA0B 1ZSPA 4XDJA 1TVKA 2WLMA 4QIWF 1F23A 3K5OA 2JGDA 2OIEA 1R3KC 1OHHG 3H1LH 5KA6A 3VQWA 3A0BZ 3OT7A 4I0XB 1R3IC 5CN0A 4I55A 4GX2A 2IU0A 5L3EA 4O4IA 1Y67A 3OFNG 2EZOA 1I94B 4ZKIA 2B1IA 2XAHA 5BXZA 2QWQB 3H1HH 4UV8A 3HKEB 3BAAA 2L35A 1YDXA 3BA9A 4B3SB 1JQ0A 4NXNO 4FLTA 1MOFA 3IAYA 3ZRVA 4X1KB 2D2CB 3DXRA 2DW4A 2YIBA 5EIBD 4BWAA 4DUYO 4FLZA 4WFGA 1Q90D 4PI0A 2YXHA 4MVZA 4UVBA 3DC6A 5GONB 2P7TC 1EM1A 1PNKA 4FVMA 1I5YA 1N36B 5EK0A 2C2AA 4F6EA 2YDEA 2ATKC 1XMOO 1R6KA 4KUMA 3QO7A 2M7WA 5JH7B 1XNRO 1H2KA 4Q20A 2GTAA 3NXSA 4DW1A 3JAKB 2BE3A 2ZCEA 3K59A 3ZRWB 2M6YA 3MHSC 2DWDC 5L3DA 4ASUG 4PJ0Z 2A06H 2N04A 1SZTA 4L87A 2B9ZA 2QM8A 4LH6A 1JJOA 3G6BA 4YY3O 3CRQA 1VQKV 2BTOA 1DF4A 1J5EO 1RSOA 1SQBH 3WB1A 2ZM6O 2OYQA 1MZEA 1HNZO 2PI5A 2KG7B 4DV2B 1QR9A 1B04A 4U3JA 2A7WA 3ABLB 1S3JA 4QE7A 2Z5UA 1SQGA 2HFEC 1WN7A 2Q7GA 1IBMB 1NT2B 4MVQA 1CP9A 3DGEA 3K04A 5HFMA 3ABKB 3H1JH 1AR1B 3K79A 2DN9A 3JAKA 1YSCA 1M1KW 3C90A 3T2MA 1Q86W 4LFCO 5LA6B 1Q81W 4DR6O 3BRCA 1N0NA 3BABA 2KQXA 1TA8A 3HKEA 3B40A 1MG1A 4O4LA 1OZ0A 2CK3G 2R9IA 5KUMA 1D2DA 1U97A 3K0DA 5LBQA 4ZIBA 3JD4A 1VQMV 2NR5A 4JYAO 2Q7EA 1Y76B 3QVNA 2R9RB 5JQGB 4JI6O 1GRJA 2BOCC 5LYJA 5D5QA 1KU9A 3ZMZA 4PD4F 4XDLA 3U0ZA 2PUSA 3JD1A 4H44B 1JR9A 1VEWA 1OV9A 1BCCH 1R3LC 3GWOA 4DYLA 2WLLA 1QBZA 4FLWA 1RSOB 4B7EA 4N23A 2WA3A 3CEIA 4H33A 4UCRA 4O2AA 4FZ1A 1H2LA 3ZN1A 3R66A 4JV5B 1A32A 2ZT9B 3B77A 1W59A 1VQLV 5KHHA 1IBLO 3WFVA 3ABMB 2KG7A 3FYIB 4IL6Z 3JAWB 1K3EA 3T4DA 2F4VB 5E79Z 2XUMA 3ZIAG 2VQEO 4LFBO 1M56C 1H38A 4WFBV 4DR5B 4UB6Z 2E5LO 1YTFD 1RPOA 2YICA 5DECA 1GMGA 2GDSA 5C8YB 2YEVB 1QNMA 2P06A 1KP3A 4X66O 5LXTB 4KFMA 3JSLA 1BQZA 4JI1O 4RO2A 4TV9A 3CRAA 3AG1C 2ZXWC 4X64B 2X6BA 2AXTZ 2OTLV 5EYPA 5H2FZ 4EFBA 2VQEB 3K57A 1AB3A 2XAGA 1BQ0A 5GONA 1HWYA 2OCCC 2ETNA 5H6QA 1SQQH 3K3WA 4LBEC 2G38A 1SQXH 4PDVA 2DJVA 2YUAA 3AK3A 3JCZA 5CBGA 3K9SA 3DXRB 2A0LA 5H9CA 2UUCO 2LFRA 5CBFA 2CGNA 3HKDA 1FD9A 4UUJC 4IYIA 1FXHA 2EILC 1IX9A 4J9ZB 3ABLC 3ASNB 3FD9A 4UXNA 1IXBA 4I50A 5IT9N 1PD3A 4RUEA 5B1NA 4JI7O 3P32A 4YHHB 5EBMC 1JOYA 3HKDB 4NXMB 4B7KA 1E1RG 1MSWD 4UCTA 4JI0O 3MAQA 5KAFZ 2YIDA 5KLVH 3F5WC 1KBHA 2B5UA 1Z2GA 1N32B 1LUVA 3ABTA 1AI6A 1BMFG 3JASA 2UUBO 3MDSA 1OCOB 1US6A 5ITZA 2Q6AA 1RP3B 3JCUZ 1VMGA 2OT5A 2R72A 4CZZA 5H5NA 3ICXA 2O57A 4PA4A 1GO3F 2AW9A 3AG3B 3B8MA 3J7AU 4O2AB 2DYSB 5LOVA 4LFAO 2Q7HA 1ORQC 1B06A 4DV4O 3RW0A 4WBNB 3OGIB 5GTHZ 1GN4A 2YIBD 2NLJC 2HKOA 3AEIA 2ZKOA 5CB4B 3W7UA 1FJGB 4OPAA 5JJEB 3RYIA 2DWEC 1YVWA 3CSXA 4MVRA 4JI4B 2EIJB 5LP6C 4IIJA 2H3OA 2DYRC 3AG2B 1TAEA 4NXNB 3TGUH 2W6IG 1FXKC 4IIJB 2ZXWB 5H6RA 3K5NA 1KKDA 5K1XA 2P5OA 2H8PC 4NKGB 3ZX6A 5J2UB 2DMXA 1WPXA 3RYIB 2VRZA 1I0HA 2ZQMA 5EBLC 3JALB 4K0KB 4ZHQB 4HNAA 3T1CA 1SF9A 4GX1A 4UFZA 3OMNB 3VQXA 1Q6HA 2WA4A 1GN3A 4F6RA 2DQ3A 3JATA 5LGNA 1VQ5V 4TQDA 2UUBB 3JYCA 1I7FA 5LA6A 4DV6O 2CE4A 1MNGA 1KUQA 1SC5B 2FTKA 2JEXA 4FK5C 1NQTA 3RYCB 3Q4HB 3RWRD 1L0LH 1K5SA 1G4YB 3SGIA 4DRXB 1Q6IA 2EINB 4P2ZA 3WB0A 1X59A 1K4CC 5IWAB 3UO3A 2XAJA 3B09A 3AG1B 1AP6A 4FLYA 3BY6A 1QU7A 4IGGA 4BIZA 2QKAA 1IBLB 3R65A 3LNMB 4AI8A 4I50B 3F7YC 3OUSA 1AJPA 1K33A 5CMUA 4GZRB 4O4LB 1FXVA 5DM6V 2YXYA 1XDCA 1VF5B 1N34B 2X6CA 1RM1B 3BHPA 1Z5WA 3ZMUA 3F5TA 1BZKA 1KECA 2LW1A 2X7RB 5KAIZ 2ZDIA 4LF5B 4WFHA 5JCOA 4EEQA 3ZEDA 1QVGU 1RFYA 4H13B 5JVDA 2IJHA 1YEWA 3U11A 3ZBHA 1Y66A 4G2KA 2EILB 3WB2A 2LJ2A 4PA9A 2D3OW 2ZR2A 4CH4A 1VQ6V 4F4LA 4DV3O 2ZE8A 4ZI7A 4HBNA 1N33O 5KMGB 3FKSG 4E2LA 3RVYA 4DO2A 3UKMA 1R6TA 5EZYB 2Y0PA 3JASB 1M56B 1FXKA 4PA6A 1Q8IA 2BCCH 4U7NA 2E5LB 3SYCA 1IVSA 4EFEA 4IYHA 2A9HA 3E22A 3PN1A 1Y74B 3CC7V 4LFBB 1GAXA 2LFSA 3N2GB 4DR6B 2EINC 2HJFC 3LUTB 1PL0A 3L73H 2Q0OC 1PPJH 2ZR3A 1QLEB 3FX7A 4LFCB 5BR8O 5JVDB 4KHPO 3D3QA 4X89A 1S72V 1KKCA 5JQGA 2Y0IA 3T1YO 3AG3C 2DE0X 4J42A 3ZRXA 2ZD9A 2GHYA 1XUQA 1U96A 3HKBB 1WAZA 1X4TA 2V4DA 2Q68A 4ICGA 1B3QA 2QR4A 3O65A 5IYZB 4MVUA 3TCUA 2QKCA 1KB9F 2ITDC 3ZJZA 1CXZB 3A2FA 2HVJC 2F43G 4AQYO 3ZHSA 3SYAA 5J2UA 1J5EB 3CC2V 1KC8W 4X1IA 1V55B 3KCXA 2EIJC 5LP6B 1DGSA 3ZHVA 3E8FA 1G8MA 2ZDIC 5JWPA 2PTMA 1GM8A 3CE2A 1FKAO 3I55V 3RYFB 1WPBA 5IJ0A 3TJTA 2EJ7A 1YJWV 1M5IA 2WLKA 2XTAA 3QNEA 1VQPV 1LNQA 1P49A 1XHXA 1H8HG 2AHYA 3B8NA 1QVFU 2IH3C 1Y76A 2PF4E 3CWBH 2KB1A 3SPJA 4B3MO 1JA8A 2IJIA 1K5QA 2RDCA 1OCCB 1SA0B 2ZE7A 4EB6A 1XL6A 4MTGA 3P30A 4FMTA 4LF8O 3DC5A 2JGDB 4LNUA 4X20B 1XBLA 2XAQA 4FFBB 5CA0A 1SQFA 3LSUA 3CP1A 4R50A 1S77D 1NTKH 1VQ4V 1HNXB 2WSSG 5IDJA 2ZE5A 2BTQA 2QA4V 5CA1A 3UM7A 3BFRA 3C3SA 4DV2O 1YCIA 2F95B 5LOVB 1N34O 5LHHA 1BHAA 3OM3B 5BMVA 4KP4A 2DQ0A 4A5UB 2Q8VA 4FZ0A 1N0JA 3QO5A 1I94O 3OTOO 4YY3B 4U3JB 3CD6V 5EBWC 3CJHB 4U3FH 2X6AA 3WG7B 1XMQO 1MZFA 2W0XA 1SETA 4PV1B 4FIPC 3H01A 3GVMA 1K7DA 2E75B 4Z1VA 4DV0B 2E76B 1W2BU 4JZGA 2IJKA 2LW7A 5K1PA 1FFTB 1BGYH 4ZBMA 1PV0A 4X65O 4DUZB 2JDIG 2ZINA 4XBFA 4CS4A 3J81N 3DTUB 1SERA 3ASOB 4LF4B 4FM1A 1N36O 4R6ZA 1S76D 4TUYB 3NR7A 3STLC 4DK1A 4LWSA 1AJNA 1QQCA 4B3RB 4X62B 4ABMA 4DUYB 1F7YA 3FAVB 4TUYA 1BT8A 3G4SV 1M57C 1V9PA 1F51A 1AROP 3FB8C 1BL8A 3K0GA 5FLXN 1MA1A 4K0KO 1SS3A 5CBHA 5IYDO 4JYBA 1Z5VA 1UPGA 1M4UA 4J80A 2QM7A 1HNWO 3OUFA 4YJ3B 4W4LA 1V54C 2GUZA 1XNQO 2OTJV 1Q82W 3ETEA 5C93A 5J9PC 1XQ8A 5CA3A 1HNXO 1TUEB 1AI7A 4ZOLB 2WWWA 3A8TA 2JJ2G 3HR0A 1S0VA 4X1YA 1CPYA 4B3RO 1XEQA 1SESA 1WB7A 4MVMA 2UU9O 3RFRA 3OTFA 3ZN0A 4DV4B 4JAVA 4HNAB 2EJRA 4LFAB 4GKJO 4X65B 1R3JC 4HYOA 3JAMN 3L9DA 5FPRA 4IHJB 4LF7O 2LP7A 2CTQA 3P3NA 1YTFB 4PDRA 1XL4A 1K4DC 3CS5A 4OX9O 3E8BA 2Z0AA 2BSKB 1QCEA 4CS3A 3CCEV 3OAAG 2PYJA 1IBKB 1HR0O 4AILC 4B3TO 5L3FA 3JARB 1XMQB 2JIZG 2HHHB 1YJNV 3EFFK 3K5MA 1WA8B 2NN4A 3OTOB 1F4NA 2LQTA 3SPHA 1S5LZ 1XHZA 3CRMA 3I5DA 1AR5A 2A3QA 4EB6B 2PGGA 5LHIA 4AQYB 4I55B 1OCCC 4UV9A 1VQOV 1L1FA 5JH7A 2FKXA 4JTDB 1FFXB 3KCYA 4CH5A 3CCQV 5LL6Y 2XHBA 3DSQA 3ZMSA 4PELA 2P22C 2YIAA 3KKYA 1J95A 5E1AC 3AG4B 4PDMA 2UUCB 5KX5B 3CB2A 1PNLA 1H2SB 3CXHF 3SYQA 5FNVA 4I7ZB 4NVPA 4KHPB 3K06A 1VQNV 1WNSA 4X1IB 4Z1MG 1WP8A 1JVMA 3IC7A 4BR6A 4H37A 1OCOC 2Y48A 5A9GA 1HP8A 1UJWB 4B3MB 1OJHA 2EBOA 5IYZA 5LXTA 4DR2B 3QG5A 1P4RA 1JCHA 2IW5A 2YXLA 4X64O 4JI8B 2WLHA 3QO8A 2DYSC 3FAVA 4LH7A 5DEDA 2AZ0A 3L72H 1V54B 1LUWA 3E89A 1JPXA 3RYHA 1L0NH 3HB3B 4LF9O 4FLVA 4X66B 3PJSK 4FPPA 5EC2C 1VIBA 2WAMA 5LGUA 2V7QG 2N05A 3FFQA 4CH3A 4NTYA 4O2BB 1YIJV 5B1AC 3E8HA 1YXBA 4XDKA 1EZJA 5IE9A 4O4JA 3ZRWA 3K08A 1Y74A 2DOSA 4LF5O 2MW2B 4WFEA 4J7JA 2YC0A 2KKWA 4TQFA 3ZCCA 5BY1A 4IT5A 3UT5B 5EZYA 4C7UA 4F6RB 3E35A 2UXBO 3VOUA 3CMAV 5ITZB 5L3CA 5J2TA 2R9AA 1VF7A 2QTOA 4DV7B 2WPDG 3W7WA 1QHTA 2VS0A 5IWAO 3FYEB 1MSDA 3ETQA 2CTPA 4LF6O 2QWNB 3G80A 4FJCC 3BVOA 1TUBB 4K8ZA 2EIKC 4I9WA 2UXXA 2GUZB 2Y4UA 3FB5C 2UXCO 3LDEA 1ZL8A 2OIGA 3IC9A 5FPOA 1OCRB 2QWRB 1NKDA 5D5PA 1TGOA 1W0KG 3THOA 4GCZA 4YJ2B 4NYKA 3HKCB 2QTSA 1N33B 4JYAB 3CCRV 4DV3B 3ZHRA 3G67A 3SYOA 3LSSA 2PY5A 3OMAB 2Q5ZA 1AJQA 1BS3A 4U7OA 4PA3A 1O9HA 4LP8A 4BAYA 4MS2A 3CCMV 3L75H 2FYUH 1MMMA 4UVAA 3ZS8C 2ILMA 4DR7O 4GKKB 1QR8A 3UCSC 4D7SA 3ASOC 3RT3C 2N74A
chains in the Genus database with same CATH topology
2R9IA 1PNMA 5KUMA 3E2EA 1KD1W 1GM7A 1AI5A 2HVJC 2F43G 3SYAA 3CC2V 1KC8W 3F7VC 3K0DA 1V55B 4MTXA 4CBCA 5LBQA 2EIJC 4MVSA 1Q7YW 3D3IA 3E8FA 1N8RW 1G8MA 2ZDIC 3W7SA 3JD4A 1VQMV 1GM8A 1VQ8V 4BW5A 2HVKC 3I55V 2R9RB 5L3BA 4YXWG 4QE9A 2H94A 2WLNA 1YJWV 2WLKA 1W0JG 2BOCC 3ABUA 1OCZB 3QNEA 1VQPV 1LNQA 2IJJA 3ZMZA 1H8HG 2AHYA 4XDLA 2OCCB 4G28B 3B8NA 1QVFU 3LDCA 2IH3C 3JD1A 3K9AA 5IY5C 2KB1A 3SPJA 1R3LC 3GWOA 2IJIA 3CCSV 4WCEV 1K5QA 2WLLA 1QBZA 5GW7A 1OCCB 2P67A 4QPJA 3STZC 4N23A 4J9YB 4H33A 1XL6A 3EHBB 2IU3A 3GB7C 4R7CA 2UXNA 4MTGA 3P30A 4FMTA 4JTCB 3ZN1A 5KUKA 1THZA 2IH1C 2Y69C 3B77A 1VQ9V 3OW2U 1VQLV 4GX0A 2XAQA 4JASA 2QKSA 3FB7C 2JEUA 1RM1C 3WFVA 3ABMB 3CP1A 4R50A 3K03A 1S77D 3FYIB 1VQ4V 2WSSG 5IDJA 3T4ZA 1K3EA 3T4DA 2QA4V 1QLNA 2K1EA 3CYOA 3UM7A 3ZIAG 4TT3G 4MTFA 1M56C 5EC1C 1H38A 2WLIB 4WFBV 3SPCA 5LHHA 3I56V 1YTFD 5HFLA 2YSUB 3ETGA 4UVCA 1RPOA 1BHAA 3OM3B 4KP4A 2DQ0A 5IYCO 1GMGA 3CPWU 3ML0A 3D36A 5B3SB 2YEVB 3QO5A 3FB6C 1KP3A 1OCRC 1Y4MA 4P9PA 3CD6V 3OR7C 4KFMA 2XOKG 5EBWC 4HZ3A 2X6AA 3WG7B 1H2GA 1DF5A 4JPRA 3VBBA 1V55C 3OR6C 4DXWA 1SETA 4RO2A 3E86A 3AG1C 3OEHG 3LDDA 2ZXWC 4FIPC 3H01A 2X6BA 4MSWC 2OTLV 1K7DA 3A0RA 2PI4A 4MW8A 3CCUV 3KG2A 1NBMG 1W2BU 2IJKA 2P6JA 1B6QA 2XAGA 3JD2A 1FFTB 4ZBMA 1HWYA 2OCCC 2JDIG 4PA7A 5H6QA 4RUFA 4XBFA 4I5SA 3DTUB 3AG4C 3K3WA 4LBEC 3CCJV 1SERA 3ASOB 1KQSU 1ZWIC 2A79B 4RQEA 4PDVA 4R8CA 4MTOA 3JCZA 5KA5A 4R6ZA 5CBGA 1S76D 3STLC 3OEEG 1AJNA 2A0LA 1RPRA 3HPLC 5H9CA 2LFRA 1E79G 5CBFA 2EIMC 2ITCC 1FXKB 4JAUA 2EIKB 4UUJC 1FXHA 2P90A 3G4SV 3ZRSA 1GM9A 2EILC 4WFFA 1M57C 1YI2V 1F51A 1AROP 3G6EV 3FB8C 1BL8A 3K0GA 4J9ZB 3ABLC 3ASNB 4JGSA 4UXNA 5CBHA 1R73A 5IYDO 4JYBA 5B1OA 1MABG 1FS0G 1PD3A 4RUEA 5B1NA 3P32A 5B1AB 3W7XA 1AI4A 5EBMC 1JOYA 2QM7A 3OUFA 1E1RG 1S5HC 2XNDG 4HAMA 1V54C 2V1DA 2OTJV 1MSWD 4GT1A 1Q82W 4RQFA 4JYCA 3ETEA 5C93A 5J9PC 5LHGA 3IFXA 5CA3A 4OXSA 1TUEB 1M90W 3ETDA 3F5WC 4P30A 1AI7A 2WWWA 1SRYA 2AHZA 2B5UA 2JJ2G 3ABTA 3MD0A 1S0VA 1CPYA 1AI6A 1BMFG 1OCOB 1SESA 4MVMA 2Q6AA 3OGCC 1YJ9V 3ZN0A 3JD3A 4JAVA 2OT5A 4CZZA 1NR1A 1DLBA 2B1GA 2EJRA 3X2QB 4WFAV 1EBOA 3CMEV 1F4MA 2JJ1G 4PA4A 1GO3F 1NVPB 3AG3B 1R3JC 1KP2A 5B1BC 3B8MA 1PKXA 1DTOA 1M9NA 4HYOA 3JD0A 1COWG 2DYSB 2WLIA 2LP7A 4RAIA 1YTFB 1BHBA 4PDRA 1XL4A 1K4DC 1ROPA 4EKWA 4N21A 1ORQC 3E8BA 3RW0A 1QCEA 4JF3A 1P7BA 3CCEV 3OAAG 1NR7A 2NLJC 2HKOA 3E83A 3AEIA 3OMIB 3TETA 3CXCU 1GKFA 5L3FA 2W6JG 2XAFA 3W7UA 4QPKA 2JIZG 2JK5C 4LCUC 5B3SC 1YJNV 3EFFK 1YITV 1GTOA 2DWEC 2HR3A 1ENVA 4PDLA 1NH2B 1QLEC 1F4NA 4MVRA 4BIUA 2NNUA 3SPHA 1NJIW 2EIJB 3RVZA 3ABKC 4X88A 4JTAB 2DYRC 3AG2B 3TK1A 2BOBC 2EZPA 4MT8A 1JJ2U 2W6IG 2X0LA 5LHIA 1FXKC 1OCCC 4UV9A 2ZXWB 5H6RA 1VQOV 1L1FA 2W0FC 1KKDA 4JTDB 2H8PC 1IXMA 1WPXA 2ZQMA 5EBLC 3SPGA 3E8GA 4TSFG 3CCQV 3T1CA 4XDJA 2WLMA 4GX1A 4QIWF 4TWKA 4PELA 3LSQA 3ZMSA 5BZBA 3OMNB 1F23A 1J95A 5E1AC 2DQ3A 1R3KC 1OHHG 2WLJA 3AG4B 4PDMA 5LGNA 5KA6A 1VQ5V 4LC1A 4MVOA 1PNLA 3JYCA 3CCVV 1R3IC 5CN0A 1K73W 3CCLV 4GX2A 2IU0A 3SYQA 5L3EA 1K97A 3K06A 1VQNV 2FTKA 2JEXA 4Z1MG 4FK5C 1R6NA 1NQTA 3OFNG 4X8AA 1JVMA 2EZOA 4P9OA 3IC7A 4H37A 4ZKIA 2B1IA 1OCOC 2XAHA 2Y48A 3M99B 5FL7G 3SJQC 1K92A 4G27B 1UJWB 1K5SA 1G4YB 2EBOA 4UV8A 1K9MW 4WF9V 2EINB 1CEZA 4P2ZA 1GK9A 1P4RA 1JQ0A 1JCHA 2IW5A 4GX5A 1K4CC 2WLHA 3WG7C 1MOFA 3QO8A 2DYSC 3ZRVA 2XAJA 1V54B 3AG1B 2DW4A 3E89A 1JPXA 3OE7G 4QJFB 3HB3B 3SYPA 3BY6A 4BIZA 1K34A 3PJSK 3R65A 4FPPA 4WFGA 5EC2C 1OCZC 3LNMB 4MVZA 2WAMA 4UVBA 2QE7G 5LGUA 2QEXV 2V7QG 3W7TA 3F7YC 3OUSA 1AJPA 2P7TC 1WLEA 3ZMVA 5LGTA 1PNKA 1I5YA 1K33A 1YIJV 5CMUA 5EK0A 5B1AC 3E8HA 1FXVA 2C2AA 5DM6V 4XDKA 3RBZA 1EZJA 5IY5B 2ATKC 1EFRG 3ZRWA 1R6KA 3K08A 2X6CA 2MK3A 4KUMA 1RM1B 3ABMC 3QO7A 3X2QC 3ZMUA 1KECA 2M7WA 2X7RB 2ZDIA 1NH2D 5B1BB 4WFEA 4WFHA 3ZCCA 4Q20A 3NXSA 1QVGU 4QNHB 2IJHA 1JX9A 2Y69B 3ZRWB 3E35A 3MHSC 1Y66A 1I5XA 4G2KA 2EILB 3VOUA 2DWDC 1M57B 2YEVA 4PA9A 3CMAV 2ZR2A 5L3DA 4ASUG 5L3CA 4F4LA 1H8EG 2D3OW 1VQ6V 1SZTA 3FKSG 4L87A 4E2LA 3RVYA 4DO2A 2QM8A 3UKMA 2QTOA 3SPIA 2HLDG 2WPDG 1VQKV 3W7WA 1M56B 1DF4A 3FYEB 1FXKA 4PA6A 5IYBO 5L3GA 4FJCC 2EIMB 1K8AW 4U7NA 2EIKC 4I9WA 2UXXA 3SYCA 3FB5C 4MW3A 1YHQV 3CC4V 2PI5A 2A9HA 1QR9A 3CC7V 2LFSA 2XASA 3LDEA 1VQ7V 3ABLB 1S3JA 4QE7A 1OCRB 2Z5UA 2EINC 2HJFC 2HFEC 1NKDA 3IGAC 3LUTB 1W0KG 1PL0A 2Z3YA 2GSMB 4GCZA 4MVQA 1CP9A 3DGEA 2ZR3A 1QLEB 3K04A 5HFMA 2HG5C 3ZMTA 3CCRV 2Q67A 3ABKB 4X89A 1S72V 1AR1B 3K79A 3G71V 2DYRB 3AG2C 3LSSA 3SYOA 2Q69A 3OMAB 1AJQA 3AG3C 1YSCA 3MHHC 4U7OA 1M1KW 4PA3A 3BEHA 4LP8A 3T2MA 4BAYA 1Q86W 1NVPD 2WLLB 4MS2A 3ZRXA 3CCMV 2ZD9A 2GHYA 4UVAA 1Q81W 2Q68A 5DN6G 1E1QG 1QR8A 4MVUA 1MG1A 3TCUA 3ASOC 2ITDC 3ASNC 3ZJZA 1OZ0A 2CK3G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 V;  1R73 A;  1K8A W;  1JJ2 U;  1VQ5 V;  1KD1 W;  1YHQ V;  1YIJ V;  4WF9 V;  3CC4 V;  1VQ9 V;  3CC2 V;  3CCV V;  3OW2 U;  1VQL V;  1VQO V;  1M1K W;  5DM6 V;  1KC8 W;  3CCE V;  2OTL V;  1K73 W;  1QVF U;  3CCL V;  1YJ9 V;  3CC7 V;  3CCU V;  3CXC U;  1Q86 W;  3CPW U;  1Q7Y W;  3CCM V;  3CMA V;  4WFA V;  1VQ7 V;  2D3O W;  1N8R W;  1VQ6 V;  3CME V;  1W2B U;  1VQN V;  2OTJ V;  1VQM V;  1Q82 W;  3CCQ V;  1Q81 W;  3CCS V;  4WCE V;  1YJN V;  1VQ4 V;  1VQ8 V;  1YIT V;  3G4S V;  3I55 V;  3CD6 V;  1M90 W;  1YI2 V;  2QA4 V;  1VQK V;  2QEX V;  1NJI W;  1YJW V;  3G6E V;  3CCR V;  1S72 V;  3CCJ V;  1VQP V;  4WFB V;  1QVG U;  3G71 V;  1KQS U;  1K9M W; 
#chains in the Genus database with same CATH topology
 1GM7 A;  1AI5 A;  4DR3 O;  2IBZ H;  2RQ6 A;  4JI3 B;  4PHZ A;  2UUA B;  4X9Q A;  2OCH A;  4DW0 A;  2LGW A;  2HVK C;  1FJG O;  2QM4 A;  1IBM O;  5L3B A;  4YXW G;  4QE9 A;  2WLN A;  2CUG A;  4CS2 A;  1OCZ B;  2FB5 A;  2IJJ A;  1M93 A;  4I9Q A;  4JI5 B;  4G28 B;  5JJN B;  2F23 A;  1ZLZ A;  1HNZ B;  4CC5 A;  4UCS A;  1NS1 A;  5EIB C;  1Q3E A;  4DV1 B;  1YF2 A;  5IY5 C;  4DV5 B;  2RCV A;  2RNB A;  5GW7 A;  4LWS B;  4QPJ A;  4J9Y B;  4DV0 O;  5JJJ B;  3H1I H;  3L70 H;  5KUK A;  1THZ A;  5F2V O;  1UFI A;  2IH1 C;  2JS5 A;  1URF A;  3OW2 U;  4JAS A;  4KXR A;  1ZX3 A;  1D5A A;  2ODM A;  3K03 A;  2EX3 A;  3SDL A;  2GTS A;  3UQ8 A;  4J11 A;  3N2K A;  3CYO A;  4NXM O;  4TT3 G;  5EC1 C;  2WLI B;  3K5L A;  3I56 V;  2VWJ A;  5HFL A;  2YSU B;  3ETG A;  4X1K A;  4D7T A;  4JI5 O;  3D36 C;  5IYC O;  2VWK A;  3ML0 A;  5B3S B;  4JI4 O;  4JAA A;  3B4S A;  3FB6 C;  1OCR C;  4P9P A;  1G6U A;  2YI8 A;  2XOK G;  4HZ3 A;  2QGN A;  1H2G A;  4JPR A;  3SJA C;  1V55 C;  1JMK C;  3OR6 C;  3VBB A;  5IJ0 B;  2GBO A;  2XT9 A;  1Q6U A;  3E86 A;  4LF8 B;  2ADP A;  3OEH G;  4UCV A;  3LDD A;  4L8J A;  4DR3 B;  4O4I B;  3ZHU A;  1HW7 A;  3A0R A;  2PI4 A;  4MW8 A;  1NTZ H;  3CCU V;  1NBM G;  4TV8 A;  4BW9 A;  2P6J A;  3EVK A;  4FLX A;  2LGQ A;  2HEP A;  4I5S A;  3AG4 C;  3WU2 Z;  5KA5 A;  4AHC A;  4TV8 B;  1AR4 A;  3OEE G;  4JI1 B;  1AVM A;  5AG2 A;  3N27 A;  4NB5 A;  2P90 A;  4WFF A;  2Q9L A;  3SJB C;  4JI0 B;  3G6E V;  4JGS A;  2VQF O;  4DV1 O;  1R73 A;  1FS0 G;  4DR5 O;  1PM9 A;  5LMU B;  2YI9 A;  1ZTE A;  1XIL A;  4GT1 A;  2PYL A;  4DV7 O;  3IFX A;  4KL1 A;  2QJ1 A;  3ETD A;  4P30 A;  2HP8 A;  1SRY A;  1Q5O A;  5GTI Z;  3MD0 A;  3CJH A;  1GN6 A;  1VF6 C;  3T1H B;  4JI3 O;  1FAF A;  3CRR A;  4RWU A;  1YJ9 V;  2CH7 B;  1NR1 A;  3RN4 A;  4WFA V;  2ZE6 A;  1EBO A;  1F4M A;  2AGA A;  5KHJ A;  4JYY A;  5FNV B;  1KP2 A;  2QSA A;  1PKX A;  1M9N A;  3JD0 A;  1COW G;  4RAI A;  1NZ6 A;  5B66 Z;  1BHB A;  5LMU O;  1D5N A;  4N21 A;  2F66 C;  4JI2 O;  4JF3 A;  1P7B A;  1SQP H;  2R70 A;  1NR7 A;  3OMI B;  3E83 A;  3TET A;  3CXC U;  2W6J G;  2XAF A;  4QPK A;  4LCU C;  2JK5 C;  5B3S C;  4BIO A;  2HR3 A;  1Q43 A;  4J41 A;  1NH2 B;  1QLE C;  1P7G A;  4BIU A;  4WBN A;  3ABK C;  5IJ9 B;  1SKV A;  1Y6X A;  1I08 A;  3RYF A;  4MT8 A;  2EZP A;  2Q0A A;  2X0L A;  2W0F C;  4O4H B;  4FFK A;  3SPG A;  5KX5 A;  4LF6 B;  1ZAU A;  2F4V O;  3QF7 A;  2RMK B;  4CH6 A;  4TWK A;  3BPZ A;  3LSQ A;  2CTW A;  5BZB A;  2CTR A;  5LYJ B;  1EN4 A;  5LMN O;  1EN5 A;  3Q4H A;  2WLJ A;  1HDJ A;  4LC1 A;  1XRE A;  4O4H A;  4MVO A;  3T1H O;  3CCV V;  1VF6 A;  3VQY A;  2GV9 A;  1K73 W;  3CCL V;  2E74 B;  1SA0 A;  4DR4 B;  1K97 A;  4OPH A;  1AIL A;  1KYO F;  1R6N A;  4X8A A;  4P9O A;  5IJ9 A;  3JAT B;  3M99 B;  5FL7 G;  3SJQ C;  1K92 A;  4G27 B;  1K9M W;  4WF9 V;  4UCU A;  4DK0 A;  1CEZ A;  1PL4 A;  2Y4T A;  1GK9 A;  1EN6 A;  1R1B A;  2JGU A;  2VQF B;  4GX5 A;  5B5E Z;  3WG7 C;  3AK2 A;  2BSK A;  3OE7 G;  4YJ3 A;  4QJF B;  5JCO C;  3SYP A;  3UO2 A;  5LP6 A;  3ZHT A;  1K34 A;  1N4C A;  3APO A;  1PP9 H;  1OCZ C;  3J80 N;  4DV6 B;  4GLX A;  2QE7 G;  2QEX V;  3W7T A;  1JFF B;  3ZMV A;  5LGT A;  1WLE A;  3RBZ A;  3N2G A;  3M8A A;  4K3A A;  5IY5 B;  1EFR G;  5BMV B;  2MK3 A;  2JVD A;  3CX5 F;  3ABM C;  3X2Q C;  3SR2 C;  2JS3 A;  3IJ4 A;  3CRC A;  4NTW A;  1NH2 D;  2LO1 A;  5B1B B;  1IUR A;  1XMO B;  4DR1 B;  4QNH B;  1JX9 A;  2Y69 B;  1KMI Z;  3C3T A;  3BCC H;  4UB8 Z;  5A2Q N;  1I5X A;  3LNN A;  1M57 B;  2YEV A;  2CGO A;  4J7K A;  3GWK C;  5KHK A;  1H8E G;  1NI8 A;  4LNU B;  3AK1 A;  2EUL A;  3SPI A;  2HLD G;  2CDY A;  2RJZ A;  2UUA O;  1XNQ B;  5IYB O;  5L3G A;  1HNW B;  2EIM B;  4IHJ A;  4B3S O;  1K8A W;  3D8C A;  4MW3 A;  1YHQ V;  3CC4 V;  5KHI A;  2FL4 A;  2XAS A;  1H2M A;  1VQ7 V;  4OGQ B;  4X20 A;  4DR7 B;  3QTC A;  3IGA C;  2E3C A;  2Z3Y A;  2GSM B;  2ZNI A;  3RGB A;  2YS8 A;  2HG5 C;  3ZMT A;  2Q67 A;  4X62 O;  3G71 V;  2DYR B;  3AG2 C;  2Q69 A;  4ZOL A;  1IBK O;  1HR0 B;  5CA1 B;  2F1M A;  3MHH C;  1N32 O;  3BEH A;  3S3W A;  1NVP D;  2WLL B;  4NTX A;  4Q6G A;  5TIS Z;  4D6T H;  4YIP A;  4DUZ O;  1NU1 H;  4TOI A;  4O4J B;  5DN6 G;  1E1Q G;  1EZV H;  4DV5 O;  3A0H Z;  1IDS A;  4GKJ B;  3ASN C;  4YHH O;  4JI7 B;  3U10 A;  1LR1 A;  1PNM A;  3E2E A;  1KD1 W;  2UU9 B;  3HKB A;  3JAL A;  3F7V C;  4MTX A;  4CBC A;  3AG7 A;  4MVS A;  1Q7Y W;  3D3I A;  1N8R W;  3O9O A;  3W7S A;  3KZI Z;  1VQ8 V;  4BW5 A;  3K58 A;  2H94 A;  1W0J G;  3ABU A;  1BSM A;  2P4K A;  1FYJ A;  2OCC B;  1ZL8 B;  5CB4 A;  2ZIM A;  3LDC A;  2ZIO A;  3K9A A;  3CCS V;  4WCE V;  3TXQ A;  2CAZ C;  1H2N A;  4GKK O;  2P67 A;  2HJD A;  2IM9 A;  3STZ C;  4E4E A;  3EHB B;  2IU3 A;  3GB7 C;  3L74 H;  4R7C A;  2UXN A;  4JTC B;  4GYC B;  2QDO A;  3S3X A;  2Y69 C;  5KMG A;  1VQ9 V;  4I4T B;  4GX0 A;  2KSD A;  5J2T B;  2QKS A;  1BE3 H;  3FB7 C;  2RN9 A;  2JEU A;  4DR1 O;  2P4V A;  1RM1 C;  2ZNJ A;  1FFX A;  3E22 B;  4I4T A;  1P84 F;  3T4Z A;  3UT5 A;  1QLN A;  2K1E A;  4FM2 A;  4MTF A;  1XI1 A;  2UXC B;  3SPC A;  1WP7 A;  2K9P A;  4UVC A;  4ZI7 B;  3CPW U;  3D36 A;  2Q73 A;  4O2B A;  3CHX A;  2UXD B;  1Y4M A;  3OR7 C;  4J7Z A;  4DXW A;  1DF5 A;  3ZHQ A;  1SZX A;  3APQ A;  4UCO A;  3P3P A;  1G1X B;  2UXB B;  4JV5 O;  1T5E A;  4NR1 A;  3JSN A;  2FML A;  4MSW C;  4K8X A;  4FM0 A;  3OD4 A;  1ZUQ A;  3KG2 A;  4I0X A;  1B6Q A;  3JD2 A;  4K35 A;  4PA7 A;  1SQV H;  4RUF A;  1JFF A;  3L71 H;  3CCJ V;  1TVK B;  1WJZ A;  4Z2W A;  1KQS U;  4DR4 O;  1ZWI C;  2A79 B;  4RQE A;  4R8C A;  4MTO A;  3TXS A;  2JRI A;  1GH6 A;  1RPR A;  3HPL C;  4JI6 B;  1TUB A;  1E79 G;  5LMN B;  4LF9 B;  5BR8 B;  2EIM C;  2ITC C;  1FXK B;  2UXD O;  4YIO A;  4JAU A;  2EIK B;  1WB8 A;  3ZRS A;  1GM9 A;  1YI2 V;  4DRX A;  1IZ3 A;  4JI8 O;  2ARH A;  4J10 A;  3H1K H;  4YJ2 A;  5B1O A;  4OX9 B;  1MAB G;  5B1A B;  3B2E E;  3W7X A;  1AI4 A;  4DR2 O;  4GUN A;  1S5H C;  2XND G;  4HAM A;  2V1D A;  5EYP B;  4RQF A;  2QWP B;  4JYC A;  5LHG A;  4B08 A;  2F93 B;  3M7M X;  4OXS A;  2ADQ B;  1M90 W;  1GN2 A;  1DK1 A;  4TV9 B;  3SJC C;  2AHZ A;  2QWO B;  1WA8 A;  2BTQ B;  3JAW A;  2Q4P A;  3HKC A;  2OWO A;  1NTM H;  3H9V A;  3JAR A;  1XOU A;  4ZHQ A;  3OGC C;  4JI2 B;  3JD3 A;  1VP7 A;  1DLB A;  2B1G A;  3X2Q B;  4CC6 A;  3RYC A;  3CME V;  2JJ1 G;  1NVP B;  3EXA A;  5B1B C;  1YZB A;  1DTO A;  2L6L A;  1FPO A;  2WLI A;  3RYH B;  4EKW A;  1ROP A;  3VQV A;  1O9G A;  2ZM6 B;  4LR3 A;  4JZ2 A;  3T1Y B;  4QGP A;  1GKF A;  1AP5 A;  4PI2 A;  5C8Y A;  1YIT V;  2HHH O;  1GTO A;  2PZS A;  1ENV A;  4PDL A;  4X1Y B;  5KHG A;  2NNU A;  1NJI W;  1L8D A;  3RVZ A;  4X88 A;  4B3T B;  4JTA B;  4FLU A;  4W4K A;  3N2K B;  3TK1 A;  2BOB C;  1S5J A;  1JJ2 U;  4LF4 O;  4H0L B;  2AZ2 A;  3BA8 A;  1IXM A;  4LF7 B;  1XNR B;  3E8G A;  1VAR A;  4TSF G;  4FFB A;  2CH7 A;  5CA0 B;  1ZSP A;  4XDJ A;  1TVK A;  2WLM A;  4QIW F;  1F23 A;  3K5O A;  2JGD A;  2OIE A;  1R3K C;  1OHH G;  3H1L H;  5KA6 A;  3VQW A;  3A0B Z;  3OT7 A;  4I0X B;  1R3I C;  5CN0 A;  4I55 A;  4GX2 A;  2IU0 A;  5L3E A;  4O4I A;  1Y67 A;  3OFN G;  2EZO A;  1I94 B;  4ZKI A;  2B1I A;  2XAH A;  5BXZ A;  2QWQ B;  3H1H H;  4UV8 A;  3HKE B;  3BAA A;  2L35 A;  1YDX A;  3BA9 A;  4B3S B;  1JQ0 A;  4NXN O;  4FLT A;  1MOF A;  3IAY A;  3ZRV A;  4X1K B;  2D2C B;  3DXR A;  2DW4 A;  2YIB A;  5EIB D;  4BWA A;  4DUY O;  4FLZ A;  4WFG A;  1Q90 D;  4PI0 A;  2YXH A;  4MVZ A;  4UVB A;  3DC6 A;  5GON B;  2P7T C;  1EM1 A;  1PNK A;  4FVM A;  1I5Y A;  1N36 B;  5EK0 A;  2C2A A;  4F6E A;  2YDE A;  2ATK C;  1XMO O;  1R6K A;  4KUM A;  3QO7 A;  2M7W A;  5JH7 B;  1XNR O;  1H2K A;  4Q20 A;  2GTA A;  3NXS A;  4DW1 A;  3JAK B;  2BE3 A;  2ZCE A;  3K59 A;  3ZRW B;  2M6Y A;  3MHS C;  2DWD C;  5L3D A;  4ASU G;  4PJ0 Z;  2A06 H;  2N04 A;  1SZT A;  4L87 A;  2B9Z A;  2QM8 A;  4LH6 A;  1JJO A;  3G6B A;  4YY3 O;  3CRQ A;  1VQK V;  2BTO A;  1DF4 A;  1J5E O;  1RSO A;  1SQB H;  3WB1 A;  2ZM6 O;  2OYQ A;  1MZE A;  1HNZ O;  2PI5 A;  2KG7 B;  4DV2 B;  1QR9 A;  1B04 A;  4U3J A;  2A7W A;  3ABL B;  1S3J A;  4QE7 A;  2Z5U A;  1SQG A;  2HFE C;  1WN7 A;  2Q7G A;  1IBM B;  1NT2 B;  4MVQ A;  1CP9 A;  3DGE A;  3K04 A;  5HFM A;  3ABK B;  3H1J H;  1AR1 B;  3K79 A;  2DN9 A;  3JAK A;  1YSC A;  1M1K W;  3C90 A;  3T2M A;  1Q86 W;  4LFC O;  5LA6 B;  1Q81 W;  4DR6 O;  3BRC A;  1N0N A;  3BAB A;  2KQX A;  1TA8 A;  3HKE A;  3B40 A;  1MG1 A;  4O4L A;  1OZ0 A;  2CK3 G;  2R9I A;  5KUM A;  1D2D A;  1U97 A;  3K0D A;  5LBQ A;  4ZIB A;  3JD4 A;  1VQM V;  2NR5 A;  4JYA O;  2Q7E A;  1Y76 B;  3QVN A;  2R9R B;  5JQG B;  4JI6 O;  1GRJ A;  2BOC C;  5LYJ A;  5D5Q A;  1KU9 A;  3ZMZ A;  4PD4 F;  4XDL A;  3U0Z A;  2PUS A;  3JD1 A;  4H44 B;  1JR9 A;  1VEW A;  1OV9 A;  1BCC H;  1R3L C;  3GWO A;  4DYL A;  2WLL A;  1QBZ A;  4FLW A;  1RSO B;  4B7E A;  4N23 A;  2WA3 A;  3CEI A;  4H33 A;  4UCR A;  4O2A A;  4FZ1 A;  1H2L A;  3ZN1 A;  3R66 A;  4JV5 B;  1A32 A;  2ZT9 B;  3B77 A;  1W59 A;  1VQL V;  5KHH A;  1IBL O;  3WFV A;  3ABM B;  2KG7 A;  3FYI B;  4IL6 Z;  3JAW B;  1K3E A;  3T4D A;  2F4V B;  5E79 Z;  2XUM A;  3ZIA G;  2VQE O;  4LFB O;  1M56 C;  1H38 A;  4WFB V;  4DR5 B;  4UB6 Z;  2E5L O;  1YTF D;  1RPO A;  2YIC A;  5DEC A;  1GMG A;  2GDS A;  5C8Y B;  2YEV B;  1QNM A;  2P06 A;  1KP3 A;  4X66 O;  5LXT B;  4KFM A;  3JSL A;  1BQZ A;  4JI1 O;  4RO2 A;  4TV9 A;  3CRA A;  3AG1 C;  2ZXW C;  4X64 B;  2X6B A;  2AXT Z;  2OTL V;  5EYP A;  5H2F Z;  4EFB A;  2VQE B;  3K57 A;  1AB3 A;  2XAG A;  1BQ0 A;  5GON A;  1HWY A;  2OCC C;  2ETN A;  5H6Q A;  1SQQ H;  3K3W A;  4LBE C;  2G38 A;  1SQX H;  4PDV A;  2DJV A;  2YUA A;  3AK3 A;  3JCZ A;  5CBG A;  3K9S A;  3DXR B;  2A0L A;  5H9C A;  2UUC O;  2LFR A;  5CBF A;  2CGN A;  3HKD A;  1FD9 A;  4UUJ C;  4IYI A;  1FXH A;  2EIL C;  1IX9 A;  4J9Z B;  3ABL C;  3ASN B;  3FD9 A;  4UXN A;  1IXB A;  4I50 A;  5IT9 N;  1PD3 A;  4RUE A;  5B1N A;  4JI7 O;  3P32 A;  4YHH B;  5EBM C;  1JOY A;  3HKD B;  4NXM B;  4B7K A;  1E1R G;  1MSW D;  4UCT A;  4JI0 O;  3MAQ A;  5KAF Z;  2YID A;  5KLV H;  3F5W C;  1KBH A;  2B5U A;  1Z2G A;  1N32 B;  1LUV A;  3ABT A;  1AI6 A;  1BMF G;  3JAS A;  2UUB O;  3MDS A;  1OCO B;  1US6 A;  5ITZ A;  2Q6A A;  1RP3 B;  3JCU Z;  1VMG A;  2OT5 A;  2R72 A;  4CZZ A;  5H5N A;  3ICX A;  2O57 A;  4PA4 A;  1GO3 F;  2AW9 A;  3AG3 B;  3B8M A;  3J7A U;  4O2A B;  2DYS B;  5LOV A;  4LFA O;  2Q7H A;  1ORQ C;  1B06 A;  4DV4 O;  3RW0 A;  4WBN B;  3OGI B;  5GTH Z;  1GN4 A;  2YIB D;  2NLJ C;  2HKO A;  3AEI A;  2ZKO A;  5CB4 B;  3W7U A;  1FJG B;  4OPA A;  5JJE B;  3RYI A;  2DWE C;  1YVW A;  3CSX A;  4MVR A;  4JI4 B;  2EIJ B;  5LP6 C;  4IIJ A;  2H3O A;  2DYR C;  3AG2 B;  1TAE A;  4NXN B;  3TGU H;  2W6I G;  1FXK C;  4IIJ B;  2ZXW B;  5H6R A;  3K5N A;  1KKD A;  5K1X A;  2P5O A;  2H8P C;  4NKG B;  3ZX6 A;  5J2U B;  2DMX A;  1WPX A;  3RYI B;  2VRZ A;  1I0H A;  2ZQM A;  5EBL C;  3JAL B;  4K0K B;  4ZHQ B;  4HNA A;  3T1C A;  1SF9 A;  4GX1 A;  4UFZ A;  3OMN B;  3VQX A;  1Q6H A;  2WA4 A;  1GN3 A;  4F6R A;  2DQ3 A;  3JAT A;  5LGN A;  1VQ5 V;  4TQD A;  2UUB B;  3JYC A;  1I7F A;  5LA6 A;  4DV6 O;  2CE4 A;  1MNG A;  1KUQ A;  1SC5 B;  2FTK A;  2JEX A;  4FK5 C;  1NQT A;  3RYC B;  3Q4H B;  3RWR D;  1L0L H;  1K5S A;  1G4Y B;  3SGI A;  4DRX B;  1Q6I A;  2EIN B;  4P2Z A;  3WB0 A;  1X59 A;  1K4C C;  5IWA B;  3UO3 A;  2XAJ A;  3B09 A;  3AG1 B;  1AP6 A;  4FLY A;  3BY6 A;  1QU7 A;  4IGG A;  4BIZ A;  2QKA A;  1IBL B;  3R65 A;  3LNM B;  4AI8 A;  4I50 B;  3F7Y C;  3OUS A;  1AJP A;  1K33 A;  5CMU A;  4GZR B;  4O4L B;  1FXV A;  5DM6 V;  2YXY A;  1XDC A;  1VF5 B;  1N34 B;  2X6C A;  1RM1 B;  3BHP A;  1Z5W A;  3ZMU A;  3F5T A;  1BZK A;  1KEC A;  2LW1 A;  2X7R B;  5KAI Z;  2ZDI A;  4LF5 B;  4WFH A;  5JCO A;  4EEQ A;  3ZED A;  1QVG U;  1RFY A;  4H13 B;  5JVD A;  2IJH A;  1YEW A;  3U11 A;  3ZBH A;  1Y66 A;  4G2K A;  2EIL B;  3WB2 A;  2LJ2 A;  4PA9 A;  2D3O W;  2ZR2 A;  4CH4 A;  1VQ6 V;  4F4L A;  4DV3 O;  2ZE8 A;  4ZI7 A;  4HBN A;  1N33 O;  5KMG B;  3FKS G;  4E2L A;  3RVY A;  4DO2 A;  3UKM A;  1R6T A;  5EZY B;  2Y0P A;  3JAS B;  1M56 B;  1FXK A;  4PA6 A;  1Q8I A;  2BCC H;  4U7N A;  2E5L B;  3SYC A;  1IVS A;  4EFE A;  4IYH A;  2A9H A;  3E22 A;  3PN1 A;  1Y74 B;  3CC7 V;  4LFB B;  1GAX A;  2LFS A;  3N2G B;  4DR6 B;  2EIN C;  2HJF C;  3LUT B;  1PL0 A;  3L73 H;  2Q0O C;  1PPJ H;  2ZR3 A;  1QLE B;  3FX7 A;  4LFC B;  5BR8 O;  5JVD B;  4KHP O;  3D3Q A;  4X89 A;  1S72 V;  1KKC A;  5JQG A;  2Y0I A;  3T1Y O;  3AG3 C;  2DE0 X;  4J42 A;  3ZRX A;  2ZD9 A;  2GHY A;  1XUQ A;  1U96 A;  3HKB B;  1WAZ A;  1X4T A;  2V4D A;  2Q68 A;  4ICG A;  1B3Q A;  2QR4 A;  3O65 A;  5IYZ B;  4MVU A;  3TCU A;  2QKC A;  1KB9 F;  2ITD C;  3ZJZ A;  1CXZ B;  3A2F A;  2HVJ C;  2F43 G;  4AQY O;  3ZHS A;  3SYA A;  5J2U A;  1J5E B;  3CC2 V;  1KC8 W;  4X1I A;  1V55 B;  3KCX A;  2EIJ C;  5LP6 B;  1DGS A;  3ZHV A;  3E8F A;  1G8M A;  2ZDI C;  5JWP A;  2PTM A;  1GM8 A;  3CE2 A;  1FKA O;  3I55 V;  3RYF B;  1WPB A;  5IJ0 A;  3TJT A;  2EJ7 A;  1YJW V;  1M5I A;  2WLK A;  2XTA A;  3QNE A;  1VQP V;  1LNQ A;  1P49 A;  1XHX A;  1H8H G;  2AHY A;  3B8N A;  1QVF U;  2IH3 C;  1Y76 A;  2PF4 E;  3CWB H;  2KB1 A;  3SPJ A;  4B3M O;  1JA8 A;  2IJI A;  1K5Q A;  2RDC A;  1OCC B;  1SA0 B;  2ZE7 A;  4EB6 A;  1XL6 A;  4MTG A;  3P30 A;  4FMT A;  4LF8 O;  3DC5 A;  2JGD B;  4LNU A;  4X20 B;  1XBL A;  2XAQ A;  4FFB B;  5CA0 A;  1SQF A;  3LSU A;  3CP1 A;  4R50 A;  1S77 D;  1NTK H;  1VQ4 V;  1HNX B;  2WSS G;  5IDJ A;  2ZE5 A;  2BTQ A;  2QA4 V;  5CA1 A;  3UM7 A;  3BFR A;  3C3S A;  4DV2 O;  1YCI A;  2F95 B;  5LOV B;  1N34 O;  5LHH A;  1BHA A;  3OM3 B;  5BMV A;  4KP4 A;  2DQ0 A;  4A5U B;  2Q8V A;  4FZ0 A;  1N0J A;  3QO5 A;  1I94 O;  3OTO O;  4YY3 B;  4U3J B;  3CD6 V;  5EBW C;  3CJH B;  4U3F H;  2X6A A;  3WG7 B;  1XMQ O;  1MZF A;  2W0X A;  1SET A;  4PV1 B;  4FIP C;  3H01 A;  3GVM A;  1K7D A;  2E75 B;  4Z1V A;  4DV0 B;  2E76 B;  1W2B U;  4JZG A;  2IJK A;  2LW7 A;  5K1P A;  1FFT B;  1BGY H;  4ZBM A;  1PV0 A;  4X65 O;  4DUZ B;  2JDI G;  2ZIN A;  4XBF A;  4CS4 A;  3J81 N;  3DTU B;  1SER A;  3ASO B;  4LF4 B;  4FM1 A;  1N36 O;  4R6Z A;  1S76 D;  4TUY B;  3NR7 A;  3STL C;  4DK1 A;  4LWS A;  1AJN A;  1QQC A;  4B3R B;  4X62 B;  4ABM A;  4DUY B;  1F7Y A;  3FAV B;  4TUY A;  1BT8 A;  3G4S V;  1M57 C;  1V9P A;  1F51 A;  1ARO P;  3FB8 C;  1BL8 A;  3K0G A;  5FLX N;  1MA1 A;  4K0K O;  1SS3 A;  5CBH A;  5IYD O;  4JYB A;  1Z5V A;  1UPG A;  1M4U A;  4J80 A;  2QM7 A;  1HNW O;  3OUF A;  4YJ3 B;  4W4L A;  1V54 C;  2GUZ A;  1XNQ O;  2OTJ V;  1Q82 W;  3ETE A;  5C93 A;  5J9P C;  1XQ8 A;  5CA3 A;  1HNX O;  1TUE B;  1AI7 A;  4ZOL B;  2WWW A;  3A8T A;  2JJ2 G;  3HR0 A;  1S0V A;  4X1Y A;  1CPY A;  4B3R O;  1XEQ A;  1SES A;  1WB7 A;  4MVM A;  2UU9 O;  3RFR A;  3OTF A;  3ZN0 A;  4DV4 B;  4JAV A;  4HNA B;  2EJR A;  4LFA B;  4GKJ O;  4X65 B;  1R3J C;  4HYO A;  3JAM N;  3L9D A;  5FPR A;  4IHJ B;  4LF7 O;  2LP7 A;  2CTQ A;  3P3N A;  1YTF B;  4PDR A;  1XL4 A;  1K4D C;  3CS5 A;  4OX9 O;  3E8B A;  2Z0A A;  2BSK B;  1QCE A;  4CS3 A;  3CCE V;  3OAA G;  2PYJ A;  1IBK B;  1HR0 O;  4AIL C;  4B3T O;  5L3F A;  3JAR B;  1XMQ B;  2JIZ G;  2HHH B;  1YJN V;  3EFF K;  3K5M A;  1WA8 B;  2NN4 A;  3OTO B;  1F4N A;  2LQT A;  3SPH A;  1S5L Z;  1XHZ A;  3CRM A;  3I5D A;  1AR5 A;  2A3Q A;  4EB6 B;  2PGG A;  5LHI A;  4AQY B;  4I55 B;  1OCC C;  4UV9 A;  1VQO V;  1L1F A;  5JH7 A;  2FKX A;  4JTD B;  1FFX B;  3KCY A;  4CH5 A;  3CCQ V;  5LL6 Y;  2XHB A;  3DSQ A;  3ZMS A;  4PEL A;  2P22 C;  2YIA A;  3KKY A;  1J95 A;  5E1A C;  3AG4 B;  4PDM A;  2UUC B;  5KX5 B;  3CB2 A;  1PNL A;  1H2S B;  3CXH F;  3SYQ A;  5FNV A;  4I7Z B;  4NVP A;  4KHP B;  3K06 A;  1VQN V;  1WNS A;  4X1I B;  4Z1M G;  1WP8 A;  1JVM A;  3IC7 A;  4BR6 A;  4H37 A;  1OCO C;  2Y48 A;  5A9G A;  1HP8 A;  1UJW B;  4B3M B;  1OJH A;  2EBO A;  5IYZ A;  5LXT A;  4DR2 B;  3QG5 A;  1P4R A;  1JCH A;  2IW5 A;  2YXL A;  4X64 O;  4JI8 B;  2WLH A;  3QO8 A;  2DYS C;  3FAV A;  4LH7 A;  5DED A;  2AZ0 A;  3L72 H;  1V54 B;  1LUW A;  3E89 A;  1JPX A;  3RYH A;  1L0N H;  3HB3 B;  4LF9 O;  4FLV A;  4X66 B;  3PJS K;  4FPP A;  5EC2 C;  1VIB A;  2WAM A;  5LGU A;  2V7Q G;  2N05 A;  3FFQ A;  4CH3 A;  4NTY A;  4O2B B;  1YIJ V;  5B1A C;  3E8H A;  1YXB A;  4XDK A;  1EZJ A;  5IE9 A;  4O4J A;  3ZRW A;  3K08 A;  1Y74 A;  2DOS A;  4LF5 O;  2MW2 B;  4WFE A;  4J7J A;  2YC0 A;  2KKW A;  4TQF A;  3ZCC A;  5BY1 A;  4IT5 A;  3UT5 B;  5EZY A;  4C7U A;  4F6R B;  3E35 A;  2UXB O;  3VOU A;  3CMA V;  5ITZ B;  5L3C A;  5J2T A;  2R9A A;  1VF7 A;  2QTO A;  4DV7 B;  2WPD G;  3W7W A;  1QHT A;  2VS0 A;  5IWA O;  3FYE B;  1MSD A;  3ETQ A;  2CTP A;  4LF6 O;  2QWN B;  3G80 A;  4FJC C;  3BVO A;  1TUB B;  4K8Z A;  2EIK C;  4I9W A;  2UXX A;  2GUZ B;  2Y4U A;  3FB5 C;  2UXC O;  3LDE A;  1ZL8 A;  2OIG A;  3IC9 A;  5FPO A;  1OCR B;  2QWR B;  1NKD A;  5D5P A;  1TGO A;  1W0K G;  3THO A;  4GCZ A;  4YJ2 B;  4NYK A;  3HKC B;  2QTS A;  1N33 B;  4JYA B;  3CCR V;  4DV3 B;  3ZHR A;  3G67 A;  3SYO A;  3LSS A;  2PY5 A;  3OMA B;  2Q5Z A;  1AJQ A;  1BS3 A;  4U7O A;  4PA3 A;  1O9H A;  4LP8 A;  4BAY A;  4MS2 A;  3CCM V;  3L75 H;  2FYU H;  1MMM A;  4UVA A;  3ZS8 C;  2ILM A;  4DR7 O;  4GKK B;  1QR8 A;  3UCS C;  4D7S A;  3ASO C;  3RT3 C;  2N74 A; 
#chains in the Genus database with same CATH homology
 2R9I A;  1PNM A;  5KUM A;  3E2E A;  1KD1 W;  1GM7 A;  1AI5 A;  2HVJ C;  2F43 G;  3SYA A;  3CC2 V;  1KC8 W;  3F7V C;  3K0D A;  1V55 B;  4MTX A;  4CBC A;  5LBQ A;  2EIJ C;  4MVS A;  1Q7Y W;  3D3I A;  3E8F A;  1N8R W;  1G8M A;  2ZDI C;  3W7S A;  3JD4 A;  1VQM V;  1GM8 A;  1VQ8 V;  4BW5 A;  2HVK C;  3I55 V;  2R9R B;  5L3B A;  4YXW G;  4QE9 A;  2H94 A;  2WLN A;  1YJW V;  2WLK A;  1W0J G;  2BOC C;  3ABU A;  1OCZ B;  3QNE A;  1VQP V;  1LNQ A;  2IJJ A;  3ZMZ A;  1H8H G;  2AHY A;  4XDL A;  2OCC B;  4G28 B;  3B8N A;  1QVF U;  3LDC A;  2IH3 C;  3JD1 A;  3K9A A;  5IY5 C;  2KB1 A;  3SPJ A;  1R3L C;  3GWO A;  2IJI A;  3CCS V;  4WCE V;  1K5Q A;  2WLL A;  1QBZ A;  5GW7 A;  1OCC B;  2P67 A;  4QPJ A;  3STZ C;  4N23 A;  4J9Y B;  4H33 A;  1XL6 A;  3EHB B;  2IU3 A;  3GB7 C;  4R7C A;  2UXN A;  4MTG A;  3P30 A;  4FMT A;  4JTC B;  3ZN1 A;  5KUK A;  1THZ A;  2IH1 C;  2Y69 C;  3B77 A;  1VQ9 V;  3OW2 U;  1VQL V;  4GX0 A;  2XAQ A;  4JAS A;  2QKS A;  3FB7 C;  2JEU A;  1RM1 C;  3WFV A;  3ABM B;  3CP1 A;  4R50 A;  3K03 A;  1S77 D;  3FYI B;  1VQ4 V;  2WSS G;  5IDJ A;  3T4Z A;  1K3E A;  3T4D A;  2QA4 V;  1QLN A;  2K1E A;  3CYO A;  3UM7 A;  3ZIA G;  4TT3 G;  4MTF A;  1M56 C;  5EC1 C;  1H38 A;  2WLI B;  4WFB V;  3SPC A;  5LHH A;  3I56 V;  1YTF D;  5HFL A;  2YSU B;  3ETG A;  4UVC A;  1RPO A;  1BHA A;  3OM3 B;  4KP4 A;  2DQ0 A;  5IYC O;  1GMG A;  3CPW U;  3ML0 A;  3D36 A;  5B3S B;  2YEV B;  3QO5 A;  3FB6 C;  1KP3 A;  1OCR C;  1Y4M A;  4P9P A;  3CD6 V;  3OR7 C;  4KFM A;  2XOK G;  5EBW C;  4HZ3 A;  2X6A A;  3WG7 B;  1H2G A;  1DF5 A;  4JPR A;  3VBB A;  1V55 C;  3OR6 C;  4DXW A;  1SET A;  4RO2 A;  3E86 A;  3AG1 C;  3OEH G;  3LDD A;  2ZXW C;  4FIP C;  3H01 A;  2X6B A;  4MSW C;  2OTL V;  1K7D A;  3A0R A;  2PI4 A;  4MW8 A;  3CCU V;  3KG2 A;  1NBM G;  1W2B U;  2IJK A;  2P6J A;  1B6Q A;  2XAG A;  3JD2 A;  1FFT B;  4ZBM A;  1HWY A;  2OCC C;  2JDI G;  4PA7 A;  5H6Q A;  4RUF A;  4XBF A;  4I5S A;  3DTU B;  3AG4 C;  3K3W A;  4LBE C;  3CCJ V;  1SER A;  3ASO B;  1KQS U;  1ZWI C;  2A79 B;  4RQE A;  4PDV A;  4R8C A;  4MTO A;  3JCZ A;  5KA5 A;  4R6Z A;  5CBG A;  1S76 D;  3STL C;  3OEE G;  1AJN A;  2A0L A;  1RPR A;  3HPL C;  5H9C A;  2LFR A;  1E79 G;  5CBF A;  2EIM C;  2ITC C;  1FXK B;  4JAU A;  2EIK B;  4UUJ C;  1FXH A;  2P90 A;  3G4S V;  3ZRS A;  1GM9 A;  2EIL C;  4WFF A;  1M57 C;  1YI2 V;  1F51 A;  1ARO P;  3G6E V;  3FB8 C;  1BL8 A;  3K0G A;  4J9Z B;  3ABL C;  3ASN B;  4JGS A;  4UXN A;  5CBH A;  1R73 A;  5IYD O;  4JYB A;  5B1O A;  1MAB G;  1FS0 G;  1PD3 A;  4RUE A;  5B1N A;  3P32 A;  5B1A B;  3W7X A;  1AI4 A;  5EBM C;  1JOY A;  2QM7 A;  3OUF A;  1E1R G;  1S5H C;  2XND G;  4HAM A;  1V54 C;  2V1D A;  2OTJ V;  1MSW D;  4GT1 A;  1Q82 W;  4RQF A;  4JYC A;  3ETE A;  5C93 A;  5J9P C;  5LHG A;  3IFX A;  5CA3 A;  4OXS A;  1TUE B;  1M90 W;  3ETD A;  3F5W C;  4P30 A;  1AI7 A;  2WWW A;  1SRY A;  2AHZ A;  2B5U A;  2JJ2 G;  3ABT A;  3MD0 A;  1S0V A;  1CPY A;  1AI6 A;  1BMF G;  1OCO B;  1SES A;  4MVM A;  2Q6A A;  3OGC C;  1YJ9 V;  3ZN0 A;  3JD3 A;  4JAV A;  2OT5 A;  4CZZ A;  1NR1 A;  1DLB A;  2B1G A;  2EJR A;  3X2Q B;  4WFA V;  1EBO A;  3CME V;  1F4M A;  2JJ1 G;  4PA4 A;  1GO3 F;  1NVP B;  3AG3 B;  1R3J C;  1KP2 A;  5B1B C;  3B8M A;  1PKX A;  1DTO A;  1M9N A;  4HYO A;  3JD0 A;  1COW G;  2DYS B;  2WLI A;  2LP7 A;  4RAI A;  1YTF B;  1BHB A;  4PDR A;  1XL4 A;  1K4D C;  1ROP A;  4EKW A;  4N21 A;  1ORQ C;  3E8B A;  3RW0 A;  1QCE A;  4JF3 A;  1P7B A;  3CCE V;  3OAA G;  1NR7 A;  2NLJ C;  2HKO A;  3E83 A;  3AEI A;  3OMI B;  3TET A;  3CXC U;  1GKF A;  5L3F A;  2W6J G;  2XAF A;  3W7U A;  4QPK A;  2JIZ G;  2JK5 C;  4LCU C;  5B3S C;  1YJN V;  3EFF K;  1YIT V;  1GTO A;  2DWE C;  2HR3 A;  1ENV A;  4PDL A;  1NH2 B;  1QLE C;  1F4N A;  4MVR A;  4BIU A;  2NNU A;  3SPH A;  1NJI W;  2EIJ B;  3RVZ A;  3ABK C;  4X88 A;  4JTA B;  2DYR C;  3AG2 B;  3TK1 A;  2BOB C;  2EZP A;  4MT8 A;  1JJ2 U;  2W6I G;  2X0L A;  5LHI A;  1FXK C;  1OCC C;  4UV9 A;  2ZXW B;  5H6R A;  1VQO V;  1L1F A;  2W0F C;  1KKD A;  4JTD B;  2H8P C;  1IXM A;  1WPX A;  2ZQM A;  5EBL C;  3SPG A;  3E8G A;  4TSF G;  3CCQ V;  3T1C A;  4XDJ A;  2WLM A;  4GX1 A;  4QIW F;  4TWK A;  4PEL A;  3LSQ A;  3ZMS A;  5BZB A;  3OMN B;  1F23 A;  1J95 A;  5E1A C;  2DQ3 A;  1R3K C;  1OHH G;  2WLJ A;  3AG4 B;  4PDM A;  5LGN A;  5KA6 A;  1VQ5 V;  4LC1 A;  4MVO A;  1PNL A;  3JYC A;  3CCV V;  1R3I C;  5CN0 A;  1K73 W;  3CCL V;  4GX2 A;  2IU0 A;  3SYQ A;  5L3E A;  1K97 A;  3K06 A;  1VQN V;  2FTK A;  2JEX A;  4Z1M G;  4FK5 C;  1R6N A;  1NQT A;  3OFN G;  4X8A A;  1JVM A;  2EZO A;  4P9O A;  3IC7 A;  4H37 A;  4ZKI A;  2B1I A;  1OCO C;  2XAH A;  2Y48 A;  3M99 B;  5FL7 G;  3SJQ C;  1K92 A;  4G27 B;  1UJW B;  1K5S A;  1G4Y B;  2EBO A;  4UV8 A;  1K9M W;  4WF9 V;  2EIN B;  1CEZ A;  4P2Z A;  1GK9 A;  1P4R A;  1JQ0 A;  1JCH A;  2IW5 A;  4GX5 A;  1K4C C;  2WLH A;  3WG7 C;  1MOF A;  3QO8 A;  2DYS C;  3ZRV A;  2XAJ A;  1V54 B;  3AG1 B;  2DW4 A;  3E89 A;  1JPX A;  3OE7 G;  4QJF B;  3HB3 B;  3SYP A;  3BY6 A;  4BIZ A;  1K34 A;  3PJS K;  3R65 A;  4FPP A;  4WFG A;  5EC2 C;  1OCZ C;  3LNM B;  4MVZ A;  2WAM A;  4UVB A;  2QE7 G;  5LGU A;  2QEX V;  2V7Q G;  3W7T A;  3F7Y C;  3OUS A;  1AJP A;  2P7T C;  1WLE A;  3ZMV A;  5LGT A;  1PNK A;  1I5Y A;  1K33 A;  1YIJ V;  5CMU A;  5EK0 A;  5B1A C;  3E8H A;  1FXV A;  2C2A A;  5DM6 V;  4XDK A;  3RBZ A;  1EZJ A;  5IY5 B;  2ATK C;  1EFR G;  3ZRW A;  1R6K A;  3K08 A;  2X6C A;  2MK3 A;  4KUM A;  1RM1 B;  3ABM C;  3QO7 A;  3X2Q C;  3ZMU A;  1KEC A;  2M7W A;  2X7R B;  2ZDI A;  1NH2 D;  5B1B B;  4WFE A;  4WFH A;  3ZCC A;  4Q20 A;  3NXS A;  1QVG U;  4QNH B;  2IJH A;  1JX9 A;  2Y69 B;  3ZRW B;  3E35 A;  3MHS C;  1Y66 A;  1I5X A;  4G2K A;  2EIL B;  3VOU A;  2DWD C;  1M57 B;  2YEV A;  4PA9 A;  3CMA V;  2ZR2 A;  5L3D A;  4ASU G;  5L3C A;  4F4L A;  1H8E G;  2D3O W;  1VQ6 V;  1SZT A;  3FKS G;  4L87 A;  4E2L A;  3RVY A;  4DO2 A;  2QM8 A;  3UKM A;  2QTO A;  3SPI A;  2HLD G;  2WPD G;  1VQK V;  3W7W A;  1M56 B;  1DF4 A;  3FYE B;  1FXK A;  4PA6 A;  5IYB O;  5L3G A;  4FJC C;  2EIM B;  1K8A W;  4U7N A;  2EIK C;  4I9W A;  2UXX A;  3SYC A;  3FB5 C;  4MW3 A;  1YHQ V;  3CC4 V;  2PI5 A;  2A9H A;  1QR9 A;  3CC7 V;  2LFS A;  2XAS A;  3LDE A;  1VQ7 V;  3ABL B;  1S3J A;  4QE7 A;  1OCR B;  2Z5U A;  2EIN C;  2HJF C;  2HFE C;  1NKD A;  3IGA C;  3LUT B;  1W0K G;  1PL0 A;  2Z3Y A;  2GSM B;  4GCZ A;  4MVQ A;  1CP9 A;  3DGE A;  2ZR3 A;  1QLE B;  3K04 A;  5HFM A;  2HG5 C;  3ZMT A;  3CCR V;  2Q67 A;  3ABK B;  4X89 A;  1S72 V;  1AR1 B;  3K79 A;  3G71 V;  2DYR B;  3AG2 C;  3LSS A;  3SYO A;  2Q69 A;  3OMA B;  1AJQ A;  3AG3 C;  1YSC A;  3MHH C;  4U7O A;  1M1K W;  4PA3 A;  3BEH A;  4LP8 A;  3T2M A;  4BAY A;  1Q86 W;  1NVP D;  2WLL B;  4MS2 A;  3ZRX A;  3CCM V;  2ZD9 A;  2GHY A;  4UVA A;  1Q81 W;  2Q68 A;  5DN6 G;  1E1Q G;  1QR8 A;  4MVU A;  1MG1 A;  3TCU A;  3ASO C;  2ITD C;  3ASN C;  3ZJZ A;  1OZ0 A;  2CK3 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...