1VQNS

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vqnS00
2J8AA 2DGOA 2RRAA 2DNPA 1QM9A 3MD1A 1NJIT 1ZZNA 2XNRA 2M8DB 2DNMA 2GHPA 4M5DB 2MPUA 4C0OC 4QU6A 3SDEB 2DGUA 2RS2A 2RRBA 1VQKS 5IM0A 5EN1A 3OW2R 1N8RT 4PRFA 2CPJA 3NNHA 2PEHA 2JVOA 2MSTA 2U2FA 1P27B 1U1KA 1X4BA 1FHTA 2I2YA 2DNNA 2HVZA 1XN9A 1M5OC 1VQPS 1Q82T 3CCUS 2U1AA 4WCEQ 4EGLA 2K8GA 2MZJA 4PKDB 1U6BA 2Q79A 3VAKA 4ZKAA 2DO4A 2LCWA 2FC9A 2AYBA 4LJMA 4FXWA 1KOHA 2MMYA 4Y00A 3DLLQ 1VBYA 4P6QA 1D8ZA 2J76E 2XNQA 3CCSS 2BZ2A 2ZJPQ 1VQ5S 4CH0S 2RNEA 2MKIA 3CMES 2KXNB 1R8HA 1CVJA 2YTCA 2D3OR 2MQMA 3JB9k 2DNYA 1DZ5A 2KT5A 2DNHA 2DNZA 2QA4S 1HL6A 2OIHA 1G2EA 3P5TL 1WF1A 3G6ES 5CA5A 2KRBA 2F3JA 3R1LA 1YHQS 3G8SA 3H2VE 2ERRA 2KH9A 1S79A 1YIJS 3I55S 5LSOA 2CPHA 2O3DA 3LPYA 1DRZA 1F9FA 1U2FA 3CULA 2BOPA 3CMAS 1YJNS 2CQPA 4QQBA 1VQ9S 3TP2A 3PIOQ 2AD9A 4OZ1A 2KRRA 1X4GA 1VQOS 1DHMA 3G4SS 5LXRA 1YWXA 3EGZA 2JVRA 2M52A 1KD1T 4J5OA 4QU7A 2KHCA 1HD0A 3ZZZA 2CPYA 1YJWS 1M5PC 2RT3A 2SXLA 3FEXB 3S8SA 1VBXA 5GADU 4Y0FA 2KG1A 1QVGR 1VQ6S 3UCZP 3VAIA 5D78A 2MQQA 1FJCA 2EK1A 1JJ4A 2DHGA 3S7RA 3MUTP 2CPZA 1FT8A 1AUDA 2MKKA 2YH1A 1VQ7S 5GMKa 3ZZYA 1W2BR 2PE8A 2KFYA 1U1RA 3CD6S 4TU9A 3CUNA 1ZZFA 2DGTA 5ITHA 2FHOB 5DETA 2KVIA 2XS2A 1OPIA 3IRWP 1KQSR 2V94A 2MZ1A 1WF0A 2F9JA 2KG0A 3UE2A 2CPIA 2ZJQQ 2M8HA 4YOEA 2FY1A 1VC0A 2MY7A 2LKZA 2L41A 4F25A 3CCRS 5BJRA 1SJ4P 4PR6A 3VAGA 4YB1P 2CQ0A 5GAGU 3RW7A 2L08A 2KM8B 3CTRA 1QVFR 4W90B 3US5A 2MQPA 3HI9A 1FJEB 3MUMP 2CPDA 2E44A 2DH7A 2YH0A 1IQTA 2EK6A 3FEYB 1FXLA 2CQ2A 1YTYA 1UW4A 2MB0B 2D9OA 2DITA 2JWNA 2VONA 1UFWA 1X4CA 1VQMS 4A8XA 3U1LA 3VAMA 1URNA 3BS9A 2J0QD 2DO0A 2HGLA 1K73T 2YKAA 1N88A 3CF5Q 1HD1A 1K8AT 1WI8A 1SJFA 3R1HA 1WTBA 2DH9A 3TYTA 2MZRA 2N82B 2X1GA 3P3DA 5DDRC 3UCGA 1VQNS 4YUDA 3ULHA 2WBRA 3B4MA 1NU4A 2LEBA 2E5HA 2M88A 2CPXA 3CCES 1WEXA 3UD4P 4WF9Q 2MGZA 2KM8C 3MD3A 3MUVP 3RW6A 2D9PA 2K3KA 1ZH5A 1U1OA 2LQ5A 1DBDA 2N3LA 1WEZA 1M1KT 2ZJRQ 5HO4A 4WFBQ 1X5SA 4C4WA 1X5OA 3U1MA 1FNXH 2CQGA 5MLCV 2JRSA 1WG4A 3PIPQ 1FO1A 5FJ4A 3S01A 3THPA 4CQ1A 1VC5A 3VAHA 2LMIA 2FPHX 2E5JA 2DNKA 4WFNQ 3CC4S 1Q7YT 2M70A 2MHNA 3CC2S 5IM0B 1X4EA 2X1BA 2A3JA 2HZCA 3BO4A 1SJ3P 2DHAA 3MOJB 4V19X 3BEGB 2HYIB 1A9NB 1X4FA 4WKRA 2LA4A 2I38A 1R8PA 2MZQA 3TO8A 2X1FA 5DDQC 1RK8A 4RU2A 2G0CA 1JJHA 3BO2A 2CQDA 2AYGA 3J7ZT 2YWKA 1H2VZ 1X5TA 2LA6A 3Q2SC 4Z2XA 2DH8A 3D2WA 2CQHA 3CCLS 1H2TZ 1U1QA 5CXTA 2VODA 4IUFA 1PO6A 3UWTA 5GAHU 1S72S 3NS5A 2L9WA 2DGXA 3LQVA 5GVQA 1U1PA 1FJ7A 2KN4A 2KXHA 5DDPC 2QFJA 5DDOC 3R27A 2MKCA 2RUGA 2E5IA 3P6YC 3CC7S 2DK2A 2EVZA 3CXCR 3G8TA 5LJ3Y 2G4BA 1VQ4S 2VOPA 2E5GA 2G1DA 3I56S 1P1TA 1YJ9S 3NNCA 2CQIA 2N7CA 3VAJA 2LXIA 2DIUA 3UD3P 2DISA 1VQLS 5DM7Q 2RS8A 1M5VC 4BS2A 1K9MT 2DGWA 2CPFA 4QPTA 3CCJS 2DGVA 2J0SD 2DGQA 2KYXA 2MQOA 3S6EA 4TU7A 2DNQA 1VQ8S 4UQTA 2QEXS 3HHNB 1B7FA 3J7YU 2DNRA 3EGNA 4OZ0A 5D77A 1PGZA 3K0JA 1WF2A 5LXYA 1U1LA 2MGZB 1Q81T 3SMZA 3CCMS 4UY8T 2ADBA 1U1MA 2MSSA 2MZTA 1WG1A 1UP1A 1BY9A 2AYEA 4IOCQ 1N52B 2DGSA 2OSRA 4LMZA 1X4AA 3MDFA 1U1NA 3P49B 2DB1A 4TLQA 2CJKA 1WHXA 4LIRA 2HGNA 5LSLA 1M5KC 1YITS 1VBZA 1KC8T 2HGMA 4CIOA 2OTJS 4WIIA 2M9KA 2LXUA 1L3KA 4TU8A 3NS6A 4ED5A 3SDEA 4F26A 2KU7A 2RQ4A 2RU3A 1VC6A 1OO0B 2CQ4A 1D9AA 5JVGQ 2M4MA 1X4DA 3BO3A 2MQLA 5LJ5Y 3MXHP 3H2UB 1H6KX 3VF0B 1RKJA 3NMRA 1HA1A 5IFMA 3MURP 3CCVS 3VALA 4WFAQ 2B0GA 1N54B 1SJRA 1X5PA 3CPWR 2CQBA 2XB2D 2KXFA 2DNGA 2OSQA 1JJ2R 2MJUA 3MI7X 2DNOA 2DIVA 2MY8A 4W92B 1WWHA 1A7GE 1WELA 2ADCA 2M0GB 1YI2S 1Q86T 3Q2TC 2MKJA 2MKHA 3N9UC 2M7SA 2NLWA 4F02A 3L3CA 1M90T 2MXYA 5H1SV 2DHXA 2RQCA 1WHYA 2LECA 1SJQA 1U6FA 2X1AA 4C7QA 3EX7B 3NNAA 2JX2A 2OJ3A 3DXBA 5IQQA 4CH1A 2XS5A 4IOAQ 3SXLA 3V4MA 4FXVA 1X4HA 1WEYA 2AYMA 1H2UX 1X0FA 2MJNA 3THTA 2UP1A 2RVJA 2NZ4A 2F9DA 2KI2A 1WG5A 2MKSA 3B4DA 3G9CA 1KOOA 1O0PA 2CQCA 5GAEU 1UAWA 2FC8A 5JVHQ 3UCUP 2DNLA 2MZSA 2XS7A 3G96A 4U67Q 2CPEA 2GO9A 2MYFA 2LEAA 2LYVA 3VAFA 2VOOA 4ERDA 1SXLA 5CYJA 2CQ1A 3G71S 2MQNA 5DM6Q 1OIAA 4IO9Q 2OTLS 3IWNC 2DHSA 2M2BA 2CQ3A 2XSFA 5HL7Q 1JMTA 1OWXA 2N3OA 1WI6A 3CCQS 1WHVA 1NO8A 1WHWA
chains in the Genus database with same CATH superfamily
1N5SA 3D6HB 2DGOA 5DS7A 4HTIA 4DFPA 2AJ0A 3D66A 4CLKA 2AJ1A 1OSDA 3EJMA 3LANA 5C7PA 3KMSA 4F4WA 3MD1A 2VQEJ 4QIFA 4C8YA 1ZZNA 9RUBA 2M8DB 4F3OA 1HPZA 4EBCA 2DNMA 2GHPA 3ENAA 2HHTA 2MPUA 3KNGA 3DRSA 1M0SA 4K7QA 3SFGA 3VV2B 3VZHA 1QAJA 2V69A 2YWWA 4FBTA 1VQKS 3TEGA 5LMUJ 1CJKA 3CJTA 4O4GB 3T5KA 4FF3A 2F65A 2AJ4A 2F5GA 3WHIA 1CJKB 2LDIA 1H0HB 3FKBA 4NYOA 4JUZA 3PDNA 4KFBB 4M5IA 3TVYA 4HYKA 1S1TA 4OYIA 1HYSA 2WOMB 3IAS9 1U1KA 4B08A 1F9HA 1MN7A 3DLEB 1JLFB 2KYZA 3TX0A 5ETTA 2I2YA 2HVZA 3HULA 3MMBB 5HLFA 4HDHA 4J91A 1EB0A 3B82A 4JI4F 3FRYA 3GR1A 1N34F 1TAUA 3QGPA 5KFPA 1U0SA 1KVIA 1HBOB 2IFXA 3TZXA 4EGLA 1BQMA 2K8GA 4A8FA 5CH7B 6FDRA 2DO4A 4IFVB 1FKOB 3MM5A 4WP9A 4TN2A 5L38A 4DV4J 5KFNA 2E5LJ 5A8RA 4LFCF 1YG0A 3G6VA 3DLLQ 5B0DA 2VKZG 1F9EB 4KGZB 5CD4A 3QRQA 3EVMA 3IO1A 5A2QU 3X3UA 1UWAA 3N01A 3OD2A 2R7TA 2JFDA 3GMGA 2ZKTA 1IBKF 4OJHA 2ASYA 2F8EX 2YKQA 3FSYA 3L4BC 3CMES 1PSDA 3CDEA 2KZMA 3I96A 1VLOA 3GONA 2X51A 3AAWB 2DCUB 3IBWA 1ZM4A 5HVHA 4X4VA 1OYDA 2DNHA 3MM6B 2DNZA 3PW4A 1NDLA 1HL6A 1P9YA 4PXBA 2OIHA 4DQIA 3P5TL 5CA5A 3LP2B 4HT5A 2CYYA 3HKWA 5L1LA 1RQ0A 3H2VE 2BE9B 2IVFB 3VR1A 1Q8LA 1YHQS 2OMOA 3BDPA 2K7JA 4LQ9A 2KH9A 1IKWB 2JC0A 5CABA 4DN9A 1TL1B 3UR3C 2EPIA 3ISND 1YIJS 5LSOA 3J81j 3MMAA 3W60A 1K47A 2O3DA 1FDNA 4PWDA 2C2KB 5I3QA 3CULA 4IG3A 4PG5A 3MR3A 3CMAS 4B9SA 3M2UA 4IH6A 5AJ3F 1NPRA 3UQSA 1VQ9S 5C24A 2AD9A 4K50A 1K1QA 1RT4A 1WSRA 2V8PA 1QDUB 4FYXB 3UO0A 4ID5B 3NS7B 2IA0A 1YQHA 3Q23A 3PV8A 4B3MF 1DHMA 1OS5A 4KTQA 1CJUA 1CBKA 3MHYA 3DMJA 3N5FA 4J9UE 1HBOA 2M52A 5DGBA 1XR5A 4DR7F 2BW2A 2HLTA 3GYNA 4W98A 1JLQB 4ECRA 4N8OA 3W1YC 2DPJA 1RBOB 1VBXA 3KLIB 5CYMA 1ZM2A 1NHVA 2CG8A 2EFQA 3DI6A 1DARA 3HHLC 2VKRA 1EQMA 4NA2A 5IC4B 2MQQA 1FJCA 1RJJA 4O3NA 1T02A 1RTIA 3HDSA 3D6TB 3HHDA 3WC0A 2AT1B 5KFEA 2MEWA 4LUBA 5KFQA 1JLFA 2AJFE 1HMVA 2GJ2A 1Q79A 2KVQE 2MKKA 3RUBL 1RBLA 4HHJA 3D67A 5LL6d 3GQCA 5J2QB 5F3ZA 1W2BR 3PW7A 3Q8SB 4DOZA 1IJFB 2J6SA 2WCXA 3CJ3A 5KG7A 3HP6A 4RUAA 2OPPA 3OTEA 1F2GA 2FHOB 5DETA 2KVIA 4ETZA 3IRWP 1F0XA 4CT9A 4URQU 2JEJA 3BB5A 4LSLA 3MZIA 5M2PA 3T6BA 2ZJQQ 1ELOA 2VA2A 1CLFA 4NLOA 1WJ9A 3KUGA 1Q16B 4TY8B 4DV7J 4MK8A 1UTAA 2BW7A 4FF2A 2XZTB 1ZPWX 4GO7X 4U7UD 1DQAA 1FI4A 3R7NB 4LRFA 1RGVA 4F25A 4EZ9A 1TK5A 1EKSA 4DUZJ 1K44A 5HVGA 2V4RA 2FVPA 2XWXA 3VAGA 4EMDA 2HQ3A 3KMQA 3J7AN 3CO0P 3KK3A 3D0GE 3POTA 2J0WA 3OQ2A 5CZXA 3UN5A 4ECYA 4AL7A 5F41A 4J90A 3T1HF 5M2UA 2CAJA 2KM8B 2BJDA 2AU0A 5B0EA 4U7CA 4OQJA 3DLJA 1QVFR 4W90B 4ILRA 2UUCF 1SIZA 2P9EA 2YKNA 3BZQA 3M9NB 3HX9A 1HNWJ 4U95A 3RTVA 2E44A 2FLLA 5AJ3J 2QV6A 1HBMB 2ZDOA 3CJ5A 1VRQC 1VQSA 2VC0A 3OL7A 2YNFB 1FTRA 3I5BA 3Q8UA 4P2MA 1UVNA 2YNHA 3FEYB 1RHQB 2WHOA 4JP8A 4URSA 4B9UA 2IMOA 2EKNA 1X9SA 1HQUA 5KT6A 2JWNA 3ETOA 4X4RA 3P45B 1RB0A 3B54A 4DLEA 1VQMS 1BQMB 1D09B 2GGPA 2X3GA 3AJ1A 3G82A 2V8HA 4C0HA 2YX4A 3EXYA 3RG6A 3TNVA 2GMJA 5F0WA 2GV1A 3SCIE 5A0YA 1PILA 2H4YB 3Q86A 3DXSX 1K8AT 4ICLA 3BBBA 4M1KA 2OPPB 4NMXA 2ACMA 3R1HA 3V6HA 1WTBA 4RUCA 1M5SA 2QA2A 3TJ8A 1D1UA 1UL3A 2C3OA 2ZFHA 3OR2B 4CLPA 2AMCB 3ULHA 1C0TB 1NU4A 1TKTB 2V8DA 4C3KA 2QSWA 2LLZA 4KE5A 2CPXA 2XMMA 3KLEA 2PD1A 1WEXA 3CCES 4WF9Q 3FGVA 2HZVA 2JNJA 4MKYA 2G1HA 3GZ7A 1DLOB 3LGMA 2ZH1A 1D8YA 3H7HB 4PQUB 3DRRB 1IQZA 4ALZA 2QRRA 1Z1ZA 4LBPA 3WDOA 1KEKA 1S9FA 2LQ5A 2C3PA 1CJVA 1TV6A 2GCFA 2LDYA 3QYYA 5JJBA 5KG2A 1U2RA 3QPIA 3HSGA 4A8SA 3JYTB 1HI0P 4L6V3 3C3LA 1TL7B 2ZBCA 4XPEA 1X5OA 3HVTA 4ZP9A 3CJRA 1FNXH 2XY6A 4E0DA 3V2UC 4E2FB 4OYWA 2BJ9A 1AUSL 5HMYA 2YVSA 1VBKA 5D4LA 4EYIB 1G3OA 2E66A 2FJXA 1JLGA 1QSSA 2LMIA 2N7YA 3FK4A 3KFWX 1NLKL 2FPHX 4LIWA 3V6DB 4IRDA 2ZUAA 2R7VA 2G2OA 2WSEC 4ZIVA 4RX6A 2GMLA 4X66J 2CJBA 4F67A 2M70A 3CC2S 2OFHX 3AFGA 1RI7A 4N41A 4Y28C 5F8HA 4RW8B 1NDCA 1RCOB 4WTYA 3OL6A 4DFKA 4LBIA 1FVSA 1MNEA 1WKJA 2X1BA 3KDNA 3RGIA 4LF2A 3NWRA 4LF5J 1R31A 3KK1B 5KOXA 1SJ3P 3CWJA 4IH7A 3FFIB 3D1OA 1T05A 4QR0A 1NMEB 2OKQA 3LP1B 1X9MA 4V19X 4CO0A 3C6UB 2NYIA 4IFYA 3AB4B 2ZNZA 1A9NB 3MPUB 2CG4A 2OELA 4A47A 1KR4A 4R5PB 1R8PA 5EWGA 4CLFA 4KQZA 4ZVFA 1T03A 2AZ3A 5IXUA 2C3UA 3J7Z5 2HFUA 3MEDB 1EKRA 1X9WA 3RR8A 4NCBA 3A3PB 1PCAA 2HWIA 1T9UA 1RK8A 3IMQJ 3KJNB 2L9DA 4FXDA 3OSNA 2QYCA 3JS9A 2FYXA 4DUTA 4DMZA 1JJHA 3KNAA 2XMUA 1EX8A 1E6YA 1HNIA 3I4HX 4I6AA 2CJ9A 3R8YA 1YSJA 4RW6B 1EETA 3W2WB 5A8RB 1KKHA 1X5TA 4ER8A 1ZTTA 2HHQA 4B9MA 4Z2XA 3RJMB 1IJEB 2CQHA 4OLOA 1H2TZ 3BSCA 3DLKB 3QT8A 5CXTA 1PO6A 2G0JA 4CLZA 4FDFA 3K5NA 5D8HB 3RAXA 1CQNA 2BJ1A 2XC9A 5A6WA 5KFFA 3HO1A 3AJ2A 4DL7A 4OI0A 3OVSA 3TAMB 1OQ3A 1REGX 2CJXB 3AXMA 5DLFA 3HLUA 1GMUA 1KFDA 1VIXA 2CNLB 1FX4A 3K8VA 1SKRA 1Y00A 2KXHA 5GADI 2VQFF 5KFBA 3JYTA 4EWTA 1HW9A 4JI5F 2GAHC 4L75A 1S49A 2W2PP 2ZE2A 3P6YC 2VG5B 1HPZB 2FGOA 2ZBQA 4PWWA 3HSZA 5F8IA 3RBEA 3CC7S 2BVZA 2CDQA 4DZDA 1HQUB 3EWGA 2E7VA 3L9ZA 4GRSA 2WOMA 2F1FA 1Y7PA 4IDKA 4L74A 1JKHA 3R9LA 3CXCR 2IRYA 3MMCB 4JI1F 4LF7F 4L72B 2HHVA 2W8LA 1SL0A 4PWDB 3T1YJ 2V6AA 1ICEB 4RW9A 2LP4A 1X8DA 2NXEA 4KHMA 4Y2IA 1XWLA 3SQGB 3U02A 2N7CA 1RHRB 2DIUA 3VAJA 3CD7A 5DGAA 2IM1A 3T6JA 1VQLS 1ITPA 3ENQA 4OI4A 5EHHA 1M1GA 1S7HA 1VIOA 2B9YA 5CCMA 4O44B 3TUJC 5A8KB 2AX1A 1N6QA 3M8QB 2HRYA 1UA1A 4ANCA 3L09A 3KWMA 3I9ZA 5C2GA 5J1EA 3IWLA 2DGVA 4R0JA 5J2NA 2OFGX 3S6EA 4X62J 2QTWA 1B3TA 4TU7A 2IY5B 3TVKA 1VQ8S 4UQTA 1LW0B 3QT5A 5A8WA 2K7KA 4ZLLA 4IR9A 3JAMY 3UDCA 5LSRA 2DNRA 4DV1F 4U6PA 2B4UA 1R0AB 1HLWA 5D77A 2G13A 4GKJJ 1MROB 2HQFA 4WK3A 2OPRB 2ZH5A 4TYBA 3SMZA 2R4FA 3O2IA 1TL3B 3MR7A 2DXDA 4M63A 4WU3A 5DZ7A 1AA1B 3W9JA 3KK3B 3JSBA 1EQ0A 3KLHA 1FA0A 1EHWA 1RT2A 2FHKA 2IHR1 3ITHB 1FEEA 1BY9A 2AYEA 1CG2A 1EARA 4USTA 2R7SA 1N52B 5ETNA 3HT0A 1SQFA 2HFSA 4OYAA 3GE9A 4AUKA 4K4VA 2AKWB 3KKFA 2HRUA 2R2RA 2HAFA 1LK7A 2MLYA 2Z30B 3GB0A 3MDFA 1C1BB 3NCQA 2DB1A 3LO3A 1FWKA 3PFEA 1IKXB 4LRAA 1RKIA 3BQ2A 1BXNA 3RB3A 4CLSA 4DPTA 1YITS 4MKBA 2FHJA 4JI0J 1HHQA 3L7UA 1FESA 1JJCB 1MG7A 3AD7C 4PQAA 3PCOB 4JI0F 3TWZA 1NRKA 1FDBA 4K59A 4KBIA 4WIIA 3UDEA 5LMNJ 4ED0A 1KVJA 4ECQA 3ZZOA 2HS4A 3FMBA 1CEZA 2B5JB 4IO1A 4FBUA 4JI6J 1AZSA 5D0RA 3MR5A 2KU7A 2E7XA 3HXMA 1BGXT 3M2VA 5E3AA 2AGOA 1VC6A 4LF7J 4LFBJ 1XR6A 2Z4PA 5BYQA 2DR7A 1TZ0A 1Q5YA 4HH0A 4RL1A 5CYQA 3DN9A 4DR1F 2MQLA 3RBDA 1N32F 4LT6A 4JV5J 3H2UB 4EK2A 2GQQA 3VF0B 4CLLA 1RKJA 3DOKA 1S6PB 3IR5B 1RAGB 1BD6A 2GHWA 5HN0A 2BMBA 4DPOA 3CCVS 1TL5A 5KFHA 4WFAQ 2B0GA 4DS4A 1N54B 2HBZB 1UZHA 4WFXA 4ZOSA 2KXFA 1RAJA 3CDWA 2DNGA 2OSQA 4FNHA 4QWCA 2R2SA 4M94A 4B3OA 2W9CA 2DNOA 2FB0A 1VRTB 2MY8A 1U09A 2Y1RI 1A7GE 1WWHA 3CD0A 4HL9A 2M0GB 4RW7A 3HFKA 3MM8A 4X62F 3DOLA 2I1RA 5GMEA 1YBAA 3CT9A 2XMKA 1IR1A 2G2YA 5F0UA 1Q86T 1LQ9A 4CYUB 2JEFA 3NBPB 5KFGA 3GIIA 2NYHA 4QR1A 2NLWA 4XPCA 4QBUA 1NAQA 3L3CA 3UD5A 4ZIWA 4B3RF 2DHXA 1KTQA 4UUXA 3OXLA 2C22A 4AQYF 1I94J 1KP6A 2NZCA 4KHPF 4JYAJ 2C2NA 5EDWA 3EZOA 1UJ5A 3DKDA 3DGPB 3HVAA 2OI2A 3NNAA 4FVMA 4KGKA 4MIAA 3E51A 3GIKA 3QQCD 4OI6A 2OJ3A 2UVVA 5H9FK 3ET6B 2PA8D 1G7CB 4IG0B 3JQKA 2A10A 2POKA 4O3OA 5IT0A 3DDKA 4UZBA 4CH1A 3SXLA 2HFNA 4IOAQ 3IA0A 2JFKA 1IWAA 1KDNA 1WEYA 1H2UX 2WVBA 3DNCA 3HVWA 2OEKA 1X0FA 3H5XA 1QUPA 1O8BA 4I6WA 4TQRA 1FKPA 1GMVA 3QMQA 2F9DA 2MKSA 3UPFA 2AW0A 5GAEU 4LQ3A 1NSAA 1PJ6A 1HQEB 1VBZA 1JXLA 1FKAF 3RBXA 1H38A 3BKFA 2FC8A 5JVHQ 1VGYA 4DR6J 4UOGA 3DRPA 1JLGB 4PYAA 4EI2A 1U26A 4KR0B 5F8JA 5KAKA 3QO9A 2ZEJA 5K8NA 3NAIA 1SXLA 5ETLA 3OUYB 2GZOA 1VFJA 4IH5A 1U8SA 2MQNA 5GAEI 1RWNB 2VV5A 2NXNA 2QLFB 3KLGA 3IWNC 2DHSA 1NK7A 3DLEA 2XSFA 2I8EA 1JXVA 8AT1B 3SZ2A 2DRDA 2XO6A 2UVUA 2G2ZA 1S1WB 3BREA 4NASA 2FHJD 1KVKA 2V9KA 3MM7B 4QOTA 1MWZA 3E3XA 2Z58B 3Q8VA 1NO8A 2PC6A 4NYZA 4RUBA 2UVRA 2PMHA 4NLPA 3TAQA 2HBQB 4NI2A 2QA1A 1C4AA 1DURA 2EI5A 3EPGA 1R0CB 3CJ2A 3GFZA 5L39A 2E29A 1N4LA 3KLEB 3GV8B 1CQMA 5EGYA 3CDBA 1NJIT 1SV5B 3K57A 5ETRA 3ENVA 3DLHA 2CZ4A 2DY9A 2VBWA 3FCHA 4DFJA 5KFAA 4AXJA 4Q43A 3IC1A 4PQUA 1JK9B 1NDKA 2DGUA 2YBVA 2RS2A 4QU6A 4U96A 5IM0A 2W4DA 4QR2A 3M9OB 2HS0A 4EBEA 1N8RT 3M7VA 3PM9A 2W9BA 2LQ8A 3W61A 2PEHA 2XYPB 2JVOA 3K5OA 2MSTA 3S1TA 5KG0A 2ZH7A 4N76A 4K4UA 1SC3B 1P27B 3FVYA 1XMOJ 3Q8PB 2J9DE 3QSYB 3DDIA 1X4BA 4ZVTB 4LFAJ 3PR5B 4FYWB 1UJ6A 4LF8J 4DR5F 1ROFA 1VQPS 4RR5A 4WTOB 1BMQB 1SBRA 1Q82T 4DV1J 2ZBPA 2VFVA 3P4UB 3Q22A 3CCUS 3EMTA 4B3SJ 1HWLA 1NB2A 1HIYA 2MZJA 4PKDB 4XIUA 4KV8A 4AYBD 3VAKA 3OUYA 2ZH6A 2LCWA 3LAMA 4IG0A 1Z4UA 4FXWA 4TYAA 2J9CA 4ZJLA 2MMYA 4QYZK 4Y00A 2DVIA 4ETXA 1VBYA 3W9IA 4EYHB 4PCQA 4J9KA 1REVA 4H54A 2YPZA 3D1QA 4PG4A 2BZ2A 2ZJPQ 2RUSA 3IG1A 2A0FB 2KDOA 4G1PA 4CH0S 1XEZA 3LTOA 4O44A 2J8SA 3GJRB 3NCRA 4Y6IA 4C48A 1PBUA 5C25B 3KK1A 4A8QA 1R8HA 3N28A 2WB1D 4U8YA 3CVKA 1NKCA 1TU0B 4USMA 1Q0NA 4QPXA 2Z57B 1WSVA 3HFZB 4USWA 1AROP 4BC9A 1RXOB 2XG8A 3C16B 3C66A 4DV0J 2W7OA 1JLCA 3QFWA 4ECVA 2V34A 3BDEA 5K14B 1NZ8A 4RW7B 4OJGA 1Q4RA 2F3JA 2A6OA 4J9PA 4RUHA 1TUGB 1ZTWA 1YX2A 4X84A 3QNWB 1S79A 4F3MA 3FBFA 5LT5A 5J2QA 2HIYA 2R8HA 1DTTB 2NPFA 4C0BA 4LR7A 3I55S 2W9BB 4NXMF 4CZCA 4OZ2A 1F9FA 3V6JA 3DYAA 1U7LA 5KT7A 3CDUA 1F1BB 3TX8A 4H4KC 3N79A 1RT7A 3HCXA 3TP2A 2CZ9A 3PIOQ 2EFNA 4U8VA 1CC7A 2XMTA 2FIUA 1VQOS 2ZKUA 3AB2B 2HNZB 5LXRA 2BQ3A 3UI3A 3KG0A 3EICA 3QWPA 3KLVA 2ZBIA 2JVRA 3BSAA 4IYQA 5B0AA 2XM3A 5KFYA 2RHSB 1Y4ZB 2VFTA 3ILLA 2KHCA 4J5OA 4DCJB 1KD1T 1HD0A 1U0HB 4GVBB 1IXKA 2CPYA 4PPDA 4ZP6A 2RT3A 4DFMA 2PMWA 2X3DA 1RAEB 1QAYA 1RT6B 1F2HA 1O5JA 3DRRA 3I82A 1FKPB 4ECXA 4HI2A 2IC3A 3OLBA 5FDLA 4URGA 3MAAA 4DN0A 3EXCX 3NG8A 4ED8A 2UXBJ 4OYZA 3CO9A 1S1UB 3DFEA 1VLYA 1XTZA 1KHVA 4J9LA 5BR8F 2RE1A 1T9YA 4ZLJA 3FBBA 2ZH4A 1FRMA 3TRGA 2KFYA 2Y9HA 1XBWA 2HMIA 4UY85 1TAQA 1M1HA 4KRWA 4DI6A 5A6PA 4B3MJ 1ZZFA 2AEMA 2DGTA 4ZA1A 4DUZF 3K8WA 5ITHA 5H9EK 2RILA 4JI6F 1RP5A 3R2DJ 2VU5A 4AD6A 5F8GA 4GKKF 1LWEB 1O6XA 2CJAA 1N5TA 3M8ZA 4OYXA 1KQSR 2XLKA 3M2UB 1AW0A 4TY9A 2PA3A 4B3OB 2CPIA 3F41A 3SI8A 5JUMA 1MU2B 2GGPB 5KT3A 2FY1A 2L41A 3VWSA 2FJVA 2WTFA 1MSWD 1HFEL 4G3IA 2VG6B 5T7LA 2FUG9 2XYHB 1WOSA 3AD9C 4M5LA 3CCRS 1IUJA 1S6PA 2XLIA 3I0SA 4NA1A 3PYGA 2YX7A 3IBCB 3H42A 3QAUA 4ED2A 3MCNA 3PX6A 3Q8YA 1OSCA 1X31C 1HR0F 4DL6A 1Y10A 5GAGU 1MN9A 1MMNA 3AA9A 3CTRA 2H4WB 1S4EA 2FJEB 1I94F 5AE3A 7FDRA 2BA9A 4QIGA 3GWCA 2YWHA 3IRXB 1R0AA 4GC6A 3M32B 2UUTA 3HHLD 4LR8A 3OVBA 3HD2A 3HSDA 2UV8G 1IQTA 5E3RA 1ULRA 2EK6A 4BCAA 3NKYA 2JLFA 5G0RB 4WFYA 1R8CA 1N36F 1TELA 4LF9F 4NLXA 4MIWA 1FXLA 2BABA 2DCLA 2B9XA 2HK2A 2MB0B 2PSZA 3OJUA 2D9OA 1C1BA 2C2RA 2VONA 1T8EA 3GJQB 1HNXF 1RT1A 1UFWA 1X4CA 1NSQA 3GG0A 3MEGB 4DV4F 2E5LF 3GCXP 2IIHA 2W4PA 1URNA 2QJ3A 2UVWA 2NXJA 2J0QD 1URRA 2DO0A 2R8JA 4UOHA 2GJIA 2HGLA 1MMLA 3GIRA 4NLUA 2D69A 3AOCA 2EC2A 1NKBA 1N88A 3PJ9A 2VPYB 2VC1A 1N32J 4J9QA 2D41A 5E3CA 1E6VA 4I1TA 4N8NA 1S0OA 3TYTA 3PO4A 4MFBB 1Q7LB 3KJVB 1W26A 1F5CA 1GQEA 1SJ1A 4M5KA 4I7FA 7AT1B 4YDXA 3O1LA 2RKIA 4MFBA 3KJVA 3UCGA 2B5JA 4CNZA 3OHAA 2XZWA 1FE4A 3B4MA 3CEDA 4M8LA 3DLGA 4RW4B 3FCWA 3H8YA 2E5HA 3HD1A 2M88A 5D0HA 1RTDB 2EC0A 2FJWA 1AFJA 4DDFA 4DUYF 5ETSA 4DV6J 2ATLA 1V6HA 2M5YA 2E1RA 4RLEA 2MGZA 2HURA 3GPAA 2HNYA 3C8YA 2AJQA 2Y8WA 1AFIA 2Y0BB 5BYSA 4C9DA 2VFSA 4OZLA 3DC2A 2R7OA 4W92B 3DI6B 3JXOA 4C2MA 2N3LA 4L3KA 1WEZA 1C1CB 2YNGB 4DQSA 4G1QA 2VQEF 4LF8F 3EGWB 2O66A 2MQ8A 2FQQB 3HHLA 2YNHB 3EVWA 5HO4A 3IXQA 4WFBQ 4LF6F 1FWLA 4C6AA 2OMLA 1T03B 1HNVA 3VVTA 3FDSA 4N77A 4CLWA 3R5AA 5MLCV 2JRSA 1WG4A 2DRBA 4F4ZA 4FYDA 1WDTA 3MOZA 4DQQA 2V50A 2W1BA 1S9GA 3D68A 3S01A 1FEHA 2HNDA 5AE1A 3F73A 1J2VA 3OFEA 1WC1A 4ZP7A 1X60A 4RNMA 3VAHA 2UU9F 2FDNA 3EUNA 2AIRB 1YK9A 2XTJP 2FY8A 2WSCC 4HTJA 3TVZA 3W7BA 5F9NA 1NK0A 1RWVB 3CC4S 1Q7YT 2AZ1A 4FKYA 1LWCB 3SFUA 1VI7A 1TK8A 1VRUB 2RDDA 1VS3A 4Y2MA 2PDAA 1LXJA 3K17A 3IFEA 4A8MP 3GTYX 5IM0B 4O3RA 3QGGA 1X4EA 3QBCA 4J9MA 2LQJA 2HZCA 3EM1A 4HHUA 5E0OA 1UVMA 3UFCX 2JH3A 2DHAA 3AH6A 3JSYA 3POTB 1KTVA 5L9XA 3MOJB 5FDLB 2BV3A 3MTJA 1RZMA 1Y3KA 2BJ8A 3K5MA 2QMXA 2HEKA 3I0RA 1NJWA 3BEGB 1PAEX 2GNKA 2OAUA 4XK8C 5HJYA 4JI1J 4CI0B 1J5EJ 2VG5A 4ID8A 4WKRA 4DQRA 2NXCA 4KH0B 5ETPA 4JV5F 3FC9A 3HVTB 4DV3J 1NJZA 2BYCA 5IOLA 1TKXA 4RBTA 3PJXA 4ZITA 4LVNP 4KKOB 4PXEA 4X4OA 3VCDA 4ED3A 4HT7A 4P2SA 3VGTA 2AJ2A 2Q1LA 3X1LB 4RU2A 1IN0A 1WNEA 1IM4A 1RT4B 4F4KA 4NLGA 2JLEA 4USKA 1S1WA 4ZPVR 2CQDA 2ZHAA 1S6UA 1ZAWA 3QO9B 2AYGA 3J7ZT 2IDEA 2MDAA 2X7IA 4DV3F 4C8LA 3W3SA 4IG3B 1XC9A 5KG3A 4OJ3A 3UR0A 1B64A 2ROEA 3MM9A 1MW7A 2DH8A 1KN6A 2W7AA 5C2CA 4ZVGA 5E33A 2DR9A 3I0SB 4DL0C 5GAHU 2DBBA 3KJQB 4X4UA 3W2VA 3KLIA 5CYMB 4JI8J 2K2PA 1R8BA 3A1YG 4YN3B 1KLMA 1WC0A 4WWSA 1Q8IA 2QLJB 4DF4A 2Z2YB 4BDPA 4I4BA 3KJFB 3M32A 1RHKB 3MAHA 4RWXA 5AXKA 4CO1A 2YNIB 4IOBA 4ZCMA 5DDPC 1L3SA 2WVFA 2ZHOA 4OMFG 2CJQA 1N36J 4LF9J 3DGVA 3CDAA 5ETKA 5KFRA 1MMDA 1IKYA 2RUGA 2VPWB 4YHHF 1KLNA 4JI7J 2F63A 1IBMJ 1DTTA 1UFKA 3FBEA 3SYZA 1F3FA 2A6MA 2BKNA 1UPMB 2QG9B 1YBUA 2GVZB 1B4SA 1GMWD 2KO1A 2OPRA 3NAHA 4PG7A 5KFZA 2HFZA 5BXIA 3G8TA 3B78A 1IBLJ 1VQ4S 1FXRA 2NPIA 3MPWA 4ECZA 1FRHA 4MKAA 3DRXA 2EG1A 4WYLA 1P1TA 2EXUA 1Q1KA 1TR0A 5IWAJ 3PVXA 3PRBA 3NGKA 4M5JA 1DTQA 2ZUGA 3K89A 2LXIA 4EFAC 2I5JA 2QN6B 1RYRA 2HHHJ 1B0VA 1S9EA 1FNMA 1TL7A 1V5VA 3D9BA 3I5AA 3PG9A 4CM2A 5DM7Q 4IQXA 2H5JB 1BWEA 1LXNA 1RABB 3AT1B 1U6ZA 3BBFA 3OR1A 3FMWA 1ZM3A 2B4OA 2QMWA 4P52A 3PW2A 3DU5A 3SSSA 2DGWA 3BN4A 1ACMB 2J6TA 5HK4A 3GCWP 5MAOA 4UTGA 3CCJS 2DGQA 3NMAA 3DM2A 1VR6A 1IWGA 4GKKJ 1HWIA 1T9TA 3ZZPA 4LRBA 2Y1IA 2HVDA 5SUHA 3W5YA 2DNQA 3OPKA 4ZJOA 1B7FA 3J7YU 4YP3A 4PUOB 1ZAXA 3DOKB 2FVRA 3K0JA 1ZA2B 5I42A 5L1IA 2G0IA 4F04B 4JI3F 2Y8YA 3BGFA 5CYQB 2ZM6J 2UXBF 1WF2A 2V2ZA 4KFBA 1RSCA 2MGZB 1D9DA 1WC5A 1C0UB 3CCMS 2GVDA 2ADBA 2VZ9A 2ABYA 1U1MA 1YZ7A 1F3VA 2MSSA 3ILIA 1HNVB 1FK9B 1N0VC 1Y3JA 2H1YA 3GJTB 1RYSA 4J9RA 2EFOA 5I3PA 5B08A 1FF2A 4G1QB 2OSRA 3W64A 4LMZA 2QLWA 1UKUA 3B6BA 1U1NA 2QX0A 4TLQA 1HARA 3IBFB 4LIRA 2HGNA 5LSLA 4CT8A 3P5BP 1VOMA 4RKUC 3GLJA 2HGMA 2P6SA 3JTOA 3Q89A 3DHXA 4I56A 4Y2KA 2VHGA 4WZMA 4DL5A 4C98A 2XGQA 4ATNA 1NCLA 3NGSA 2F7VA 3VQSA 2R7RA 3KTQA 4B9LA 1LWCA 4YQWA 2LXUA 4WXWA 3QT7A 4P2FA 4TU8A 1K0VA 2J5AA 3D4JA 4RWWA 3NS6A 3IRXA 2IRXA 1QE1A 5IZHA 1T9WA 4ZCKA 4F26A 2RQ4A 4UF4A 1GXUA 1VRUA 1OO0B 2CQ4A 1D9AA 3BH7B 4ZPBA 2E9ZA 3VVUA 4QYRA 5JVGQ 1F6TA 4USUA 2XO7A 3H5UA 1HR0J 2W01A 5A8WB 3EDQB 4KGMA 5E3PA 5LJ5Y 1MLAA 4JV1A 2O1PA 4F7VA 4DV5F 4HACB 5KFMA 2YKOA 3MXHP 4YMEA 1JQGA 5KG5A 2YWGA 3ADAC 1NSPA 3QJPA 4TVAB 5IFMA 1LWXA 3MURP 2QA4G 1NEEA 2IVMA 1N5VA 5J1NA 1RT1B 4A4JA 1HQEA 1SC1B 1SJRA 2ZBRA 3TUZC 5T14A 2CQBA 4HI1A 2UXDF 1TUVA 1BWVA 4GMKA 1NUEA 4G1IA 1U02A 2GA7A 4A48A 5JXSA 4MYTA 2WVEA 1RT3B 3A3OB 5HROB 3T1YF 1TMJA 1WELA 4GO5X 1WTFA 4Q0BB 2UZAA 5KTQA 1HWJA 3D7SB 2Q3PA 3QRRA 4P72A 3UNYA 4RW9B 3QIPA 3OJSA 3KLFA 2MKJA 1NXIA 2MKHA 1LEOA 2Q66A 2RDJA 2M7SA 2IM0A 2QFIA 3J81Y 2CNOB 4NX9A 2VG6A 3L7PA 5D0GA 5AE2A 1M90T 2WBMA 2RQCA 2QYGA 1RACB 2NCKL 2LECA 3OTBA 1MU2A 3DRYA 2FVSA 1JB0C 4C7QA 3BYPA 1HNXJ 2K3IA 2HFVA 2J7UA 3M6WA 2R3VA 3EX7B 4K2XA 2R7UA 2JX2A 4WU2A 2EBEA 2YQ1A 3DXBA 4RW8A 1AYEA 1M5HA 2YNIA 2QE5A 4FKXA 3TEHB 2CA9A 4DR5J 3HPOA 4ZCLA 1U25A 2JJ4D 4FXVA 4ZHRA 1IKYB 1R6VA 1GXLA 4AE5A 1JLAB 4H4MB 4P7TA 2UXCJ 4IRKA 4CO2A 1PKUA 4KHPJ 1BE4A 1RHUB 2RVJA 2MKYA 2J7WA 4UT4A 2NZ4A 4K0KF 1WG5A 3B4DA 1RAFB 3JQJA 2A2CA 2CQCA 3HK2A 3KUHA 1KFSA 2V9WA 4Z7YA 4P2XA 4MIBA 2PN6A 3K2YA 2H51B 4MT1A 4NXMJ 3UCUP 2MZSA 4KGXB 1APSA 3O3LA 3MEEA 2PI4A 4BHQA 4J37A 2W9CB 3H0PA 2WB4A 5G0RA 2CPEA 3DYAB 4ES3A 4F2SA 2F4VF 4WE1A 1D0EA 4FF4A 2HG4A 2BKOA 2VOOA 4DJBA 4ERDA 4IFVA 5CYJA 1TKZB 1V3SA 3NGTA 2N4CA 4OFZA 4TNOA 4B17A 3I6PA 5G4DA 3KK2B 1HNIB 1E6YB 4FS1A 3FSXA 3PTWA 5HL7Q 2MTLA 2NSBA 3TJ9A 1MWQA 2Y0SD 2KJWA 3N0VA 5J2MB 4DV0F 2HWHA 5F8MA 1QSYA 2I6WA 3UW1A 4ZN3A 1GAOA 2GAGC 1RWPB 2GS8A 4WFZA 2VJVA 4MAKA 2HKEA 1GNKA 4F36A 1WHWA 3Q8RB 5ADZA 3C2PA 2XY5A 3CB4A 1RU2A 2HHSA 2P8IA 4P74A 2RRAA 1QM9A 2WRMA 4OX8A 3W62A 5BYRA 2Y3YA 4JB8B 1S48A 4NMLA 4TQSA 1JX4A 4OZNA 1GT8A 2XNRA 1WDDA 3MFIA 5E5NA 4C0OC 2Y1LB 1FCAA 1PYSB 1R27B 3C19A 3KUEA 5ETQA 1KQKA 3SDEB 1OY6A 2ACYA 1SPBP 4ZPAA 5KT4A 1T05B 3UDLA 3M9MB 1DY3A 4PABA 3OW2R 3NP5A 4TKTA 1CJTB 2CPJA 3UNGC 3GV5B 4DV2F 3T1HJ 4DU7A 2B51A 4QWBA 2HIQA 2HMIB 1NDPA 1WOOA 3BR8A 1U24A 3T9ZA 1HBNB 1YJVA 2DHHA 3V6DA 2C2EA 3WIVA 3THVA 4C8NA 3HHLB 3BV8A 1NSKL 3SSQA 5K8PA 2DR6A 4K4YA 1RU1A 3BKUA 1N0UA 5KFIA 2UXDJ 2APOA 2BE2B 2R7WA 4YDDB 4M5GA 3LOUA 3T9NA 4A46A 1W7WA 4AL6A 1EP4B 2GW8A 2RIJA 1EAYC 4HVZA 2KHDA 2XEXA 4NLWA 4X4QA 4J9OA 4OI2A 1U6BA 1RCXB 2XMAA 3RBZA 1KLMB 1FDDA 2CXEA 2FC9A 2L9NA 1I3OB 5KG1A 4LJMA 2EKYA 4LFAF 1KOHA 2W4CA 3M8QA 1U8WA 5AXLA 4JI7F 2PFFB 4LSLB 2HSEB 2V4JA 1CULB 1D8ZA 2XNQA 2RB7A 4P6QA 3SCJE 5CCLA 3M1VA 2PEBA 3CCSS 4FS2A 5GAHI 5FLXY 2BQUA 1TKDA 4DR4J 3ZXWA 4EO6A 3H4DA 1SV5A 2RNEA 1IBLF 3TA0A 1BHNA 3ELHA 1FRJA 4F0KA 5DQGA 2GJFA 1TKTA 5DZ6A 2YTCA 1CVJA 1DLOA 4NRUA 2D3OR 4K0KJ 2MQMA 2MLXA 4AXIA 3SCLE 5C5JA 3GIMA 3OTOJ 3G6YA 2DNYA 4KT0C 2KT5A 4YB6A 1DZ5A 1IBMF 3E2EA 5KG6A 1NPKA 2Q6BA 2G9OA 2QA4S 3A8JA 1N34J 2AHOB 5JMNA 1OY8A 2DKOB 4FPRA 2KRBA 1SIWB 3I0RB 3FUYA 2C3YA 3R1LA 1XNQJ 3M8PB 1C2PA 4LRCA 1TKXB 4L76A 1FXDA 2FZCB 4OYPA 3ZTOA 3DOMB 2ZZTA 3O8WA 4DF8A 4BLGA 3IR6B 3CJ0A 2PFDA 3J80Y 4ZP8A 4K4SA 2RQKA 4DR6F 3TZYA 5J2PB 1C0UA 1OMSA 1EIYB 1U2FA 5D4OA 2FGCA 2IPOB 4K5RA 4BBYA 2OPQB 7FD1A 1RLDA 3DM2B 1YJNS 2BOPA 4C8KA 1GK8A 3R5BA 3CCZA 5IC6B 2V4QA 3BBCA 1E6VB 5HMZA 3H5SA 4OZ1A 2KRRA 4K8RA 2QL9B 2WVCA 3LAKA 4RNFA 5HSPA 3G4SS 4HH1A 2FZGB 2IYGA 3OV7A 3PRDA 1U45A 2B8PA 2DR5A 3M4XA 4NI2B 3J7YI 1CJUB 2DEIA 2DTJA 3W8PA 4DLGA 3AODA 2R8GA 5SZTA 3PXGa 1S1VB 3ZZZA 3M2RA 1RBAA 3JQMA 4MJKA 5AT1B 1M5PC 2PMZD 5GADU 4JOUA 4Y0FA 1B0PA 2KG1A 1QVGR 4DSKA 4ELVA 2DD8S 1VQ6S 3TANA 3M6UA 3D6FB 1CULA 4MTPA 3UCZP 4ED4A 2UUBJ 1QLNA 5D78A 1PYOB 4X64J 1TK0A 3J81U 2DHGA 1FD8A 1WC4A 2M3DA 2QSFA 2WK4A 4CTAA 3MUTP 2HHHF 1YVFA 2CPZA 4QJVA 4ELTA 2XMVA 3EDRB 1HBUA 4OZ5A 1YBTA 3R6GB 2GIQA 2V2QA 4PRFA 4QCLA 4LSZB 4J9VA 5GMKa 4NRTA 3QZ7A 2XQCA 4DR2F 2PE8A 3NBPA 4HACA 4I68A 2BEFA 1Y5LB 3CUNA 1UVJA 1PAUB 4B3RJ 3NXZA 3MM8B 1UETA 3TAPA 3KG1A 2XS2A 5KFTA 1OPIA 4X65F 3G6XA 5KT5A 2HAIA 2F9JA 1S9EB 2K06A 2ZOFA 3ZNUA 2WZ1A 2KG0A 4YOEA 2M8HA 3KK2A 1IVZA 1VC0A 1DTQB 5B0BA 3CNQP 1Q53A 4YY3F 3QSIA 3BR9A 4N56A 1NKEA 4F2RA 1Q8BA 2Q6CA 1RAIB 3FCVA 3T5JA 2UUBF 1H7WA 5BJRA 2BX6A 1FRXA 3R6LB 2IYIA 3HKZD 3DGPA 3RB6A 4NPOA 3RAMA 3T5HA 3KHHA 2HVIA 1N5YB 4YB1P 3TAMA 3ZO7A 3CCTA 4LF5F 3BGRA 5I4MA 1NJXA 2HZAA 4RBUA 5IT9Y 3VGUA 2HK3A 2VPZB 4PXDA 4WP8A 4Y2AA 4HKQA 2D3O1 3C15B 3VHQA 2LQBA 2WONB 3HI9A 1FJEB 1XR7A 3TUIC 2CPDA 4KY3A 3KHGA 2XMWA 4XDDA 2ZOGA 1Z2ZA 4I2QA 4NZ7A 4NLVA 1FRLA 4ANEA 3V4IB 1J5EF 4LFBF 2NXUA 2VA3A 5KFOA 3LF0A 2VQFJ 1UA0A 4KC5A 1N5QA 3ENWA 2B56A 1YTYA 3AQPA 3PYEA 4ZPWR 4NLSA 4NEYA 2YWFA 4X4PA 2DITA 5K14A 2FLNA 3MMBA 2GC8A 1H74A 2DXEA 2QGFB 2RDIA 4R5PA 3IS9A 2R8IA 3AOBA 2L48A 2Z2ZA 1QUVA 3MM9B 2PGCA 3N5BA 3VAMA 2VBZA 4NCAA 4KIAA 1XNQF 3BS9A 1TFWA 4YR3A 3DDNA 5AXMA 4F0MA 3LPEA 5T7LB 1K73T 2ASJA 1S76D 4DR3F 5KFSA 3ZZTA 3C46A 1HD1A 2YPYA 3MCOA 5L8RC 5EUHA 4BWMA 1WI8A 3JSRA 1SJFA 1GX6A 5CZVA 1IBKJ 2DRAA 1ZS6A 3CJKB 4E8UA 2RJZA 3LP1A 1FFGB 2N82B 3VZIA 2PT0A 4CLTA 2H65B 3HVRA 1ZBTA 3D1HA 1U49A 1JLAA 2WBRA 4H4MA 2H9ZA 4QWAA 4DR2J 2LEBA 2LQ9A 2AWZA 4RPFA 3RU0A 4DHVA 3W65A 4OHXA 3UD4P 1T94A 4CTAB 5E41A 3ET6A 1FE0A 3GJSB 2CJYB 1S77D 3WIUA 3MUVP 1QSLA 1UVIA 3RW6A 2B8QA 1IBCB 5D15A 3EZ5A 2EFGA 2NREA 4EZ6A 2K3KA 3JSMA 1ZH5A 4OHZA 2HQGA 5B0GA 3BSNA 3OL9A 2BRLA 1U1OA 1DBDA 2HQIA 3FZ2A 1JXEA 2BDPA 4JBCA 2H5EA 4CO5A 2ZJRQ 3V81B 3MCSA 4LR9A 5F3TA 4DV6F 1X5SA 4C4WA 2HRTA 1A6LA 1SH2A 1GMWA 5HATA 2XYGB 5T41A 1FO1A 5FJ4A 4TY8A 2XBPA 4GC7A 1RADB 2H48B 3D6MB 4CQ1A 4DSFA 4Q0BA 1AUDA 3GR0A 4ZVEA 3QWUA 1F60B 4X66F 4WFNQ 3GIJA 4B9TA 2FJDB 1HNWF 1S5ZA 4Y34A 4KV8B 2IVYA 4FYVB 4O4RA 4XTTA 1F5AA 3DLGB 4RW4A 1X7VA 2JDJA 4AFFA 2V2KA 4OHWA 3EE3A 2RKIB 2VFUA 3C15A 4ZPTR 3CCWA 3MCMA 4Y65A 1SQGA 1OY9A 3DRSB 3ONQA 5B0CA 1SVDA 1VJWA 3ISNC 4Q44A 3EGVA 3QGHA 2KZZA 1TVRA 2E7WA 3M2VB 1UFLA 4OL8A 1JKHB 3G87A 2CZVC 1UVLA 2CWXA 3R97A 1FRKA 1HWUA 3V5RA 2HYIB 1G6BA 1S1XB 1RWXB 4ANDA 3KHLA 2AQ4A 4JI2J 2R42A 4WZQA 2RQMA 2LA4A 2B9WA 3C16A 1S1XA 2B7CB 3R3TA 2I38A 2XGPA 5L1KA 4UUWA 2MZQA 4CCHA 3R5JB 3OL8A 1SKWA 1EP4A 1O51A 1LV5A 3TO8A 1RUSA 2X1FA 1RWKB 5DDQC 2XCAA 2KFZA 1TL3A 4ITSA 2KL8A 2G0CA 4K2JA 3UVJA 3TZZA 2D74B 4I2PB 3PEHA 3BO2A 3W2WA 1H2VZ 4O0NA 1AB8A 1RWUA 1PJ7A 4XAKA 4J9NA 2LA6A 5L46A 1U4BA 1V5IB 3MEKA 3N6LA 4DPWA 4FZVA 1S6QA 1DJ0A 2O01C 4W4MA 3MR2A 4V19J 4NZ0A 4X4NA 4IUFA 1BQNA 1UMJA 3CIZA 2HWTA 1FERA 2E1PA 2YQ3A 5M2RA 3UWTA 1TQLA 3Q83A 4NLQA 2EEYA 2W2MP 3RR7A 5A2QY 4FVCA 3NS5A 3OFHA 2GX8A 3MPVA 2DGXA 3LQVA 3W5XA 4F3QA 4BC7A 1YKWA 1L3VA 4DWIA 2OEMA 2QFJA 2YKNB 4JI5J 1UWBB 2ZOMA 3HZGA 5EWFA 4KO0B 2E5IA 4USHA 3VQTA 1QTMA 4DSIA 4ZVRB 3N6MA 3QFHA 2OP5A 4DUYJ 1QTNB 4H4OB 4MH8A 2DK2A 3D0IE 1B0TA 3PHTA 4CP5A 4D3GA 4F4AA 3VGVA 1IR0A 1RT3A 3W9HA 1UPPA 3AD8C 4EO8A 5I3UB 3TI0A 2G4BA 2E5GA 3IM8A 1HBNA 1LW2A 5DO2A 1JLBB 3Q24A 3R2CJ 5C42A 1RWWB 1IKVA 1Y5NB 2B6AA 2OEJA 2CQIA 3IS9B 5HVFA 2OHDA 4LSNA 1L5UA 3BGLA 1XJWB 2FTRA 2LU2A 4U9RA 1VHFA 3U27A 4PG6A 2RS8A 5ETMA 5L9NA 1LWEA 4I64A 1L3TA 2W2NP 3I9V9 3PR4A 1RHJB 4NXNF 4DX5A 3PW5A 4BS2A 1QY7A 4NLTA 1RE1B 3BN7A 2CPFA 4EEYA 8RUCA 1VMBA 2UV8A 4KB7A 1RT7B 1WACA 3M6VA 1T0TV 3IP0A 1CPZA 2V8VA 2CIMA 3UDVA 1NK6A 2MQOA 4LREA 4DV5J 3M8RA 3OFFA 4LF1A 2W8KA 1T3OA 4KYZA 1K1SA 1NH7A 1MWYA 4PXCA 4ZHRB 3D3CJ 3GFXA 4KPCA 1Y11A 4A8WA 4H4KA 2QEXS 5IQ6A 4DSLA 3EGNA 4ED1A 3KHRA 3NGDA 4OZ0A 4DU8A 1PGZA 3H59A 1UEUA 2J7KA 3BQ1A 4USVA 2XHWA 1T9XA 2JL9A 5LXYA 4IRCA 8ATCB 2ZH3A 2KJVA 4UY8T 1CS4A 1RA7A 2JOQA 5LM7E 2NQPA 2ILYA 2P9CA 1RLCL 3TUPA 2HW3A 2AGPA 2IJNA 3QAEA 2W24A 1RT2B 1WORA 2E1MC 2DGSA 2GQ2A 4ZVOB 3MMAB 2IBOA 2EG2A 3QIDA 3SV4A 2QL5B 2VL1A 5AXNA 1R0BG 1X4AA 3HF5A 1ZAVA 3OBIA 2VBXA 1S59A 1JLEB 1N56A 3PRVA 2CJKA 2FVCA 2QMUB 1XQIA 2YY3A 1H72C 1Y5IB 2VF3A 3W5ZA 3HMJG 4QIWD 5I3UA 1BQNB 2FZKB 2OTJS 3ILJA 2AP6A 1WC6A 2J9EA 1GH8A 2K1RA 1VHIA 2L3MA 2UUCJ 1NPPA 3LGNA 1NHUA 1SC6A 2BM0A 5KFJA 4S0MA 1KHWA 3OFGA 3SDEA 1FDAA 4O3PA 1T9VA 1DAXA 3M30A 2RU3A 1U48A 2DT9A 1NZAA 1NHKL 2M4MA 1UEVA 1X4DA 3BO3A 4RBVA 1YRXA 3C14B 5J1PA 5D6GA 5LOQA 4ES1A 1XMOF 1U2CA 2ZNYA 2C2ZB 2O5DA 3K7RA 3TARA 3QJLA 3W63A 4U7UK 1HA1A 5HP1B 4ECUA 3M2RB 2AX0A 4LF4F 2QZ8A 3MECA 1X5PA 5HLFB 2XB2D 3HSJA 2V2VA 3EVOA 3NCPA 2UUWA 1R89A 1I5OB 4USIA 2PI5A 3ZTSA 2BRKA 2DIVA 1WD6A 4I2PA 4B9NA 4OX9F 5KT2A 4NCGA 3WC2A 4MKVA 1YI2S 3R5DA 3I87A 1UCNA 3LA0A 2A2DA 5A8KA 5B09A 2NUUG 3L95X 2C28A 2VASA 4A8KA 1GX5A 4JI3J 4FF1A 3K5PA 3OR2A 1RDRA 4HEA9 4WXOA 1RWOB 3DCAA 1OYEA 4ZVHA 1KQFB 4CM0A 3K58A 1ZOTA 2MXYA 4F02A 5H1SV 4O23A 3OT9A 1SJQA 1WC3A 3U7JA 3ILOA 1U6FA 1L3UA 3QJJA 2X1AA 4OX6A 1S7IA 3M1VB 4V1Ak 1VDHA 4OV1A 5F8LA 1RWMB 4NL5A 4Y3CA 5KFVA 3VGSA 3CE8A 1RAHB 3DLKA 3FZBA 4QW8A 4JI4J 4ZDNA 1Q78A 2JZ5A 2XS5A 1LNQA 1FRIA 2FLOA 4ZPDA 1V3ZA 2ZDPA 3GFYA 3MTKA 6AT1B 2UUAF 3PHEA 4FPIA 4OYBA 1FFSB 4DCOB 2WONA 3THTA 3V81A 2UP1A 2P9GA 4I7FB 5HJXA 5K9FA 4I67A 3CMQA 4UW2A 3P96A 2KI2A 2RAQA 3WZ0A 4PAAA 3KXDA 1O0PA 4DG1B 4RNNA 4PUOA 4C8ZA 1UAWA 5DRKA 4UZCA 1RTHB 2YKMA 2DNLA 5I42B 3G96A 3QATA 4U67Q 4ZPCA 1VK8A 1LWFB 1RTJB 3GP9A 2HPUA 3CJSA 3CGIA 3TJAA 3H5YA 2MYFA 3WX4A 2LEAA 5HQMA 2VB6A 2LYVA 2HLUA 3BKTA 3KLGB 3KLFB 3L7OA 2HVHA 5KFLA 4OV6A 3G71S 3SCKE 2KFNA 1OIAA 2OTLS 4XDCA 2CQ3A 1JLBA 2BJ3A 4YB5A 4QWDA 2C3MA 2QT7A 3SIPB 3KYLA 4Q2MA 2BE2A 1OWXA 4BWJA 2N3OA 1WI6A 3LW5C 1XMBA 4ID5A 3CCQS 2O67A 5FLXU 2GHVC 4ZVQB 2MHEA 2MZ1A 3PZPA 1NBEB 2I0XA 2BANB 4X65J 1SH0A 2D1CA 2J8AA 1R6YA 3MWBA 3GSDA 1HNZF 5E2QA 2DNPA 1D9FA 4F4XA 4ZVSB 5IWAF 1C1CA 2YNGA 4NZ6A 4YEAA 4LBHA 4M5DA 2JLGA 1CC8A 4ZN1A 1H7XA 2ZC4A 3W2VB 4M5DB 4QZVB 4ED7A 3O5TB 2R2UA 2BQRA 4NWBA 1PC5A 4CO4A 2YWEA 2RRBA 5DLGA 3SBMA 4ZLNA 3TA2A 5EN1A 3I4PA 3CSKA 1GEHA 1Z2LA 2V5HG 4RNHA 3KDOA 4DPUA 4DR3J 4MK7A 3NNHA 3OVAA 4ZCIA 4ZLPA 5HI7A 1ZA1B 3NY0A 1YRUA 2U2FA 3OXFA 1FVQA 4G6VB 3TOQA 3T5LA 3RRGA 2IC3B 4DR7J 2ASDA 4KSEB 4PZVA 1B99A 2Q43A 3LP2A 3LUYA 4DBQA 1S1UA 2ZZNA 1FHTA 1CJVB 1TV6B 2DNNA 4EU0A 1S6QB 1XN9A 4OYOA 4R8UB 1M5OC 4B3SF 2ZE2B 5J2MA 1PYTA 4PPZA 4B02A 4LF6J 1KRPA 2RF2A 1B70B 2WW4A 4PEOA 1LWFA 1RTJA 2U1AA 1NK4A 2BACA 2XY7A 2V63A 3PKMA 4YS2A 1UJ4A 4WCEQ 1SUQB 3QZ8A 2Q79A 2ASLA 2EWHA 1U0HA 4ZKAA 3J7A1 2BE7D 2C2MB 1LFWA 1SUQA 3AJDA 4O3QA 5C42B 3EPIA 2AYBA 4OHYA 3SEOA 2ATCB 2Y1JA 2F40A 2KT3A 1R7IA 1S99A 2J76E 3NGRA 1NM2A 1AZSB 3MAQA 3G2XA 1TVRB 1VQ5S 3BGUA 1W2IA 2V67A 4H4OA 4P9SA 2YXLA 2XCPA 2MKIA 1N33F 2JSXA 4KO0A 2KXNB 2NS1B 4CNYA 2WW8A 4DL4A 4B3TF 3DRPB 3KOAA 1H73A 1T7PA 2CFXA 5HBMA 2JHEA 1FWPA 1PIEA 2B6AB 1U47A 2VDIA 2XULA 1S0NA 1G2EA 1WF1A 5HQ8A 1LW2B 3G6ES 1A0OB 1RA6A 4NCGB 1I6JA 3FEZA 2BR0A 2Z56B 3G8SA 4F50A 2ERRA 2R7XA 1S1TB 2ZVSA 2EBGA 1V3RA 1S4FA 2GMHA 5D3GB 3V6KA 3NLCA 3ZTRA 2ROGA 4NLYA 2XHCA 4AQYJ 2CPHA 3LPYA 4YY3J 1YJRA 1DRZA 1VCTA 2PIIA 3O44A 2D3UA 2CQPA 4N7TA 4Q5VA 2JC1A 3F44A 3KLHB 2P6TA 4QQBA 1XNRF 2RRNA 1P1LA 5J1EB 3AA8A 1SI9A 1TUWA 3LP0A 4M5HA 3UVJB 3AHPA 1AXQA 1KSPA 1RISA 5K8OA 3HFVA 3FQLA 1X4GA 5DQIA 2ADCA 1LOUA 1YJTA 9ATCB 4DSEA 2LU1A 4ECWA 4X64F 1YWXA 4Q2LA 3EGZA 1BLUA 2RD5C 2B4PA 3JB9k 4JV2A 4F4YA 4QU7A 5U47A 1WKKA 2MLZA 3BJYA 4CDIA 1DQ9A 2GIRA 1YJWS 2QL7B 2ROPA 2SXLA 2J9DA 3FEXB 3S8SA 4DL2A 3BM7A 1S97A 1LKZA 3CW2C 2EFPA 3OLAA 1VYAA 1Y9OA 1FTCA 2KKHA 2VG7A 4EUVA 3Q8QB 3GV7B 5LMUF 3VAIA 1RT6A 1RTHA 4ECSA 1PC4A 2V0NA 4Q8EA 2EK1A 1JJ4A 3MR6A 3S7RA 4DG1A 1UVKA 4FP9A 1FT8A 1P9QC 2W7PA 2YH1A 3MPYA 4O4GA 2BM1A 1H98A 4K5SA 4WPAA 3WBZA 2BJ7A 3FJ2A 4QW9A 1NJYA 1VQ7S 2Z0GA 3ZZYA 2VJUA 1TFYA 2P5VA 3M8PA 2CVIA 4NOHA 3G86A 2IDLA 5HMWA 1FK9A 2YKMB 4UQGA 3ZFVA 5J2PA 1U1RA 4L73A 4WBFA 2K1RB 4TU9A 2IA6A 3CD6S 2GVDB 1QJHA 2AGQA 2ZH9A 3PNIA 4AL5A 3MMCA 5KFWA 1XK8A 1HYSB 4R25A 2V94A 3IGNA 1SQEA 3E01A 3ISZA 1WF0A 3LH2S 1PG5B 1GXTA 2B7BB 2BBEA 3UE2A 4K4WA 2BXJA 3RRHA 2RSQA 1I51B 2MY7A 2LKZA 4ZVPB 3SQGA 3W8GA 4OI1A 4OJ1A 2GIFA 2VDHA 3GYXB 5RUBA 3HM9A 3PX4A 5IV4A 1SJ4P 4PWUA 4PR6A 3DMJB 1T11A 2OD6A 5HANA 5D4NA 4ILLA 2V4JB 2C2DA 2HHXA 3C14A 3C6TB 4ZS6A 3GU0A 2IRUA 3TR5A 2CQ0A 3EYZA 1JWWA 3MECB 3OXGA 1JLCB 2L08A 3RW7A 1RAOA 2F8MA 1YDLA 3OTDA 4MMOA 1D3WA 3US5A 4ZK7M 4OX9J 2UU9J 3PX0A 2OGUA 2MQPA 4DXLA 4RZRA 4O0IA 1FFWB 3MUMP 1XERA 2DH7A 2YH0A 4O3SA 1SKUB 3H25A 1W25A 4DQPA 4P75A 5GAGI 3I31A 1YJ9S 4LF4J 2F8HA 2KT2A 4HHHA 2CUYA 1MROA 1UEKA 3HJVA 1HNZJ 2CQ2A 2VBYA 2UXCF 2QO3A 3M8SA 1UW4A 2C1EB 1Y0HA 2CRLA 2GVZA 1RT5A 3IR7B 3GSIA 2HQDA 2CDRB 4QIEA 5DJBA 5FD1A 1NK8A 1GTHA 3LP0B 4OI3A 3ZTPA 1TTHB 2ZWOA 4A8XA 3R7BB 3U1LA 3PKYA 2JEIA 2A1BA 2GO8A 2P2CB 5DG8A 2ZITA 5KFKA 1IKWA 1SCJB 2XZDB 4I69A 1WOPA 1S10A 4ZVUB 1DQ8A 2YKAA 3R5CA 2XMJA 3QIPB 3FSIA 1KONA 5CD4H 3CF5Q 3CIMA 5DG7A 2ALZA 1J5OA 2J0XA 1JLEA 4RO0A 2JEGA 3MMJA 3Q0AA 4FNIA 2DH9A 3OR1B 3PYDA 4I6YA 1NNDA 1QAXA 2AEFA 2MZRA 5A76A 2X1GA 3P3DA 5DDRC 1VQNS 2B43A 4IKAA 4YUDA 3RAQA 2D7SA 5F8NA 3A12A 5BR8J 2E9RX 2QLXA 4C8OA 1CJTA 1F5BA 2A18A 2COLA 3CD5A 4DV2J 3ICLA 3M8YA 3PEJA 4MK9A 1UWBA 3MD3A 1GTEA 4D3HA 4X4TA 2LEPA 4NLRA 2KM8C 1UZDA 3RB0A 1UW9A 2BANA 5E7OB 3T19A 2D9PA 5DQHA 4HDGA 3OTOF 2DPIA 5H9FJ 3RB4A 3TW0A 1KNZA 1RTIB 4I2QB 3LWMA 2E9TA 4QYZJ 1M1KT 1HHTP 2UUAJ 3ZC4A 2ZC3A 4OIXA 5CHCB 4DEZA 4DR4F 2RU9A 3U1MA 4N47A 3D54A 4QIVA 2CQGA 4WIQA 1RTZA 1Q8KA 3PIPQ 1XMQF 2VICA 5KFXA 4C97A 1SKSA 1I1GA 3MM7A 3ZZ0A 1EJ7L 3M05A 1FNOA 3THPA 1VC5A 1WKLA 2VUGA 2LXFA 3H98A 3MEEB 5THWA 5IS2A 5KFDA 4DV7F 5D4PA 2E5JA 5ETVA 2FD2A 2DNKA 2B3TB 4ICLB 1TKZA 2CADA 3F56A 2H5IB 3D0HE 3I5CA 2DJWA 1RAAB 2HS3A 2R8KA 2MHNA 4RW6A 3A8EA 2ZHBA 2XSJA 1SL1A 2IAJB 5F9LA 2ZZMA 3MFHA 2W2OP 1FJGF 2RF2B 4P10A 2A3JA 3NOCA 2VFRA 2DY1A 3GFHA 3BO4A 2ALYB 4PG8A 2E1CA 2OPSB 3LGHA 3JAMU 1N5YA 4NLDA 2W2QP 3JTNA 3GILA 2OUGA 1HI1A 2XI3A 2OLWA 2XLJA 3ITHA 2HQCA 1OJ4A 1TP7A 1S0VA 1G1XA 3FNNA 1X4FA 3D3BJ 1HQ2A 3DLBA 3NEKA 4J7CA 4P73A 1TL1A 4E98A 2LFVA 2CWKA 2VPXB 5IV3A 2VIHA 4NE9C 3TQ1A 5KFCA 5HROA 2FJAB 3OTCA 1ZYQA 5KG4A 3ZTQA 3HJFA 4WYWA 3QLHB 3A8KA 3I32A 4K4TA 2CVEA 3QLHA 2BUNA 2WVDA 2RH3A 2OH2A 2GQCA 3A3NB 3AXKA 3BF4A 1SH3A 3N6NA 2DEJA 4DX6A 2HBRB 2NR0A 2YWKA 3G82B 4LFCJ 3UN3A 1YZ6A 3H4BA 2RMLA 3Q2SC 2ZVIA 3D2WA 3IGVA 2HFOA 4WJBA 2I9SA 5HAOA 4ES2A 5HMXA 5CAAA 4ZMMA 4RNOA 3C6TA 3R7SB 3CCLS 1U1QA 2VODA 2FVQA 3M30B 1LK5A 1OPZA 2V68A 3T3FA 3CJKA 1RHMB 2J6UA 1C4CA 2HNYB 2AEJA 2OO4A 5K20B 4MYUA 3DU6A 1S72S 2L9WA 2F4VJ 1LW0A 1FKOA 4ZJQA 5GVQA 4F0HA 4YFUA 1U1PA 4FN5A 1S57A 2GFFA 5K5MA 5HBMB 4QWEA 1FJ7A 2W9AA 1QE1B 2KN4A 3BH6B 2HVEA 1FJGJ 2ZH8A 1WUUA 4FYYB 1H3DA 1KS2A 2IAJA 5DDOC 3R27A 5CQGA 4X4SA 1BQXA 2MKCA 1N33J 3PFOA 1HMVB 3R5GA 3U1NA 1CS4B 2DXFA 2EVZA 3DOLB 3FRZA 5D3GA 4OX7A 3J80U 1QAIA 1KBRA 1VRTA 1JIHA 2B9EA 2IJFA 3P8BB 5EX0A 5LJ3Y 2VOPA 1CSJA 1PJ5A 2G1DA 3PJWA 3H20A 4N5SA 3I56S 1XMQJ 2LVWA 1AT1B 5B0FA 1NB7A 3RRKA 3M8WA 3JTPA 1EETB 3DOMA 4WE1B 3UD3P 2DISA 3EZUA 4NXNJ 4C11A 2FHMA 3DHWC 3LWLA 2BJEA 2HHWA 1R8AA 1M5VC 3MEGA 4XO0A 2HNZA 1S0MA 3T41A 3E8OA 3H2LA 5EWEA 1QD1A 1S6OA 1K9MT 2QC3A 1HI8A 4UOCA 4B3TJ 5C24B 2EFVA 1YGYA 4QPTA 3TQEA 2ZM6F 2VG7B 2J0SD 1FX2A 2KYXA 1V9OA 4HR2A 1OQ6A 1P8GA 1YLXA 3NL0A 2QLBB 2C42A 1TMMA 3RYLA 4ELUA 4LRDA 2WAQD 5C25A 3K5LA 2ZD1A 4CO3A 1K0TA 2BKPA 2NUHA 2DYAA 2XWYA 3NGUA 4RJVA 3HHNB 1NK9A 3WX8A 2XI2A 2AF6A 2YQ0A 3W66A 3NNCA 5LMNF 4GVLA 4Q7AA 3HZEA 3BYRA 1ZM9A 1T3NA 3N4WA 4A8YA 2WSFC 2PO4A 4HLBA 1FD2A 2F4FA 1U1LA 1Q81T 4F8RA 3FFIA 4DPYA 4M95A 4B9VA 2H3EB 1JLQA 3A4TA 4Z7CA 1G4CA 2QIFA 1HBMA 5DG9A 1DFDA 1NH8A 1KQGB 1WG1A 2MZTA 4M5NA 4WK1A 5HP1A 2DR8A 4P7VA 1UP1A 2IBKA 4IFYB 4NA3A 4ECTA 2N4DA 4IOCQ 4LSNB 2YX1A 2Z8QA 3D5MA 3QT6A 4ED6A 4Y2CA 1SL2A 5E3QA 4JV0A 3PY8A 5EX3A 3P49B 4DS5A 3IAM9 4YB7A 1WHXA 1YJUA 3MEDA 3SV3A 3AQOA 3SQOP 3NOGA 1NK5A 1KC8T 1M5KC 4M5MA 4JYAF 4CIOA 1ZPVA 4WP3A 2XSJB 3SSRA 1SC4B 3BPSP 3GYGA 3IWXA 3FQKA 4CYUA 2YKPA 3MGJA 3MM5B 3LALA 4CLUA 3ZZUA 4WKYA 3WQPA 2M9KA 1N48A 1ZETA 1L3KA 4GKJF 4EBDA 3RZAA 3CJ8A 3ZZRA 4NEZA 1XNRJ 4RU9A 3QGIA 2V8GA 5J2NB 4ED5A 4KAIA 4DX8H 4OZ3A 2OPSA 2NSCA 3NRBA 4KH1B 4OLPA 4TXSA 5FIIA 3HHKA 4JI2F 4GVBA 6FD1A 3MM6A 3TA1A 1J5OB 2OD4A 1H6KX 4Z37A 1VK3A 5K8MA 1T95A 4YHHJ 3NMRA 5ETOA 4Q45A 5H9EJ 4CLYA 4PYDA 3FBCA 2R2TA 3D28A 1YJ7A 1R43A 3OHBA 3BQ0A 3VALA 4KPYA 4Q8FA 2ZD1B 1EZZB 3BGRB 3CPWR 1VJQA 3MAAB 1RTDA 1R3NA 2HBYB 3AOAA 1JJ2R 1YRTA 4UOFA 1X0PA 2MJUA 4OHVA 4C3LA 4DPXA 4DZ6A 4DR1J 2RHQB 3MI7X 4C8MA 4IDKB 3BSOA 4C11B 2VH7A 1IKXA 4KHRA 2H54B 1JNZB 4R8UA 1N6QB 2IM2A 1BUXA 4R0EA 3OSPA 4TLRA 3V4IA 2ZWPA 3A8IA 4LVOP 3GG1A 1IKVB 4KKOA 3ETMA 3Q2TC 2OPQA 2HHPA 1JNRB 1GFWB 3N9UC 1HKAA 4KJIA 4OYMA 4K4XA 4ILMA 4DSJA 3H90A 1WHYA 2KB2A 1LFPA 3IG1B 4CH7A 4YR2A 5KOWA 2C2OB 3E01B 3IM9A 1REVB 5A0YB 4K4ZA 5IT9U 3G8QA 4NYPA 2IM3A 4CRJA 1BC6A 3M6XA 2HNDB 3A13A 5IQQA 3CJ4A 4P71A 2YNFA 3AY0A 2R9LA 4IR1A 2B4VA 2D3ZA 1S1VA 2W25A 3UN2A 4DCPB 3V4MA 4X2BA 1Q95G 3BGOP 1X4HA 3PACA 4I0WA 1VISA 1C0TA 2AYMA 4IQMA 4ENOA 3PW0A 3C6UA 1PBAA 2MJNA 2IJRA 1P6TA 1HHSA 1Q5VA 3F0NA 1XIQA 2ILZA 1SB6A 4YR0A 1HBUB 4CWBA 3G9CA 3HT3A 2KTQA 5KFUA 3MPDA 1KOOA 3PYFA 3KG4A 1S12A 1KWMA 1HW8A 1HWKA 3HHEA 4G65A 3TZWA 3JSMB 5L1JA 4DL3A 3PO5A 2XS7A 2CNNB 2CKWA 3CJQA 3BPDA 5GMDA 2EW9A 2R7QA 1S9GB 1TL4A 2GO9A 2I5JB 4USJC 5D0EA 3T1AA 4L3NA 3VTIA 3ZNJ1 3VAFA 1J27A 3IN5A 2CQ1A 4A8OA 3O6QA 4J9SA 5DM6Q 5B7WA 3H40A 4IO9Q 1RT5B 2CNKB 2AV5A 4KGVB 2M2BA 5HQLA 2FJBB 2HHUA 2Z2MA 1JMTA 3K59A 2VD3A 4OZJA 2FLPA 4AT1B 2E1AA 1IR2A 4C3MA 2IMWP 2BOAA 4DX7A 1B7YB 1VQYA 1WHVA 3B8HA 3MF5A 3NWGA 4JI8F 2Z2LA 5IT4A 1IM6A 3QRPA 2ZH2A
chains in the Genus database with same CATH topology
1N5SA 2DGOA 5DS7A 4HTIA 4DFPA 2AJ0A 2AJ1A 1OSDA 3LANA 3KMSA 4F4WA 1QSLA 3MD1A 4C8YA 4QIFA 1ZZNA 2M8DB 4F3OA 1HPZA 4EBCA 2DNMA 2GHPA 2HHTA 2MPUA 3KNGA 3DRSA 1M0SA 3SFGA 3VZHA 1QAJA 4FBTA 1VQKS 4O4GB 3T5KA 4FF3A 2AJ4A 2LDIA 1H0HB 4NYOA 4JUZA 3PDNA 4KFBB 3TVYA 4HYKA 1S1TA 1HYSA 2WOMB 3IAS9 1U1KA 4B08A 3DLEB 1JLFB 2KYZA 2I2YA 2HVZA 3MMBB 5HLFA 4HDHA 3B82A 4JI4F 3FRYA 3GR1A 1N34F 1TAUA 3QGPA 5KFPA 1KVIA 1HBOB 2IFXA 4EGLA 1BQMA 2K8GA 4A8FA 5CH7B 6FDRA 2DO4A 4IFVB 1FKOB 3MM5A 5L38A 4TN2A 2J6TA 4JV1A 5KFNA 5A8RA 4LFCF 1YG0A 3G6VA 3DLLQ 5B0DA 2VKZG 3IO1A 3N01A 2R7TA 2JFDA 3GMGA 2ZKTA 1IBKF 4OJHA 2ASYA 2F8EX 2YKQA 3FSYA 3CMES 1PSDA 3CDEA 2KZMA 3I96A 2X51A 3AAWB 2DCUB 3IBWA 1ZM4A 4X4VA 2DNHA 3MM6B 2DNZA 3PW4A 1HL6A 4PXBA 2OIHA 4DQIA 3P5TL 5CA5A 3LP2B 4HT5A 2CYYA 3HKWA 5L1LA 1RQ0A 3H2VE 1YHQS 2IVFB 3VR1A 1Q8LA 3BDPA 2OMOA 2K7JA 4LQ9A 2KH9A 1IKWB 2JC0A 4DN9A 1TL1B 3UR3C 2EPIA 3ISND 1YIJS 5LSOA 3MMAA 2O3DA 1FDNA 4PWDA 5I3QA 3CULA 4IG3A 4PG5A 3MR3A 3CMAS 4B9SA 3M2UA 4IH6A 5AJ3F 3UQSA 1VQ9S 5C24A 2AD9A 4K50A 1K1QA 1RT4A 4ID5B 2IA0A 1YQHA 3Q23A 3PV8A 4B3MF 1DHMA 1OS5A 4KTQA 3MHYA 3N5FA 3DMJA 1HBOA 2M52A 5DGBA 1XR5A 4DR7F 2BW2A 2HLTA 3GYNA 1JLQB 4ECRA 4N8OA 2DPJA 1VBXA 3KLIB 5CYMA 1ZM2A 1NHVA 2EFQA 3DI6A 1DARA 3HHLC 2VKRA 4NA2A 2MQQA 1FJCA 1RJJA 4O3NA 1T02A 1RTIA 3HDSA 3HHDA 3WC0A 5KFEA 4LUBA 5KFQA 1JLFA 2AJFE 1HMVA 2GJ2A 1Q79A 2MKKA 1AUDA 3GQCA 4HHJA 5LL6d 5J2QB 5F3ZA 1W2BR 3PW7A 3Q8SB 4DOZA 1IJFB 2J6SA 2WCXA 3CJ3A 5KG7A 3HP6A 4RUAA 2OPPA 3OTEA 1F2GA 2FHOB 5DETA 2KVIA 4ETZA 3IRWP 1F0XA 4CT9A 4URQU 2JEJA 3BB5A 4LSLA 3MZIA 5M2PA 3T6BA 2ZJQQ 1ELOA 2VA2A 4NLOA 4TY8B 1Q16B 4MK8A 4FF2A 1ZPWX 4GO7X 1DQAA 1RGVA 4F25A 4EZ9A 1TK5A 2FVPA 2V4RA 2XWXA 3VAGA 2HQ3A 3KMQA 3KK3A 3D0GE 3POTA 2J0WA 3OQ2A 5CZXA 4ECYA 4AL7A 5F41A 3T1HF 5M2UA 2KM8B 2BJDA 2AU0A 5B0EA 4U7CA 4OQJA 3DLJA 1QVFR 4W90B 4ILRA 2UUCF 1SIZA 2P9EA 2YKNA 3BZQA 3M9NB 3HX9A 3RTVA 2E44A 2FLLA 2QV6A 1HBMB 2ZDOA 3CJ5A 1VQSA 2VC0A 3OL7A 2YNFB 1FTRA 3I5BA 1UVNA 2YNHA 3FEYB 4URSA 2WHOA 4B9UA 2IMOA 1X9SA 1HQUA 5KT6A 2JWNA 3ETOA 4X4RA 4DLEA 1VQMS 1BQMB 2GGPA 2X3GA 3AJ1A 2V8HA 4C0HA 2YX4A 3EXYA 3TNVA 2GMJA 5F0WA 2GV1A 3SCIE 5A0YA 1PILA 3DXSX 1K8AT 4ICLA 4M1KA 2OPPB 3R1HA 3V6HA 1WTBA 4RUCA 1M5SA 2QA2A 1D1UA 1UL3A 2C3OA 2ZFHA 3OR2B 3ULHA 1C0TB 2V8DA 1NU4A 1TKTB 4C3KA 2QSWA 2LLZA 4KE5A 2CPXA 2XMMA 3KLEA 2PD1A 1WEXA 3CCES 4WF9Q 3FGVA 4MKYA 3GZ7A 1DLOB 3LGMA 2ZH1A 1D8YA 4PQUB 3DRRB 1IQZA 4ALZA 2QRRA 1Z1ZA 3WDOA 1KEKA 1S9FA 2LQ5A 2C3PA 1TV6A 2GCFA 5KG2A 2LDYA 3QYYA 5JJBA 1U2RA 3QPIA 4A8SA 3JYTB 1HI0P 4L6V3 3C3LA 2ZBCA 4XPEA 1X5OA 3HVTA 4ZP9A 1FNXH 2XY6A 4E0DA 3V2UC 5HMYA 2YVSA 4EYIB 5D4LA 1G3OA 2E66A 2FJXA 1JLGA 1QSSA 2LMIA 2N7YA 3KFWX 4LIWA 2FPHX 3V6DB 4IRDA 2R7VA 2WSEC 4RX6A 2GMLA 2CJBA 4F67A 2M70A 3CC2S 2OFHX 1RI7A 4N41A 4Y28C 5F8HA 4RW8B 4WTYA 4DFKA 3OL6A 1FVSA 1MNEA 2X1BA 1R31A 3KK1B 5KOXA 1SJ3P 3CWJA 4IH7A 3FFIB 3D1OA 1T05A 4QR0A 2OKQA 3LP1B 1X9MA 4V19X 4CO0A 3C6UB 2NYIA 4IFYA 3AB4B 2ZNZA 1A9NB 2CG4A 4A47A 1KR4A 4R5PB 1R8PA 5EWGA 1T03A 4KQZA 4ZVFA 2C3UA 3J7Z5 3MEDB 1X9WA 3RR8A 4NCBA 2HWIA 1RK8A 2L9DA 4FXDA 3OSNA 2QYCA 4DMZA 1JJHA 3KNAA 2XMUA 1E6YA 1HNIA 3I4HX 4I6AA 2CJ9A 3W2WB 1YSJA 4RW6B 1EETA 5A8RB 1X5TA 1ZTTA 2HHQA 4B9MA 4Z2XA 1IJEB 2CQHA 4OLOA 1H2TZ 3BSCA 3DLKB 5CXTA 1PO6A 3K5NA 5D8HB 3RAXA 1CQNA 2XC9A 5A6WA 5KFFA 3HO1A 3AJ2A 4DL7A 4OI0A 3OVSA 3TAMB 1OQ3A 5DLFA 3HLUA 1KFDA 1VIXA 3K8VA 1SKRA 1Y00A 2KXHA 5GADI 2VQFF 5KFBA 3JYTA 4EWTA 1HW9A 4JI5F 1S49A 2ZE2A 3P6YC 2VG5B 1HPZB 2FGOA 5F8IA 3CC7S 3RBEA 2BVZA 2CDQA 1HQUB 2WOMA 1Y7PA 2F1FA 4IDKA 3CXCR 1JKHA 4JI1F 2IRYA 3MMCB 4LF7F 4L72B 2HHVA 2W8LA 1SL0A 4PWDB 4RW9A 4Y2IA 4KHMA 1X8DA 1YJ9S 3NNCA 3U02A 1XWLA 3SQGB 2N7CA 3VAJA 2DIUA 3CD7A 5DGAA 2IM1A 3T6JA 1VQLS 3ENQA 4OI4A 5EHHA 1S7HA 1VIOA 2B9YA 5CCMA 4O44B 3TUJC 5A8KB 2AX1A 3M8QB 2HRYA 1UA1A 3L09A 3KWMA 3I9ZA 5J1EA 3IWLA 2DGVA 4R0JA 5J2NA 2OFGX 3S6EA 4TU7A 3TVKA 1VQ8S 4UQTA 1LW0B 5A8WA 2K7KA 4IR9A 3JAMY 3UDCA 5LSRA 2DNRA 4DV1F 4U6PA 2B4UA 1R0AB 5D77A 2G13A 1MROB 4WK3A 2OPRB 2ZH5A 4TYBA 3SMZA 2R4FA 3O2IA 1TL3B 4WU3A 4M63A 3KK3B 3JSBA 3KLHA 1FA0A 1RT2A 2FHKA 2IHR1 3ITHB 1FEEA 1BY9A 2AYEA 1CG2A 2R7SA 1N52B 3GE9A 4AUKA 4K4VA 3KKFA 2HRUA 2R2RA 3GB0A 1LK7A 3MDFA 3X3UA 3PFEA 1C1BB 3NCQA 2DB1A 3LO3A 1IKXB 1RKIA 3BQ2A 3RB3A 1YITS 4MKBA 2FHJA 1FESA 4PQAA 4JI0F 1NRKA 1FDBA 4K59A 4KBIA 4WIIA 4ED0A 1KVJA 4ECQA 3ZZOA 2HS4A 3FMBA 1CEZA 2B5JB 4IO1A 4FBUA 3MR5A 2KU7A 2E7XA 3HXMA 1BGXT 3M2VA 5E3AA 2AGOA 1VC6A 1XR6A 2Z4PA 5BYQA 2DR7A 1TZ0A 3RBDA 4HH0A 5CYQA 3DN9A 4DR1F 2MQLA 1N32F 4LT6A 3H2UB 2GQQA 3VF0B 1RKJA 3DOKA 1S6PB 3IR5B 2GHWA 1BD6A 5HN0A 4DPOA 3CCVS 1TL5A 5KFHA 4WFAQ 2B0GA 4DS4A